1XBZA

Crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound l-xylulose 5-phosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
213
structure length
210
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIDLTGYWTWEQAQQWRDAGIGQVVYHRSVDAQVAWGEADITAIKRLSDMGFKVTVAGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
publication title Evolution of enzymatic activities in the orotidine 5'-monophosphate decarboxylase suprafamily: structural basis for catalytic promiscuity in wild-type and designed mutants of 3-keto-L-gulonate 6-phosphate decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 82
structure length 210
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xbzA00
3H55A 3PG8A 4O0ZA 4C1KA 2VFEA 3HGOA 5DLCA 1RQHA 4RZ4A 5F4XA 3BK0A 3DI0A 1U5JA 1SZGA 3THQA 3GYEA 3BO9A 3R8RA 1TTQA 4WD0A 2O7SA 3W7GA 4WY0F 1EB3A 2J9ZA 1XDMA 4PCFA 2W0UA 3TCEA 3N3MA 4JYDA 1QO5A 1SU5A 2VOMA 1OX4A 4MKNA 1JCJA 4B5NA 2E5DA 1HFBA 4AH7A 4AAJA 1YPIA 2H6RA 2X30A 3WK3A 4JIPA 3CB8A 3BARA 3MP3A 1SZFA 1KM3A 4OV9A 3E96A 1TTIA 2J9YA 3LERA 4RV8A 5CPLA 2C19A 2FPVA 2Y61A 1TO3A 3F03K 4WOQA 3SGUA 2QCDA 3S9YA 2ZA3A 1KTCA 1AG1O 4Z0JA 4CNOA 2YGYA 2Q8ZA 3W7OA 3LCFA 5K9DA 2YDAA 4EF8A 2Y7FA 2A7NA 3MP4A 4NNBA 1L9WA 3GIYA 5D02A 1XCFA 3N2XA 3ABRA 5KZDA 2RDTA 4UTWC 1FX6A 4OWGA 3HPSA 4WXZA 5AN7A 4LW7A 2Z1BA 1M6JA 2ZRYA 2E09A 3W76A 1T99A 4HNTA 1LP6A 1KW1A 3M47A 3I7QA 4Z08A 2J27A 3PSWA 2GVLA 3L5MA 4LRTA 5F1VA 3PY2A 3QSTA 3VKJA 4ZQRA 3PR2A 2Y7DA 4P61A 2EKCA 4IX0A 1TMHA 3EX1A 2ZA2A 1YTEA 2PRLA 3L5AA 1W37A 3OVPA 3AJXA 5KINA 3BPWA 5AYZA 1QPRA 1W5PA 4N9EA 3W86A 4WQ6A 2FB2A 3RK8A 2VENA 4NUWA 4QSHA 2PRMA 1LCOA 5AHFA 2P1FA 2B7PA 3RU6A 4GXMA 3NM3A 1KM4A 1Q45A 3W2MA 3KOFA 1O60A 4WZHA 1FXPA 3GDRA 4JTGA 1TCDA 4JN6A 3S1VA 5BNKA 2R8WA 4MUZA 2DP3A 3LGEA 3MW7A 2NX3A 3W73A 3CC1A 3UZJA 3LX9A 3FS2A 3W84A 3USBA 3ZFHA 4MZ1A 1P4CA 4AWUA 3S1UA 2JK2A 4GRSA 2WNQA 2ATSA 1VCVA 3LTSA 2AGKA 4Z1CA 4O12A 3GXNA 3NQ7A 4NJHA 3SW6A 1TIMA 1VRDA 1PL9A 1KTNA 3UWZA 5DBUA 2WNZA 5HNRA 3O8AA 2CLEA 3G1AA 1KFEA 3W87A 4PH6A 4AB4A 2GQ9A 2RH9A 1JR1A 2WJZA 3VCRA 1LM1A 4IMGA 2W6RA 2X1RA 3S42A 3WFAA 1DVJA 3NG3A 3ELFA 4GUJA 2QDHA 4JS3A 3P8IA 3P67A 3BG5A 3W88A 3EWWA 3IIZA 1O95A 5G2HA 3PG9A 3UXAA 4LOCA 4N4PA 4E0CA 3GLCA 4Q4KA 2OMAA 3ZWSA 4M6PA 5K9CA 3UQNA 4GBUA 4DO6A 2RDUA 3G8EA 3M5XA 4UTTC 4JTHA 1H5YA 1V7YA 1Z42A 2DZVA 1W3NA 1G67A 1TPFA 4LC6A 1O5KA 4BR1A 3HBLA 3MP5A 3LI0A 4GWEA 2BZNA 4A2RA 2A6NA 1TV7A 1R46A 1J4EA 4GFSA 3N19B 1ICPA 1TRDA 3NXFA 4ZZ9A 1K7EA 2R94A 3Q58A 3HGRA 2BXVA 5KZMA 3OIXA 1OHLA 1B4EA 1W5OA 1BWLA 5HWJA 3STFA 3BG3A 4N02A 3CEPA 3R12A 3W2NA 1B57A 1EP2A 3DFTA 4BFAA 1JULA 1GWJA 5CZJA 3T44A 1EA0A 1G4SA 3M1ZA 1QPNA 2H90A 2Y7GA 1GG0A 3M16A 5KTLA 2GVGA 1VJIA 1IIHA 3KHJA 2CFFA 1PVNA 2XN1A 3NL2A 3A23A 3UWUA 4FXSA 4PA8A 1JQXA 3L2IA 1H7OA 8TIMA 1W3TA 1WV2A 4HSNA 1L2UA 2PRHA 3STEA 3FJ6A 2NX1A 3C0JA 4A2SA 4FX6M 4Y96A 3NPUA 2YSWA 3RLUA 3UWWA 2TMDA 3IIXA 4BWLA 2B0MA 1UUMA 4FX8A 5L6UA 3C56A 2WQPA 1DV7A 4RXFA 2JGQA 1B4KA 4LC8A 4MZ8A 3W74A 4Y9AA 1ME9A 3W6YA 4ZQOA 2Q3OA 2DZUA 4NX5A 1BEUA 2E6DA 5I3GA 5D30A 6ALDA 2YYUA 3QJAA 2ZZ3A 3EX6A 1JCLA 4PC8A 1ONRA 5E93A 5TIMA 5DXXA 3U8GA 3G18A 4N9BA 3SECA 4Y6GA 4NX0A 2CU0A 1B9BA 2NV2A 3QMRA 1F05A 4RKAA 5AHMA 1IXNA 3TSMA 3HPZA 4RXGA 1YXCA 3G22A 3NNTA 1PS9A 3W83A 1W54A 3PB2A 5CPMA 1Q6QA 2GQ8A 3NQGA 1G4EA 3W1UA 4OHQA 3MUXA 3NO5A 3W9ZA 3EX3A 3IVTA 4QNWA 3W7QA 3UY8A 1OFOA 1X7FA 3CPRA 1D9EA 4XTDA 3NQMA 3PF3A 2B4GA 4NU7A 2NXHA 1P1XA 3GZ3A 4FX7A 1GVRA 1X1ZA 3G24A 4OT7A 3GKAA 7TIMA 4OBTA 3W22A 3C2FA 3S1WA 3EB2A 2OZ0A 3S5OA 4PTNA 3G1FA 1EUAA 1GEQA 1ML1A 2NLIA 3T4CA 3TXVA 3UXDA 4O17A 3W7NA 3W7PA 1EWEA 1EX5A 4WY0B 1RV8A 4M5PA 3BLIA 5TQLA 4ZMGA 1FY6A 1TPVA 5DCBA 3EWUA 2PC4A 4JTTA 4QIUA 1OK6A 5D38A 1OX6A 2EF9A 2CZEA 3LLDA 1DQWA 1FDJA 1VPXA 1R30A 2JKPA 4LU0A 1KM0A 2A2IA 2J88A 2QKFA 4CCCA 3NPVA 5K4XA 4JICA 1SW0A 4TR9A 3CIWA 5DN1A 1F7BA 2BX7A 4FNSA 4HHPA 4NJGA 4FB7A 1OYCA 2QUTA 5FF7A 3E0IA 4FIRA 4O8RA 2TPSA 3M9YA 2NWSA 5LGZA 1OF8A 4S2CA 3TIMA 3FLUA 2C16A 3GK0A 4O1CA 3SR7A 3TJXA 2A0NA 1YPFA 1OYBA 1VYSX 4MYXA 4IQLA 5FF0A 2QCEA 3WJYA 1XC4A 1TPEA 2Y63A 3TK7A 2JKEA 3ABOA 1JVNA 3PBVA 3MMTA 1A50A 2A7RA 1QPOA 1SZNA 4QM1A 4MFEA 4JYEA 2VEKA 1IIGA 3OHIA 3VNDA 2XN0A 3TW7A 1IXQA 1FCQA 4CQ8A 4RJEA 4JY9A 2R14A 3OVQA 3FOKA 4YMZA 2VFFA 4NJKA 1I2PA 3W7JA 2V81A 3W7EA 1H1YA 5D2YA 1P0KA 4FIQA 3P8JA 3F4NA 2CZ5A 1NSJA 1OABA 5CSRA 2X2GA 3NZRA 4S1FA 4CNNA 4UUIA 1HG3A 3EWYA 2E6FA 2ZZ4A 4MFDA 3LCHA 4GUFA 3QFEA 1KM2A 3MO7A 2QJHA 1JCXA 1K02A 1YXDA 4JD4A 1G4TA 2TSYA 3CLMA 1ZFJA 5CZTA 3C6CA 1HTIA 4WOZA 1VLWA 3P60A 3A9IA 4Q33A 3GDTA 5HULA 5AYYA 3W07A 1GPWA 1N7KA 3C2VA 1JCMP 5CPOA 3U2OA 3WJXA 5HR7A 3NA8A 4DF1A 4AHQA 5LNSA 2HSAA 1ZENA 5FEZA 5LNRA 5AHEA 1PHWA 3LM7A 4JEQA 1FWWA 1SW3A 1THFD 4EVZA 4UTUA 4H6KA 4A22A 3HO8A 1O5XA 4YWIA 4AHOA 1QR7A 1KBIA 3NL3A 5F2LA 1RPXA 4BK9A 2QAPA 3TV8A 3JS3A 4PODA 3C61A 4JIQA 1BKSA 2X1UA 1QOPA 3L9CA 3MWAA 2QCFA 2C18A 1EUNA 3ZR4A 2QAFA 1TJPA 2DJXA 3W72A 1W5MA 2YX0A 4O11A 4JX5A 2YW4A 2NX9A 1M5WA 3HGJA 2VELA 2E6AA 3W1MA 4UIOA 1XBZA 1IXOA 3W7CA 4NJJA 4UTLA 3NZ1A 3W1LA 1LBFA 5FF4A 4XQ6A 3TDFA 4MY9A 1GOXA 2VFDA 1DOSA 5D09A 3T40A 4IOTA 3IRDA 3CEUA 3FFSA 4O10A 1Q3NA 4BF9A 2NUYA 5D2XA 1NVMA 1XI3A 4QISA 5CPNA 5FESA 3ANYA 2GVJA 2X1SA 4AWTA 1QO2A 4K6AA 3PBYA 5TBOA 1WQ5A 4YCOA 1QPQA 5D05A 1FDYA 2YR1A 1OFAA 1U83A 4O15A 4UXDA 4Z0SA 3SGZA 4O1AA 2QF7A 2CLKA 1SO5A 4O1BA 5IBXC 1TREA 2E5CA 4MLJA 3NQ8A 3S5NA 4MVAA 4NJIA 3SSJA 1XBXA 5D33A 3S0CA 3TFCA 1H61A 4IMFA 1WAUA 2G95A 3CWOX 5CZ0A 1PE1A 4W9TA 4XWUA 1GYNA 2D73A 3LHTA 4MY1A 4UMAA 1I2OA 4N9DA 2ZDRA 5D32A 3KX6A 3VFLA 1AW5A 1JJKA 1DKWA 5G4EA 1R2SA 3I65A 3HGSA 2QJGA 4O4VA 3FYPA 5K3VA 1NAL1 5J5DA 2Q3RA 2V2HA 2P0OA 3NL5A 4HNUA 3LTYA 5DXYA 3EX4A 4J9JA 3RNDA 1KFLA 1OJXA 4NZFA 2NXIA 3RF9A 3THAA 3TH6A 4QITA 5K4ZA 1I4NA 2O7QA 1KV8A 3NAVA 1KFBA 4JTKA 3BW2A 3NPWA 5AC6A 3VE7A 2J24A 3GX9A 1FUYA 4KWVA 1GVSA 2BTMA 3EXRA 4HT3A 1M7OA 1QOQA 1W56A 2OT1A 3W3OA 1VCFA 3CTLA 3M6YA 4UFHA 4WUIA 1F5ZA 3W1TA 5J5RA 1H7NA 1HL2A 1LDCA 1OFPA 2VFGA 2Y88A 3UPBA 3I7SA 2A5HA 1GTEA 1ALDA 2QUUA 1FCUA 1UJPA 2Y7EA 1UASA 5K7JA 1I45A 4K39A 2JGYA 4L4LA 1IXPA 2EHHA 4O13A 1DHPA 3CM4A 3EXTA 4AF0B 3ATYA 1OFRA 3LXAA 2V5BA 5F4WA 4TU1A 1QWGA 3G0SA 2PCQA 4GE8A 4DBDA 1H51A 1FDZA 1W3IA 4FNPA 3LCIA 3R13A 4LTSA 3P5YA 3TMQA 1QFEA 5GVJA 5A8GA 4PL1A 3QW4B 2C3ZA 3TKFA 2C6QA 1VR6A 1FWNA 3HMJG 5G5IA 3O07A 2QUVA 3EWBX 3H53A 3SI9A 1Q6OA 3NM1A 3DFQA 4QAIA 1XBYA 1DJNA 3OA3A 3BVJA 3W7LA 3Q2DA 1A5AA 3TQVA 5EYWA 3NYZA 2VC6A 1VYPX 4IX2A 3LCGA 1VCGA 3O05A 4ALDA 3MI3A 5FEXA 4O0KA 4CNPA 5KZEA 1ME8A 4UFMA 4EOUA 2Z6JA 3PB0A 3KRSA 3A24A 3O6DA 4FNTA 3EKZA 5EBUA 5KSWA 1I8JA 2ABAA 3LHVA 2X16A 1YXYA 4JTJA 1KV5A 3MJYA 4LVFA 1XXXA 3DI1A 2Z6IA 2ISWA 1MXSA 3TC6A 1H7PA 5HQEA 5BOOA 3NQAA 2ZQ0A 3TSBA 2WKJA 3GDMA 1SO4A 3BV4A 4M7SA 5C6MA 4I7WA 4LNYA 2A6LA 5DCDA 3PWAA 3O63A 1S5VA 3LV6A 1ZY9A 4UTIA 1AL7A 3C8FA 4LVDA 3G0UA 6TIMA 3LBCA 3WJZA 3W75A 1DQXA 3IEBA 2NXGA 4NVTA 4O18A 1LLZA 2KZHA 1V5XA 2IQTA 4JTUA 4L4MA 3M5ZA 3WK0A 4E2BA 1XM3A 3STGA 1MEWA 5I3IA 3G1VA 2RKXA 4C1LA 2ZZ2A 2J9XA 3C4UA 4UFLA 1OFEA 5D37A 3O15A 3QM3A 2X1TA 1LROA 4ORMA 5IBXA 2FTPA 3A22A 3GVGA 3G3DA 1TQJA 3W7IA 1Z48A 4TO8A 1DL3A 1VH7A 3H54A 2FJKA 4UMCA 1T8XA 2C0AA 2Q8LA 1EP1A 4O4WA 1QMLA 3LRLA 1YDOA 1LZOA 4DO4A 5AFDA 1KM5A 4JXCA 3P62A 4UTWA 1FCVA 1K03A 1P5BA 2CZFA 4LS1A 2V30A 1I2NA 1EWDA 3HF3A 1UCWA 5AC7A 4JDBA 3MBDA 4N2YA 1G6CA 4I7VA 2G97A 3FA5A 3P84A 3CT7A 2PE4A 3GAKA 1SW7A 1KFCA 3W1NA 2Y62A 5CSSA 2YPIA 3NQ2A 3PSVA 4ADSA 5E0KA 3DZ1A 1F2JA 1X1OA 1W8SA 4BI5A 3HG2A 2FB3A 3G1XA 1IF2A 1QDSA 2BWGA 4PFMA 3QPYA 1TPWA 4AF0A 4Z1AA 5HMSA 1MEIA 2FPYA 3W1RA 3PS7A 1YLVA 1GZGA 1W0MA 2CLFA 1WBJA 3KAOA 4OGZA 3CIXA 3KVJA 5DELA 4R7JA 4UCGA 1R47A 4DO5A 3W7RA 3I68A 3IGUA 2V82A 3B05A 1RVGA 2YXGA 3V75A 5D2TA 2H3BA 3EEGA 3ABSA 1M7PA 4JNMA 2G5WA 5CGQA 4HNVA 4K37A 2YFNA 1ZHAA 5EL1A 3UYCA 4EIVA 4OV4A 3QRHA 1GQNA 1J2WA 1NF7A 3S5YA 4HIBA 2FQIA 3TQ0A 4EWND 1OK4A 2I1OA 1F73A 4UTMA 3TE9A 3DHDA 3DXIA 4XBKA 1D3GA 1J5TA 3W7MA 1EP3A 3M44A 1JUBA 1TJRA 2YYTA 3QYQA 4KFNA 3ATZA 2BLEA 1S5WA 1MZHA 1ME7A 4O52A 5LGXA 2AQWA 5C54A 4GUIA 5HUPA 3DBPA 5LSMA 4X22A 4JTFA 1HO1A 4YXGA 2WNNA 2YZRA 4XBSA 2QJIA 3NQDA 3B03A 3TAOA 1L6SA 3G1SA 1DJQA 3QSRA 3B04A 3Q37A 4R33A 1KA9F 3SJ3A 2W79A 3QPZA 4UFKA 3NOEA 1GVFA 4RLIA 2EPHA 4NQ1A 5F1UA 3N14A 4UTTA 2DJLA 2JKAA 1O4UA 3B0VC 3UNDA 3B4UA 3QW3A 3QQ1A 4UNLA 3L5LA 5EKYA 4DXVA 4JGDA 4IPIA 2ZRUA 1KFJA 3DHFA 3IVSA 4K7VA 2B7NA 3B0UX 4AXKA 4HPJA 2FIQA 4A29A 3QZEA 3UY7A 5D2VA 3LHYA 4ML9A 4LV9A 1FWSA 1GYLA 3GKFA 4GC4A 3KVMA 3LCWA 5U7SA 1YADA 3DFPA 3N2MA 3R5EA 4FO4A 1SFJA 3MHGA 3P61A 3IGXA 3P82A 3W7HA 1SO6A 4IMDA 3NR0A 5DY2A 4Z1DA 5FI8A 5AYXA 2JBMA 5BW6A 3WK1A 1KM1A 1WOAA 2DZTA 4X3ZA 2QCNA 1FQ0A 1SPQA 2VFIA 3P5ZA 5CZSA 5C5YA 4E38A 1F6PA 1F6KA 3O1NA 2WPBA 4BI7A 4KKXA 2J6XA 1TTJA 5C2XA 2CLIA 1A5BA 1FBAA 5LNUA 3UZ5A 1QNVA 2VFHA 3DFOA 3UWQA 5F2MA 4ZQNA 1YYAA 3N73A 3NQCA 1T96A 1TV8A 5HUOA 2H3DA 3TJLA 2CLOA 2VXNA 4UMBA 1W31A 3RLVA 1YTDA 3PUDA 4AMAA 4WX2A 1XKYA 4UTJA 5CG7A 3FYOA 3QMTA 3PBWA 1VHCA 4OU1A 4AHPA 3CU2A 3L68A 2DZPA 4MJMA 3CWNA 3ABQA 4XKYA 2HS6A 3P74A 5BMWA 4MOZA 3FJLA 2EAWA 1L6WA 1LRTA 1LOQA 3N9SA 1JRBA 2E68A 5G2WA 3U6WA 4O54A 3LOTA 2DU2A 2YCEA 4LUIA 3SFKA 1OFBA 3JR2A 2E5BA 1Q6RA 3W2JA 4A21A 2FDSA 3P81A 5G1YA 1AW2A 2A7PA 3OEXA 2ZRWA 2ZZ6A 3GDLA 1I2QA 3E12A 3DKJA 1SQ7A 4HSOA 4MY8A 3S6DA 4LUJA 1NEYA 1H7XA 2Y6ZA 4FHAA 1DORA 3P80A 3INPA 4O14A 1H1ZA 2VEIA 4JDYA 4KFOA 3BGGA 1LTDA 1E51A 3HG5A 4O53A 3S5ZA 1TPDA 3W85A 3PAJA 3TAKA 3WJSA 2QDGA 4O50A 5EPDA 3AO0A 1PHQA 1ZALA 3DH7A 2GQAA 1G69A 3W1AA 2ZRVA 3V1PA 1LYXA 2ISVA 3GR8A 1HUVA 3N9RA 1W1ZA 4JY8A 3MHFA 3DU0A 3LHUA 3QEZA 5D04C 3NDOA 2CW6A 3NEVA 1K8YA 1SZEA 3G1DA 4R34A 1WX0A 2WSQA 5F2GA 1RR2A 3L66A 4O19A 1JQVA 4NXKA 5EY5A 3TNOA 4LVGA 3W7KA 3UWYA 3JRKA 4N6EA 4Y90A 4IMEA 5AHNA 4Q32A 2OJPA 3LI1A 4LY8A 1XFBA 4Y8FA 3EX2A 1KFKA 1K8XA 3DAQA 4ONVA 4TIMA 4QQ3A 1D3HA 3PM6A 4X2RA 2HS8A 3BG9A 1TTPA 1SFLA 2DZSA 4FNUA 3E49A 4D2JA 2V5LA 4FNQA 2ZRZA 5U4NA 2A1YA 2ALDA 1N55A 4ZQPA 1VYRA 4DBEA 4RR4A 1JUEA 4DF2A 1GTHA 3G0XA 3S8HA 1Z41A 3GXTA 4N4QA 3UWVA 3W23A 2ZTKA 4CQAA 1PCWA 1RQBA 2Y70A 3PUEA 2CLLA 4CCDA 2RDWA 2NV1A 2H8XA 3C2EA 4BWLC 4YCPA 4R53A 5F2IA 2V2CA 1AK5A 2XFWA 3TXZA 5AC8A 1PV8A 2LLEA 2QCLA 1EEPA 1C29A 2F84A 3MI2A 4UFIA 3IGSA 1KM6A 1FWRA 5FEWA 4HPXA 3GDKA 3CQ0A 5G4WA 1H63A 3QH2A 1TPB1 1VHNA 2GJNA 3L0KA 3B0PA 3C2OA 3KVLA 3E9AA 3I7RA 2ATMA 5KMYA 4JR5A 5I3FA 3C52A 5HJLA 2EGZA 3O6YX 1WYIA 2FLIA 4UR7A 2QCCA 3DFNA 1BTMA 3G1HA 2V9DA 2RHGA 1ZAIA 2UV8G 2NZLA 1C9DA 4LWWA 5SWUA 4M7TA 2CZDA 2ISSA 1ICSA 3GNNA 2CLMA 1NF0A 1ZJIA 3QC3A 1K7FA 3LRMA 3PVFA 1QAPA 2ZRXA 5HWMA 3NQFA 4HN4A 4GNJA 3M43A 4MYAA 5K2ZA 5DCEA 1WBHA 5F4SA 3LCLA 3STCA 1CI1A 1MEHA 3LCXA 2P10A 1LRQA 1SR9A 4K36A 3Q94A 3W71A 1KLZA 5LZLA 3PULA 3G1YA 2A85A 3HB9A 3A5VA 3R2GA 3VE9A 2I9EA 4DPPA 1JCYA 2AAMA 4YLWA 4MPQA 3VI2A 3BGJA 4RX0A 5AHLA 4DEFA 3LRKA 3C3NA 5I3KA 1Y0EA 4PEKA 3ZS4A 4NXSA 3KRZA 3IVUA 1JCNA 3LHZA 1L6YA 3KVKA 1NFBA 4IJBA 3M7WA 3SZ8A 3GR7A 4H3DA 2QR6A 3LBMA 3DGRA 5ABTA 1H7RA 3LHWA 2RFGA 4IPJA 1C8VA 4U28A 4MZYA 4K38A 4ICNA 2Y85A 1UBSA 1OVDA 5I3HA 3R89A 1S3HA 1GT8A 4YL2A 1GJPA 1OX5A 3L0GA 1KBJA 4RCXA 2WSYA 4OQVA 1KTBA 2V0TA 2G96A 1OFQA 4K8HA 1SSGA 2E1DA 2FFCA 1TPH1 4OE7A 4X9SA 1WA3A 5DBTA 5FEPA 2GJLA 3T78A 1AW1A 3TW6A 2PURA 2OX1A 3G8RA 3KFTA 1CW2A 2TYSA 1A5CA 1B3OA 3SIZA 4IWWA 1SSDA 3DKLA 1O94A 1H62A 1AMKA 1OFDA 5LNWA 3OG3A 1MO0A 3IIPA 2WV8A 4FXRA 5AB3A 1K3UA 2A4AA 4IXXA 1R2TA 2ZZ1A 4UTKA 2F7FA 4JTLA 1H7WA 3W7DA 1GG1A 2Y89A 3EKLA 2YFOA 1VZWA 3TU9A 3W1PA 1TSIA 2OCZA 1TPUA 5FF2A 1OF6A 3NQVA 5IM51 2ZYFA 1JRCA 2QEZA 1F76A 3D0CA 4POCA 4JTSA 3DENA 5BRBA 1Q6LA 3WK2A 2H8ZA 1VGAA 2QCMA 3W2KA 3B8DA 4NNCA 4E2DA 4Z1BA 3HJZA 4KWWA 1LLWA 4MLRA 1LORA 1SUXA 3TR2A 1BWKA 4K8EA 2E6YA 4ORIA 4UC5A 3N34A 3LLFA 3UPWA 4ZL1A 4AEOA 4PL2A 4JTEA 1LOLA 3NVTA 3EWXA 2OT0A 4GUGA 5AHIA 1A53A 3ZWTA 2GOUA 2ZCGA 3W2UA 3M41A 3TMLA 3IV3A 3HQ1A 4IUOA 3GB6A 1XBVA 4HNNA 4MIMA 2I14A 4M6VA 3SY5A 4NZJA 5G1TA 4BI6A 1OYAA 4LT9A 4ADUA 4XKYB 4NNAA 4N9CA 5I3JA 4TMBA 4KFPA 1S5TA 1LRNA 4IXHA 1XUUA 4CQ9A 2ABBA 5T26A 3W1QA 1T0OA 3GXPA 3TX9A 1GVQA 2ZZ5A 1YDNA 4EF9A 1WOBA 2Z0IA 1XUZA 1TRIA 3M5YA 2NUXA 4S2BA 3MYPA 3NQ6A 1ZNNA 3MYOA 3LTPA 3GAYA 4RZ5A 4M6QA 3TA6A 4ZVJA 3FIGA 5LHEA 5D2WA 1MSSA 1ICQA 2FPTA 1UB3A 1Z44A 3OVRA 4MJZA 3PUOA 3NQEA 5LHFA 1JUKA 2ZBTA 2BSLA 2ZFAA 4HKPA 1AL8A 2V8ZA 3YPIA 3M0ZA 4DF0A 4H4IA 3FKRA 3QF0A 4XUGA 2ZZ7A 4ZQCA 2QCHA 1ZAHA 2A21A 3QMSA 3F1QA 3G3MA 3TROA 1WDWA 5LKYA 5CKSA 4JTIA 4TMCA 5HWNA 1KLYA 1VLIA 2HMCA 4IMCA 1TV5A 3UD6A 1ADOA 3L0NA 5K9XA 1F74A 3W2LA 4TX9A 4CLMA 3E02A 3I6RA 1PIIA 3OBKA 4CCEA 5EMUA 1UUOA 4QNEA 1I2RA 1XDLA 5HINA 1W5NA 3QQ0A 1G7UA 4O1DA 2WOQA 5G2IA 3NGJA 1H60A 1RD5A 5DY3A 4FF7A 4O16A 1OX4B 3BW4A 2YW3A 5C55A 1X6UA 3RMJA 2NUWA 3L65A 1K8ZA 5H2ZA 3MI6A 1YTKA 4LS0A 2QCGA 2GUUA 4UNKA 4RK8A 1G7VA 1TPC1 5EA9A 3KXQA 3TC7A 2VEPA 1IGSA 1XL9A 2C13A 3M5VA 4XTIA 1A5SA 1G4PA 1X8FA 3L67A 4LVAA 3DFSA 3NL6A 4ZQMA 1TB3A 2HTMA 3F4WA 4RZ6A 1PCKA 3BLFA 4NT0A 3FEMA 1HO4A 3BLEA 4JX6A 2V2DA 1FWTA 4N6FA 2QCDB 3B06A 3P7YA 2Z2UA 3C2RA 1RZMA 3IIOA 5A5WA 3MBFA 3T7VA 2C15A 5HR6A 3PBUA 2ZTJA 5LNVA 1FCBA 1R2RA 3A21A 5MHBA 1ZAJA 5L9FA 3L21A 5E1QA 5BMXA 1RQEA 4GJ1A 1QCWA 1WXJA 2VKZG 5D03A 2GPTA 1VQTA 4AVFA 4UR8A 2E77A 4AWSA 4GUHA 4M19A 3IIVA 4JYFA 3LXBA 5H91A 4O57A 4DELA 4FEZA 3T55A 3GNDA 3HOJA 3NPXA 3TSDA 2XN2A 4U4MA 1LOSA 1DBTA 4UTHA 3LXCA 3HG3A 3LDVA 1VS1A 1VC4A 2DORA 3WJWA 1W5QA 1FXQA 4DPQA 1SO3A 2B7QA 3K30A 3O06A 4LRSA 4UFJA 2VEMA 2C1HA 4A3UA 3O6CA 2CLHA 1TQXA 4JX4A 3HIJA 1EIXA 3EWZA 4FNRA 4O28A 4LS2A 3HG4A 4K7YA 3PC0A 4LV4A 3LB0A 3FKKA 3W70A 1EPXA 1GVOA 4P2VA 2NWRA 3BW3A 4IGHA 4I7UA 4ADTA 3HPXA 1CX9A 1H50A 5KITA 4DQWA 3RFAA 4G1KA 3TFXA 2WO5A 4QJ1A 2CWNA 1N8FA 2DZWA 3LV5A 4WXYA 4I9AA 3EXSA 2TRSA 2B7OA 1P0NA 2C14A 3TUUA 1LBLA 2R91A 2ZA1A 3MHUA 3O16A 3W1XA 2DZXA 3TQKA 3KRUA 4LVBA 4XZ9A 4WJEA 1YDVA 5AOUA 1ZCOA 1TYGA 3S1XA 2WSRA 1OG0A 1K7XA 3A5FA 1LBMA 5FF3A 3CHVA 4WY0A
chains in the Genus database with same CATH superfamily
4A8IA 4X0VA 1J0ZA 2VFEA 2X0SA 2F2HA 1RQHA 4S39A 2FJUB 1PX4A 4MWAE 1U5JA 4B2DD 2PFHA 1X6LA 4MAVA 3WLMA 5HMFA 4C65A 4WY0F 2J9ZA 4JFTA 4H8UA 1IQ8A 3V4BA 1SU5A 1ZBCA 5ABEA 4MKNA 1JPHA 3QR3A 5CBIA 2H6RA 4JIPA 2NT0A 3L12A 4UTFA 2WAGA 4MWAB 1KM3A 3E96A 1QI5A 2J9YA 3Q45A 1TX2A 2AOSA 2YA1A 2B31A 5CPLA 3WY1A 2Y61A 1S1PA 2Z1VA 2F8QA 4BS0A 3SUTA 1ELSA 3P0WA 4FOUA 4MGGA 4KETA 3VXGA 4QS5A 1SZRA 2BP1A 3LCFA 5K9DA 1L9WA 3EWDA 2PF8A 3HPSA 3AYTA 1KW1A 4ZE5A 4AX6A 4LANA 1DTUA 1RCXB 3BSMA 1A0EA 3PY2A 2Z2BA 2E8YA 3QSTA 3LGDA 1VBHA 2ISFA 3F2BA 3VAVA 3TYAA 4NHVA 1U2YA 3LUTA 4ACYA 2Y7DA 4P61A 4IX0A 1TMHA 1JPMA 2C0HA 2ZA2A 4PMJA 1CIUA 3L5AA 3L2LA 1LG2A 2XVLA 4QP0A 2HNEA 3UR8A 1QPRA 2GDVA 4WQ6A 2FB2A 2VENA 1C7TA 4HYRA 2P1FA 3R79A 3RU6A 3NM3A 1KM4A 3LMYA 4PUUA 1O60A 1B0IA 3FSUA 2XVNA 4JTGA 1TZ7A 1TJ1A 3BQ5A 1Z32X 1TCDA 3LSBA 4JN6A 1IEIA 4LUSA 2VJXA 2E9BA 2R8WA 3R4IA 1XSJA 3W73A 1ADDA 3CC1A 3RGTA 2W91A 3UZJA 4V1XA 3USBA 4B5WA 1VCVA 1X96A 4PN2A 4JHZA 1MNSA 4NJHA 1VRDA 3MWCA 5I78A 1JDFA 4ZFCA 4IFRA 4DJDA 4YN5A 1JZ3A 5HNRA 3O8AA 2CLEA 1PUDA 3W87A 1R3SA 4AB4A 2GQ9A 3LLXA 3QTPA 4KERA 1JR1A 3F7JA 2WJZA 3WENA 5A6LA 1R85A 4IMGA 2QNEA 2W6RA 4AIUA 3WBWA 3S42A 3WFAA 3WH9A 1E0VA 3OZMA 1W3KA 3NG3A 4LB3A 4GUJA 3P67A 2C8NA 3F2DA 2C1IA 2YCKX 3N3TA 3UXAA 1XS2A 3HZ3A 5I2UA 4AX7A 4E6MA 3NSMA 2OZTA 4J4KA 4DNMA 4Q4KA 2OMAA 3T9PA 4M6PA 5ECVA 4EACA 1A4LA 3M5XA 1H0IA 4JTHA 1H5YA 1XGEA 2DH2A 1Z42A 1MUCA 3PTDA 1O5KA 2G0WA 3T81A 3HBLA 4US5A 3OYZA 1XIBA 3UBPC 5DO8A 4WGXA 1GOWA 2ZUTA 1TRDA 3NXFA 3WQPA 4KWUA 3M0YA 2O55A 2WMFA 5KZMA 1W5OA 1BWLA 3STFA 3V5FA 3BG3A 3S83A 3CEPA 3R12A 5CC6A 5FSEC 3WD1A 4DWSD 4XZMX 1GWJA 1XYCA 3EPMA 5M03A 2OSWA 1G4SA 2H90A 4G56A 3MANA 1UH2A 1X6NA 1VJIA 3KP0A 2XN1A 1ITQA 4DLMA 3A23A 4PA8A 2QUNA 1R8LA 3L2IA 1DWAM 3FGCA 3LQLA 4HSNA 3WF1A 2X0YA 2PRHA 2VRKA 3CUIA 4FX6M 5A6MA 2TMDA 4BWLA 2D20A 1UUMA 4YYFA 5L6UA 1Q8JA 3C56A 2WQPA 1DV7A 2JGQA 1Q8AA 4Y9AA 3W6YA 1U22A 2Q3OA 2DZUA 4NX5A 2HV5A 1BEUA 4JTDA 4QR6A 5I3GA 1TVPA 3WL1A 1DJYA 3VUSA 4Q3MA 3QJAA 3RU8X 1JCLA 4PC8A 4A6GA 4Q8QA 3T0TA 3ZIZA 4N9BA 1V02A 2YDRA 4WHBA 2J7GA 2NV2A 1QI4A 4RKAA 1IXNA 3P2VA 3TSMA 4GHRA 1YXCA 3WD0A 1W54A 1AD4A 4OHQA 4YS1A 1EL3A 2ACRA 3FX4A 3N2TA 3ANVA 3MUXA 1YX1A 3QBUA 5CXPA 2O9PA 4N7QA 3T1GA 2OVLA 1QOXA 3UY8A 2CBVA 3CPRA 1D9EA 1JPDX 1V6YA 1M1BA 3RCMA 3OPSA 1CXEA 1DWIM 4I6VA 3TTSA 2O0TA 2OB3A 3GKAA 1DWHM 3W22A 2V68A 2VX4A 1ISZA 4M0XA 1EUAA 4E2VA 1ML1A 2BS9A 1REQA 3TXVA 1PZ0A 3UXDA 4O17A 3GNXA 4IFKA 1JZ6A 1YNPA 4PTVA 3S9ZA 2Z1WA 5IFTA 4JTTA 5CJ5A 3T0CA 3BAXA 4AU0A 4C1NB 1OX6A 2EF9A 5JIPA 3KOZA 1XJBA 1VPXA 1R30A 4ILSA 2QS8A 3C8NA 5CSUA 2PDCA 3KS6A 3NDZA 1KM0A 2QKFA 1T41A 3CIWA 2BX7A 4LYKA 3SN1A 1I0DA 4JL1A 1OYCA 5FF7A 4FIRA 4O8RA 3M0IA 3TIMA 3FLUA 5CH9A 3TJXA 3PZUA 1AQ0A 2RJGA 4FR1A 1OYBA 2QLYA 1QASA 1TCMA 4Q8VA 1BSIA 4IQLA 1LJYA 2QCEA 3VCCA 3WJYA 1XYMA 1XC4A 2CZVA 3PBVA 1X98A 4OUEA 1QPOA 3AI0A 5EMJA 2DT0A 2BBFA 3OHIA 4GO9A 4OIFA 3VNDA 2XN0A 3LNPA 1IXQA 1UZ1A 2EBNA 4S23A 2R14A 3FOKA 3LA4A 2VFFA 3RXZA 1I2PA 1NWSA 1F07A 1UW9A 1ZL1A 5H8UA 4HOWA 4P7NA 4Q8WA 2NVCA 2QJMA 1E5NA 3NZRA 4WKAA 2QGYA 2VGGA 1HG3A 2ZZ4A 4MFDA 3UR7A 4GUFA 2L5HA 4CN4A 1KM2A 2QJHA 4C6MA 1K02A 1SMDA 2J4GA 4JD4A 1PZ1A 5CZTA 3C6CA 4OECA 1HTIA 1VLWA 2FTWA 3A9IA 4Q33A 3UA4A 2HXTA 1FHVA 5HULA 1NOUA 3W07A 3CZKA 2NSOA 3R0UA 4NSBA 4E8GA 4PMZA 1TVNA 3VD5A 1HNYA 5HR7A 3W24A 1OQFA 3N15A 4DZIA 5FEZA 4P8WA 3VZYA 4IP5A 5LNRA 5AHEA 1O1ZA 3SCNA 3EMZA 5CGTA 1SW3A 1ZBWA 1UOKA 3CPUA 1E3ZA 2GSHA 1E6ZA 2UY3A 4A22A 1XX1A 1O5XA 4YWIA 3OHMB 3QPEA 1KBIA 2X40A 3WDPP 5F2LA 3WYZA 3TV8A 3JS3A 2X1UA 3GVWA 1QOPA 3GIPA 4M1BA 2QCFA 2C18A 1EYEA 2Q71A 5A6BA 5FKYA 5M5DA 3UG5A 2WWCA 1CTNA 3SCTA 4O11A 2HRWA 2DQXA 2VELA 3A13A 1XBZA 4I5XA 1IXOA 1B31A 4LUTB 3NZ1A 3W1LA 5I23A 1W1B1 3BCJA 4Z2GA 2GSEA 4H7ZA 3WNMA 2V63A 4US6A 2PGRA 3VIIA 2X1SA 4KMQA 3N25A 3MUCA 3OO2A 1BKHA 1DXIA 4QX4A 3UJFA 1U83A 4O15A 3IARA 1Q7QA 3SGZA 1M7JA 4PE8A 3HPFA 2QF7A 2CLKA 1SO5A 3CQJA 5IBXC 3NQ8A 2BY0A 1OCBA 1UBPC 1XBXA 1I1XA 2PP1A 4I8YA 3FNDA 5D33A 1EJUC 3S0CA 4HCLA 3B4YA 2EQDA 2FMNA 3CWOX 3GVVA 3GXFA 5CZ0A 1PE1A 2CWXA 3CUZA 1VRXA 2YCLB 4XWUA 4QEHA 1R5YA 1EDTA 5EMLA 4WKFA 4MY1A 1I2OA 5IOBA 2ZDRA 4C6CA 5I6SA 2Z1SA 4R88A 1JJKA 4C6IA 3EMQA 3IJDA 7REQB 3HGSA 2QJGA 3FYPA 5K3VA 2IQDA 4C6NA 5J5DA 3R6IA 1GKRA 5ENLA 3KBJA 1T6MA 3UNTA 1KV8A 3NAVA 5CAHA 2Y5EA 3VE7A 1VP5A 2FZBA 4U3AA 4H9YA 3GVQA 4UBPC 4HT3A 4J3UA 1VCFA 1YBQB 1GJUA 2WW5A 1S2WA 2VFGA 3V16A 3WD2A 3I7SA 1R6WA 2A5HA 1IV8A 1FCUA 2XFRA 5DT7A 1QBBA 3KBNA 4GQRA 1E6XM 3RPMA 3RG6A 3PFRA 2GL5A 1JPIA 3DIPA 3O0KA 4Q7BA 4DAIA 2YBUA 3Q4DA 1EDQA 3N2OA 3UGVA 3G0SA 1V6UA 4IF2A 2PCQA 4GE8A 2Y1HA 4MUPA 4DXXA 1FWJC 4V1YA 1EGMA 2VX7A 3A4WA 1LF1A 1LT8A 3DYMA 2MUCA 5GVJA 1GUVA 2VL4A 4NAFA 4A8NA 3ITVA 3KRBA 1PKYA 3HN3A 3O07A 2J7EA 2QUVA 4HZ7A 5REQB 3SCPA 1GQLA 3LPPA 1W2PA 4HGXA 3S3GA 4G7FA 3V7PA 3TQVA 5EYWA 1VYPX 4IX2A 1DWFM 1H2JA 2IXUA 1AH4A 4UFMA 2Z6JA 2HVOA 2O4QA 6A3HA 2MANA 2PTZA 2HQAA 3JZUA 4GYFA 4UQBA 5EBUA 2ABAA 3LHVA 4OVXA 3VA8A 1KV5A 2ISWA 3IANA 1T40A 3NQAA 3VIOA 1SO4A 4M7SA 4I7WA 1WZAA 1TVLA 2A6LA 4LNYA 5DCDA 1BSLA 1S5VA 3SUVA 3LV6A 1AL7A 4LVDA 4XSLA 2UY4A 1GEHA 3AS0A 2OYKA 3W53A 4IICA 1LLZA 2KZHA 1DP0A 3QVQA 3WEZA 1JG9A 3ARSA 3WK0A 1XM3A 3STGA 1MEWA 5HATA 3PWIA 3IAQA 2RKXA 2WMIA 4C1LA 3C4UA 2J9XA 1J0JA 4LAOA 4IHCA 3ZT6A 3DERA 3TYEA 4ORMA 3A22A 3W7IA 5JH2A 4X9YA 2C0AA 3G5EA 4JFSA 1KGUA 4O4WA 2EG7A 3V35A 3E74A 2WLYA 4U5IA 1LZOA 4E2OA 4DUXA 1KM5A 3H4WA 1C7SA 4LY4A 3S2NA 1C8QA 2CXEA 1EDGA 1VEPA 3T2OA 3VIJA 5A94A 4JDBA 4PB4A 1G01A 4RNIA 3RPTA 3AISA 1UC5A 5CSSA 1IYXA 3EDEA 3V0TA 1E0WA 1BYCA 3DZ1A 1F2JA 1CXIA 1X1OA 1W8SA 4IIBA 4BI5A 3HG2A 1U33A 4JEJA 4W5UA 4JQ4A 1QT1A 3MDUA 4H8NA 3I6TA 3KAOA 3KEHA 1J2BA 4JL2A 2C1GA 5DELA 4YHGA 2XM1A 3MVTA 3WQEA 1RVGA 3UEQA 3V75A 4AY8A 4W7WA 3RX3A 4JNMA 2W4XA 2D0HA 5CGQA 3CMJA 3PPGA 2IPJA 5CLTA 3WQ8A 1EKOA 2Z7GA 3AS2A 1GQNA 4NAEA 1JYXA 1HGYA 3GH7A 1A5LC 5JMUA 4KBXA 1KFWA 1E4NA 3DHDA 4QRNA 4R3UA 3FJNA 3IRSA 3W7MA 3F4DA 3R58A 1FRBA 3M44A 4KFNA 2J7BA 4XK2A 3SRDA 1ME7A 5HUPA 3APGA 4MG4A 3OBAA 2Y2WA 1IE7C 1Q2RA 1E4IA 4YXGA 3WQOA 1OT1A 3TOPA 1K9FA 1M01A 3B03A 2X2YA 5JH1A 3QSRA 1BD0A 1E6RA 2OQYA 3Q37A 3B97A 3SJ3A 4PRTA 5ABFB 3QPZA 3AS3A 3DEQA 3VOGA 2EPHA 2AAAA 2JKAA 1UWAA 4KCWA 4DXVA 3IVSA 2PAJA 2ZWZA 1E0TA 1XRFA 4MNMA 3TZNA 4UB9A 2FIQA 4YVXA 4A29A 5DEZA 4L9XA 2WZMA 4JIRA 4ML9A 4HJFA 1CGXA 2FHFA 2XG9A 5AC4A 1F3WA 2JALA 2PWGA 3DFPA 3U4FA 3TWAA 3W27A 2P0IA 3P61A 4JQ2A 3W7HA 1PTAA 4Z1DA 5FI8A 4BF7A 2JBMA 2BOEX 1WOAA 4X3ZA 2QCNA 3P5ZA 2AKMA 5C5YA 2XM2A 4XV0A 3O1NA 3AYRA 3MKKA 5CSYA 5C2XA 2CLIA 3B8SA 3UZ5A 3UWQA 4YIWA 5HK4A 3NQCA 4MB4A 1T96A 3ITYA 1TV8A 4HOXA 2H3DA 2RAGA 3PUDA 4AMAA 4QROA 2CHNA 1EQCA 2QJNA 5AECA 4JPGA 2VD9A 4ATLA 2VR5A 3CU2A 1A80A 3L23A 3TVAA 4MJMA 3ABQA 4V15A 1XHGA 3UXKA 5BMWA 2W92A 2J62A 4GPNA 3UZYA 1O68A 3BMVA 2I5QA 1WAWA 1LOQA 3N9SA 3SDOA 2JF6A 3PJTA 2IUZA 3LOTA 2YCEA 5B7YA 5BYWA 2QW5A 2WCAA 1Q6RA 3W2JA 4YWSA 4H01A 3OEXA 2WJDA 5I07A 1IZJA 4I90A 4WDTA 1JFXA 1I2QA 4MAZA 2WHMA 3MSRA 4HSOA 4XKMA 1H7XA 2OQHA 5HPOA 3INPA 3R25A 4O14A 1H1ZA 4JCMA 1TPDA 1L6FA 1A3WA 4O50A 1MQPA 3V1PA 4Q4OA 2OLSA 2ISVA 1HUVA 3UETA 3J7HA 1J96A 3EBVA 3LHUA 4D8AA 1IGWA 3LK6A 3VFCA 3QEZA 2WNWA 2QHAA 3SCOA 1K8YA 2O56A 2WSQA 4O19A 1JQVA 1WZKA 2VDIA 3UWYA 3JRKA 4N6EA 4DZAA 4IMEA 5AHNA 1Q6EA 4WJXA 4Q32A 2IKIA 2OJPA 1XFBA 3T42A 1S5MA 1E6PA 4TIMA 4CQBA 3WMSA 1D3HA 4NI3A 3PM6A 2HK1A 2DZSA 3E49A 4JHMA 3WBYA 3OGVA 4DZ5A 2DGAA 4ZQPA 3E38A 1ISXA 1DJIA 1B30A 1AA1B 3AZSA 1JXJA 2PGEA 5D4YA 4CQAA 1PCWA 1QRQA 3PUEA 5C8BB 2EG8A 3ANUA 4TXEA 3EPOA 5F7UA 4MKSA 2V2CA 1Q65A 5AC8A 1W9DM 2QCLA 3ZT5A 3NYDA 1FWRA 3M0KA 3B0YA 4XIMA 5TAOA 1M7XA 1OIMA 2XPKA 3GDKA 1PAMA 3R0DA 4XAZA 2CETA 2VR2A 2WZIA 3AHYA 5H8PA 3QH2A 4CNUA 1QWKA 5KMYA 4JR5A 4XZLX 3C52A 1A5OC 1SYTA 4EPBC 1QI3A 3O6YX 1LQ2A 2FLIA 1WO2A 4D1JA 4DUWA 4KIEA 2QCCA 5CC5A 2XIQA 2BDQA 1ZJAA 2V9DA 2ZUWA 3POCA 1HKIA 3Q65A 4QE4A 1C9DA 4LWWA 4WJ8A 4HSHA 3AOFA 4GVHA 2QMKA 1XINA 3GNNA 1OG6A 5FJRA 3BLPX 1K7FA 3PVFA 4F0SA 2AL1A 1V4YA 1VPQA 2XGZA 1RAKA 5DCEA 3STCA 5HNUA 1MEHA 1BRLB 2P10A 2Y8UA 1CB2A 5FAGA 2A3LA 3CMFA 1UD8A 3G1YA 3HB9A 4DPPA 2ZICA 1PKLA 1EYWA 5C7VA 4YLWA 4RX0A 1R3VA 5I3KA 3LSCA 4CD4A 1K9EA 4PMRA 4LPCA 4FSAA 3IPWA 4BKNA 1FWGC 3SN4A 2ANUA 3GR7A 3WIJA 3LBMA 1H7RA 1C8VA 4EAMA 3CHEA 4ICNA 5BXSA 4NY2A 2Y85A 1UBSA 1DXEA 5I3HA 1XG4A 5FJIA 5E0FA 1S3HA 4RDVA 4R7WA 5D8ZA 4PBGA 4ZOEA 1TJ2A 4RCXA 2Y8KA 3IJ8A 4CQDA 3GIQA 2AMXA 3ZVHB 1FKWA 2PDMA 3WQCA 4MWAA 3PAOA 1HX0A 3BZGA 4P8UA 1MRQA 4X9SA 3W00A 4H9TA 2R1NA 2GSJA 1Z8AA 5CPSA 1TV4A 3REQB 1UD6A 3G8RA 2R1KA 1CW2A 1RY0A 1SSDA 3W6LA 3ARVA 4NZ4A 4JN8A 1HIZA 1IWPA 2J66A 3TTOA 4KGLA 2PDWA 3SBFA 3BL3A 3V18A 4IXXA 4US5D 1GG1A 1VBGA 2OO6A 1TSIA 1XCXA 4LSBA 1TV3A 1ZSXA 2ZYFA 1KO0A 1JRCA 4QCFA 1B3VA 1F76A 1R9ZA 4POCA 5BRBA 2QCMA 4AZCB 4DJED 3VKKA 4Z1BA 1LLWA 4MLRA 1A0DA 1LORA 4K8EA 1CCWB 2E6YA 4UC5A 3N34A 4W93A 4E4FA 4MB5A 4P7QA 4AEOA 4ECLA 4PL2A 1N8IA 3U4AA 3B8TA 3EWXA 3D3FA 3K13A 3KOWA 4GUGA 1DE6A 1H49A 1V77A 2ZCGA 3W2UA 3M41A 2XIOA 1YEYA 1UP2A 3TMLA 2XSXA 3L4XA 4AIBA 1JAKA 3AXXA 1IEQA 4WSJA 4MIMA 2I14A 3SY5A 1I60A 4NILA 3TTQA 3R1ZA 4BI6A 3NCOA 1E1CB 1UR4A 4XKYB 2QT3A 3H2OA 1CLXA 1IEXA 1NM9A 5I3JA 3ITTA 5T91A 4KFPA 1XUUA 4PCSA 2ABBA 3A3XA 5T26A 1UZ4A 2XIMA 3GXPA 5LXXA 1DJGA 1LWHA 3EDJA 4DJFC 3MYPA 3ZLHA 1IWBA 2HDJA 1IHIA 5BWFA 4RZ5A 1FVPA 4Y9MA 5D9PA 1GW1A 1QUMA 1XRTA 5DF0A 1ICQA 2FPTA 1Z44A 3OVRA 3PUOA 2PPGA 4D6HA 2ZFAA 1J0KA 4GXWA 2V8ZA 3YPIA 5C71A 2EJ1A 4H4IA 3MSYA 3GH5A 4ZBCA 3SCQA 1JD9A 1ZAHA 3TROA 4REQB 2YCJA 1WDWA 1XC6A 3AIEA 1VLIA 5IDZA 1UOZA 5E5CA 3CHFA 2FH8A 2F2KA 2NSXA 2PZ0A 3OBKA 3V5OA 1V6XA 1W5NA 3QQ0A 4O1DA 4ZSTA 2WMJA 2MNRA 3VNZA 2IKGA 1H60A 1W3HA 5DY3A 4FF7A 4N42A 2NT1A 5C55A 5HMEA 1V0MA 3RMJA 4D6DA 1PZ3A 1K8ZA 1RSCA 1YTKA 4LS0A 4E5TA 2HVMA 5B80A 1NIUA 3TC7A 1EOKA 4AYSA 4EXBA 3N4FA 1X8FA 3NO3A 4LVAA 3GC2A 3T2QA 4H9VA 3ZJ6A 3BLEA 1FWTA 3HMCA 3IIOA 2Y8VA 1S1RA 4KT2A 4PSPA 3VIFA 2ZTJA 4XAFA 3SUUA 3AHTA 1TUXA 5IHSA 2YZ5A 3ZSTA 3V0SA 4UQ9A 3M46A 1FCBA 3HFYA 5MHBA 5CGMA 2VM8A 1RQEA 3VNMA 1QCWA 4AZGA 3S5SA 1NQ6A 3F5LA 4AD0A 4M19A 1I9CB 3R10A 2INFA 1KC7A 2YBVA 4OBSA 3UCQA 3LG3A 2D3LA 4DELA 4C6DA 4FEZA 3VX1A 3NPXA 3TSDA 1S3TC 3W28A 1EGVA 2G3FA 3GXDA 3LXCA 1Q5MA 2PD9A 4KS0A 4E4PA 5I3DA 3WJWA 4KRUA 2XISA 1B3WA 2D22A 4LRSA 4UFJA 2BG5A 2C1HA 3DDMA 3O6CA 4A3UA 1EIXA 3OLIA 4FNRA 3EDDA 1R3YA 4LS2A 1OB0A 4GA8A 3RJYA 2CITA 3FKKA 4PRRA 5I24A 1MZRA 2WC3A 3RJXA 3HPXA 3ZMRA 4G1KA 2GFTA 4ZE4A 2PTWA 4I9AA 2BFGA 2OOGA 4B9ZA 2B7OA 1P0NA 1FKXA 3TUUA 3S47A 3CZEA 2GWNA 3O2LA 1HQTA 2VURA 4A8LA 5JBDA 1FH9A 4EPEC 6REQA 1TYGA 4ENLA 4AY1A 3S1XA 5FF3A 3PG8A 4YJ5A 4O0ZA 1PTGA 5DLCA 4OKDA 3VINA 1NP0A 3DI0A 3ZJ7A 3M0HA 2ZE3A 3GYEA 3VIHA 1EO7A 1XDMA 4PCFA 4DWSB 2W0UA 4JYDA 3UYIA 1US3A 2VOMA 3FVMA 1JCJA 4ZB0A 1HFBA 3D47A 4AH7A 4AAJA 1YPIA 3WK3A 2GK1A 3BARA 3ECQA 1JZ7A 1XH1A 1UWSA 2A3AA 4NI8A 3LERA 3IJ9A 3THDA 2VGIA 2Z2AA 3N11A 3VOJA 3VMPA 4WOQA 3SGUA 4CNTA 4ZODA 2ZA3A 2VUNA 1PJ9A 1AG1O 3WQ4A 5BXPA 4MNJA 4AD2A 1NFGA 1K4HA 1MWOA 4PSRA 2A7NA 3H2CA 1QVBA 3KL3A 1XCFA 3ABRA 4UTWC 1D8CA 1FX6A 3CB3A 2Z1BA 2D2JA 1M6JA 3RX2A 1VFUA 3W76A 1P0BA 4HNTA 1LP6A 2J27A 3PSWA 5JXQA 4LRTA 1YE4A 5F1VA 1CGUA 4ZQRA 3LGGA 2EKCA 3FGCB 3IAPA 3EX1A 1UWUA 4KPLA 5I00A 3QOMA 5KINA 3E2SA 1WUFA 3SQMA 4WSKA 3RK8A 4HZ6A 2WHJA 4QSHA 2PRMA 4WDXA 2B7PA 2XZ9A 2AQVA 4GXMA 3AAMA 3VKBA 3W2MA 5LYRA 3CYJA 2QYGA 1FXPA 2VX6A 3E1F1 5HBFA 2C7FA 4GZEA 4KIRA 1NWUA 3GY1A 3S1VA 1KWGA 2Z28A 4MUZA 2DP3A 4QJ3B 3AC0A 3MW7A 4TVDA 2JFEX 3FS2A 2E40A 1M68A 3SO7A 4AWUA 1J0YA 4GRSA 5HOSA 2PWFA 3LTSA 3PBGA 1AD1A 4O12A 3GXNA 1IEWA 3RPDA 2IPFA 1FOBA 1TIMA 1KTNA 5DBUA 3AZTA 2Z24A 1VF8A 3CHCA 1GQKA 4F0HA 1LM1A 3U57A 3ZXWA 2VHLA 4F0RA 2QPSA 1DVJA 3WLRA 1SMAA 3P8IA 1S46A 3W88A 1O95A 5G2HA 3PG9A 4LOCA 4N4PA 5I77A 3GLCA 1JPKA 4F79A 4YVVA 1ZB5A 3VNKA 2PLKA 3ZWSA 5K9CA 4NL1A 3VC5A 3WN6A 2RDUA 4DO6A 4XZNX 4GH1A 4LC6A 3MP5A 1V08A 3WKZA 2BZNA 2WC7A 1K8CA 1MUMA 1KGWA 1L2QA 3PZMA 1IEVA 1ICPA 8RUCA 4GOAA 2ZE0A 4LQ1A 2R94A 3Q58A 2VWTA 3NO1A 4IG2B 2BXVA 5A2AA 1JZ2A 4GI6A 4N02A 4F66A 1VFSA 3VGBA 4FOKA 4LYPA 3W2NA 4JKKA 1B57A 1TX0A 3QQWA 4F9JA 4YNGA 5A6KA 1TUFA 1EXPA 1TWWA 1JULA 3GDBA 3T44A 4B16A 1QPNA 2Y7GA 3M16A 1VENA 5I09A 2EKGA 3M07A 1XLIA 1IIHA 3HV8A 3L7RA 2DIJA 4I9JA 3UWUA 1P1MA 4L80A 4J3TA 1UR2A 8TIMA 1W3TA 4IIDA 1L2UA 4IGMA 2PDHA 3C0JA 2G41A 2ZIDA 2BOFX 4Y96A 4HYWA 3UWWA 4GZ7A 3ITXA 4DVOA 1POKA 1H1NA 4UQAA 4WRHA 1UD3A 4QTGA 1KXHA 4CU7A 1QATA 1B4KA 4YTTA 1YBQA 2OEKA 4ZQOA 2X42A 1GK8A 1R7AA 2E6DA 4Y2WA 2AMGA 2WBKA 1CECA 3EX6A 3NZPA 5DXXA 2P8BA 2CU0A 3DCPA 1J5SA 3QMRA 1F05A 4TVUA 3W0KA 3ONCA 3HPZA 1Y65A 3W83A 2GJPA 5CPMA 1VJSA 3NQGA 2GQ8A 4Q8UA 1MNZA 3D46A 3W1UA 3QHOA 4K1WA 1MQQA 1KGXA 3NO5A 3LU2A 1EJVC 3LBOA 2V38A 1X7FA 3QYSA 2YLLA 3NQMA 2QV5A 3M0XA 1Z7AA 2NXHA 5REQA 1Z3NA 5A8NA 4LBUA 2OZ0A 3S5OA 1TV2A 3G1FA 5DQPA 1GEQA 4GD0A 2TAAA 1EX5A 4QCEA 1WXZA 1RV8A 1E4MM 1MFVA 4M5PA 2OEMA 4M29A 1FHLA 1QI0A 2CCRA 4HTBA 4MNKA 1FY6A 1FH8A 3MTWA 1TPVA 5DCBA 2PC4A 3F5JA 3E0FA 5D38A 5AKQA 1SR0A 3B8UA 1N8WA 1DQWA 5GPRA 2Y0FA 3KBMA 3L4ZA 2E67A 5DN1A 4HHPA 3BGAA 2XGIA 4NJGA 3ZZ1A 2D2OA 2QUTA 3E0IA 3JZEA 2EJAA 5LGZA 4JAWA 4ZXOA 4CGTA 2C16A 1WCGA 1ITCA 3SR7A 2EEXA 3ALGA 1YPFA 1NDVA 4Q4PA 5DFAA 1FP9A 3ABOA 3MMTA 2JE8A 3WNOA 1FH7A 1A4MA 3FYYA 3RN6A 4GGBA 2E1WA 3KCOA 4G5DA 3UW6A 4RE3A 2XZ7A 1MFUA 2TODA 1DYSA 3W7JA 4V33A 2R24A 1P43A 2OOFA 3CK5A 2CZ5A 1J10A 1NSJA 1OABA 2QVHA 2X2GA 4S1FA 4GC3A 5G4HC 3UESA 4IISA 2FZ9A 3MO7A 3ZM8A 1JCXA 1U1HA 4B92A 1G4TA 3CLMA 5BOEA 5A95A 2NV9A 3AROA 4PMYA 4XAGA 3TYZA 3A4AA 1QNRA 3TZFA 1CENA 2DW7A 4W84A 3CXOA 1N7KA 2HZGA 5CPOA 1RJRA 2CIPA 3NA8A 4A3QA 4AHQA 2XYLA 2GZXA 3DG3A 3RCNA 1XF0A 4A3YA 3K4AA 3LM7A 4JEQA 1FWWA 1WZLA 4RE2A 1NARA 6PTDA 4PGLA 2HPIA 1E72M 4L61A 3B9AA 4C6QA 1B90A 3DUGA 1FHDA 2QAPA 4HK6A 1ZLPA 5BXTA 2OEJA 3T6CA 3LPOA 4I3GA 5FL0A 3MWAA 1ZU8A 4JFVA 2QAFA 3W72A 4Z2LA 4NAFB 4OOZA 4DWSC 4Y9OA 3M0MA 1UKPA 2R6OA 3W1MA 4DY1A 3VX0A 4UIOA 3W7CA 2GUBA 4IUGA 1V0KA 4G1NA 1LBFA 3AALA 4MY9A 2VFDA 4HJWA 1DOSA 3T40A 1ZZMA 2DZBA 1V6VA 1GZJA 1OZMA 1QK2A 1NVMA 3GW0A 5FESA 3NDYA 4V2XA 1FWDC 1QO2A 4RW3A 1YIXA 4HZ8A 4CCZA 4LEFA 5D05A 5DMLA 1FDYA 1A0CA 1OFAA 1UA3A 4DJFD 1XH2A 3K8MA 2NQHA 4Z0SA 4O1AA 4M6UA 4KESA 4W7VA 1TREA 2E5CA 3IJQA 4MLJA 3VCNA 3VGFA 5D9MA 4MVAA 3ZT7A 4Q7NA 4NJIA 1G94A 5FCZA 1AH0A 3SSJA 4V28A 3TFCA 3B3DA 1H61A 1WAUA 2PZNA 3ARXA 4QG9A 1GYNA 4Q8OA 4GXPA 2UY2A 3LHTA 1HJQA 3E0LA 1AW5A 2HBXA 2WMIB 1LQAA 2V2HA 1KCKA 3H2NA 4RDZA 4HNUA 3LTYA 4F8XA 4F40A 3EX4A 3RNDA 1OJXA 2NXIA 3W37A 3T2PA 4C6JA 3TH6A 1AJZA 4QITA 3PZIA 1I4NA 1A3XA 3PTKA 1EO5A 4HZMA 2FGZA 3KWSA 3NPWA 3UJSA 3KM8A 3GX9A 4KWVA 1FUYA 1S2VA 2BTMA 3EXRA 3PPCA 3UWEA 5AC5A 1M7OA 1QOQA 1W56A 3TTYA 1V3IA 3GH4A 3GO2A 4UFHA 3C2YA 5IXEA 5J5RA 2V69A 4F0MA 1BG9A 2EPOA 1HL2A 3R0KA 2VCAA 2Y88A 1GTEA 3FSTA 3KWXA 2GDUA 4FALA 4YTRA 4B5TA 1I45A 5HJXA 2O4MA 2JGYA 1IXPA 3BXWA 3OLGA 4O13A 2D1ZA 3CM4A 1EF3A 1SFTA 4C6KA 5J8LA 5F4WA 4TU1A 1DJWA 2BODX 4DBDA 1E56A 3BQ6A 3LCIA 3P5YA 3TMQA 4HMCA 1QFEA 3MCMA 2WMHA 3DHPA 1UR9A 3VKCA 3QW4B 3TKFA 1ONWA 2C6QA 5FJJA 3GFYA 3HMJG 5G5IA 4INFA 3H53A 1Q6OA 1EA9C 1DHKA 2OSXA 1NELA 1V3MA 3JU2A 2UWFA 4XD4A 1NH6A 3AMDA 3W7LA 1A5AA 4WIWA 2XTKA 1Q2SA 2VC6A 3NYZA 3LNMA 4AIEA 1KXVA 5KZEA 5LXEA 3ES7A 1UKQA 4K3ZA 4YPJA 1XLAA 1DE5A 1TA3A 3PB0A 4ZO6A 4FNTA 5KSWA 1I8JA 2X16A 1YXYA 1A5NC 2O9RA 4JTJA 1Q6GA 2R1MA 3MJYA 4LVFA 3DI1A 1MXSA 5HQEA 1J12A 3KOXA 3MB9A 1J6OA 2I17A 1DPMA 3O63A 4GNKB 3C8FA 3BV7A 3W75A 5GJNA 3VPLA 4FLSA 4B3LA 3IEBA 4NVTA 2NXGA 2GVEA 4O18A 1V5XA 4L4MA 3UFYA 2OWXA 5C9RA 4LAZA 3T4WA 2J8FA 8CGTA 5KETA 5HPCA 1HZYA 3RLHA 1HKKA 5IHRA 3CO4A 4MWAD 3DX5A 1M04A 1OFEA 4JKLA 2X1TA 2ZWYA 1LROA 4HU0A 1FWCC 3GVGA 4BY3A 1Z48A 1RY8A 3PJUA 2Q8LA 1B1YA 1EP1A 4UNIA 2J78A 2A3HA 4L6DA 3LRLA 3ERPA 1YDOA 2ZXQA 1QNPA 4KCVA 4KGJA 4UTWA 1FCVA 3B8IA 1P5BA 4L5ZA 2CZFA 4UZSA 2V30A 3QV9A 3HF3A 3OA5A 1PWMA 3LYEA 3MBDA 1XLBA 1HJUA 1VFTA 1VFOA 1W91A 2YCIX 1C91A 4W86A 4J3SA 2E0PA 5DT5A 4F2BA 5A2BA 3GYCA 1ZJBA 2ZDSA 3KP1A 4TOQA 1SW7A 3W1NA 2YPIA 1X8CA 2DT2A 3FJ4A 3H8AA 5E0KA 1KBBA 2PLMA 3EOEA 4HN8A 3A12A 2E9LA 4H6EA 3MA8A 4PFMA 4Z1AA 3A6OA 1CBGA 3AIBA 4HVXA 2FPYA 3V36A 3W1RA 1YLVA 3BLOA 3FN9A 4LEQA 3CIXA 1AQHA 4R7JA 4UCGA 1R47A 3W7RA 4LFYA 1NP2A 3I68A 1TR1A 2V82A 1BRLA 2JF7A 3EZ4A 2YXGA 1PKMA 3NZQA 1M7PA 1VIZA 2ALRA 4C5ZA 4HNVA 3U2CA 3MS8A 5I03A 3UYCA 4GCXA 4OV4A 1U5HA 4RDWA 3VGGA 1NF7A 3SRKA 4RUBA 2BY1A 2FQIA 3BOXA 2XIJA 1C92A 1KRCC 2GGGA 2VNCA 4K1GA 1J6PA 8XIAA 3F4VA 4XBKA 5E6ZA 4ZXLA 1D3GA 1J5TA 3GHUA 4G9PA 3AXMA 2PDKA 4RNHA 1BYAA 2XHYA 1FTXA 1JUBA 1TJRA 2PWEA 4JBRA 1HVXA 3ATZA 1S5WA 1RBOB 2H9AB 1XIGA 2YL6A 3CUGA 2AQWA 4GUIA 2BHUA 4IFOA 3ZVHA 3APYA 3MSGA 3CUHA 3G1SA 3RYSA 4HCDA 4R33A 1UP3A 1KA9F 3E3HA 4H6QA 2W79A 3PPFA 5XIAA 1IZCA 3NOEA 4RLIA 1HT6A 3REQA 5F1UA 4EPKA 3QW3A 5EU9A 3W6MA 5EKYA 4IPIA 3GRIA 1W8GA 2ZRUA 4K7VA 4HPJA 4J35A 2ODOA 4UZUA 4J28A 4J7RA 5D2VA 3U2EA 3P6LA 2VYOA 1R3WA 3GKFA 4PMOA 4GC4A 3SY8A 3LCWA 3DBNA 2IPGA 5U7SA 1YADA 5MF5A 3BCDA 4AZ7A 2Q09A 4FO4A 4YYCA 3MHGA 3IGXA 1GOKA 3P82A 3SRHA 4FXJA 1SO6A 4J3XA 3NR0A 5DY2A 1B5TA 1FQ0A 1OC6A 1SPQA 5CZSA 1KD0A 1V0LA 1F4HA 1OD0A 1F6KA 4GIYA 3IJLA 2WPBA 1TTJA 3ZSSA 5IFPA 4LX4A 2VFHA 1YNYA 4ZQNA 3CNYA 1IZKA 5HUOA 4LCQA 1R3RA 1TMLA 3TYCA 5C9XA 4UTJA 5CG7A 3QMTA 1XLMA 2OZ8A 3PBWA 2PWDA 4A3HA 3L68A 2CLPA 1E1CA 3CWNA 4XKYA 4JNYA 3P74A 3CUXA 4MOZA 2XVKA 3GR4A 3WLSA 1WB0A 1L6WA 5EFDA 5FIPA 4ZB2A 3CZGA 4JCLA 5G2WA 2J75A 2R1PA 3BOLA 3ZR6A 4B2DA 2FDSA 3P81A 1AW2A 2PLJA 2PWUA 3E12A 3PP7A 2WC4A 1A5KC 3XINA 1ENUA 4B90A 4XZHA 2IXVA 4HPGA 1JEZA 4KFOA 1LTDA 1S39A 2WVVB 2OXNA 3RRXA 2EPMX 2DIKA 1IR2A 2QDGA 5EPDA 5A8OA 1BXNA 3AO0A 1UH3A 1ZALA 3DH7A 4REQA 1HKJA 1G69A 3UVIA 1GOIA 1XPYA 2PU0A 5CCZA 1LYXA 3GR8A 3L4WA 4JY8A 4QDMA 4IM4A 4WDUA 3MHFA 1G5AA 4C5YA 3NEVA 1SZEA 4HMDA 4AEEA 4B4FA 1WX0A 1UC4A 4M1RA 2HPMA 1I6NA 1TMQA 1HKVA 1RR2A 4LVGA 3PZNA 1XV8A 3LI1A 4C7DA 3EX2A 1K8XA 2WSPA 4QQ3A 3PWGA 2E9MA 4X2RA 2HS8A 2VI0A 1VPYA 4QLLA 1SFLA 4D2JA 2V5LA 3AIVA 5LIWX 3WUGA 4UCFA 5U4NA 2EPLX 3MMDA 2V5JA 3ARRA 1XGZA 2BMBA 1JUEA 4DF2A 2Q01A 1GTHA 1L6GA 1Z41A 3VKAA 1CLKA 3KUMA 1J18A 1RQBA 4V27A 2HWGA 2NV1A 4L65A 5DX7A 3EOLA 3QKEA 4XZWA 2J7HA 1EEPA 1C29A 3MI2A 1PYFA 3IGSA 2J74A 3KOYA 2XFYA 4HNCA 3N1AA 4XD6A 3WO8A 2XIBA 3EOSA 2XU2A 3CQ0A 1RH9A 2GJXB 4X61A 4XO6A 3C2OA 2E28A 3E9AA 2ACSA 3I7RA 1SJAA 4FXFA 1XQLA 3WQ6A 1HJVA 3UG4A 3DFNA 4ZO8A 3MKCA 1BTMA 1VEMA 4MDOA 2PDGA 3DGBA 4YU1A 5ECUA 3G77A 4GVFA 2HE5A 2ZUMA 2CZDA 2ISSA 4NZ3A 3BAIA 1US2A 3UPMA 1ZJIA 2IKHA 1WDQA 3QC3A 3UZZA 4KRZA 3CGTA 4ZENA 1QAPA 4GZIA 3WLOA 3NQFA 3M43A 3RAOA 1V3HA 4MMWA 4OJYA 3I4EA 3DG7A 3LCLA 3LMZA 2G8ZA 3CAVA 4C7GA 1CI1A 3LCXA 4QG6A 2XWDA 4K36A 2ZXAA 1LWJA 2YIHA 5HJYA 3WEOA 3WH6A 3WBAA 4ERIA 4MF4A 2A85A 3VIKA 2XDFA 1XLKA 3VE9A 4IJRA 4BQ5A 1EBHA 4K2SA 1EJTC 3BGJA 5A8PA 5AHLA 3SCRA 3DOPA 3D3AA 1Y0EA 2VO5A 3CBWA 2RUSA 1JCNA 3QLLA 3LHZA 1L6YA 3QFWA 1NFBA 3OIHA 4IJBA 3M7WA 3UERA 5ABTA 1Q7ZA 3THUA 4K38A 4HOZA 4DWSA 1VBRA 5GJPA 1GT8A 4ZR8A 1NU5A 2DEPA 3GFZA 2QDDA 1HJSA 2V0TA 3VMNA 1R86A 1XPGA 1SJCA 2FFCA 1GJWA 4LAUA 1UHVA 5XIMA 5FEPA 4MJ4A 1W3LA 1AW1A 2PURA 2OX1A 3N12A 2J7DA 4BEUA 3BAJA 3KFTA 2TYSA 1A5CA 1B3OA 3SIZA 4FF5A 4N0RA 3DKLA 5RUBA 2YDQA 1H62A 1AMKA 1DQUA 1K70A 2ONEA 4FLOA 1MO0A 3IK2A 2CC0A 2HEJA 1GOOA 1V6TA 5AB3A 1SGJA 2IQ0A 4UTKA 4JTLA 5BRQA 4GQ0A 1DIEA 2YFOA 1PXGA 2DQWA 5XINA 1QJWA 4U2YA 3W1PA 3TU9A 1B3XA 5EBAA 1TPUA 3LEPA 5FF2A 1QBAA 3FEQA 4GI4A 2X7WA 4KEMA 3H2AA 2CKSA 2POZA 1OGGA 3JUGA 2H8ZA 1VGAA 1RHCA 4NG3A 3B8DA 4GG9A 5FJTA 3E2VA 3HJZA 2DSVA 1SUXA 3TR2A 1BWKA 2FHCA 1LT7A 4ORIA 4JOMA 3UPWA 3WCZA 5T9BG 3CAQA 3PANA 2OT0A 3PHAA 2FZ8A 3ES8A 4UOZA 3M7SA 4J2MA 2OTDA 1X1NA 3AUJA 2DDXA 2VZUA 3E5BA 3CV1A 4GFIA 3HQ1A 1M41A 4D8ZA 3GB6A 1XBVA 3K8KA 3GWQA 4DAFA 1P7TB 2HXUA 2YL9A 4ZTXA 3BDKA 3URBA 1OYAA 4LT9A 1RBLA 4TMBA 1NDWA 4O1FA 1NWRA 3MMWA 3QR0A 4EF9A 2Z0IA 3M5YA 1WKEA 3WQGA 5J04A 4GZJA 4EE9A 2OWWA 1KCZA 3RCYA 1EOMA 1EXBA 3GAYA 1GW9A 3C0QA 3OTRA 3CH9A 5LIYX 3FIGA 3WLPA 5D2WA 2DH3A 1MSSA 4DYEA 4H9UA 1AJ2A 4MJZA 4GX8A 1JXKA 2ZBTA 3KDNA 6REQB 3QMSA 3TWBA 1ZBVA 1BFNA 4CD7A 5CKSA 2VCBA 1W17A 4JTIA 3G6MA 1KLYA 1V0NA 3UD6A 3L0NA 5K9XA 2PTYA 2NVAA 1F74A 2OGYA 1RJQA 2QPUA 4CLMA 2VD8A 3E02A 1PIIA 4QNEA 2QVNA 4GQQA 2VR4A 3R43A 3FDKA 1O5RA 4IH3A 4O16A 3BW4A 1X6UA 4IG2A 3T05A 2NUWA 1R38A 5D9OA 5H2ZA 2GK1B 2Q02A 1OSEA 1RA0A 1XH0A 1IWAA 4RK8A 3AHXA 1IGSA 1XL9A 1YE6A 2VEFA 1G4PA 1FWAC 4GH3A 1LLOA 2WZEA 4F2UA 1TB3A 4AWEA 2I57A 4RZ6A 1DWGM 5JBFA 4Q4RA 3C3UA 2ZOXA 3MY9A 4N6FA 4WLCA 3VGEA 2P88A 2CERA 3P7YA 3TYDA 4L6OA 5HDRA 2Z2UA 5CBBA 4U31A 3MBFA 4CUCA 2C15A 4MPKA 3BCFA 3HJEA 5LNVA 2ZC8A 3QGKC 1E5JA 5L9FA 2QJJA 1R9YA 4PYSA 4GJ1A 4A35A 4PBFA 3W81A 1WXJA 3CPGA 1VQTA 4ZEPA 3GBDA 3U5YA 3WQ5A 4CEUC 2IPWA 4GUHA 1XYAA 1Q6FA 3IIVA 1VEOA 4M24A 2D24A 4C6PA 5BU9A 2WVSA 3GNDA 4PB3A 4XVDA 4Z2IA 2NQJA 2DY3A 2NW0A 2XN2A 1LL6A 1DBTA 2V5KA 4WEVX 5DMMA 6XIAA 3N4EA 1VS1A 3AU6A 1YDYA 4Z2JA 2B7QA 3K30A 3HIJA 4AZIA 2PDBA 3KBSA 4DB7A 1D7FA 3EA1A 2VCCA 4LV4A 3LB0A 1EPXA 4P2VA 3WLQA 2NWRA 3BW3A 5A69A 3BLKA 1CX9A 3OZOA 2VQTA 2E25A 4EX4A 1MXGA 1N8FA 2DZWA 1PPIA 3EB4A 4WXYA 5MKGB 2XSBA 4HCHA 3QV6A 2V5DA 3EXSA 2C14A 2R91A 3MHUA 4H1ZA 4E8DA 4CN6A 4PEEA 4PCNA 1UQYA 3TQKA 4LVBA 2D0FA 1CYGA 4XZ9A 4P8VA 4WJEA 1T7LA 4XB3A 3FV9A 2VDHA 3AMKA 1R87A 4KW2A 2CNCA 3HU7A 4PR4A 3H55A 3HGOA 1QPKA 4RZ4A 5F4XA 4PTXA 3UXIA 3BK0A 1FWEC 2GGHA 1SZGA 4IPNB 3THQA 3LENA 2BVYA 3EOOA 1H0GA 3BO9A 1T8QA 1Y5WA 4WD0A 4I6KA 3OGSA 1O7AA 3WDRA 3TCEA 3EYPA 2C79A 4W7UA 4BQ3A 3GG0A 1P0EA 1OX4A 4B5NA 3V5CA 3GU2A 3IS4A 3DYPA 2X30A 2X09A 3B0XA 4DJEC 3CB8A 4PMXA 4JKMA 2UY5A 3UR2A 1W1VA 1TTIA 1QU4A 3GG8A 5GNXA 1MW3A 2C19A 4H8VA 2FPVA 4L9ZA 1TO3A 1L8PA 2XVGA 1QXLA 1J8VA 2QCDA 3S9YA 1GHRA 1MW0A 2GJRA 4CNOA 2YGYA 2PTDA 2Q8ZA 4M8UA 2OELA 4PCPA 4KWSA 1OC7A 2YDAA 3B9NA 4DHGA 2Y7FA 4NNBA 3N2XA 4OWGA 4WXZA 4LW7A 2ZRYA 1T99A 1W1TA 3I7QA 2GVLA 1OCJA 5FA5A 2ICSA 2WKGA 3H4GA 3A4XA 3C5QA 5GNYA 3PR2A 4WCJA 5TF0A 2IMRA 2VQUA 5LIUX 4QFUA 1YTEA 1W37A 4CD6A 1ZGDA 3AJXA 3WLTA 2HK0A 1JF5A 3UZXA 2WJFA 3BPWA 5AYZA 3F5KA 3GUWA 1Y8BA 4IIEA 2Y4SA 4NASA 2FGBA 1BGGA 1PTDA 3KBVA 3H24A 3VKDA 1Q45A 3T8LA 3H70A 4WZHA 2G4FA 4HQVA 3GDRA 3WUBA 4Z42C 4PMUA 1UD5A 2AL2B 3A9BA 4JNZA 2R9RA 3L2MA 1YKWA 2NX3A 1JDCA 4PBEA 4WSHA 4MZ1A 3S1UA 2WNQA 2ATSA 2CBJA 4M51A 4I9MA 4Z1CA 4QG8A 3SW6A 3CV6A 1PL9A 3AMLA 4Q6XA 2BNJA 4G7EB 3DFYA 1KFEA 3ALFA 1BVWA 2PCEA 2PDJA 5A6JA 2V3EA 5PTDA 4QQUA 1ECEA 2PDFA 4KCTA 4E4UA 3D5HA 2CBIA 2VGFA 4WF7A 3MUAA 2BY2A 3BG5A 4XZBA 3EWWA 3IIZA 3WL0A 4EKJA 4FA3A 3NSXA 4GBUA 3K1DA 1GOMA 3G8EA 3AIRA 3MC5A 1W3NA 1TPFA 3BJFA 4NF7A 4GWEA 4A2RA 1E6NA 1XD1A 5HAOA 1TV7A 5EFFA 1KB3A 3OQ8A 4GFSA 3N19B 3WQDA 4F0KA 3NOYA 2V6AA 4ZZ9A 3WLKX 3ICJA 4CEXC 4L7ZA 1HP4A 4JIIX 3OIXA 4Z17A 1B4EA 2A3EA 3L4VA 4CVWA 4HU3A 5LIKX 3URQA 3UGRA 4BFAA 2F6XA 4LCSA 3H6OA 1EA0A 4JTQA 3M1ZA 1TIWA 2E7FA 2G37A 2OWCA 2B81A 3SEPA 4HBKA 1GG0A 4CKQA 4AFYA 1EHNA 1ODUA 4H9ZA 2P5NA 3KHJA 2CFFA 1XLHA 3NL2A 4Q8PA 2QIIA 4QJ4B 4JFWA 4ZO7A 4Q4QA 3STEA 3FJ6A 2NX1A 4JTCA 4RDYA 3VU2A 2NQ5A 4PRWA 3GNRA 4A2SA 4JIHA 4QE5A 1WKYA 3RLUA 3IIXA 3NUKA 3GC4A 2BY3A 4FX8A 4BZYA 4IP7A 4RXFA 2GYIA 1UR1A 4MZ8A 3W74A 3JW7A 1NQKA 2F6UA 3RILA 3QV7A 2YYUA 2ZZ3A 4P8XA 1MI3A 2REQA 3FAXA 1ONRA 5E93A 5TIMA 3U8GA 3RM9A 1BF6A 5DMNA 3QOKA 4LBRA 3AYSA 3M0VA 4OTKA 2WZTA 2DSUA 5AYIA 5AHMA 1GGOA 2WCGA 4RXGA 1PS9A 1Q6QA 1I1WA 1XLGA 3CZLA 3D6NA 3MDWA 3EX3A 3XIMA 3W7QA 1RLCL 4XTDA 4LALA 1XWYA 2JQXA 4NU7A 4ACZB 1ISVA 3AZRA 1PSCA 2GQ3A 4F9DA 4FX7A 3ARQA 1X1ZA 3N4AA 4HPHA 2WCSA 3G24A 4OBTA 3C2FA 3EB2A 4PTNA 4HPNA 5D9NA 1E43A 2XIIA 4CD5A 2HROA 3T4CA 1Q6DA 1JDAA 3EA3A 3QTGA 1RALA 2D2HA 3W7NA 3W7PA 1EWEA 3WFLA 4WY0B 3BLIA 5TQLA 4ZMGA 4L4OA 3EWUA 3I10A 2EXOA 2GGIA 3EDFA 2CZEA 3LLDA 1M65A 2JKPA 4LU0A 3SCVA 2A2IA 2J88A 2PU1A 3BMWA 4JICA 2AQOA 4KH2A 3I3BA 2PDYA 2FKPA 3GXIA 1BWVA 1BF2A 1KRAC 5CAKA 2ZX5A 2NWSA 1OF8A 2EPKX 3VO0A 3CUJA 1E6QM 3GK0A 2HNHA 3CH0A 3UJEA 3N2BA 3VK5A 2P50A 4MYXA 1TR9A 5FF0A 1TWIA 3UG8A 2Y63A 3TK7A 1OADA 3GTNA 1JVNA 3ZQ9A 4TX6A 1UQZA 1A50A 1SZNA 4MFEA 3I3DA 4AMCA 2JEQA 4JYEA 2PDLA 4JTRA 2P3ZA 4GX9A 3U3HA 5LIXX 1WKDA 5ABGA 4HA4A 5A6SA 3TW7A 4CQ8A 4RJEA 2VEGA 4JY9A 5DMYA 4NJKA 4PMVA 1OBAA 1F3TA 2V81A 1ONXA 4M82A 1H1YA 3W7EA 5D2YA 3MQTA 2WKLA 3WNLA 2WHKA 4FIQA 4HA3A 3P8JA 3F4NA 1XW8A 3DESA 5CSRA 4CNNA 4H41A 1C93A 1MMFA 1XGDA 3EWYA 2E6FA 4HHHA 4TV6A 3LCHA 1MDRA 7PTDA 1W2VA 4Q8TA 2PLCA 3GZAA 4GMEA 3DN5A 2J8TA 3UXLA 3H23A 4KF1A 2TSYA 1ZFJA 2V67A 5JUVA 4WOZA 4E3TA 2PEVA 1W6TA 1E1FA 4IPLA 4B3ZA 4HMEA 2A3CA 1GPWA 3PZ9A 3WJXA 2RGLA 3IWPA 5LNSA 1ZENA 2F9RA 4P7RA 1RLDA 4EVZA 3R8HA 4UTUA 1E9ZB 3ARUA 2X41A 4AD1A 5I79A 4H6KA 1VFMA 3HO8A 3KCJA 5T9CE 1RCQA 1QR7A 4GVGA 4Q22A 3NL3A 2DUXA 4BK9A 4PODA 3C61A 1WDSA 2WZHA 4JIQA 1B54A 3L9CA 1QHZA 3NQBA 1TJPA 2DJXA 2J8GA 2PDNA 1TE6A 2YW4A 2ZC1A 2H9AA 1E1EA 2NX9A 2A79A 2E6AA 1GOQA 5DRCA 2JEPA 4F4RA 4NJJA 3MMUA 4MADA 4UTLA 4DI8A 3TDFA 1GVEA 1GOXA 4B3KA 5D09A 4D6IA 3IRDA 1BTCA 3ARTA 3FFSA 4O10A 4BF9A 2NUYA 5CPNA 2GVJA 4S38A 1TA3B 4AWTA 5TBOA 1FFRA 3RMEA 1XLFA 1QPQA 4DUVA 1J93A 3RDKA 1KKOA 4B15A 4UXDA 3T8QA 3QZ6A 3NIYA 3GM8A 5JVLA 2P53A 3VGDA 1GVIA 3P14A 1KRMA 1MVYA 9XIMA 4WR3A 2X1IA 4IMFA 3VC6A 5AZ0A 3W82A 4TV5A 2ZX9A 2CXGA 1C3FA 4N9DA 3QR1A 3R7MA 1OD8A 3A3HA 2O9OA 3TP4A 3I65A 4OZOA 4AIOA 2BVDA 4MB3A 4O4VA 2VVNA 3B8WA 3VDHA 3WDIA 1ESWA 1KFLA 3TW9A 3THAA 2UBPC 1D2KA 2G3NA 3L4YA 3URNA 2Q6ZA 3S2MA 3BW2A 5AC6A 2J24A 1IT8A 2YB4A 3VMOA 2OT1A 3CQHA 3B9OA 3CTLA 4WUIA 4AZ5A 3W1TA 3AICA 1E0UA 1H7NA 4C60A 2YL5A 3KZSA 1O5QA 1OFPA 4IL2A 1ALDA 2QUUA 2ZUNA 4JQAA 1UASA 1Q7MA 1S2AA 2EHHA 1JZ4A 1DHPA 4F48A 9RUBA 1OFRA 1E71M 3SURA 1QWGA 3N18A 4PUWA 4H19A 4ZOAA 1XD0A 1CGYA 2ACQA 1ODZA 3UCDA 4GY0A 1UWTA 1FDZA 4FNPA 4JQ1A 2DZAA 3R13A 4LTSA 4R9OA 3W01A 3MV01 2FZDA 4PL1A 2C3ZA 3UVAA 3VNYA 1JYNA 1DIKA 3GTFA 2WVVA 3SI9A 1Q6CA 4AUBA 1WP6A 1DJNA 2FZNA 5H6HA 3Q2DA 1KR1A 1UIPA 2QMJA 2HCVA 4W89A 4XAPA 1UPMB 3LCGA 1UZHA 5CPQA 4QLKA 1VCGA 3B9DA 3O05A 3VTRA 4CNPA 5EGRA 3OG2A 1ME8A 3IV8A 2OODA 2VUYA 3A24A 3O6DA 3EKZA 1ONEA 3DYOA 4JZ5A 1ZP4A 1XXXA 5EMYA 4DJDD 1UUQA 2QULA 3TC6A 4M3PA 1H7PA 5BOOA 4D6EA 3TSBA 3KZPA 3GDMA 1VB9A 3BV4A 2WJEA 5C6MA 4NRSA 3PWAA 5EMKA 4UTIA 3CAKA 3G0UA 1UR0A 3LBCA 3TOYA 4DJEA 1DQXA 1EHAA 4AZ6A 3AWOA 4J2PA 5LA2A 4DBSA 4AD3A 3VM7A 4JTUA 3NFUA 3M5ZA 4DLFA 1TJ0A 3FXYA 1GORA 1GPFA 1NJJA 4B5UA 2FGLA 2OFJA 1WNOA 2ZZ2A 3WLIA 4UFLA 3GG1A 5D37A 3VD9A