1XBZA

Crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound l-xylulose 5-phosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
213
structure length
210
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIDLTGYWTWEQAQQWRDAGIGQVVYHRSVDAQVAWGEADITAIKRLSDMGFKVTVAGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activities in the orotidine 5'-monophosphate decarboxylase suprafamily: structural basis for catalytic promiscuity in wild-type and designed mutants of 3-keto-L-gulonate 6-phosphate decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
total genus 82
structure length 210
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xbzA00
3MYOA 3TJXA 1GJPA 1P0NA 3N19B 2FLIA 4EF8A 5DCBA 4S2CA 2HMCA 5D2XA 2ZQ0A 5CZTA 1QAPA 3IIPA 2VFHA 2ATSA 1L6WA 4FX6M 2NWRA 3VI2A 4JX5A 1NF0A 3TQ0A 4NJJA 3T4CA 4PL1A 3O1NA 2Y7EA 2JKPA 1OX5A 4WOQA 3TAKA 1LRTA 4U28A 3NQFA 3NQ6A 1EA0A 4HNTA 5DY3A 1JCJA 3OA3A 2JGYA 2WO5A 5FF4A 5FF3A 1F5ZA 2A7PA 3B04A 5C55A 2H90A 1PL9A 2PC4A 5AHFA 3W3OA 3G1SA 3GR8A 4YL2A 3UXDA 5CPNA 1GVRA 3N2MA 2TSYA 1LYXA 3MHUA 3W2LA 2VEIA 4IMDA 1YPIA 3EX6A 1M6JA 1W31A 2VFEA 2DP3A 4LC6A 1YXDA 4IOTA 2VFIA 2Y62A 3TSMA 2ISSA 5D30A 4DBDA 1NVMA 4JEQA 1W5OA 2YR1A 1DOSA 1TPVA 3MI2A 4NZJA 1TPDA 2QCHA 1Q3NA 4IXXA 4RXGA 4RLIA 1KW1A 1IF2A 4XTDA 3NQVA 5D2TA 1VH7A 4CQ8A 2FFCA 4FF7A 2QCNA 3DFSA 3G3DA 4LY8A 2ZZ4A 3OVRA 1W3NA 3W86A 1SW0A 3LM7A 3W85A 5LHEA 2CLHA 1H7NA 2Y88A 3GDMA 1FCQA 3TC7A 1TCDA 1RVGA 2FJKA 3N9SA 3DHDA 2AGKA 2Y89A 3UPBA 1Q6QA 3DU0A 2GUUA 3TSDA 3M43A 1ICSA 1ME9A 4ADSA 2KZHA 4HNUA 5AHLA 2ZZ6A 1J2WA 3M44A 4UXDA 1DV7A 2QDHA 5BMXA 5G2HA 3L65A 3AO0A 3LHZA 2CLLA 4PC8A 4UFLA 3TROA 2G96A 5C2XA 1NAL1 3NPUA 1XI3A 3KRSA 3G1DA 1K7EA 4G1KA 1EP3A 1PIIA 4GXMA 1WA3A 4LT9A 3PWAA 4TIMA 4JY8A 2B7PA 4PCFA 5KMYA 2Y85A 1TPC1 4WY0F 3LXCA 1K8ZA 4JTJA 1RD5A 3U8GA 1UBSA 1T96A 2I9EA 4P61A 1AW2A 3UWUA 3N3MA 4CCEA 3GDKA 5EBUA 4GUFA 2GOUA 1L6SA 1FWSA 3EX1A 4TR9A 1PHWA 4O53A 5I3JA 1EP2A 1WDWA 3MWAA 5U7SA 5D05A 5T26A 4UTMA 4I7VA 2VFDA 1D3GA 3L67A 3EKLA 4O0KA 1E51A 3GZ3A 4BK9A 2CLEA 1G4PA 2WNNA 3OVQA 5KITA 1ML1A 3LCWA 3W1MA 3PR2A 4KFNA 3EX2A 1JULA 3NQGA 3LHTA 2DZWA 1NFBA 2Z2UA 2ALDA 1K3UA 1F2JA 3G1XA 4LVAA 4AF0A 1N8FA 1DQXA 1K7XA 5L9FA 1S5WA 3TW6A 1A50A 2E09A 4PA8A 1H7WA 1W1ZA 4JTSA 3NM3A 2YXGA 4C1LA 4MLRA 3G0SA 1WBJA 4K6AA 1AK5A 2V82A 3B4UA 1GG1A 3INPA 1TQJA 3ABOA 2E6YA 2GJLA 3I65A 4PEKA 3TSBA 3LV5A 4LVFA 5FEZA 1G7UA 4A21A 3EWWA 1OK6A 2CU0A 3SFKA 5LNUA 3QMSA 4HSNA 5FF7A 3W1NA 2ZDRA 3L21A 4O16A 2ATMA 5A5WA 2WNZA 5KINA 1MEIA 4MFDA 5I3GA 3EB2A 4E2BA 3H55A 3TQVA 2WNQA 4BWLC 3P81A 5AB3A 3DKJA 2R8WA 4PL2A 3S9YA 1NF7A 2XN0A 1VHCA 3MO7A 4KWVA 1QO2A 3EKZA 2ZRVA 1PV8A 4N02A 5AC6A 3WK3A 3IVUA 3W84A 3SR7A 3BG3A 3B0PA 2Z1BA 1KM2A 1YLVA 3R2GA 5D33A 2CZDA 3CU2A 2GQ9A 2ZZ7A 3A21A 3GAKA 1ZHAA 3M7WA 1FWRA 1T99A 2TMDA 4WZHA 2H3BA 5HUOA 1KM0A 4R34A 1QDSA 5LKYA 2QJIA 2IQTA 3L9CA 1TV8A 1YXYA 4A22A 4UNLA 4UCGA 1I2QA 3B0UX 1KTNA 3W7JA 5D32A 3G1VA 3TA6A 1H7PA 3OBKA 1SZNA 3FOKA 1ICPA 2DZXA 4JX6A 3W7NA 3NYZA 3MP4A 5DXYA 3O07A 1FWTA 1P4CA 4AF0B 1TYGA 4UFJA 3STEA 1I45A 4FXRA 4HNNA 3GR7A 3PB0A 4QISA 4FNPA 2CLOA 2ZCGA 4BI7A 3GDRA 3DFOA 2WSRA 4TMCA 1VHNA 4UFMA 3QF0A 1ZCOA 4FIRA 5D2VA 1FBAA 1QPOA 3STFA 5I3IA 1F76A 1M7PA 1XL9A 2RKXA 2GQAA 1KM6A 1TTIA 3P82A 4JD4A 2H8XA 1LBLA 1GYNA 3KHJA 4A2RA 3QH2A 4KFPA 5D2YA 2TRSA 1FXPA 1JUBA 3BO9A 2EAWA 3GYEA 4CQ9A 3QQ0A 4RCXA 3W2UA 4MUZA 4NXSA 1JCXA 4IGHA 2YW4A 1WOAA 1ALDA 5G4EA 1J4EA 3NPWA 4M5PA 1GVQA 4RV8A 1JRCA 1KFEA 3EXTA 3KRUA 1UUMA 4FNUA 4CNNA 3E9AA 4RZ6A 2V2DA 1A5BA 3W7HA 1G4SA 3VFLA 5AYXA 5K4ZA 2Y61A 1RV8A 4IWWA 4LV4A 5HQEA 3P74A 1XCFA 1TSIA 1GOXA 3HIJA 4IPIA 1P0KA 1BWLA 3W1TA 1OFAA 3W72A 3LCLA 1SO5A 3B06A 4DF1A 3BPWA 2F84A 2QCDB 1LBFA 4AWTA 5CPOA 1W5MA 3NQ8A 3UYCA 3SECA 4AAJA 1L6YA 4M6QA 2FB3A 4LTSA 3W2NA 1G67A 3LGEA 3P5YA 2E6AA 1XUZA 2CZ5A 2OCZA 4R53A 3L5AA 3HG5A 5IBXA 2EGZA 4MJZA 1ICQA 3TE9A 1O5KA 1BKSA 4X2RA 3W7EA 4NQ1A 1KV8A 2QCMA 3QPYA 5KTLA 3N73A 5FEPA 3NR0A 4MYAA 2GVGA 4NJKA 2C3ZA 4J9JA 4NNAA 1Z42A 2ABBA 3LCIA 1X6UA 2YPIA 1QOQA 2V2HA 4K8EA 4Z0SA 3S1VA 1GVSA 1S3HA 3NAVA 4K39A 5G1TA 5HR6A 3W7RA 5DXXA 3W9ZA 4UTHA 2J6XA 1EWDA 2X1UA 3QPZA 5D38A 3IIOA 3TAOA 3PG8A 3HGJA 1TTQA 2CZFA 2X1SA 1FDYA 4NXKA 4JTFA 2Z6IA 2CLIA 3PC0A 2ZTKA 2DZUA 4IX2A 3ZWSA 3O16A 4MY9A 5J5RA 5BNKA 3Q37A 3RK8A 2WQPA 3FA5A 5CSSA 3RNDA 4FHAA 3L0KA 3VCRA 2FIQA 1H7OA 1OYBA 3TMLA 3G18A 4CCCA 3TIMA 1I2NA 4WXZA 4AHPA 1LRQA 3LOTA 4MKNA 1OYCA 3C2EA 4Z1BA 1YADA 3ZFHA 1S5VA 3SGZA 3L0NA 4BF9A 5G2WA 1AL7A 1VQTA 4I7UA 5LHFA 1SZFA 1MSSA 3NL3A 3F1QA 1B4KA 1H7XA 4QSHA 2V8ZA 3CQ0A 1W5QA 4JDYA 3VNDA 1KTCA 3EX3A 3R12A 3A5FA 5A8GA 4CLMA 1ZENA 4WY0A 1FDJA 2NV2A 3RMJA 4EF9A 3TFXA 3A5VA 2NUXA 3GXNA 3QSTA 3ABQA 3VE9A 2YCEA 1S5TA 4O1AA 2NX1A 3HQ1A 1CX9A 1XDLA 3G1HA 1BWKA 4JICA 4Y6GA 2X16A 3GAYA 3BK0A 4H4IA 1OK4A 3GXPA 4A3UA 1R2RA 1W54A 1A5SA 4UUIA 2V30A 3NL2A 3QYQA 3EXSA 3HF3A 4WOZA 2YX0A 3NGJA 3PUEA 2R94A 2A1YA 3T44A 4MOZA 4H3DA 3QFEA 4O18A 4UNKA 4GE8A 3W73A 1MZHA 4Z1AA 2A0NA 3SSJA 5LNVA 1L2UA 4O19A 1JUKA 3BV4A 4O4VA 5CKSA 3RU6A 2E1DA 4LUJA 1VJIA 3CTLA 2X2GA 1Y0EA 4EWND 3I7RA 1KFJA 2ZA3A 3OIXA 1LROA 2E5BA 2C6QA 3PSWA 3C52A 1R2SA 2YGYA 4HIBA 3KOFA 3Q58A 1K8XA 4NNBA 2ZZ3A 2BTMA 1XM3A 1TTJA 4HPXA 3DXIA 3I7QA 1FDZA 3LX9A 3GDTA 1YTDA 1ZAHA 1H7RA 3HJZA 3W88A 4MYXA 5CZSA 5EPDA 2WKJA 1EWEA 4UTUA 1H62A 1I2OA 3HG4A 4MY1A 2Z6JA 4RZ4A 1A5AA 4PFMA 1VYPX 2QEZA 1YYAA 5D37A 3W1AA 1UASA 1SO6A 1G4EA 3O6YX 2Y6ZA 4FO4A 3W7OA 1OFQA 4L4MA 1T8XA 3U6WA 3E0IA 3W2MA 3FJLA 4RX0A 4LVDA 4MZYA 3E49A 3P80A 1P5BA 1HO4A 3L0GA 5AHMA 2C15A 4AWUA 4N9EA 1GVFA 1B57A 1V7YA 1KLZA 1XC4A 2A4AA 5C6MA 1IXQA 1J5TA 2ZBTA 2DZVA 3KFTA 2WOQA 3LRKA 1QOPA 3BW4A 2NZLA 4FNQA 4XKYA 4AWSA 4WX2A 2PCQA 4JTLA 2B4GA 3WJSA 2H8ZA 4NJHA 2QCLA 3M5ZA 3P67A 4AH7A 4AMAA 1TPWA 2LLEA 4RXFA 5IBXC 2ZYFA 8TIMA 4JN6A 1GTHA 1JR1A 4ONVA 4FX7A 3S5YA 1VYRA 3CHVA 3W87A 3HMJG 3C3NA 4MVAA 2D73A 2E5CA 4HSOA 3W7MA 2RH9A 2W0UA 4PODA 4JY9A 4FNSA 2DU2A 1LP6A 1JCYA 1UUOA 1W3TA 4W9TA 2TPSA 4QAIA 4JXCA 4CQAA 3CT7A 4I9AA 1YTKA 1OYAA 3W2KA 4GUGA 1DORA 3HOJA 4RK8A 5F2MA 2FTPA 1TQXA 5D04C 1PCKA 2B7OA 3ELFA 4E2DA 4QIUA 3PY2A 3LXAA 3LI0A 2C19A 2V81A 4M7TA 2AQWA 3D0CA 3O6DA 4FXSA 3DAQA 1H61A 1RQHA 1SQ7A 3W74A 4HKPA 2W79A 2QR6A 5CZJA 2VELA 3JS3A 1H60A 1WXJA 3ZS4A 3FEMA 3LTPA 3O05A 5AN7A 1ZY9A 1A5CA 2YDAA 3NO5A 1KFCA 3MJYA 3ABSA 1N7KA 3VKJA 3NQ7A 2O7SA 1TRIA 2BSLA 3BW2A 2BZNA 4ORIA 1RQBA 1W5PA 4XBKA 1GG0A 1ZALA 4E38A 3BG5A 4IQLA 3W22A 1EB3A 3W23A 5LZLA 4LS2A 2BWGA 1HFBA 3E02A 1YDOA 4NX0A 1AW5A 4YLWA 2FDSA 2VENA 3C2VA 2I14A 1AW1A 3B03A 3G1YA 3LHWA 1EUNA 1D9EA 4GNJA 4ADTA 4A29A 4LU0A 2EKCA 2B7NA 3PAJA 3VE7A 1ONRA 4O52A 4K38A 4LUIA 1JVNA 3TW7A 2TYSA 3OEXA 3OVPA 3WJZA 5DLCA 5EY5A 5J5DA 4NZFA 3S1WA 5LSMA 4LOCA 3YPIA 4H6KA 3DGRA 3S5ZA 1VLWA 1MXSA 1RR2A 2VXNA 3GB6A 2ZRYA 1HUVA 1DJQA 5H91A 4OE7A 4M19A 3QEZA 5K7JA 4N9DA 4X9SA 1OABA 2X30A 3PSVA 4O12A 5LNRA 1GPWA 4OBTA 3KVMA 1ME8A 4DF0A 1TPEA 3W83A 3BLFA 1ZNNA 4JTKA 3NNTA 1IXOA 3S1XA 3W76A 3TK7A 1DBTA 4Z1CA 4UFIA 3Q2DA 1JQVA 3JRKA 1FX6A 1G69A 2DZTA 4WXYA 3SIZA 3THAA 1TRDA 3PG9A 4E0CA 4ZL1A 1DL3A 4O50A 2NXHA 3C56A 3RF9A 1VLIA 3LTYA 1OFBA 4X22A 4MLJA 5BW6A 4NJGA 2Q8LA 3LBCA 2ZRXA 3DFQA 3NPVA 3T55A 2ISVA 5LNWA 4LVBA 1PS9A 2VKZG 1LOLA 3QRHA 3GK0A 2J9ZA 2PURA 4OHQA 4N9CA 2VOMA 1OVDA 3STCA 1FCVA 4QNEA 2ZZ2A 4EOUA 4M6PA 3MP5A 2GVLA 3W1QA 3EWYA 4YXGA 1N55A 3P84A 3R5EA 3I6RA 3EX4A 3W75A 1FWNA 1H1ZA 3A9IA 1VGAA 3KAOA 3TU9A 3DFTA 3IEBA 3B05A 4YWIA 3SI9A 1WYIA 1T0OA 1PCWA 1JRBA 1BTMA 1TMHA 3BW3A 2YZRA 1EIXA 3QJAA 2NLIA 3EEGA 4LRTA 5C54A 3M41A 3IIZA 4RZ5A 4XTIA 1GVOA 3P5ZA 4GUHA 2NX3A 1I8JA 2F7FA 3S6DA 4LWWA 1SPQA 3G1FA 5IM51 2ZA1A 4NJIA 3DH7A 1EX5A 4ML9A 1SSDA 1VPXA 1H50A 1XBVA 1G6CA 4WD0A 1AG1O 3TX9A 4QM1A 3R13A 1NSJA 3A22A 2ZA2A 1TIMA 4JGDA 4BI5A 3LCXA 4ADUA 3W7IA 2UV8G 3AJXA 2QUUA 1W8SA 1VCGA 3W1XA 4CNPA 5G2IA 3G3MA 2C13A 1OFOA 4HT3A 5EA9A 2NX9A 3W1PA 2QUTA 2VEMA 1Z41A 1UCWA 2GJNA 4UFKA 3SZ8A 5CGQA 4D2JA 3LI1A 1TTPA 1O5XA 1H51A 3A23A 1UJPA 4O11A 3FFSA 1K03A 4Q32A 3GNDA 1UB3A 3BG9A 2H6RA 5FF0A 5I3HA 2WSQA 2J27A 3IRDA 5EKYA 1EUAA 3KVLA 3L66A 5DBTA 4UTWC 1F05A 3IGSA 3MP3A 4XUGA 2QF7A 4N4QA 1F74A 4IJBA 2GQ8A 3M9YA 1JQXA 1WOBA 3IIVA 2FPVA 3CM4A 2PRMA 3QQ1A 4AXKA 3W7QA 1SR9A 5CZ0A 1RZMA 2A85A 4N9BA 3PM6A 3K30A 4YCPA 2PRHA 3CEPA 3LCGA 3TXVA 5DY2A 3QW4B 4RR4A 3LV6A 1Z44A 3V1PA 1Q6LA 1YDNA 3DKLA 1RPXA 4DELA 2VFGA 3C4UA 2RDUA 1KLYA 5FEXA 1SZGA 1KBJA 4OV4A 4IMGA 4JIPA 3PUOA 5K9CA 1OFPA 3B0VC 5K9DA 3NA8A 1LLWA 2EHHA 2CLFA 1AMKA 3TC6A 4DO5A 1I2PA 2HS8A 3PBYA 1W0MA 1O4UA 3TKFA 3G0XA 4LVGA 5AYZA 5HUPA 5FEWA 4CNOA 1LCOA 3WJYA 5HWJA 1OFRA 3LBMA 5SWUA 5C5YA 4O17A 2V2CA 3RFAA 1HL2A 2ZRUA 4JTTA 3I7SA 2R14A 1LLZA 4AB4A 3W7CA 1K8YA 3G24A 4LNYA 3CB8A 2OT0A 3MI6A 3IGXA 2E68A 1ME7A 3GX9A 5F2GA 1GWJA 1O94A 1IXPA 2ZZ5A 2ZRZA 4N4PA 5AYYA 4I7WA 1YDVA 1FWWA 2YSWA 4UIOA 2QCDA 4O1DA 3T7VA 1QPQA 2WSYA 3S5NA 3A24A 1RQEA 3FKRA 4UTWA 2V0TA 2YYTA 4DPPA 3NOEA 4WQ6A 4AVFA 2Y7GA 1F6PA 3TMQA 3UY8A 3KX6A 1WX0A 4O28A 3UWVA 3KXQA 2J9YA 4Z1DA 1TPFA 3PBUA 4FX8A 3M47A 1FUYA 3F03K 5CPMA 2WPBA 4O0ZA 3W07A 3M6YA 3DI1A 3WJXA 3W1LA 4DQWA 4O10A 3NG3A 1WQ5A 1GYLA 1QMLA 4MFEA 3WFAA 5D09A 1CW2A 3ANYA 3M1ZA 5K2ZA 2QJHA 1F73A 2Q3RA 3TNOA 3IVSA 4OQVA 1X1ZA 4O14A 1YXCA 3PVFA 2OX1A 4NX5A 4FIQA 4Q33A 3NQDA 3G8EA 3P60A 3MI3A 3SJ3A 4KKXA 3LRMA 2RHGA 3KVKA 3C2FA 3NZ1A 3P62A 4RJEA 1R46A 4S2BA 2ABAA 3FYPA 4JS3A 3S0CA 3NEVA 4N6EA 2NXIA 2DJXA 1AL8A 4DXVA 2Y7FA 3GVGA 4IMCA 2E6DA 2QCFA 2ZRWA 4P2VA 4UTKA 4GUJA 2G5WA 2OZ0A 1HO1A 1GZGA 4NVTA 1X8FA 3QMTA 4N6FA 1MO0A 1FY6A 1MEHA 2XFWA 1GTEA 5AHEA 3M0ZA 5CPLA 1QPNA 1I2RA 3LHYA 2EF9A 3UWZA 2Q3OA 1SSGA 4CCDA 2Y70A 5D2WA 5K9XA 3W2JA 3RLUA 3GDLA 1TO3A 3LCHA 2XN2A 1SU5A 4K36A 3WJWA 3N2XA 1VC4A 2PE4A 1TV5A 3ATZA 5AC7A 5MHBA 3LLFA 5F4SA 5EYWA 1ZAJA 3B8DA 4QQ3A 1Q6OA 4JIQA 1O60A 3RLVA 4ZVJA 2CLKA 1PE1A 3C2OA 3C6CA 3E96A 4FB7A 5G1YA 3ATYA 4Z08A 3NXFA 4U4MA 3NVTA 1P1XA 2V9DA 2A5HA 4UMCA 4OT7A 3NDOA 4OV9A 2GVJA 3LB0A 2WV8A 4UFHA 4PH6A 3BLIA 2FB2A 3G8RA 2J9XA 3DHFA 4MZ8A 3O15A 4POCA 1THFD 4ZQOA 4JDBA 1B4EA 2B0MA 1KM1A 4UTJA 1H63A 1U83A 3CWNA 1IGSA 1A53A 3UD6A 3LTSA 3TQKA 5KZEA 4K8HA 3MHFA 3C8FA 6TIMA 4ZQNA 3FYOA 3G1AA 2W6RA 4GWEA 4O8RA 1O95A 2B7QA 3LHUA 5HULA 5I3FA 1IXNA 2A21A 3CIWA 1IIGA 3BLEA 3DZ1A 5E1QA 3UXAA 1HG3A 1SO4A 5G4WA 3BVJA 4PTNA 3UWYA 2RFGA 3HPXA 2X1RA 1K7FA 4IXHA 5K4XA 1CI1A 3DBPA 4Q4KA 2JGQA 5BRBA 3LHVA 3TV8A 1GT8A 1LTDA 1LOSA 4XQ6A 4JTIA 1LRNA 3G22A 4K7YA 4YMZA 2JKAA 4ORMA 4ZQMA 4R7JA 3PULA 3UWQA 3HG3A 4LW7A 1BEUA 2CWNA 2VEPA 5DELA 3ABRA 1I4NA 2Y7DA 2AAMA 5LNSA 3NQEA 3OG3A 3NQ2A 4AHOA 3THQA 5E93A 2NUWA 5FI8A 1KM5A 4UC5A 1LOQA 4UTLA 2OMAA 4BI6A 3PB2A 5AHNA 3O8AA 1QNVA 3GXTA 3E12A 2R91A 3S42A 3GIYA 4NU7A 3SGUA 4UTTA 4MJMA 1QCWA 1X7FA 2GPTA 2YW3A 5AHIA 4LV9A 3GKAA 2NXGA 1OX4A 2J88A 5H2ZA 1OFDA 1LM1A 4JR5A 5E0KA 3QM3A 1M5WA 4ZMGA 4FNRA 5K3VA 4IMEA 5L6UA 2YFNA 1IIHA 3EWBX 4QNWA 4TX9A 3BGJA 3C0JA 3IGUA 2EPHA 3STGA 1OX6A 4GC4A 4BFAA 4MIMA 5F2IA 3MYPA 3OHIA 3F4NA 4O57A 4LC8A 4HN4A 5FESA 3CEUA 3NQMA 1KM4A 4M6VA 2FPYA 4TMBA 2A6NA 3HG2A 1SW3A 5F4WA 2NWSA 3HPSA 3PS7A 1V5XA 4HHPA 3CLMA 1VYSX 4Y96A 2C16A 4UR7A 2P0OA 3UNDA 5KZMA 1U5JA 5DN1A 3PF3A 4LS1A 5DCEA 3BARA 2QAPA 4JTUA 2QAFA 3LERA 4UTIA 3W7GA 2YYUA 3R8RA 1TREA 4UTTC 4IX0A 2I1OA 2HSAA 1OFEA 1XBXA 3FIGA 5EL1A 3LDVA 4GJ1A 3U2OA 4Y8FA 3TJLA 4TO8A 1SZEA 1GQNA 3W7DA 1FQ0A 2A6LA 3TXZA 1QPRA 3O63A 4WJEA 3DFNA 3GLCA 3P7YA 3C61A 1VR6A 3R89A 5HR7A 5CSRA 1QR7A 4N2YA 3GNNA 1ZFJA 1QO5A 4C1KA 4NNCA 1LZOA 1QWGA 3KRZA 3CPRA 3H53A 1K02A 3PBVA 3W1UA 3MHGA 1KA9F 4L4LA 3TCEA 1H5YA 4OU1A 4JNMA 1GEQA 2ZZ1A 1DKWA 4Z0JA 3QC3A 5LGXA 5F2LA 2A7RA 1G7VA 3L68A 3EWXA 4XKYB 1F7BA 4R33A 3UZJA 5D02A 1MEWA 4MPQA 2NUYA 2ZTJA 5DBUA 3GKFA 3N9RA 1WV2A 7TIMA 4ICNA 1C29A 4NUWA 2C18A 1SUXA 3MUXA 1PVNA 3TH6A 3W7PA 3C2RA 1Q45A 5DCDA 2C0AA 4O54A 1R30A 3UY7A 2CFFA 5AC8A 5FF2A 3KVJA 2RDTA 4EVZA 1R2TA 3TUUA 1VZWA 2ISWA 1JCLA 1FXQA 3M16A 2BX7A 2E6FA 4Y9AA 3TR2A 4A2SA 4DO6A 3W70A 5HMSA 3N14A 1D3HA 3H54A 1ADOA 4LRSA 1SFJA 3MW7A 1OG0A 3W7KA 2FPTA 4M7SA 3O6CA 2CZEA 4DBEA 4HNVA 1JUEA 4QJ1A 4KWWA 4YCOA 2DORA 5KSWA 4DF2A 3PBWA 3M5XA 5BOOA 1YPFA 1DVJA 1G4TA 2CW6A 2HS6A 3CWOX 3L5LA 1SFLA 3TFCA 3FKKA 4B5NA 5HJLA 1WAUA 2E5DA 3MMTA 2QDGA 3UZ5A 2DJLA 4JTGA 2YFOA 3EWUA 3QSRA 1TPB1 1VCVA 3F4WA 3HGSA 3O06A 3WK0A 3QW3A 5KZDA 1LBMA 3S1UA 3L5MA 1OHLA 3G0UA 3M5YA 1VRDA 1OF8A 5F4XA 1TV7A 2Q8ZA 2E77A 3HGRA 3HB9A 4JTEA 4IPJA 3P61A 4WY0B 1W5NA 2VEKA 1LORA 1KFKA 5EMUA 4RKAA 3EWZA 2ZFAA 3W71A 5AOUA 1ZAIA 1X1OA 4X3ZA 1OF6A 4FNTA 3IVTA 3LXBA 3T78A 4GFSA 2QJGA 3Q94A 3UPWA 2P10A 4JTHA 4DPQA 4ALDA 1M7OA 4LS0A 1C8VA 1EEPA 4O13A 3MBFA 4MY8A 3M5VA 3QZEA 1WBHA 3ZR4A 4DO4A 1DJNA 2QUVA 4O1BA 1H1YA 2XN1A 2G97A 2RDWA 1PHQA 1XKYA 1W56A 4NT0A 1B9BA 2BLEA 4ZQCA 5GVJA 4S1FA 3HBLA 3TDFA 5HWMA 3SY5A 4JYFA 4UMBA 3FJ6A 2CLMA 1OJXA 1FCBA 4HPJA 1JCNA 5HINA 3CIXA 3NL5A 4IMFA 2J24A 3ZWTA 2P1FA 2Z0IA 2HTMA 2A2IA 4O4WA 4BR1A 4OGZA 3W7LA 3IV3A 3NPXA 3HGOA 4GRSA 4QITA 3QMRA 2FQIA 1KBIA 2V5LA 3NQCA 3SW6A 2X1TA 1VS1A 1SO3A 2BXVA 2NV1A 2A7NA 1EPXA 2C1HA 3HPZA 3MBDA 1R47A 1SW7A 3T40A 1F6KA 4JYDA 3W1RA 1Z48A 1XFBA 5TBOA 4K37A 5TIMA 3UWWA 5F1UA 2PRLA 1YTEA 3FLUA 3JR2A 4WUIA 5G5IA 1FCUA 1B3OA 2JK2A 5AFDA 4XZ9A 2QKFA 1Q6RA 4GBUA 3V75A 4JX4A 1XXXA 4XBSA 3DFPA 2O7QA 2G95A 1JCMP 5CG7A 1DHPA 1EP1A 1C9DA 3L2IA 2QCGA 4ZQRA 4TU1A 4BWLA 5D03A 1HTIA 5I3KA 3CC1A 1KV5A 1LDCA 4O1CA 5BMWA 3NZRA 2H3DA 5TQLA 4XWUA 5HWNA 4OWGA 1KFLA 2QCCA 4AEOA 1OX4B 2WJZA 3PUDA 5ABTA 1JJKA 3FS2A 4JYEA 1ZJIA 3NL6A 1KFBA 3N34A 3HO8A 1TPUA 2VFFA 3NM1A 4AHQA 5HNRA 4GUIA 1XBZA 3LCFA 3NQAA 1XUUA 2OJPA 3S8HA 2Y63A 3WK1A 3S5OA 2DZPA 2OT1A 4MZ1A 1DQWA 2JBMA 2C14A 1VCFA 3IIXA 3UQNA 2V5BA 4ZQPA 1QFEA 2QCEA 4IUOA 3EXRA 1W37A 2DZSA 4EIVA 1NEYA 4UR8A 1KTBA 3P8IA 4KFOA 3WK2A 4O15A 2VC6A 1XDMA 3P8JA 1KM3A 5U4NA 5LGZA 1L9WA 5F1VA 6ALDA 3DI0A 3DENA 4K7VA 1TJRA 4FEZA 4DEFA 3W6YA 2JKEA 3BGGA 3LRLA 1TJPA 1TB3A 1TPH1 4ZZ9A 4Y90A 3I68A 1XBYA 3USBA 1W3IA 4UMAA 3LLDA
chains in the Genus database with same CATH superfamily
4JIEA 3OPSA 1G01A 2Y1HA 4GZIA 4S2CA 3TOYA 5AY7A 3USZA 4WJ8A 4C60A 7XIMA 2WSKA 3N04A 3VK5A 5A6MA 2VFHA 1R9XA 4JX5A 1NF0A 3WQFA 1S2CA 1FWGC 4NJJA 1QBBA 1QNSA 1UA7A 1IZKA 3EMCA 4V2XA 4QROA 3OA3A 2JGYA 3HV9A 1PYMA 2WO5A 2YB1A 2OEJA 5FF4A 2PB1A 4M1RA 2ESCA 2H90A 1PL9A 4AG0A 3W3OA 3OTRA 1TFVA 3RM8A 3UXDA 5C8BB 1GVRA 1LYXA 1RSCA 4J2MA 2HVNA 2DP3A 4LC6A 3ALGA 1JDDA 2VFIA 2PDMA 3SRHA 4JEQA 3RX2A 3QHMA 1DOSA 3MVTA 3QOKA 4DJFA 2NT0A 2OSYA 4MDOA 2G3MA 4DO7A 4XTDA 3WFZA 3UP8A 1HKKA 4CQ8A 1X6NA 1XINA 3O9NA 1EJRC 3A4WA 2GFTA 1FKWA 3G3DA 3AZSA 3O0KA 3W86A 3W85A 2BMBA 1RVGA 2FJKA 1VPYA 2QGYA 1KGWA 4W87A 1ICSA 1MW2A 1RD6A 3MQTA 2E67A 4E3VA 2V67A 4UXDA 1VBUA 4W93A 4B5XA 4PUWA 1NFPA 5G2HA 4JCLA 3OBAA 3AO0A 2QDEA 3TROA 3HMCA 5C2XA 1K9EA 1NAL1 3KRSA 1K7EA 4PYSA 4G1KA 3PAOA 1WA3A 5I23A 2YBUA 4HN8A 4TIMA 1BWVA 2B7PA 2ZX8A 1UKQA 3GH4A 2BGQA 3AI0A 1V3HA 2I17A 1K8ZA 2JEQA 1T96A 4AC1X 4CVWA 1XIMA 1VP5A 1NOWA 3S6OA 4CCEA 4GUFA 5AZ0A 2ZUSA 4O53A 5I3JA 1EZWA 1ZCCA 4PUDA 3MWAA 2VD8A 5D05A 2INFA 2BP1A 1D3GA 2E7FA 1RY0A 3G6MA 3SN1A 1VBRA 2WNNA 1RUSA 5BXSA 3LCWA 3W1MA 1BKHA 3HTWA 2HE8A 3NQGA 5GNZA 1REQB 2Z2UA 1RPKA 3WF3A 4LVAA 3CZKA 3SN0A 1K7XA 4M29A 3B9AA 2F8QA 2E09A 3MV11 3RJXA 1X8CA 4JTSA 3M0VA 1OZMA 5E09A 1B3WA 1SZRA 2PWUA 1R86A 3S2JA 4P8VA 4QS5A 3AYTA 3MWCA 4HA3A 3ABOA 1GGOA 1O5QA 4OIFA 1KNWA 1Z3NA 3TSBA 2W67A 4LVFA 1G7UA 4NAFA 1R3TA 3ENLA 3EWWA 1OK6A 5D9OA 3SCTA 4HBKA 3R94A 3SFKA 5LNUA 4PEEA 5BRQA 5FF7A 3ZQ9A 3W1NA 3F4CA 4DZIA 3LMYA 3DCPA 4UR9A 3CHFA 5KINA 3EB2A 1XSIA 2PBGA 2WNQA 3DKJA 2R8WA 2VR2A 3S9YA 1NF7A 2YL8A 4PFHA 1CGTA 3EKZA 1L8NA 3SR7A 1UWIA 2Z1BA 1XR2A 2QLYA 1YLVA 2FGZA 5AVNA 1A5NC 2CZDA 3A21A 1JIBA 2WC4A 4JL1A 1KRMA 3ZLHA 1OD0A 4KMQA 1FWRA 1LL6A 4AZCA 3FY1A 4R34A 3DGBA 5FJTA 2D22A 1YQ2A 2INZA 2PPGA 1UUQA 2XINA 1KTNA 3UVIA 3WFLA 1WXZA 3TA6A 1V77A 1H7PA 1SZNA 2A3LA 4GCXA 1Z32X 3SQSA 3ERPA 3CHCA 3M0XA 5A6SA 3PZTA 4ECLA 3WQPA 4AF0B 5T8GA 1RA0A 4IP5A 3STEA 2IQDA 4HNNA 1PB0A 4CNTA 4GXWA 4FNPA 3VIKA 2WSRA 4UFMA 3NZQA 1ZCOA 1W9VA 1FBAA 3FK4A 3I3EA 3R4IA 2W4XA 1M7PA 1RCXB 2RKXA 3LPFA 2ZC1A 3HQOA 4Q4OA 4YHEA 3P82A 2UY3A 1L6GA 3TYCA 3GD6A 3WD3A 1FXPA 1DJHA 4KWUA 1F07A 4RCXA 4NXSA 5G4EA 4ATWA 1JRCA 4FNUA 2PGEA 4Z2JA 1V6YA 3UERA 3V18A 3K8LA 3T2PA 3W7HA 1G4SA 3GW3A 3VFLA 4LV4A 2FGBA 2GUBA 1MW3A 3GU2A 3JVAA 3KL5A 1NWTA 3QTGA 1BWLA 3W72A 4GYPC 2XPKA 1SO5A 3CZLA 3BPWA 2QCDB 3AHXA 4C6IA 3P14A 4AWTA 1UWQA 3MUAA 1HGYA 1XQLA 2PTYA 3CQJA 1BXNA 3K5XA 1WO2A 1L6YA 1G67A 3IPWA 3P5YA 2OCZA 3UJSA 1OIFA 3HG5A 3FA4A 1ICQA 4DJED 3SY8A 1AUSL 2VCAA 4HJFA 3QPYA 3GNXA 3N73A 3CZGA 4MYAA 4NJKA 3K4WA 1U5VA 1EYEA 2ABBA 3LCIA 4K8EA 1GVSA 2QJMA 2QXWA 5G1TA 2YOCA 2D3NA 5I0DA 4FMVA 3W37A 1EWDA 1UR1A 3QPZA 3IIOA 3TAOA 3OG2A 2X7VA 2CZFA 2X1SA 4Q8MA 4U2YA 2XU2A 4EXAA 1VFSA 2QMJA 3PC0A 2DZUA 3NIYA 1OM0A 3BICA 4K8GA 2CPUA 3KCOA 4P7QA 2VZSA 4WF7A 4K3ZA 1OYBA 3TMLA 2R1PA 3G18A 3C2YA 4LAZA 4AHPA 3LOTA 4MKNA 2O4QA 3WD2A 4Z1BA 1JZ3A 3N12A 4HYVA 1E0WA 1VEMA 2CESA 1VQTA 2BHYA 4I7UA 3NL3A 3F1QA 1H7XA 3CQ0A 4EKJA 2VUNA 3VNDA 1YHTA 4UOQA 2EJ1A 3R12A 4CLMA 1E3XA 1ZENA 1YBQB 3NJ3A 4CD5A 1NOFA 2NV2A 4EPDC 3IK4A 3RMJA 2E1WA 4EF9A 2WMFA 2Y4SA 3TFXA 3C86A 3GXNA 4ZR8A 3VE9A 4AUBA 1XPYA 1S5TA 2NX1A 4M3PA 1B31A 4D6FA 3G1HA 5XIMA 5EMLA 1BWKA 3RITA 2X16A 1D8WA 4A3UA 1XCWA 4BQ4A 2Z27A 4W7VA 3NL2A 3OLDA 3QYQA 3EXSA 1UD8A 4Z17A 2YX0A 3KBSA 3NSNA 3T44A 4MOZA 3RN6A 2BXYA 4HYWA 1MZHA 3HPFA 4Z1AA 4D1JA 3SSJA 1L2UA 3BV4A 3UWEA 4P7OA 2O4MA 1QT1A 2DY3A 4U5KA 1ECEA 3CTLA 3EZ4A 1Y0EA 3KCLA 3MUY1 4EWND 5FSDC 2BY1A 8CGTA 1JAEA 3DECA 1BXBA 2EEXA 4HIBA 4R85A 1R85A 3KOYA 1TTJA 4IUGA 1EKOA 3I7QA 1FDZA 1YTDA 2ZVIA 2E40A 3CMGA 3GVRA 3GG0A 2WKJA 5EPDA 2PLMA 2FHCA 1K9FA 4UTUA 2V68A 4MY1A 7TAAA 1OCJA 4RZ4A 4HPNA 1VYPX 5D37A 4JEJA 3W1AA 1G4EA 3UYIA 3II1A 4FO4A 3VNKA 3W7OA 3WH6A 3QV8A 1IWPA 3ZLGA 1PWMA 2C0HA 4RX0A 2WQDA 1P5BA 1HO4A 3SCWA 3L0GA 4AWUA 2IUZA 4QQUA 1R0MA 1KLZA 5C6MA 1IXQA 2DZVA 5CC7A 1GORA 1QOPA 4WX2A 1S2WA 3EWDA 4LF1A 4GC3A 3M5ZA 1TPWA 3CT2A 2PC8A 3TNBA 5IBXC 2ZYFA 4D6IA 2X8RA 6ENLA 4FX7A 1VYRA 4MVAA 2D73A 4XAFA 4QDMA 4QJ3B 2ZADA 2BDQA 1R3RA 4XAGA 1UUOA 1FP9A 4AIBA 1JYNA 3DERA 4FF5A 2F9RA 3NYDA 1YTKA 4M82A 3AFBA 4GUGA 2HXTA 3QY6A 1VFUA 4A4AA 2FTPA 3FAWA 2UY5A 1L8PA 2PI6A 3PY2A 3LXAA 5I00A 2FVMA 2C19A 3HURA 2AQWA 1U22A 5I03A 3O6DA 4H41A 2ACSA 2RJGA 1RQHA 2IKIA 4HKPA 4AY1A 5CZJA 5H8UA 3JS3A 1H60A 3AIBA 4L1WA 1H1NA 1WXJA 1O7AA 4IPPA 2UY4A 3FEMA 3LTPA 1Q4WA 1ZY9A 2YDAA 2WVSA 3MJYA 1XLIA 4Y7EA 1RXOB 4PUUA 3N6HA 3EOLA 4TV6A 3MPGA 5JIWA 4ZGYA 3GTIA 2BFGA 1DXEA 4E38A 3W22A 1FRBA 1HFBA 4YLWA 2FDSA 4F4RA 2I14A 3G1YA 4DVOA 4KBXA 1VAHA 3W6LA 5HNTA 1WPCA 1D9EA 4ADTA 1E56A 7ODCA 3R11A 3SIMA 5HXMA 2OX4A 2B7NA 4O52A 4K38A 2D2OA 2XGZA 1UBPC 2YA2A 3KZSA 4NZFA 5LIYX 4H6KA 2FH8A 3S5ZA 4RW5A 1VLWA 3GXDA 2OLHA 1YX1A 1U2YA 5M3WA 2BS9A 2PU1A 4UOJA 3A9BA 4N9DA 4X9SA 3N4EA 3PSVA 5I06A 3AXIA 4OBTA 3KVMA 4DF0A 3AROA 1PKMA 1QBAA 2DFAA 3BLFA 4MWAD 1ZNNA 3NNTA 1IXOA 1LL7A 3W76A 3BJTA 2YXXA 2XGBA 3VMOA 3TONA 1LQ0A 4XZMX 4PRTA 3Q2DA 2OWWA 3C8NA 1TRDA 4E0CA 4ZL1A 4BY3A 1DL3A 4O50A 4JZ5A 3LTYA 4N7QA 2C71A 3WYZA 4D9PA 3O6AA 4JIIX 3GM8A 3VGEA 5E0FA 2Q8LA 3NPVA 4LVBA 4YVPA 3U9IA 2JF7A 4CQDA 2OWXA 4ATLA 2QZRA 1LOLA 2VC7A 2AKMA 2J9ZA 1J79A 2Y8KA 4N9CA 1RHCA 2VOMA 1OVDA 3STCA 1FCVA 1C9WA 1X98A 2YL9A 3A64A 3PJWA 4EOUA 1X97A 4F2UA 2GVLA 4QRNA 3EWYA 3LZ3A 3P84A 3R5EA 1K70A 4DZHA 4LSBA 1FWNA 4S3KA 3GTNA 3E1F1 1VGAA 3TU9A 3DFTA 2I16A 2CZVA 5GJPA 1WYIA 1PCWA 4IG2B 1W9DM 2NLIA 3EEGA 1XIHA 2D0GA 3V5OA 4LRTA 5HJXA 5C54A 4BEQA 3M41A 3IIZA 4C5ZA 4YN5A 4EPBC 4HHHA 3VINA 3PZUA 5HMEA 2NX3A 3GRIA 4XX6A 4U33A 1CXKA 1NQ6A 1BVWA 5AVHA 4NJIA 3S46A 3DYPA 1SSDA 1R3VA 1AG1O 3MANA 4QM1A 1UROA 1JYVA 3ARTA 5HK4A 3WZ0E 3CUHA 3FX4A 4LAKA 1Q65A 1D2KA 3VDGA 3AYSA 3E0LA 1QI0A 2FH6A 1SFSA 1VFMA 3TYAA 1KCKA 1Q63A 1XRVA 4JFWA 1JGIA 3DYOA 3ZJ6A 4UQAA 2L5HA 3LUTA 2ZXBA 2C13A 1EDTA 3UVAA 4UFKA 8XIMA 4XO6A 4IFOA 3TYEA 5CGQA 3UF9A 4D2JA 2GK1B 4TQTA 2OXNA 1UJPA 4C6KA 4AW7A 4Q32A 3TTYA 5IXEA 1UB3A 3VDAA 2H6RA 4KEUA 1VJZA 5FF0A 4NI3A 2PDXA 3KS5A 1UC5A 1UD2A 2PWEA 3T0AA 3PZNA 5EKYA 3BLKA 1EUAA 3H2EA 3L66A 2YL5A 1GJWA 4RNIA 4IJBA 2GQ8A 1PJ9A 3M9YA 3O3RA 2FPVA 3CM4A 4AXKA 1SR9A 3KE0A 1HJQA 2PDUA 4NAFB 4YWSA 3CEPA 3VUPA 3TXVA 4Q8NA 3MUCA 4PMRA 3IK2A 1Z44A 1E6ZA 3BOFA 2D2HA 4DELA 2VFGA 4F0RA 1UZDA 4J1OA 4AZ6A 4OV4A 4JIPA 5DMYA 3ECQA 3ZJ7A 5K9CA 5I24A 2V69A 1GEHA 3NA8A 3EMQA 1LLWA 2JIWA 2G50A 7PTDA 2CLFA 1I2PA 3PZGA 2HS8A 4X9YA 3PBYA 3G0XA 2GWGA 4LYQA 3ITCA 4CNOA 1LCOA 4GI9A 2V2CA 3TJIA 2Y8VA 1ZBCA 1ZP3A 3W38A 4KWSA 1B54A 3I7SA 3P0WA 4W88A 1EGMA 1Y5WA 5ABEA 3G24A 3MI6A 1J0ZA 1H11A 5F2GA 1OC7A 4QSFA 1IXPA 4J7RA 3VXGA 4W8LA 5FCZA 3CHEA 3H4XA 4UIOA 2J77A 3BAXA 2AGTA 4MAVA 1S2VA 1FWIC 4UTWA 3B0YA 4HU3A 4PCNA 3B8UA 2YDQA 4D6JA 3GNPA 3GU9A 4EAYA 1TPFA 3M47A 2ACUA 2FFIA 4NAEB 3BZJA 1GYLA 4ZB5A 4WCJA 4RW3A 3WD4A 4V15A 4XZNX 1IGWA 1XRFA 4NX5A 5FIPA 4RE2A 4URIA 3H24A 1J0KA 2Z29A 1O1HA 1JPMA 4S2BA 4PBFA 3NEVA 3OZYA 5CC6A 5IFTA 3DFHA 2WZTA 3IJIA 3T9PA 3RLGA 2FMOA 2WLYA 2E6DA 2QCFA 5C9UA 4NG3A 2ZVRA 1Q6DA 4KW2A 2G5WA 1TCMA 4BS0A 3SADA 1N8IA 5D8ZA 4N6FA 1AD1A 1EJVC 1GTEA 4IG2A 1JXJA 1I2RA 3NO3A 4CCDA 2Y70A 2NW0A 4ZOBA 3Q4DA 2PDPA 3GDLA 2XN2A 1QUMA 4C6LA 1K77A 4JIRA 2VZOA 4H9UA 2KAUC 3A12A 1R8LA 3IJ9A 4FB7A 4Z08A 4BJHA 3NVTA 1P1XA 2EPNA 4UMCA 5AZ1A 4WKHA 1XS2A 2GVJA 1I9CB 3KP0A 3ARRA 3KS6A 3UZWA 2J9XA 4PSRA 2Z28A 2VJXA 3O15A 2WKLA 4E6MA 4GINA 4UTJA 1U83A 5LA0A 2DIJA 3UD6A 2VQUA 2PA6A 3L4YA 4K8HA 3OO2A 4PMVA 3WQ4A 5CGTA 2XYLA 1O95A 4RDWA 1W9XA 3LHUA 5HULA 5I3FA 1IXNA 3CIWA 3VNZA 1KQZA 1IIGA 1DIDA 3DZ1A 3BVJA 1RBLA 1A80A 5A6AA 2X1RA 1MVYA 2ZX7A 3RMEA 2XWEA 1FHUA 2NQZA 3T0TA 2XIQA 1AD4A 1ZQ5A 1LTDA 1LOSA 1XLGA 3G22A 4K7YA 3ZMRA 2WJEA 2FZDA 4RDYA 2JKAA 2O0TA 2XVPA 5FJJA 2ZE0A 5ECVA 3HG3A 4GA8A 3VAVA 5DELA 1A4LA 2Y7DA 2VOTA 4W7UA 1FH9A 1RCOB 4P8UA 4MHBA 2VNCA 3TLQA 5FI8A 1HP4A 4BKNA 1EXBA 4GBDA 1MFVA 4LB4A 5JBFA 4UC5A 4GISA 4EXQA 4FZIA 3EB3A 1US0A 1W9UA 5AHNA 4CEXC 1DWIM 1XLHA 1GYMA 4IL2A 1WKYA 2IKHA 1EHNA 1T6MA 2WZHA 3AHYA 1W9BM 1X7FA 4H00A 5AHIA 3BQ5A 1OIMA 4QS6A 4XG1A 4B16A 4W84A 1H4PA 3EKGA 3JU2A 5E0KA 3QM3A 1F4HA 2FHFA 4IMEA 5L6UA 2XM1A 2YFNA 1IIHA 2FZBA 2GDVA 3B8IA 3WF1A 4NKCA 2EPHA 1OX6A 5BROA 1YDYA 3ANVA 3TN3A 1PAMA 5FESA 3CEUA 1KM4A 2IKJA 3IJQA 1JG9A 1SW3A 5A2BA 3PS7A 3VIPA 2G3NA 2OEKA 3HFYA 4Y96A 2J7BA 3UNDA 4LAMA 2D3LA 1DYSA 5DCEA 4JTUA 1HKMA 4UTIA 2E4TA 3ARVA 5D9MA 1PZ0A 1TREA 3TWBA 2BHZA 3WLJA 4ACZB 2HSAA 1X1NA 1XBXA 4PCPA 3OODA 4GJ1A 1C93A 2QQ6A 3U2OA 3PPHA 3OHMB 3TJLA 3N1AA 3H7UA 1W1B1 1XLFA 4OBRA 1QPRA 3ARSA 1HP5A 5CSRA 3GUWA 4ZE4A 4N2YA 3L4WA 4UQCA 4C1KA 3G1RA 1LZOA 3KRZA 4EPEC 1K02A 4YHGA 3VIHA 3W1UA 2NVCA 4L4LA 1KA9F 3ICJA 5HOSA 2XUCA 2BVYA 5DMMA 4PMUA 2ZC8A 2ZZ1A 3QC3A 1POJA 3N18A 5TNVA 1V6UA 5F2LA 2A7RA 5JU6A 3DBNA 1KRBC 3VOGA 3QGVA 3EWXA 4XKYB 3UZJA 5D02A 4MPQA 3GKFA 2BVTA 3KEHA 4INFA 3UEQA 4J40A 3TTOA 1W1VA 3RGTA 3W7PA 4E5TA 4K68A 2QUNA 9XIAA 4GZEA 2VT0A 5FF2A 2RDTA 4EVZA 2GQ3A 1FXQA 2E6FA 1CGUA 1XIGA 3P2VA 1D3HA 3BOLA 4D6CA 4B90A 1SFJA 1E5JA 5REQA 3ZXWA 3W7KA 4DBEA 4GYFA 4QJ1A 3BXWA 6TAAA 5KSWA 4DF2A 1JYWA 3M5XA 5EFFA 1E9YB 1G4TA 1PSCA 4IZGA 3URNA 1EC8A 2PZNA 5HJLA 3GH5A 1XLLA 4DUXA 2OELA 5E9AA 1VFLA 3TVAA 1B1YA 4S38A 4C5YA 4V27A 3F4WA 3F4DA 3S1UA 5B7ZA 4ZSTA 1VRDA 1VBJA 4CNSA 5F4XA 5ABGA 2E77A 3HGRA 3P61A 2VEKA 1V8EA 1LORA 1KFKA 4DLFA 2YXOA 4A8LA 2HXUA 1SMAA 1A0DA 2OOGA 4AISA 3FEQA 1XPGA 2WHMA 2G41A 4FK9A 4WKAA 1VFOA 1X1OA 3RLHA 1OF6A 5CPTA 2IW0A 3LXBA 3GE7A 4BA0A 4D6GA 3J7HA 2QUMA 3NWRA 4Q6XA 3Q94A 4CD8A 4F0MA 4JTHA 1MNSA 2JIEA 3UCCA 1UG6A 2GUYA 3TWAA 4KT2A 4O13A 1WBHA 2PDFA 1JZ2A 3OU8A 4MMWA 4HK6A 4DO4A 1T40A 3QR0A 1ZJHA 1UWSA 3H4WA 2G97A 4H7ZA 3CUGA 1SM9A 1XLMA 4LALA 3IJDA 4FAMA 4FOJA 3VC5A 4AX7A 3TDFA 5HWMA 3S9IA 4JYFA 3FJ6A 1TWSA 4GQBA 2B81A 2CLMA 3WDRA 2HV5A 1FCBA 4HPJA 3G2GA 4IMFA 3ZWTA 2P1FA 2IMRA 2R1MA 2Z0IA 1PO9A 2A2IA 3WELA 3V0UA 4BR1A 5LIWX 4QITA 4ASTA 1R9ZA 2PDWA 3QMRA 3SW6A 2JFEX 4C6OA 4J5NA 1SO3A 3RPMA 1TJ2A 2NV1A 2A7NA 2C1HA 3HPZA 1QNOA 1R47A 3L23A 1U30A 3U0HA 4PMZA 2D23A 1ADSA 2CYGA 4GYJA 5A6BD 1P0DA 3EOEA 5TBOA 1DE5A 2HE5A 4ENLA 5CLTA 4MJ4A 5TIMA 4DLMA 4PUMA 4H83A 1ZBWA 3TA9A 3BMWA 3FVDA 5AFDA 4GBUA 3L12A 3BOXA 2ZXQA 3CAQA 3V75A 1V0NA 3URQA 2G95A 1JCMP 4S3CA 3TP4A 1EF2A 4WSKA 2CCRA 1Z6KA 2WWCA 5D03A 3UG4A 4LY4A 4P7LA 4YTSA 1QATA 1LDCA 1V3JA 1L6FA 5HWNA 5BU6A 4AIUA 1AQHA 1Q85A 1KFLA 1OX4B 3M0YA 1UC4A 3CIVA 4ZTYA 3FW6A 3N34A 4KEMA 1TPUA 4IICA 3NM1A 4AHQA 4OUIA 3I3DA 2JEPA 4AX6A 3S8HA 3WK1A 4QCEA 4KS0A 2DZPA 2OT1A 3V0TA 2JBMA 3KWSA 5AC5A 3UQNA 3SQLA 1H41A 3EXRA 1LWJA 3R10A 1W37A 2DZSA 3IAQA 4DJEC 4KFOA 1L0PA 3WK2A 3KL0A 2VC6A 1LT8A 1XDMA 5LGZA 3UFYA 2XSAA 3VNJA 3VGFA 2H9AB 2VGIA 5F1VA 1AQ0A 6ALDA 1DWJM 3A4JA 4QAWA 1XHGA 4ZEPA 4FEZA 4GO8A 2WMGA 3N6JA 1FWEC 4DEFA 2C8NA 2JKEA 2G3FA 5HATA 1E4LA 1TJPA 4PBEA 3I68A 1XBYA 5J8LA 4E2OA 5DCBA 3VGHA 1EQPA 4OZOA 3U2ZA 5CZTA 4Z2LA 1E0UA 3IIPA 4YYFA 2CHNA 3PUGA 2NWRA 3VI2A 4AMCA 5XIAA 4CGTA 2XZ7A 3C0QA 3NQ6A 4HNTA 3L7RA 3ZSSA 1V4YA 2WMJA 4O1FA 4XO7A 5CPQA 1GPFA 4Q4MA 5AHFA 1KGUA 5FOOA 5KEZA 4QG6A 4IJCA 2VEIA 4GNKB 4IMDA 1S1PA 3EX6A 1PTDA 1W31A 4PZVA 4X0VA 2VFEA 4R9OA 1YXDA 1D8CA 4NL1A 5D30A 3GXMA 4OOZA 1W5OA 2V38A 1AODA 2J7HA 4H1ZA 5CZKA 1TPDA 2WMKA 2QCHA 1Q3NA 5I2UA 3WUGA 3ARQA 3NQVA 3TYZA 1N8WA 1VH7A 4G2DA 4QLLA 5CC3A 5E9XA 4PMXA 3DFSA 3HQPA 4LY8A 2ZZ4A 3OVRA 4QX4A 3EWCA 1RAKA 4FLRA 1EQCA 2GLKA 2PUZA 3E5PA 1NWRA 3SCVA 4DNMA 4TX8A 1FCQA 1XCXA 4HK5A 3N9SA 2GJRA 1HJSA 2OQLA 2GUUA 3TSDA 4CNUA 2C79A 4KQNA 1IT8A 4HNUA 5AHLA 5D9PA 3RX4A 2Q71A 1J2WA 3R0UA 5ABFB 4M8UA 3QZAA 5BMXA 3EEZA 5KZ6A 2Z1SA 1Q66A 1TV4A 3L65A 4NYUA 2ZUNA 2CLLA 4UFLA 5A94A 4WHBA 1V3IA 4US5D 2DUZA 4FI4A 4AVNA 3ITVA 4KCVA 2O9RA 3GNOA 2OLAA 2WB5A 5KMYA 5DRCA 1K8CA 5C70A 2I5QA 2J75A 1J11A 1DWFM 5IFPA 1RD5A 4G7EB 5LA2A 4P61A 3XISA 1AW2A 4QG9A 2YBVA 2I9UA 4E4UA 5HPCA 4YVVA 1FWSA 3EX1A 2HBXA 3AMGA 4DZ5A 1RLCL 1WDWA 2JF6A 1M1BA 3N2BA 1UA3A 4O0KA 1J2BA 1G4PA 1S2UA 1PEZA 4L9XA 1UOZA 2PU0A 1RJRA 4XV0A 3LHTA 3GO2A 1NFBA 2ALDA 2O56A 5DT7A 3G1XA 1SFTA 1PIGA 2HQAA 3VKBA 1S5WA 2JQXA 4QE5A 1H7WA 3NM3A 4MPKA 4MLRA 1E73M 9RUBA 4CU6A 3W6MA 2J79A 1TIWA 2V82A 1IQ8A 2OU4A 4NAEA 3B4UA 1GG1A 1LQ2A 4IQJA 3BJFA 1TQJA 4UTFA 1ITXA 3TZNA 2E6YA 3A3WA 3LSCA 2QMKA 3GH7A 3I65A 3GVWA 1BRLA 3LNMA 1E4NA 3H70A 4FXJA 3K8KA 5HNNA 3ZLFA 3R7MA 1I60A 3T42A 3QZ6A 2ON3A 5I3GA 2GOKA 3RIKA 4B5VA 5CH9A 2XN0A 1GVYA 1VHCA 4KWVA 2VDGA 3FDGA 1PV8A 5H1WA 4XZWA 5AC6A 1ODUA 3WK3A 3W84A 3CV1A 3LMZA 3BG3A 5JVLA 3R2GA 4GGBA 4AZGA 2O92A 4GFIA 5DMLA 1GOQA 3ABXA 2VR4A 2H3BA 1KM0A 4Q8OA 1QDSA 3L9CA 3M0HA 3KRBA 4HTYA 4A22A 3LPOA 4UCGA 3B0UX 4HNOA 3EDEA 4C6NA 3N29A 4HU4A 3NSXA 5HMDA 5EFDA 4R7WA 1V03A 3RX3A 3VKAA 4JFSA 3UR8A 4Z2GA 1I0BA 3KOZA 3O07A 1P4CA 4YS1A 4H8VA 4UFJA 4NIRA 1TA3A 2CLOA 4YJ5A 3POHA 3MKCA 3KL3A 4TMCA 4H7VA 3VZXA 2AOSA 1VHNA 3RILA 3N15A 3QF0A 4FIRA 3S5SA 1QPOA 2HPIA 5I3IA 4L64A 1F76A 2WVUA 1NWSA 2GQAA 1KM6A 3SRDA 4JD4A 4DXXA 1GYNA 3KHJA 5M03A 3WSUA 4PMJA 3QXBA 4KFPA 5D2YA 3B8WA 3GUGA 1XLAA 3BO9A 4NZ1A 3QQ0A 1EOMA 3DHUA 2XFRA 2YW4A 3NXLA 3ONBA 4R27A 4M5PA 4ZB0A 3S47A 2WZIA 2DEPA 1GVQA 1R7AA 1KFEA 1R3QA 2VUYA 3EXTA 4F9DA 4CNNA 1MQPA 1V0KA 1WUEA 1ISXA 4RZ6A 2V2DA 1DIKA 4IWWA 1HW6A 3FJ4A 3DUGA 1A0CA 3DYMA 3P74A 3ITXA 4KGLA 2EO7A 1V0MA 3LGDA 3QOMA 1F3EA 1JPKA 4DF1A 2EPOA 5XINA 2ZIDA 1W5MA 2VR5A 1NY1A 3P93A 3SECA 3W2NA 1E9LA 4QGCA 1XUZA 4CVUA 3L5AA 4LUYA 5IBXA 4MJZA 3K1GA 2D24A 1XG4A 1Z7AA 4LCSA 3QV9A 3SURA 2DV0A 2J78A 3VO0A 4H04A 2QCMA 4OBSA 5FEPA 3NR0A 2RGMA 2CKSA 5GNXA 2C3ZA 3DC0A 1UZ4A 4NNAA 3E2QA 2MNRA 1Z42A 1X6UA 1QOQA 2YPIA 3NAVA 5H6HA 1EEXA 5HR6A 3WBXA 4IIHA 4UTHA 3H12A 3PG8A 4FP1A 4L9YA 4JAWA 1YEYA 4JTFA 3OZPA 3FA3A 2CLIA 2DUAA 1R5YA 4DZAA 3VD9A 2P88A 3AU2A 3ZWSA 4PB5A 1E6PA 1QI4A 1FFRA 5HQMA 5BNKA 3Q37A 3RK8A 3FA5A 1PUDA 1ISWA 4FHAA 4XZHA 5FAJA 5IRPA 1F4AA 3LY0A 2R1KA 1I2NA 3PNZA 3CUXA 5MF5A 4MGGA 1WKFA 3QHNA 1YADA 4JKMA 1WAWA 3SGZA 4C7GA 3OZMA 2CHOA 1B4KA 4UNIA 4ZO9A 4JDYA 2QPXA 3EX3A 3A5FA 3T2QA 3BLOA 2OEMA 3VDHA 1HNYA 1FDJA 4M6UA 1OC5A 1UKPA 1Q2RA 3OBEA 1XYLA 1MNZA 2NUXA 4C6BA 3WNLA 1F3TA 5HJYA 3ABQA 1GCYA 4O1AA 3HQ1A 1UQYA 4YIWA 2A3EA 1XDLA 2ALRA 2X2YA 4H4IA 3UW6A 1MRAA 3GXPA 4XB3A 1A5SA 1VFHA 4ACYA 4UUIA 3CASA 1UWTA 1YMYA 4WOZA 4DI8A 4H3DA 1BRLB 1WZLA 3GHSA 2EG7A 3B9NA 1QTWA 3MY9A 3W73A 3MTWA 2PWVA 5LNVA 3VD5A 1XIBA 3KBNA 5G4HC 2QPSA 5CKSA 3RU6A 3SN4A 4LANA 1HKIA 4LUJA 3H2CA 4PMDA 3N4AA 3APTA 4YYCA 3CQKA 1EF3A 4Y2WA 4DUWA 2X2GA 3T0DA 3I7RA 2ZA3A 3PWIA 1DE6A 1LROA 2E5BA 5DRIA 3CJPA 3UBPC 3KOFA 3Q58A 3VU2A 1K8XA 4NZCA 2BTMA 4HPXA 1FWFC 3DXIA 3IS4A 5EMKA 1B90A 1ZAHA 3W88A 4MYXA 5CZSA 1ZBKA 5BRPA 1H62A 3SJNA 3NFUA 3LSBA 3NGFA 1Z8AA 3GHTA 1MMFA 1E0TA 1IEQA 1UJQA 1UASA 2A3AA 3GS6A 1XIJA 1DJXA 3E0IA 3C3UA 1OD8A 3LQLA 4YVXA 1BF6A 1KXVA 5AHMA 1GVFA 1XC4A 2A4AA 3WH9A 1EPVA 1AH4A 4S23A 4DJDD 1A3XA 3BAWA 3LRKA 3WDIA 4L56A 3ID7A 3I10A 4FNQA 1BAGA 1E6QM 2B4GA 4NJHA 2H8ZA 3G6LA 2QCLA 4AMAA 4AQLA 4RXFA 1T8QA 2WLZA 1JR1A 4ONVA 4HYRA 3HMJG 3C3NA 2GJPA 4UQBA 3W7MA 3T8LA 1FTXA 2DIEA 2OVLA 2DU2A 1JCYA 4W9TA 1CGWA 4L6OA 2TPSA 5M17A 2QPUA 3WQWA 3H2FA 3W2KA 3AU6A 3HOJA 1S5NA 1LJYA 3MCMA 2B7OA 1IV8A 4QIUA 3CXOA 3LI0A 4M7TA 1RBAA 1RBOB 2J66A 2VTFA 3B40A 2F2KA 1LT7A 3DAQA 3PK7A 1H61A 3G5EA 3K1DA 4A8IA 3ZS4A 2E28A 1LL4A 3CL8A 2Z00A 3O05A 2HRWA 4O1EA 1E1CA 3ABSA 3VKJA 3NQ7A 2O7SA 3LZ5A 2W92A 2BSLA 1QI5A 4B9ZA 4B91A 1IZCA 1V79A 3SUTA 4EWJA 2I56A 1MW0A 3QTPA 4IQLA 2QV5A 4HHLA 1ZZMA 3SFWA 1YDOA 1HKJA 1QK0A 1AW1A 4MG4A 3LQGA 5HDRA 1DJGA 1RY8A 4J35A 4QTGA 4GZ7A 4LU0A 2EKCA 1GOIA 4L65A 2VURA 1ISVA 3VE7A 1ONRA 3WDHA 1R3SA 1JVNA 3TW7A 2QJNA 3WJZA 3FCPA 5EY5A 5J5DA 5LSMA 1EJ7L 1TA3B 2J7EA 3DFYA 3TC3A 3LS9A 2IXVA 4ES4A 4FXFA 1DJQA 5H91A 4OE7A 4M19A 5IOBA 3S3GA 3QEZA 5K7JA 4AZ5A 1CWYA 3BV7A 1V0LA 4O12A 5LNRA 4I8DA 3MDUA 1TPEA 3W83A 3TK7A 2VYOA 4DRSA 3SIZA 1G69A 1CLVA 4WXYA 3EPNA 3THAA 3PG9A 4A3HA 4A05A 4YTRA 3B8VA 1VBHA 4FALA 2XHYA 4NJGA 1CECA 4F79A 1B3ZA 3DFQA 3T55A 2ISVA 5LNWA 1PS9A 2D1ZA 3CUZA 1TMLA 5B7YA 1J0IA 3BSHA 3GK0A 4OHQA 4XD5A 2CBVA 5BXPA 3EX4A 1XWYA 2DUXA 3A9IA 3IEBA 3B05A 3N3TA 4H6RA 3K2GA 1T0OA 1TMHA 2C91A 4MTVA 1Y5VA 4RZ5A 4WIWA 4QFUA 3U2EA 3E38A 4HP5A 1ITUA 3WMSA 2OYLA 1I8JA 2XIBA 4P8WA 4RNHA 4LWWA 4AZHA 5IM51 3M6DA 5HANA 4G56A 3QKZA 1S1RA 1XBVA 4OECA 4WD0A 3UG5A 2QYGA 2HNEA 1D3CA 3AMLA 5EMYA 3RCMA 4F2TA 5CJMA 3VZYA 4H2HA 4MDPA 4RE0A 4AD3A 3AICA 4JGDA 3ARYA 4RE3A 1WDQA 5BXTA 4ML4A 2VD9A 3LCXA 4ZXOA 3MSGA 2UV8G 4ZOAA 3SUWA 1BGAA 4ZOCA 3AIRA 2QUUA 2GGGA 4MWAB 5EA9A 2VEMA 2W61A 1UHVA 5EMMA 5C7VA 2TAAA 3KBJA 4TUFA 4U10A 3LI1A 2ZDSA 3C0LA 1TTPA 4IQDA 2FZNA 4O11A 4JQ4A 1LF1A 4IGSA 2WVTA 3GNDA 3EDKA 2J13A 4IJRA 2WSQA 3K4AA 2J27A 3QGAC 2GVYA 2RUSA 2VC9A 1IWBA 4AY8A 3SB0A 1CNVA 3CB3A 2B31A 2ZUMA 1UMLA 1XLDA 3N17A 1U1JA 3IGSA 3MZNA 1DEDA 3GBEA 3VGDA 2VVSA 4Q6JA 4FSAA 3TJ4A 3WMBA 1WOBA 3H7RA 4L80A 3REQA 5CZ0A 4HGXA 2AL2A 2PRHA 3LCGA 4GJJA 4W8AA 5DY2A 1W1A1 2BVWA 4GQGA 1RPXA 3W0KA 2VX7A 1DWGM 1KLYA 3TYUA 2G3IA 5FEXA 4V1XA 1PDZA 1CIUA 3IWPA 4GKLA 1A5KC 1W3HA 4ZA0A 3CZ8A 4IMGA 4AC7C 2XSBA 3B0VC 2AMGA 1BYCA 3SAZA 3UPMA 1P43A 2EHHA 3V36A 3PBGA 5A2CA 5BU9A 5HUPA 1OFRA 1CXIA 2PF0A 3KP1A 3M0MA 2ZRUA 4JTTA 2GSJA 2VWTA 4KH2A 1VF8A 2V3DA 4A3YA 2POZA 3W7CA 1K8YA 1TUXA 1YNQA 1R3YA 3WMLA 3WF2A 3IGXA 3KBMA 3EPMA 3GX9A 5E5CA 3KDNA 5A8QA 3PPCA 1GWJA 3D3FA 3FN9A 2HBVA 2ZZ5A 2ZRZA 4N4PA 5AYYA 4H19A 1E55A 2BGSA 3T0BA 4LCQA 2BOEX 4C6CA 3CPUA 1C8XA 4QEEA 4DPPA 4L5ZA 3B9EA 5PTDA 3B97A 3TMQA 3SEPA 5HBFA 1VIWA 1WX0A 3WLHA 3UWVA 3KXQA 1A49A 5I7GA 4J28A 4FX8A 3GYCA 2WK2A 1FUYA 3F03K 5CPMA 4O0ZA 4TX6A 3M6YA 3WJXA 1DIEA 3W1LA 2OQYA 3NG3A 1WQ5A 3WFAA 1J0YA 3QR3A 3TNOA 4DJDA 1X1ZA 3I3BA 4JL2A 1UYQA 1YXCA 3PVFA 4O14A 3B3DA 4Q33A 1KBLA 1MFUA 2QS8A 4S3DA 2NLYA 3UR5A 1GZ1A 1Q8JA 2VEFA 3BE7A 4D6HA 4KKXA 4C7DA 1JZ4A 3CNYA 2RHGA 3AZRA 3KVKA 3ARWA 3C2FA 1S38A 3P62A 2O9TA 1W3LA 4LBUA 4RJEA 1R46A 3FYPA 2VX5A 1J93A 5I6SA 2ADAA 2OR2A 4U2ZA 1WNOA 2I5GA 3MVIA 5B80A 2YA0A 2FKPA 2OZ0A 1HO1A 4NVTA 3BAJA 1JF5A 3QMTA 3VNMA 4GVIA 4UOZA 1CLXA 5CPLA 3WQDA 5AHEA 1QPNA 3RRAA 2UZ9A 2G37A 2EF9A 3A4AA 1SSGA 3G77A 5D2WA 1MW1A 4GGHA 4WDUA 1J6OA 3LCHA 3BTNA 5MHBA 3LLFA 5F4SA 1UD4A 1ZAJA 2D0HA 3C2OA 4XZBA 3NXFA 1PTGA 4UQDA 4HNLA 3UGRA 2HWGA 1WXYA 5BWAA 3AXXA 2SFPA 2WV8A 3F2DA 4PH6A 3BLIA 3CO8A 1XIIA 4G9PA 1BYDA 5GQBA 1EDQA 4POCA 3KTCA 4ZQOA 1DTNA 3VVGA 1KM1A 3MMDA 1H63A 5DQPA 1V3MA 3ZYZA 1RLDA 1A53A 1FWHC 5KZEA 3KOWA 6TIMA 4F0HA 3FYOA 1BSLA 1AQMA 2J7DA 2IQ0A 2BV9A 1JNDA 4AD2A 2RAGA 2P3EA 3UGVA 1VB9A 4HZ6A 2V5CA 5G4WA 1FWCC 3UWYA 4WEVX 3GHRA 2NSOA 2VWSA 2RFGA 3HPXA 3VCNA 3PPGA 1JDAA 5T91A 1CI1A 1U33A 3OQ8A 3SO7A 4IIDA 3AS3A 2OQHA 1GJUA 3F5JA 5BRBA 3H6OA 1GT8A 4XQ6A 4JTIA 3F5KA 5DF0A 4YU1A 1PBGA 2Y5EA 4YMZA 3SRKA 4ORMA 3PULA 2BNJA 1BSIA 2NQHA 4ROPA 2AAMA 4HMNA 3CV7A 1FHDA 3GSMA 1B3YA 7CGTA 2V5DA 2NUWA 1G94A 1R9YA 1LOQA 2QULA 2OMAA 4BI6A 3CAKA 3PB2A 4M81A 1QNVA 1YBQA 3EOUA 3GXTA 2R91A 1Z89A 3S42A 3BCDA 1JFXA 4NU7A 3SGUA 4MJMA 1GW1A 4IIBA 3EB4A 2PDCA 1OX4A 4JR5A 2BHUA 5K3VA 4LB3A 4QNWA 3F2CA 2R24A 3KHDA 4D1IA 1XYZA 3STGA 2PGRA 4BFAA 2Z7KA 4M51A 2VZTA 4PRWA 1XRTA 3QKEA 4HN4A 2A6NA 4MWAC 1NDZA 4HA4A 1T41A 1TMQA 1CPUA 4KETA 2INEA 4H8UA 5D9NA 3HPSA 1J5SA 1QHPA 1VYSX 3GWQA 3S2MA 1M68A 1UH4A 3L4TA 4UR7A 4HNCA 1HKVA 5KZMA 4BF7A 1A3HA 4JTDA 4XZLX 2P0IA 3NURA 2YYUA 6REQB 3H2MA 5C9ZA 3T4WA 1OB0A 2V3FA 3T6CA 1V02A 3FIGA 2F61A 5C2CA 1I75A 1JL8A 4GY1A 1LUCB 5TD4A 2YCKX 1UR3M 1IEWA 1FQ0A 3TXZA 1NELA 3DFNA 3P7YA 3M0LA 2IS7A 4DIAA 3W00A 3OZOA 3GNNA 5FL0A 5DT5A 4XZIA 1IT7A 4LUSA 2IPWA 4E4PA 1OY0A 4GMEA 5BYWA 1QNQA 2HZGA 4PGLA 3H53A 3PBVA 4GO9A 3MHGA 1TX0A 4GG9A 4WK9A 1JGMA 1GEQA 1DKWA 4Z0JA 1YKWA 1YPXA 2XWDA 1MQQA 2WBKA 1HXJA 2I57A 1F7BA 4R33A 2ZTJA 3M0IA 1WV2A 4GQQA 5FSEC 4ICNA 4FOKA 4NUWA 3RCYA 3VM7A 3VD7A 3TH6A 2WJDA 1V93A 1VJSA 3U7VA 2C0AA 4C6PA 2CFFA 1LUCA 1O5RA 1R2TA 4MUPA 1X96A 1US2A 3WX7A 1JCLA 1HJVA 4J4KA 5FD0A 1DTUA 3ZM8A 5HMSA 4US5A 4GIAA 4ZTXA 4LRSA 3UXKA 3MW7A 4DJEA 2PS2A 1Q7ZA 1OG0A 4GIYA 4IP7A 2FPTA 3BLPX 4M7SA 4KCTA 3P0XA 1C91A 2JALA 2DORA 5BOOA 1PWLA 1YPFA 1DVJA 2CW6A 3PJUA 2HS6A 3CWOX 1MQRA 3L5LA 1SFLA 4W86A 4B5NA 5C7HA 2OTDA 3GG8A 5DANA 2DJLA 4U3AA 1RP9A 1GOMA 4DAIA 2WMIB 1VCVA 3O06A 3FVMA 3WK0A 4JN7A 3ZT7A 5KZDA 4QR6A 3L5MA 2HEJA 2OFJA 4XAPA 2HVOA 3M5YA 2XH4A 1OF8A 1K9TA 1TV7A 5GNYA 2YA1A 1UKOA 4JTEA 1V08A 1W5NA 1V3KA 2MANA 4B5TA 1JYXA 1V7AA 4GPNA 1ZAIA 2V5KA 4X3ZA 2CNCA 4XSLA 4FNTA 1JFHA 3UPWA 4ALDA 1M7OA 1GQIA 2NV9A 2EQDA 3CO4A 3WLOA 4AZ7A 2ZX6A 3BDKA 5C9XA 1GW9A 3EOOA 1DJNA 2E9MA 1XLEA 4AVOA 2J62A 3RPTA 4BQ2A 1V02E 4F8XA 3A3XA 3GR4A 1XLKA 1LLOA 2DT0A 3SY5A 3APGA 4MNJA 4S3JA 4UMBA 2VI0A 4KRUA 5HINA 4WKFA 4D8AA 1YIXA 3NL5A 3VOCA 2C1GA 4O4WA 4ERIA 1ZUAX 3IV3A 3NPXA 3UR7A 3HGOA 4W7WA 1E6NA 2V5LA 3N4FA 3NQCA 2FMNA 4ICCX 1P7TA 1FFQA 4FPSA 3JUGA 1EPXA 1SW7A 4J3UA 3SY1A 3W1RA 4PUEA 1XGEA 5DMNA 2ZX9A 1C92A 5I02A 1XIFA 1NIUA 2Q09A 4K37A 5DO8A 2OSWA 3FLUA 3S2NA 4XVEA 2MUCA 2VZUA 2AL1A 4XKMA 1HF6A 2JK2A 2WYSA 1E4MM 2VGFA 3PN8A 1Q6RA 4GIEA 2GSEA 4QCFA 4PE8A 3C0SA 4JX4A 1XXXA 5T9BG 4QEHA 5CG7A 3SGGA 3VDBA 4GQRA 1C9DA 3L2IA 3F2BA 4TU1A 4RUBA 1O68A 4GX9A 4YTUA 3B8SA 5I3KA 4JQAA 1O66A 5BMWA 1POKA 4OWGA 4DWSA 2AQVA 3PUDA 5ABTA 1HN1A 3CBWA 3FS2A 3OLIA 3U4AA 1ZJIA 2F38A 2PFHA 4CN6A 2PLCA 4IF2A 5E6YA 2OO6A 3CQIA 1XBZA 1ENUA 5M5DA 4GI8A 1XUUA 2OJPA 2Y63A 3WLQA 5LYRA 1JI1A 4MZ1A 1DQWA 3IARA 3GC2A 1QFEA 1SMDA 3D46A 4OJYA 3EGJA 1NEYA 4WGHA 1MZRA 3CUFA 3SCNA 1EJSC 3WLTA 2W62A 3P8JA 1L9WA 4A8NA 1RJQA 3DI0A 3DENA 4K7VA 1Y5XA 2QVNA 2Z2AA 2NSXA 3W6YA 1TB3A 4B3ZA 1ZTVA 4Y90A 3WQOA 4JTAA 3AMCA 3TJXA 1P0NA 3N19B 2FLIA 4LXFA 4XAZA 1OBAA 2PP3A 3U5YA 2ZQ0A 4JKKA 2VP8A 1KR1A 3MKVA 2NQ9A 1L6WA 3PFRA 2ZXDA 1EYWA 2OKTA 1LRTA 3GXFA 4U28A 3TTEA 1EA0A 4I3GA 5DY3A 1JCJA 1TWWA 2Z1WA 5FF3A 1F5ZA 3TN5A 3ZJ8A 4HK7A 4ZE5A 1JD7A 3ONCA 1Q2SA 2PC4A 3GR8A 3N2MA 2WHJA 3W2LA 3MHUA 4L6DA 1CEOA 4DX3A 5JH2A 2V3GA 1X6LA 2YIHA 4IOTA 5GJMA 3TSMA 4AEEA 1P48A 1E6RA 2PDGA 1TPVA 3MI2A 3L4XA 1EH9A 4IXXA 5D2TA 1SJBA 4EPKA 2FFCA 3HJEA 4IFKA 4C1NB 1CENA 1S5MA 3TLLA 1SW0A 3LM7A 4HZ7A 5LHEA 1OQFA 3GDMA 3TC7A 3BWWA 4V28A 3DHDA 1SR0A 3GC4A 1GNXA 2J47A 2Y89A 3UPBA 2AL2B 2Z1VA 3DU0A 5A6JA 3M43A 2WZMA 3EDDA 2PAJA 3CTTA 1ME9A 2KZHA 2J6VA 4DYEA 3M44A 1DV7A 4Y9PA 4R9XA 3ES7A 4GI4A 3SDOA 2YBTA 4RV3A 2WC7A 1UR9A 5HQLA 1TX2A 3KDOA 2G96A 2PTWA 3R0DA 1XI3A 5A8MA 3G1DA 3L4VA 5E70A 4GXMA 3LN3A 3PWAA 5A6LA 4PCFA 2Y85A 4QBXA 4RZBA 4WY0F 2I9EA 1H3GA 3UWUA 1EJUC 3N3MA 1VFFA 3N2TA 2VM8A 2QNEA 4NZ5A 1BQCA 3GDKA 5EBUA 1L6SA 4TR9A 1PHWA 1U1HA 2OOFA 1EP2A 2XH7A 5U7SA 3U4FA 4MWAA 5MKGB 2O9PA 2NVDA 4H2CA 3L67A 4J3ZA 3EKLA 3LA4A 1E51A 4QE4A 4BK9A 1FWJC 3OVQA 1ML1A 3ABZA 1TWDA 2YCLB 3EX2A 2DZWA 1K3UA 1F2JA 3GVQA 4AF0A 2HISA 3SRFA 2G8ZA 3ARPA 1DQXA 5L9FA 1I1WA 5AC4A 4PA8A 4M80A 5BOFA 1W1ZA 3VDCA 2YXGA 1QJWA 4HD5A 2ACRA 3KM8A 1OCBA 4FOUA 3G0SA 1WBJA 4K6AA 1AK5A 3CMFA 4OTKA 4LUTA 3N13A 3E0VA 3ES8A 4NSBA 2RDXA 3VA8A 1J18A 3LV5A 3VFCA 2GYIA 1XJBA 4XIAA 4HJWA 4S3AA 4A21A 1ISYA 2XIJA 5TAOA 3LENA 3BQ6A 4MWAE 1JZ7A 3EDFA 2DH2A 2ZDRA 3L21A 4O16A 3AMKA 4B15A 3LGGA 1GVEA 5A5WA 1EDGA 3VGGA 1MEIA 4MFDA 3PZQA 1ZBVA 4E2BA 2V6AA 4ZBCA 4BQ3A 3MSRA 1W91A 2Z1KA 5FJOA 2ZRVA 4N02A 2X41A 5I5RA 3PBMA 1KM2A 5D33A 2D69A 1KWGA 1UH2A 3CU2A 1O1ZA 3GAKA 1SYTA 2NQ5A 1UD3A 2R9RA 3M7WA 1T99A 4LX4A 4TVDA 2TMDA 3BUVA 5HUOA 1F6YA 5LKYA 1UP2A 1XLJA 2IQTA 3E2RA 1I0DA 4AZBA 1IZJA 3W7JA 3G1VA 3PNUA 3OBKA 4RPPA 3NSMA 1CXLA 4EACA 1PIFA 3W4RA 5ABHA 2GVEA 2WBGA 1ICPA 2QVHA 3NQBA 3NYZA 2EPLX 3MP4A 1TYGA 1GUVA 4S3GA 4FXRA 3T1GA 3AYRA 3VIJA 3QC0A 3PB0A 4TVCA 4BI7A 3GDRA 3CYJA 2OB3A 3OGVA 4PTWA 3AUJA 5D2VA 1Q5MA 4J3TA 2EXOA 3STFA 1XL9A 1PKNA 4M0XA 1JZ6A 2H8XA 4HOXA 1VBGA 4C7FA 4A2RA 1GZJA 2TRSA 5CBBA 1BYAA 4JHZA 2BODX 2EAWA 4CQ9A 1TUFA 1BYBA 3MCOA 3VNIA 1E9IA 1ALDA 2WCAA 3M64A 3CLWA 3OYZA 3ARZA 3CUIA 1GQKA 1AA1B 4RV8A 2VDIA 1DPMA 1XC6A 2OLSA 1E71M 1CGXA 3H21A 1TJ0A 3LPPA 5AYXA 2Y61A 5K4ZA 1RV8A 2X0SA 4BF5A 1HX0A 4B2DA 5CJ5A 1JF6A 5HQEA 1XCFA 2ZWZA 1YE6A 1GOXA 3HIJA 3W1TA 1E1EA 3AXHA 3LCLA 3B06A 2F84A 3U2CA 1LBFA 2D20A 4MB1A 5CPOA 3CL7A 3DG7A 2DZAA 3FGCB 3NQ8A 3WBWA 1OZQA 4AAJA 4MADA 1W6TA 1VEOA 2FB3A 1AJZA 2CZ5A 1R87A 4Q7BA 4HMDA 4GVFA 1B3VA 5E0CA 4X2RA 2FTYA 3W7EA 2PTXA 4NQ1A 1KV8A 4IIFA 1M7XA 2PLJA 5KTLA 1H0GA 1W17A 1DWAM 1WDSA 2GVGA 3L2MA 1BG4A 4AD1A 4J9JA 3V5FA 3S2CA 2V2HA 4Z0SA 4RL3A 3S1VA 1S3HA 3WCZA 3OLGA 3ITYA 3VIOA 2GGEA 3DDMA 3W7RA 5DXXA 2J6XA 4XSMA 1HL9A 2IXUA 3QVQA 4F9JA 2EG8A 4H8HA 3AZTA 4NXKA 1FWDC 4KIEA 4KCUA 3PZMA 4XIMA 1WCGA 1TZ7A 1G0CA 3M46A 3W81A 5J5RA 2W9MA 3MS8A 1KKOA 3TZFA 4ACZA 5CSSA 3WL0A 3RNDA 3GZAA 1K1DA 3L0KA 3VCRA 3K13A 3UXLA 1H7OA 3WUFA 4CCCA 1IHIA 1QOXA 4RPQA 2POTA 2F6KA 5HAOA 4PCTA 2F6XA 3M4HA 1EL3A 3CQHA 2OG9A 1X7IA 3ZFHA 1XYAA 4BF9A 4MF4A 1NDWA 5G2WA 2DSWA 1PDYA 4Q7NA 4Z2IA 1ZP4A 3VKKA 2X7WA 1ZU8A 2PODA 4FA3A 3HFTA 4BHYA 2V8ZA 1CGYA 1W5QA 1MRQA 2XGIA 1FKXA 5A8GA 2GDUA 1KRAC 4S3FA 4ZOEA 3B0XA 2W63A 3QSTA 2Y2WA 7REQA 3AJ7A 1IWAA 2YCEA 4JOMA 5LXEA 3B4YA 1EFZA 1CBGA 4JQ3A 2NVAA 4JICA 1A5LC 2VX6A 4Y6GA 3BK0A 2W27A 3CUJA 1OK4A 2RJHA 1P1MA 3CYVA 5I78A 3ARXA 4UBPC 2R94A 1H49A 3QFEA 4UNKA 4PTDA 5E6ZA 5A1AA 2H9AA 2Y0FA 4R7OA 4O19A 1JUKA 3EAUA 3WLIA 4ZB2A 2E1DA 4AYGA 3WLMA 2BGNE 1F8MA 3OIXA 5C71A 2C6QA 3PSWA 4OUEA 1WDDA 1R2SA 3CMJA 1TELA 3BURA 3IJ8A 1QI2A 1XV8A 3PWGA 4PB3A 3U57A 3LX9A 3GDTA 3BLDA 1Q8AA 7REQB 1H7RA 2GZXA 1LG2A 1MWOA 3O0FA 1B2YA 1TVPA 4P7RA 2C7FA 4AY7A 2Z6JA 1UH3A 3THCA 2WXDM 1YYAA 3TN4A 4HB7A 4H9VA 3UJ2A 3O6YX 2Y6ZA 3E74A 4U31A 1OFQA 3AISA 4PSPA 3U6WA 7ENLA 2WCGA 4GNVA 3W2MA 2OGJA 3U3HA 4HPHA 2WPGA 3FJLA 4LVDA 3E49A 3THUA 1FOBA 3E2VA 3P80A 1W2PA 3RDKA 3AYVA 2C15A 2YLLA 4JTCA 4HOWA 4N9EA 1V7YA 3VIFA 3COTA 3RJYA 3KFTA 1UW9A 3BW4A 3LG3A 4JPGA 2PCQA 3P67A 4AH7A 2HK0A 4M24A 2PDLA 2PP0A 4JN6A 1UR8A 1ZRQA 1GTHA 3GU1A 1FWAC 5AECA 4IQEA 3S5YA 3W87A 3WNOA 2PD5A 3T09A 3CAWA 4HSOA 2W0UA 3WLSA 4JY9A 6A3HA 4IISA 1W3TA 3LM3A 2HJPA 1A47A 3WQ8A 4I9AA 2XIMA 3WKZA 2OPJA 1Z69A 2Z7GA 4RK8A 1XSKA 4J2PA 1PCKA 1X38A 2P8CA 1GKRA 4CU7A 2DVUA 4AIOA 1KB3A 3D0CA 4FXSA 1SQ7A 2W79A 2QR6A 2VELA 4V1YA 3WEZA 3U48A 3WEOA 2WHLA 4CD4A 5AN7A 1KFCA 1E70M 4JKLA 4OKDA 1N7KA 1TRIA 4ORIA 4NP7A 4XBKA 4UB9A 2XM2A 4B2DD 2ZOXA 1ZALA 3B9DA 1UWAA 3V3WA 4B3KA 3W23A 4MKSA 1NOUA 3WH7A 5LZLA 2BWGA 4JNZA 4Q8PA 1AW5A 1W32A 2ZICA 2VENA 2PDYA 2VDHA 1SGJA 3LHWA 3EOSA 4XISA 1VRXA 3CZEA 2PLKA 3RR1A 1VIZA 2DQWA 4ROQA 1CYGA 4EK7A 3PAJA 3UU0A 2WVVA 4Z42C 4LYKA 2TYSA 3OVPA 5DLCA 4IH3A 3PTMA 3W25A 3AIQA 4LOCA