1XBZA

Crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound l-xylulose 5-phosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
213
structure length
210
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIDLTGYWTWEQAQQWRDAGIGQVVYHRSVDAQVAWGEADITAIKRLSDMGFKVTVAGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activities in the orotidine 5'-monophosphate decarboxylase suprafamily: structural basis for catalytic promiscuity in wild-type and designed mutants of 3-keto-L-gulonate 6-phosphate decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
total genus 82
structure length 210
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xbzA00
2NLIA 3DFTA 4NXKA 3SW6A 5LGXA 2VC6A 3R13A 1K02A 1QCWA 3NZRA 3TV8A 2V30A 3LHYA 5I3FA 4U4MA 1JCYA 3BLFA 5H91A 1PCWA 1DKWA 5FEPA 3OVQA 2A4AA 5AHEA 3M16A 3LHVA 3G1AA 3OHIA 1L6WA 4OV9A 5HMSA 4FXRA 4MOZA 4BI6A 5HR7A 4DBDA 2DP3A 2YYUA 5EMUA 4LRTA 4FNQA 2OT0A 1W5PA 1R46A 3NQVA 3UD6A 3OIXA 3CIXA 4IJBA 4BI7A 3G1XA 1WDWA 2DZSA 5DY3A 3SY5A 5FEWA 1EPXA 4CNPA 4P2VA 1OFRA 3QSRA 1S5WA 4OQVA 2YX0A 1A5CA 1OG0A 1D9EA 1G7VA 1YLVA 5A5WA 3HG4A 2E1DA 1TJPA 3NQCA 5AHMA 2ZCGA 4FIQA 3F03K 4EIVA 3W1UA 1S5VA 3QZEA 2RKXA 1J2WA 1L9WA 3MHFA 3UY8A 3UWYA 1I8JA 1JRCA 3DI0A 3CT7A 2X1RA 4Y96A 1GG1A 1JCLA 3G1SA 4KWWA 4NX0A 4POCA 1XXXA 3LXAA 3KRUA 4JR5A 3CWNA 3PC0A 2I9EA 4E2BA 5G4WA 3HQ1A 1EX5A 3IRDA 4AMAA 3NPXA 4DF2A 1H62A 3GYEA 1D3GA 3EX4A 5HJLA 1QOQA 1WX0A 1TPH1 4JIPA 2GQ8A 3L5LA 3TMQA 5C55A 4NNBA 1LBFA 1OVDA 2GQ9A 2V8ZA 4IMCA 1JUBA 2ZA1A 3LV6A 1GG0A 3IVTA 2XN2A 3L66A 1OHLA 4TR9A 3ZR4A 2BXVA 3TFXA 1HO4A 3W76A 1A50A 5D2VA 4XBSA 2VKZG 4MVAA 4ICNA 2OMAA 4MJMA 1SZGA 2DZPA 4GNJA 4L4MA 1LROA 2ZTKA 3N3MA 4MPQA 3G3DA 3LV5A 3MHGA 4GC4A 3W22A 1F73A 4A2RA 1HO1A 3I7QA 1TV8A 2NX3A 2RDTA 5CPNA 2QAPA 4MZ1A 3O15A 2FPTA 3E0IA 2VFIA 3W83A 2ZZ2A 3MP3A 4O1DA 4EF8A 4XTIA 1JCMP 5BMXA 1SFJA 4DBEA 3QYQA 4DF0A 4K8HA 3Q94A 1HFBA 2FB2A 3IIPA 1OFEA 1BEUA 1KFLA 1KM5A 3W1QA 3DKLA 3OEXA 2YZRA 1SR9A 2E68A 2A6NA 1WBHA 1QDSA 3W2KA 4M5PA 3SGZA 1B4EA 3DFQA 3LCXA 2Y85A 1BKSA 3LDVA 2QDHA 2X2GA 3TQVA 3KX6A 3B0UX 1TMHA 3T40A 2JBMA 2B0MA 1DJNA 4JICA 3P61A 1YTEA 2TPSA 1I2NA 3R89A 2W6RA 3W7GA 2QR6A 5D2XA 4LT9A 5AHFA 1H50A 1I2QA 2B4GA 4RXGA 3EB2A 1QR7A 1P4CA 5EKYA 3LXCA 3G8RA 1RVGA 1VJIA 2P1FA 3CWOX 4LVGA 4U28A 3FLUA 4DPPA 3T44A 4J9JA 5D2WA 2QUTA 2E77A 3TC6A 3BW3A 3DZ1A 2E5BA 3EWWA 3IV3A 5IBXA 1SO4A 4LRSA 4CQAA 1K8ZA 4RZ5A 4LS1A 3PAJA 3RLVA 3P80A 3B0VC 4O50A 1TPUA 4XUGA 4Y9AA 1TPC1 3O8AA 1K3UA 4CQ8A 4IGHA 3GVGA 4PODA 2B7PA 3KAOA 1FBAA 1KLYA 3HG5A 3FA5A 2ISVA 3W3OA 4MJZA 4ZMGA 3SR7A 5DXXA 2FIQA 1U83A 3W75A 4LOCA 5EY5A 3GNNA 2NZLA 1GYNA 3W85A 1PE1A 4NX5A 3LM7A 1KFEA 3GIYA 4X2RA 3TH6A 3E12A 5C2XA 1VHCA 1LLWA 2C16A 2BLEA 2NX1A 3C2FA 3STFA 3NQ7A 3PBYA 5CZTA 3MP4A 2FDSA 5CGQA 4JX5A 3VCRA 1XBVA 2H90A 4Y90A 3TCEA 3I7RA 1UCWA 4LVFA 3JR2A 2VEMA 3JS3A 2AGKA 4Z08A 3I68A 3ABQA 3MP5A 5F4WA 2J9XA 1W5NA 1GVQA 4O0ZA 2XN0A 2D73A 4E38A 1D3HA 4K7YA 3IGXA 1VZWA 5G2HA 3SZ8A 2ZBTA 4TO8A 1K8YA 2C0AA 3G1DA 4O53A 1N7KA 3MWAA 3I6RA 2YCEA 3NQMA 2VENA 4A29A 2X16A 3GB6A 2NUYA 3P5YA 3G1FA 4OGZA 1YXDA 3FFSA 4Q32A 1QFEA 1ZAJA 2ATSA 5KSWA 1M6JA 2J88A 4Q33A 1A5SA 4UMAA 2DZWA 3W2MA 1BTMA 4GUIA 6TIMA 1TJRA 3MYPA 2Q8ZA 2J9YA 3PF3A 4KFOA 3M0ZA 4MUZA 3BK0A 2Z1BA 3LCLA 2G95A 1QNVA 4DEFA 1RPXA 2LLEA 4O19A 5E93A 3U2OA 2FPYA 2CFFA 3DU0A 5LHEA 5IBXC 4WUIA 4NJIA 1TTQA 4FX6M 5CPOA 3TQKA 4BK9A 1GTEA 3LCFA 3HGRA 3I7SA 4MZYA 3KVMA 2H3DA 3M5VA 4XKYB 2PCQA 1VRDA 2NX9A 3NG3A 4KFPA 1G6CA 1JUEA 1RZMA 1ZALA 4CNOA 2QCGA 3CB8A 5LNVA 1OYCA 3DI1A 1LOQA 2JK2A 3PBVA 1QWGA 3FS2A 4WY0A 3P7YA 1ZHAA 4MFDA 5KITA 2YGYA 3OBKA 4CCCA 2W79A 4CQ9A 4O10A 4ZVJA 1GEQA 4N02A 4WXYA 3W88A 3EX1A 3G0SA 4LY8A 1E51A 3LI0A 5F2MA 4MLJA 4DELA 4LUIA 1HTIA 3LBCA 3NQGA 1WQ5A 2JKEA 2ZZ4A 2C3ZA 5FF3A 3DAQA 3GXPA 3MI6A 3W74A 5HWNA 1VCVA 1OFBA 4QQ3A 5HQEA 4AWTA 2B7QA 4EF9A 1SSDA 4GWEA 4RZ6A 3QMTA 1H7OA 2A7NA 3EX6A 1IGSA 4LWWA 4UTMA 4HT3A 1H60A 3M5ZA 4OT7A 5CKSA 2CU0A 4O14A 3CQ0A 2YW4A 1Z41A 3W1XA 4MFEA 1UB3A 2GJLA 1KA9F 1MEWA 4GUHA 4ORIA 3S1XA 1C8VA 1XFBA 4FF7A 4YCOA 4RXFA 2O7SA 1OK4A 4BR1A 1TTPA 4A21A 3ABSA 1V5XA 5AOUA 2NUXA 3DFSA 4JYFA 1F5ZA 1F05A 4O18A 2ZQ0A 3C2VA 3QW4B 4O52A 5F1UA 4UTIA 4K37A 4N9CA 3PB0A 2HSAA 4UCGA 5AC8A 5LNRA 3TAKA 3BVJA 4IX2A 2DORA 4JY8A 5D33A 3BW2A 4C1KA 2VFGA 5KZEA 3W7EA 5CZ0A 2FPVA 3M41A 1O95A 4B5NA 1VPXA 3KXQA 4WX2A 4ZQPA 3W1MA 4N4QA 3ATYA 3W7MA 3KVJA 5J5DA 2WSYA 4QITA 1OYBA 1GVFA 4H4IA 4WQ6A 1O60A 4RK8A 1UUOA 3U8GA 2YFOA 4RX0A 3TXZA 5K9DA 3OG3A 1FX6A 4HPJA 4A3UA 4IXXA 1CI1A 2Z0IA 3GXNA 1G4PA 1VR6A 3LBMA 4I9AA 1L2UA 3TSMA 1THFD 2Y62A 1IXPA 1P1XA 3TU9A 2A6LA 2PRLA 5I3HA 4H6KA 2C13A 3QMSA 4LVDA 4IMDA 4JN6A 3LRMA 2V5BA 2G5WA 4PA8A 2GQAA 1KLZA 3CU2A 3EWZA 1KTBA 2A5HA 1TB3A 3DFPA 3ZWTA 3TC7A 4DF1A 3W70A 4JNMA 2TMDA 3MJYA 2CZDA 3CTLA 1R30A 1JR1A 2Y7FA 4N6FA 1KV5A 1JJKA 1DHPA 2ABBA 3L65A 2FFCA 3W1LA 2V81A 3C6CA 4DQWA 4QM1A 5D30A 3DGRA 3STEA 3QW3A 5FF0A 5F2GA 4ADSA 1OX5A 3GXTA 5SWUA 4K38A 4MKNA 2X1UA 2W0UA 3SECA 3P62A 2PC4A 3A24A 5EBUA 3F4WA 2Z2UA 2CLEA 4OBTA 1DQWA 4FNRA 2F84A 1XL9A 5D38A 1FCVA 4A22A 3S9YA 4IMFA 2YSWA 1G4EA 1R2RA 3M9YA 4N2YA 1X8FA 3TMLA 3UZ5A 3LOTA 3Q58A 4ONVA 1EUNA 1YDVA 4E2DA 1LZOA 1EP3A 5FF7A 5KTLA 3P5ZA 2ZZ7A 5BW6A 5DCDA 2VFFA 2A1YA 4WXZA 3LGEA 2BWGA 2RFGA 1HL2A 3M6YA 1O94A 1JRBA 4LUJA 1H7XA 1LRTA 3PSVA 5I3KA 3CM4A 4MYXA 4UTHA 3W2LA 3EEGA 5LKYA 2VELA 2YDAA 1OF6A 4ADUA 2E5CA 1FDJA 4GE8A 1P5BA 3W7QA 1JUKA 4RKAA 2C14A 1DQXA 1CW2A 2BX7A 3EKLA 1U5JA 1W5QA 2Y89A 3H53A 4JTEA 1DVJA 1I2PA 2E5DA 3KRZA 3P8IA 4OU1A 2EPHA 1KW1A 4O16A 2CLHA 3QFEA 1EA0A 2B7NA 3RMJA 5D32A 1SUXA 3W2NA 4FEZA 4MY9A 3NL2A 3QC3A 3LLFA 1B4KA 1GQNA 3PR2A 1S5TA 3W1PA 3W9ZA 5AYXA 4C1LA 4JYDA 1NSJA 1ME9A 3M5YA 3P8JA 4WY0B 5I3IA 1I4NA 2VEIA 1F2JA 5FESA 1TPFA 4BFAA 2V5LA 4LVBA 4NJGA 3NL5A 3S1UA 3FIGA 2OT1A 3GK0A 1A5AA 1FWRA 1GVSA 2I1OA 4XWUA 3UQNA 2ZRYA 4Z0SA 3WK3A 1K03A 4UTKA 1MZHA 1TPWA 8TIMA 4LC6A 3MMTA 3E02A 4UFLA 2ISSA 2ISWA 1Z48A 3A9IA 5CSRA 1F6PA 1RQBA 1ZCOA 3HG3A 3HPZA 2Y7GA 4UR7A 3MI2A 4FB7A 1XUZA 2QCMA 3O06A 4UC5A 3W1AA 2NXHA 1Q6OA 4O17A 1VHNA 3GDRA 3NQAA 1RR2A 3UYCA 1EWEA 5C54A 1SZEA 3GDLA 1PVNA 1YXCA 4O1AA 3PWAA 4UXDA 5BNKA 3LHUA 3SIZA 3NM3A 3TUUA 4ZQNA 2E6YA 2DJXA 3DH7A 5F4XA 3G22A 4TX9A 3LCGA 4OHQA 3W7LA 3W1NA 2TRSA 1OFAA 1BWKA 3WJSA 3RF9A 1PHQA 2QUUA 4OV4A 2V9DA 2Y70A 4PC8A 3LCWA 2A7PA 1WV2A 3NM1A 1ZY9A 3PBWA 5G1YA 1ZJIA 3TE9A 2ZZ6A 5BRBA 4IWWA 4JY9A 2WSQA 2EAWA 1FCQA 1Q6RA 4CCDA 3C52A 3UWQA 3PUEA 4CLMA 4BI5A 2NWSA 3IGSA 2FLIA 1QO5A 1EP1A 1AK5A 2H8XA 1K7XA 4IPIA 2NXGA 3L0KA 2DU2A 4BF9A 2DZVA 3GDKA 3P82A 1SO3A 4JTUA 3SJ3A 3EWBX 2E6FA 2GJNA 5HINA 1QPQA 3MUXA 4IUOA 3G24A 1TRDA 2E6DA 3BO9A 3O6DA 2H8ZA 2R94A 1KM6A 3G8EA 1K8XA 1CX9A 1UUMA 4JTKA 4X9SA 3TSDA 4ZZ9A 3F1QA 4WOQA 2CLMA 1XKYA 4AWSA 4UR8A 3QF0A 3BLEA 3GX9A 3LHWA 4WJEA 3LRLA 2AAMA 4TMBA 1Q45A 1J5TA 5DXYA 3GZ3A 3LTSA 4AWUA 4YWIA 3B8DA 3LRKA 3C3NA 4S1FA 1LRNA 4AHOA 3FYOA 3GNDA 4O11A 5DN1A 2OZ0A 4N9EA 3GAYA 3EX2A 2GPTA 4JYEA 3NO5A 1G7UA 4TU1A 5LNUA 4YXGA 4UTLA 2NV2A 2EF9A 3M7WA 3LCHA 3CPRA 5F1VA 4FNTA 4BWLC 5AFDA 3W7CA 3CEUA 3EXRA 4X22A 4AXKA 4M6PA 3G1YA 3PVFA 5TQLA 4K7VA 4PH6A 1ICQA 3T4CA 1H7NA 3N2XA 4JTTA 1PIIA 2GVGA 3L9CA 3UWZA 3HB9A 3UPBA 3VE7A 2QJHA 1TQXA 2JGYA 4JTGA 4GXMA 3ATZA 1ZNNA 1IIGA 3S5OA 1PCKA 1BWLA 3S5NA 5G2WA 4JTLA 4JTJA 4D2JA 4P61A 4N9DA 5HWJA 3NR0A 4JS3A 3NQ6A 1M7OA 3FKRA 1EUAA 3W2UA 2RDUA 1SZFA 3GAKA 4LV9A 1B57A 1NF7A 4UFIA 4PL2A 3NNTA 3EXSA 4AH7A 3ZFHA 1XC4A 3QQ0A 4Z0JA 1L6YA 3NL3A 1OFQA 1QPOA 1KV8A 3GKAA 5EPDA 1SSGA 3N9RA 2OCZA 4LS2A 3HPSA 4G1KA 5EA9A 1RD5A 3B03A 1ZAIA 3HO8A 5BOOA 1W5OA 3L0GA 3W86A 4DXVA 1H7PA 2C1HA 1MEIA 3UZJA 3W7OA 3MBDA 1KFCA 4NJKA 1W54A 2Z6IA 2EKCA 1F74A 4FO4A 2CWNA 4AHQA 5D09A 3NA8A 2V2DA 1TV5A 1OJXA 1J4EA 5I3GA 1G69A 4UFHA 1GPWA 3NAVA 5DBUA 4GJ1A 4O4WA 3WJZA 4O15A 4DO6A 3O6CA 4GUJA 4I7UA 3USBA 4LNYA 3MO7A 3IIOA 5F4SA 3UY7A 4PCFA 4S2BA 1KBIA 3RK8A 2KZHA 3BG5A 3ABRA 4UFKA 1NVMA 3BW4A 5FF4A 4O13A 3G18A 5D03A 3R5EA 3C2RA 2WNZA 3N9SA 2QKFA 4I7WA 3PB2A 4FHAA 2X1SA 1WAUA 1XCFA 1AMKA 3TW7A 4EVZA 1ZFJA 1FQ0A 4HHPA 4NZJA 1F76A 1WXJA 4IQLA 1SW7A 3ZS4A 1TRIA 2QCCA 1VYSX 2FB3A 3EWXA 3K30A 1SO6A 4GBUA 4H3DA 2Y61A 1TPDA 2ZRZA 3PG9A 2WNQA 1R2SA 2WNNA 4LC8A 3QSTA 4MIMA 1W37A 3P60A 1NF0A 5DLCA 4W9TA 2VOMA 3NOEA 1MXSA 2OX1A 1LM1A 1RQHA 2ZRXA 3L68A 3ANYA 4JTFA 1DBTA 3INPA 2AQWA 1ME8A 4M6VA 3IIXA 2FJKA 5G2IA 3WK0A 3GR8A 1LTDA 3A22A 4O4VA 1EIXA 4PFMA 2YYTA 3B06A 3UWVA 4UUIA 2ZRVA 3QQ1A 5DELA 3TAOA 3M1ZA 2DZUA 3G3MA 6ALDA 4O1BA 2J6XA 1KFKA 3MI3A 3QH2A 2ZZ1A 4RV8A 3BARA 5CZSA 2A7RA 4JTHA 5U7SA 3GDMA 1WA3A 4JTSA 4WD0A 5AN7A 4EOUA 1M7PA 2CZFA 1GTHA 1JVNA 1M5WA 1V7YA 5I3JA 1JCNA 5AHNA 3QPZA 5CG7A 2ZDRA 4Y8FA 4NNCA 2CLOA 3FKKA 2ATMA 4Q4KA 3S42A 2QJGA 1F6KA 5J5RA 3DHDA 4HSNA 1TQJA 1H7RA 1LP6A 2EHHA 1OABA 3UXDA 3MYOA 1QAPA 3W7HA 3O1NA 3H54A 3P67A 3TR2A 2Q3RA 1YXYA 1NAL1 3UNDA 4ZL1A 2VFHA 3H55A 4RLIA 2ABAA 1TTIA 4HSOA 1LRQA 4DPQA 3FJ6A 4FXSA 3GR7A 4PL1A 2J24A 3SFKA 5G5IA 4JIQA 1OX4A 3VI2A 4ZQOA 1ICPA 4RZ4A 1QPNA 3W2JA 4IPJA 3C61A 1WBJA 4TIMA 1ADOA 3LI1A 1SW3A 3LTPA 5FEXA 5HNRA 4A2SA 4HNTA 4R7JA 5T26A 3PBUA 4XBKA 5DY2A 4JEQA 3E49A 2Y63A 4YL2A 4O1CA 2V2CA 1YTKA 2FTPA 4MY8A 2TSYA 1TPVA 3R8RA 2ZFAA 1TREA 3L21A 4N6EA 3W7DA 4NVTA 3PUOA 4GFSA 3PSWA 3S6DA 5IM51 3NZ1A 4K8EA 1XBZA 2GVJA 4UTJA 3TROA 2V82A 2NXIA 1H51A 4FNUA 4HNUA 2ZZ3A 2UV8G 2CLFA 4K39A 3UWWA 3NQEA 5DCBA 3HF3A 1VGAA 1YTDA 2YPIA 3M43A 4UFJA 3TDFA 4TMCA 1R2TA 1SO5A 2QUVA 1AG1O 1FWWA 3C56A 1MO0A 1DORA 2H3BA 5HULA 4HNNA 3B04A 1FY6A 4O0KA 4M19A 3PM6A 1ALDA 1AL8A 1W8SA 1KM3A 4NJHA 1VCGA 1VCFA 3GLCA 1WOBA 3C0JA 1XDLA 2HTMA 4IX0A 4JD4A 4MZ8A 2E09A 2NV1A 3Q37A 1XDMA 3MW7A 1SFLA 2Y88A 4E0CA 3T7VA 2OJPA 2R14A 3AO0A 5EL1A 1H1YA 1AW5A 1OF8A 3W23A 3VE9A 4KFNA 5GVJA 2NWRA 3BLIA 1VH7A 1KM0A 4JX6A 1LDCA 1Z44A 2JGQA 4UNLA 1H7WA 5HUOA 2HMCA 3KFTA 3GDTA 3DFOA 5KZMA 1X1OA 3CIWA 3LCIA 1AW2A 1T96A 4XKYA 1S3HA 1KM2A 1O5XA 2C15A 1TPB1 4Z1DA 3KRSA 3VNDA 3PULA 1C9DA 2WQPA 4FNSA 3N73A 2QCDA 1I2RA 1YDOA 5D37A 1I2OA 1RV8A 3TJLA 2ALDA 1QOPA 1H63A 5DBTA 4QISA 1IF2A 1RQEA 3BG9A 1KM1A 3STGA 1SQ7A 1LBLA 5KZDA 3NL6A 1YADA 2PURA 1LBMA 2Z6JA 2A0NA 1IIHA 5C6MA 2V0TA 4OWGA 1TPEA 4UTWA 2WJZA 3QEZA 4R53A 1XBYA 1KM4A 4Y6GA 1AW1A 3STCA 2GUUA 5E0KA 4ADTA 4AF0A 3AJXA 3LTYA 1TYGA 2X30A 4UMBA 4O28A 3A21A 3THAA 3W72A 3W7IA 3DHFA 1YYAA 2CLKA 3M44A 1T8XA 1W3TA 2YXGA 3RNDA 4NQ1A 3GKFA 3W7RA 1P0NA 5CZJA 4WY0F 4ZQRA 2JKPA 1C29A 1JCXA 3SI9A 3O05A 4ZQMA 3HG2A 4BWLA 3CLMA 3IVSA 5CPMA 4M7TA 5FI8A 3UWUA 3S1VA 3TW6A 3NXFA 4K36A 5HR6A 3NGJA 3BGGA 1FWNA 5LGZA 5K9XA 3HGSA 5D02A 2QCDB 4HNVA 3OA3A 4AEOA 3DXIA 3KOFA 4HPXA 3N14A 3P84A 3EKZA 3A23A 3C2EA 2QAFA 5AHLA 4UTWC 1FXPA 3DBPA 4DO4A 3N34A 2CZEA 2QDGA 3QJAA 4LU0A 3RLUA 1VS1A 4UTTC 1FDZA 3NQ2A 4NNAA 3M5XA 3G1HA 2R8WA 3NEVA 3LB0A 1OFPA 2VEKA 1XUUA 1KFBA 3JRKA 1PV8A 3DENA 1TO3A 2QCEA 5BMWA 3W87A 2JKAA 3L5AA 4O8RA 2EGZA 4AAJA 3E9AA 4NJJA 1Q6QA 2QCFA 4CNNA 1ZENA 4O12A 1K7FA 1OYAA 4Z1CA 5LNWA 5CSSA 1Q6LA 1PHWA 2P10A 4UTUA 3HOJA 4R33A 2RDWA 1FDYA 3G0XA 1LCOA 5AYZA 3YPIA 3W7NA 2WOQA 5L6UA 2IQTA 2R91A 5K7JA 1T99A 3IGUA 4XQ6A 1B9BA 4HKPA 3Q2DA 1Q3NA 4L4LA 5H2ZA 3NPVA 1GT8A 3PY2A 4IXHA 2CLIA 4NUWA 3P74A 3LLDA 2TYSA 2ZTJA 3IIZA 3RU6A 3P81A 4FX7A 2J27A 4HIBA 3NPWA 2B7OA 3FYPA 3TKFA 3L2IA 1QMLA 4FX8A 4JX4A 1YDNA 3IIVA 2QCNA 3EWYA 2WSRA 3NQDA 4JDYA 4QSHA 1O5KA 3A5FA 3EXTA 3W7KA 4O54A 3TNOA 1Y0EA 3SGUA 4YLWA 3S0CA 1YPIA 3LERA 1GVOA 3LXBA 4JXCA 4IMEA 1ZAHA 2G97A 4KKXA 4M7SA 1UJPA 5KINA 2Y7DA 2NUWA 5TBOA 3CC1A 1XM3A 4JDBA 4UFMA 5AB3A 4AB4A 3TQ0A 3QRHA 5D2TA 4X3ZA 3W7PA 1HUVA 3NVTA 4JGDA 5K2ZA 4XTDA 2BSLA 2P0OA 3HBLA 3N19B 4WZHA 2J9ZA 1ONRA 2X1TA 2ZZ5A 1LOSA 2BTMA 1L6SA 5MHBA 3TA6A 3HMJG 1X7FA 1VYPX 1DOSA 1H61A 4LTSA 1W3IA 4QNEA 4S2CA 3W6YA 1NEYA 2QJIA 3MHUA 5AC6A 1XI3A 1OFDA 1IXQA 4ZQCA 2HS6A 1TCDA 3LX9A 3W7JA 4IOTA 4AHPA 5K9CA 2PE4A 2A85A 1OK6A 5FF2A 1VLIA 3PS7A 1PS9A 2GOUA 3ZWSA 1SPQA 3S1WA 1DL3A 1PL9A 1EEPA 5K4ZA 1VLWA 2A21A 4UIOA 5TIMA 3W1RA 4K6AA 4DO5A 1X6UA 3R2GA 1R47A 1GVRA 1H5YA 3WJXA 3NQ8A 4NU7A 4QIUA 1LOLA 1KFJA 4KWVA 4AVFA 4Z1AA 2GVLA 2ZA2A 1YPFA 4R34A 1I45A 2E6AA 5ABTA 1K7EA 3LHZA 5C5YA 2V2HA 5F2LA 5FEZA 3TK7A 4MYAA 3CEPA 1LYXA 1GZGA 5HUPA 2C18A 1GJPA 2XN1A 3C4UA 1G4SA 2A2IA 4ML9A 1F7BA 3KVKA 2DJLA 3IVUA 4MY1A 3HPXA 4ORMA 3V1PA 2CZ5A 1TV7A 3B0PA 4HN4A 5AC7A 1DV7A 3ABOA 1JULA 1ME7A 1N55A 1HG3A 4PTNA 1W1ZA 1W5MA 3WK1A 3EWUA 3G1VA 1B3OA 1T0OA 2BZNA 3FEMA 3KHJA 1A5BA 2CLLA 2FQIA 4UTTA 1JQVA 2QCLA 4XZ9A 4OE7A 4IMGA 1UASA 1FUYA 1SU5A 1SZNA 1JQXA 4NT0A 4O57A 1FWTA 4UNKA 4N4PA 3BPWA 4MLRA 3TFCA 1G67A 5AHIA 1VYRA 5HWMA 4QAIA 1AL7A 3A5VA 1A53A 1NFBA 3OVRA 2QCHA 3RFAA 3U6WA 1UBSA 2ZYFA 3TXVA 4NXSA 5G4EA 1VC4A 2YR1A 1WOAA 3O6YX 2QEZA 4GUFA 4AF0B 1ML1A 2I14A 1FWSA 1TSIA 1XBXA 3NYZA 2VXNA 1GOXA 3O07A 1N8FA 3W1TA 1DJQA 3QM3A 3LHTA 3C2OA 1OX4B 3TJXA 4CCEA 1FCBA 4NZFA 4YMZA 1EB3A 4UMCA 3L0NA 3UXAA 4RJEA 5G1TA 1MEHA 2RH9A 2VFDA 5LZLA 1P0KA 3B05A 1GWJA 3IEBA 1G4TA 2PRMA 4LV4A 2HS8A 3QMRA 3FOKA 3DFNA 4N9BA 5U4NA 3EX3A 4GRSA 3WJYA 2WKJA 4GUGA 1W3NA 1FXQA 3C8FA 2ZRWA 3ELFA 5K3VA 4JTIA 1WYIA 1Z42A 2VFEA 3QPYA 4FNPA 5LSMA 3CHVA 3W07A 3NQFA 3HGJA 1VQTA 2H6RA 1KTNA 1SW0A 3BGJA 3S8HA 3I65A 1X1ZA 1OX6A 3V75A 3BV4A 4Z1BA 4LW7A 3WJWA 1TTJA 5CPLA 3KVLA 1JCJA 1O4UA 2DZTA 1W0MA 3S5YA 2VEPA 5DCEA 3PUDA 2C19A 3TSBA 4RR4A 1KBJA 5EYWA 2QF7A 5AYYA 3W84A 3OVPA 4RCXA 5D04C 3VKJA 2XFWA 2Q3OA 2PRHA 2F7FA 3SSJA 3VFLA 4I7VA 1H1ZA 2WV8A 1KTCA 3S5ZA 3O16A 3NPUA 3F4NA 3WK2A 1GYLA 3B4UA 4M6QA 3TIMA 1EWDA 1IXNA 1QO2A 4PEKA 3THQA 1LLZA 5KMYA 3HIJA 5F2IA 1LORA 2YFNA 1MSSA 3E96A 3N2MA 3BG3A 2WO5A 3L67A 3L5MA 3O63A 1W31A 2Y7EA 3HJZA 1IXOA 3T55A 4LVAA 1QPRA 3WFAA 5L9FA 2WPBA 3W71A 1FCUA 3NDOA 5E1QA 1ICSA 3G0UA 4FIRA 2C6QA 3TX9A 4LS0A 3HGOA 2G96A 5D05A 5LHFA 3DKJA 5LNSA 5K4XA 5A8GA 2DZXA 2RHGA 4YCPA 5D2YA 2YW3A 2ZA3A 3FJLA 3D0CA 2Y6ZA 2CW6A 3M47A 1OFOA 3R12A 1TIMA 2Q8LA 3T78A 4QJ1A 1EP2A 4ALDA 4EWND 3UPWA 2O7QA 2ZRUA 3PG8A 3W73A 1W56A 7TIMA 3MBFA 4QNWA 4WOZA
chains in the Genus database with same CATH superfamily
2NLIA 4GH3A 2J7EA 2I5QA 3LLXA 1HNYA 3VILA 3TTQA 3BXWA 3R13A 3JU2A 4HB7A 4MWAE 1K02A 3N12A 3NZRA 3TV8A 2V30A 1LF1A 3VMPA 1PCWA 5FEPA 2A4AA 4GY0A 4K1WA 4HHMA 3MUZ1 5I06A 1JPKA 1K9TA 1KKOA 5HR7A 4YNGA 3T2QA 5EMUA 1XICA 4UQ9A 3TVAA 1XRFA 5J8LA 4FNQA 4DWSD 4ZA0A 3L4YA 3EGJA 4GX9A 2NVCA 4D1IA 4FS9A 1CXHA 4P2VA 3QSRA 5HPOA 3QTPA 1TR1A 3N17A 1OG0A 2PDNA 1YLVA 2PDHA 1ZUAX 3HG4A 3LPGA 1JDAA 3XINA 2E1DA 3NQCA 4FIQA 3W1UA 1ITXA 1L9WA 3BQ6A 3DC8A 3UESA 4ZO8A 2V3EA 3UWYA 1YIXA 3DI0A 1GG1A 1JCLA 1XYZA 4NX0A 4F2BA 3QZAA 3E2SA 1P0DA 1ENUA 1EX5A 3IRDA 2XFRA 1H62A 3GYEA 1S39A 2ZADA 1WX0A 2DDXA 2GQ8A 3L5LA 1JUBA 3H70A 2DZBA 3IUDA 3BSMA 3L66A 1GUVA 1DJYA 3QBUA 2OZ3A 2BXVA 4WDUA 4AYGA 3TFXA 3W76A 4LX4A 1BGGA 1SZGA 4GNJA 4WSKA 3WQGA 2YKKA 4MPQA 1EZWA 3LV5A 1F6YA 2DQXA 3MHGA 4UCFA 3W22A 2DT1A 2B31A 3LPPA 1TV8A 2W27A 4XIMA 4B2DD 1ZBWA 5I78A 3LENA 3O15A 4MDPA 1E0WA 2C8NA 2VFIA 4JIEA 4F79A 3MP3A 1PZ0A 3H21A 5BMXA 1SFJA 3SCRA 3QYQA 4DF0A 2D0HA 3IIPA 3HV8A 4RW5A 3H2EA 2G3NA 3HFYA 4EAMA 1O12A 4GY7A 5HJXA 3ZJ6A 3ARXA 2E67A 3CS2A 4NRSA 2DSWA 1WBHA 1H1NA 4WGXA 3SGZA 4S3EA 3TTYA 3CQKA 4R27A 2QDHA 3TQVA 1MDRA 4O1FA 2WB5A 3KX6A 3B0UX 3SJNA 1TMHA 3I10A 1OY0A 4ATLA 3UR5A 4AZ5A 1I2NA 4CQCA 2W6RA 4DZAA 4US6A 1MWOA 5AHFA 3GC4A 1PIFA 3EB2A 1Q65A 2OSXA 1Q6DA 2O9PA 3W24A 1V8EA 5BXTA 3CWOX 1AQFA 4U28A 5D2WA 2E77A 2FFIA 1RA0A 4X63A 3EWWA 2HVMA 2HQAA 4H83A 4JIIX 3B0VC 1QNOA 3CAQA 3G77A 4O50A 1TPUA 2VZSA 1UKOA 1JF5A 4DHGA 1K3UA 4CQ8A 1R9XA 3KAOA 4PBGA 1KLYA 3PZMA 3FA5A 3UF9A 3W3OA 2P50A 4HU3A 4P8VA 4LOCA 1S2UA 3W85A 4KW2A 1CGVA 4NX5A 3VOHA 3WG6A 3GD6A 1O68A 1WXYA 4MDOA 2BLEA 1NWSA 2FH8A 4Z2KA 3MP4A 2FDSA 4JX5A 3VCRA 2HEJA 3RJYA 3BOLA 3QV9A 1Q7MA 1R0MA 4Q4SA 1CWYA 1W5NA 4TVDA 1VIWA 4O0ZA 3RR4A 2ZXDA 4GVGA 5E9AA 5GJNA 1XH0A 4TO8A 4O53A 3KBNA 3I6RA 3NQMA 3FYYA 5DRIA 2F6XA 1YNPA 3T81A 4J1OA 2HROA 4OJYA 1ZAJA 2ATSA 3AIWA 4Q33A 1A5SA 2VC5A 4LY4A 5CPTA 5LIXX 2Q8ZA 2J9YA 3M0ZA 4JOMA 2VWTA 2O92A 1LL6A 2DVUA 5FJJA 2LLEA 4J3VA 2VM8A 4W4QA 4MF4A 2FPYA 1DIOA 2WM0A 1L8PA 1TTQA 3TQKA 3AICA 1GKRA 2O55A 5JH2A 5BOEA 3I3DA 3G5EA 2QV4A 3NDYA 3VCNA 1TVNA 3V7PA 1G6CA 1JUEA 2SFPA 4GVIA 4CNOA 7REQB 2GGIA 2Y4SA 4C6OA 5LNVA 4AX6A 3NGFA 4A35A 3ZSSA 3RPTA 4LJ3A 1I0BA 2XM2A 2ZX8A 3B9OA 1Y8BA 1K9DA 3N29A 4CN6A 5KITA 1ISXA 2BVWA 3CL8A 2YGYA 1XLDA 2VTFA 2W79A 4NY2A 3QTGA 1GEQA 5CEWA 3A3HA 3G0SA 1QHOA 3ENLA 1A5LC 1E51A 4MLJA 1EF3A 1B3ZA 3LBCA 3NQGA 1IWPA 2ZZ4A 2FTWA 3DAQA 4GISA 3GXPA 2XIIA 2ZOXA 3OODA 4WRHA 4QDMA 2ISDA 4DUVA 3VCCA 4AWTA 5IHRA 4EF9A 4DVOA 2J74A 1SSDA 4H1ZA 3BICA 3CHCA 3M5ZA 5CKSA 2E25A 4XAYA 3W1XA 1XYCA 2Z1VA 1WCGA 1MEWA 1K4HA 1C8VA 4PTDA 3RR1A 4YCOA 4LB4A 2O7SA 4A21A 3DG7A 3AXKA 1E5JA 3UZZA 4PMNA 3DFYA 4I5RA 5AOUA 1XLCA 1UD3A 4JQAA 3DFSA 1NOWA 2E9MA 1F5ZA 2DSVA 1C8XA 3QW4B 3TYCA 3WQCA 1DWJM 3PB0A 1S5NA 3ZJ7A 5AC8A 1V0MA 3BVJA 1JGIA 1UWAA 2DORA 5D9NA 3CQJA 4YHGA 5D33A 4C1KA 5KZEA 1M1BA 2FPVA 3M41A 2YL6A 3EOUA 3H7RA 1VPXA 4QE4A 4ZQPA 3GVVA 1S2CA 2PGEA 4QITA 2QYGA 4L5ZA 4G1NA 4KEMA 2D2OA 3UFYA 4RK8A 1UUOA 3U8GA 3ONCA 2YL8A 3AHXA 4RX0A 5DANA 4PCPA 4IQDA 2EQDA 4I9AA 1PKYA 3GNXA 1SJBA 1XHGA 4QS5A 1TWWA 3FHAA 4L6DA 5BRPA 1IXPA 1P1XA 3TU9A 5FJUA 3AYRA 2I57A 4WJ8A 3Q4DA 4PBEA 4QLLA 2E3ZA 5CZKA 2ODOA 1XYFA 3R43A 4LVDA 1TG7A 1HVQA 3QHNA 4GO8A 4AX7A 2WHLA 4PA8A 4J3ZA 3LEPA 1W9VA 4PEEA 4L4PA 1W32A 3EWZA 4OIFA 1DEDA 3PZUA 1A5KC 4IISA 3TC7A 3O3RA 1RUSA 4DF1A 4HQVA 3VIHA 1VJSA 3WH7A 1JD7A 3WNOA 4IT1A 4N6FA 3K13A 3VGEA 1DHPA 2ABBA 2FFCA 4QM1A 4R85A 3R0UA 1DHKA 3DGRA 3B8TA 1GCYA 1TIWA 1OX5A 2PAJA 3PANA 4C1NA 3GXTA 5HXMA 1FWBC 3KE0A 1M65A 4Q7IA 1OT1A 2OR2A 7CGTA 2Z00A 2X1UA 5EBUA 4RDWA 4HHLA 3LSBA 3OZYA 1HN1A 4FOUA 1XL9A 3S9YA 4AZBA 4N2YA 2AMGA 1R38A 1X8FA 5DO8A 3UCCA 4I9JA 1EUNA 1CGXA 2QIWA 1D3CA 1EP3A 1TZ9A 2BS9A 2ZZ7A 5BW6A 4NG3A 2VFFA 4JEJA 1OCJA 5I2UA 2BWGA 5D4YA 3CYJA 4XIAA 4B5XA 1R3RA 4J27A 1LRTA 1SJAA 3W2LA 1B3XA 3H2NA 4DAIA 1X1NA 2VWSA 1F8IA 3W7QA 3SB0A 2UZ9A 3ARRA 1U5JA 1J79A 4V1YA 5IFPA 2WVUA 4WSHA 1XF0A 3ZO9A 1KW1A 1HKIA 3APYA 3W82A 1C7SA 3RMJA 4FLRA 3VIJA 4MB4A 1VBUA 2W62A 3PR2A 1CTNA 1KR1A 4BQ4A 5C70A 3W1PA 4OUIA 1NSJA 2D3LA 4Y9OA 1HKJA 5GJPA 1ME9A 1B3VA 1DXEA 4WY0B 5I3IA 1I4NA 1JZ3A 5FESA 4HN8A 2QGYA 5FAGA 2I1OA 3UQNA 3WBXA 2FHBA 1K03A 2GDQA 1MZHA 1OD0A 1JPMA 1X98A 2ISSA 2ISWA 3VO0A 2Z1SA 1ZBCA 3MI2A 1OZQA 2QCMA 3O06A 2NXHA 1Q6OA 2OXNA 1RR2A 2JEPA 5C54A 3GDLA 4DAFA 3KCJA 2J77A 4D8ZA 3LM3A 1W3KA 4GX8A 3DH7A 1RBOB 4C90A 4NIRA 3WUFA 3I3EA 2HISA 3W7LA 2TRSA 1OFAA 4HPHA 1Q4NX 1SVDA 4OV4A 2QUUA 2V9DA 3KBJA 1MQRA 1WV2A 4W86A 4CQBA 1ZJIA 3OZMA 3TE9A 1NWUA 4IPPA 1GOWA 2OZ8A 2ZZ6A 3CK5A 2EAWA 4Q8TA 1FCQA 4CD7A 1Q6RA 4CCDA 3C52A 2CHOA 1XLBA 3PUEA 5B7YA 4OVXA 3IGSA 3SUVA 6PTDA 1H0IA 3WBAA 3EMQA 1EP1A 4IPIA 4GYPC 5J04A 4BF9A 1UR3M 2DZVA 2CESA 4GYFA 2IXVA 1LL7A 2E6FA 4M81A 2GJNA 3O6DA 3E2VA 4XBJA 3EA3A 1OM0A 3G8EA 1J0ZA 1K8XA 4XG1A 1UUMA 3TSDA 4X9SA 2CITA 4WOQA 5D8ZA 3SEPA 1ESWA 3AWNA 4WJEA 4E4PA 1XIMA 1J9YA 1J5TA 1UC4A 3GZ3A 4AD1A 4US5D 4EPBC 3B8DA 3LRKA 4LPCA 3RRXA 1JCTA 1XG4A 4AW7A 5CCZA 3EX2A 3SCTA 4G5DA 1ONWA 1G7UA 5LNUA 3URAA 3QZ6A 2EF9A 4QJ3B 1AMYA 3LCHA 3CPRA 1HIZA 4FNTA 5EGRA 4W5ZA 3W7CA 5AFDA 3M0MA 1IR1A 4PULA 1H7NA 4WHBA 4PMVA 4RNHA 3T2OA 5HBFA 3AISA 2GVGA 3FAWA 3HB9A 1XGDA 5FJIA 4JTGA 2V38A 3R0DA 4GXMA 1E0UA 4S3AA 1IIGA 4UWMA 1ITUA 5C9ZA 5G1MA 3F2BA 1PCKA 1BWLA 5HMDA 5G2WA 4JTJA 2VR2A 3TOPA 3NQ6A 2PCEA 3GAKA 4EANA 4PMQA 3UG4A 3WBEA 2D1ZA 3LY0A 2JF7A 4AH7A 3H2AA 3HU7A 3AYTA 2Y5SA 1H2JA 1QPOA 1A5NC 5EPDA 4LQ1A 4ZFMA 2OCZA 4LS2A 1Q4WA 3P0WA 2E0PA 4YVVA 5EA9A 4XD4A 1M3UA 1FHVA 2ZXBA 4Q8QA 3HO8A 3H8AA 1W5OA 2VX4A 1U30A 3UZJA 4Y8EA 4NJKA 1F74A 4UB9A 2XM1A 3DERA 1HP5A 1MRQA 2WMIA 2VL4A 5D09A 3V1HA 2XPKA 1TV5A 1IZCA 4I6KA 4U5KA 5I3GA 5T9BG 4NKCA 2JFEX 1G69A 1UR9A 1GPWA 3NAVA 1H09A 5DBUA 3WJZA 3AS2A 1E40A 1UG6A 3PP7A 3O6CA 2R6OA 4M29A 1XG3A 3N1AA 1VKFA 1GVYA 1V0LA 3AHVA 3BG5A 3ABRA 4IL0A 4UFKA 8RUCA 3BW4A 1TMLA 1QVBA 2VZTA 3L4TA 4O13A 4M80A 1J12A 2WNZA 2QKFA 1XLHA 3PB2A 2X1SA 1AMKA 3ZVIA 3CUXA 3WLRA 3CZGA 2VDIA 3KLKA 3ZR5A 3EB4A 2IXUA 2JALA 1HKVA 3NDZA 3EWXA 4EPDC 3AZRA 4KRUA 1R2SA 2WNNA 3QSTA 1GQIA 3DECA 3GHTA 3MC5A 2GQ3A 1DXFA 4L9ZA 5DLCA 3NOEA 2XFFA 1US3A 4JN8A 3ANYA 4M6VA 2V6AA 2FJKA 4V27A 4ZBCA 3H24A 4MM1A 1KRBC 5G2IA 3SM0A 1XD1A 2PF0A 3CXOA 3GR8A 4GK8A 4H7VA 3B06A 3QQ1A 3M1ZA 1J6OA 4EE9A 2OLHA 4O1BA 1V3LA 5JVLA 3QH2A 1EKOA 2ZX7A 5CZSA 4HBKA 2A7RA 2E40A 1L6FA 3I4EA 2WYSA 4GC3A 3IJQA 4EOUA 4FAMA 2CZFA 1JVNA 1SMDA 1C7TA 4QE5A 2ZDRA 4Y8FA 1OC6A 4YTSA 3S42A 3KZPA 2QJGA 2JE8A 1OABA 4HU4A 1BFNA 4QS6A 1D7KA 5A2CA 2VFHA 3H55A 3QY6A 3ID7A 3FHQA 6XIMA 1BLIA 3WLKX 4MJ4A 5H8MA 1V03A 4QBXA 3GR7A 1XD0A 4PCNA 3LNMA 4JIQA 4ZQOA 2EPOA 3W6LA 3G6LA 1QPNA 3MY9A 4JKMA 1O6IA 4CD5A 3GDBA 5HNRA 5KZ6A 3DEQA 3T8LA 4R7JA 3E49A 2Y63A 2V2CA 1YTKA 2NT0A 2TSYA 3WY1A 3BZGA 1TREA 3W7DA 3V5FA 1Q2SA 1BXNA 4H9MA 2X8RA 5IM51 3BWWA 2Z26A 4UTJA 3FGCB 2V82A 1UMLA 2IPWA 1TJ2A 4HNUA 4LCSA 2UV8G 1OBAA 5DCBA 3HF3A 1S3TC 2OSYA 2OEMA 1TUFA 3GHRA 1SO5A 4K3ZA 1JXJA 2PDWA 2E8ZA 2BBFA 1MO0A 1Q6EA 4CVWA 1X7IA 1RBAA 1E0XA 1ZZMA 1FY6A 4XAGA 2EG7A 1WZAA 1W8SA 2ZVRA 1W6TA 1B1YA 3GLCA 3LSCA 3MUAA 2HTMA 4G8TA 4MZ8A 2E09A 1HVXA 2NV1A 3T7VA 2VNCA 2OJPA 3AO0A 3UETA 3KBMA 1OF8A 1ECQA 5GVJA 3VIGA 1VH7A 1KM0A 2PGFA 2FVLA 1N2VA 1EBHA 4J2MA 1Z44A 2JGQA 2AKZA 1JZ5A 4FK9A 1YQ2A 2J8TA 3KFTA 3G1RA 2RJGA 3VC6A 1QI5A 4AIBA 2WC4A 3F4VA 3VNDA 1UZDA 5A2BA 4V1XA 5HATA 1PJ9A 2VGIA 3ARQA 4IPLA 1TUXA 2ALDA 1QOPA 4QISA 3BG9A 4LUTB 3EWCA 4L1XA 4ACZB 3NL6A 1D7FA 2IW0A 1XQLA 1CBGA 2Z6JA 4F0LA 1QI4A 1CXIA 3TYAA 1FHUA 4HMEA 4ZODA 2WHJA 3EPOA 2PTYA 1AW1A 1OC7A 5E0KA 4DJDD 1XS2A 1KXQA 1LT7A 2QVHA 2X30A 4O28A 3A21A 1XLMA 2Q8XA 3MVTA 3REQB 1O5RA 2PLKA 4OBSA 2GZXA 1T8XA 3BLPX 3WF2A 4H04A 1RD6A 2YXGA 4J2PA 2VO5A 4ZR8A 1F4HA 3U3HA 3WL0A 3R10A 3VX1A 1X97A 2O9RA 3A47A 3HG2A 4J4KA 4ICMA 1AQMA 5FL0A 3BGGA 3HGSA 5A6MA 4EPEC 3DXIA 3KOFA 4GGHA 2QAFA 5AHLA 1KRAC 1FXPA 2D20A 3H4XA 4QG8A 4Z2JA 3RLUA 3SURA 1FP8A 4ZTYA 2PLJA 2WHMA 2QVNA 4ZO9A 3VD4A 3JRKA 2XVPA 4DX3A 1POJA 3R4IA 3L5AA 1XLJA 1LWJA 4KF1A 3CL7A 1OYAA 4LCQA 1Q6LA 2P10A 4B3KA 1UH3A 4MNJA 2RDWA 2Z7GA 4YIWA 2PPGA 1E9LA 1LCOA 3YPIA 5DX7A 2VC7A 4Q8MA 1ZRQA 5IRPA 1DJXA 3ZIZA 1B9BA 1TWDA 4HKPA 1Q3NA 4L4LA 1US0A 3VYLA 3WH6A 4I5UA 2WW5A 3PY2A 4NUWA 2VZOA 1DPMA 4DZHA 2VDHA 3W53A 5ECVA 2XGBA 4RW3A 3NPWA 3WDIA 2OQLA 1VFFA 2CZVA 3UJFA 2ONEA 2F8QA 2QCNA 4C6NA 4FR6A 4F66A 1ZJHA 3W7KA 3TNOA 1V3KA 1Y0EA 3GIQA 3S0CA 1NDVA 3LERA 3WD3A 4JXCA 1E6RA 3T4WA 2G97A 1NARA 3KW3A 4FA3A 1A5UA 1P1MA 1YNYA 1GNXA 5TBOA 3CC1A 4XUYA 2RJHA 5AB3A 2FZNA 2VQUA 1YE4A 3QRHA 5BWAA 1E6QM 2J9ZA 3CZKA 3WQ5A 2RDXA 1MNZA 2Y8VA 4LYQA 1PYMA 5LA0A 3TA6A 4KCTA 2EPLX 4X60A 2V3GA 4D72A 1V7AA 1B9ZA 2E4TA 4PGLA 3W29A 3SUSA 1ISVA 1XI3A 1TFVA 1XISA 5A6BD 4DWSB 3E2QA 1KCKA 1BG4A 3LX9A 1MUWA 5TAOA 1A3WA 1EXPA 4AHPA 2A85A 4GQQA 2GOUA 2X2YA 4ZCWA 4DWDA 4EXAA 1EXBA 2D69A 3V36A 3KUMA 3ZWSA 5A6LA 5JIPA 3S1WA 1DL3A 3S2NA 5TIMA 4K6AA 3R2GA 1OCNA 1H5YA 3WJXA 2CBIA 1HJQA 1XRVA 1LOLA 4AEEA 4KWVA 4E4FA 1CCWB 4AMCA 2ZA2A 3LPFA 4PCTA 3TK7A 4CD6A 4MYAA 3HQPA 5A6BA 4JTAA 5M2FX 1DWFM 1JDEA 2C18A 3BV7A 4B9YA 1XIBA 2WSPA 3IVUA 1VEOA 3V1PA 1TV7A 3OLEA 3AWOA 4HN4A 5AC7A 3ABOA 1ME7A 2X42A 4AZ6A 1W5MA 3DYPA 3G1VA 4H9YA 2WAGA 4FF5A 3PZIA 1JZ6A 1JQVA 1EA9C 4IMGA 1SU5A 1JQXA 1XLIA 4NT0A 5DMMA 3BPWA 4MLRA 5AHIA 5GJMA 1OCQA 4QAIA 5HWMA 3OZOA 3A5VA 2XYLA 1A53A 3RFAA 4BQ3A 4DJDA 2BXZA 1SJCA 2ZYFA 4GBDA 2GYIA 3K4WA 1G1YA 2V5KA 2RAGA 3JZUA 1J0HA 4H6EA 3KBWA 3THCA 3O07A 1GPFA 1V6YA 3C2OA 3TJXA 3MANA 1FCBA 1R3WA 4B91A 1E73M 1S2TA 2RH9A 1JZ7A 4DB7A 3WLMA 3IAPA 4AQLA 4IFKA 3PZOA 3UZYA 4GI6A 4HTYA 2FZMA 8XIMA 2V68A 3GTNA 3WJYA 1FXQA 1Q7ZA 2J6VA 3CUGA 2ZRWA 4M82A 3N2CA 5JIWA 1WYIA 1Z42A 4LFYA 3VKBA 4Q8WA 2VFEA 3B8IA 4LF2A 4FNPA 3UZXA 2I17A 1ZB5A 3CHVA 3PZGA 5IXEA 2H6RA 3S8HA 1SW0A 1PIGA 5JXQA 1CNVA 1NDYA 3I65A 4LUSA 3N04A 1OX6A 3V75A 3FSTA 3W26A 3U7BA 3UG8A 1TV2A 4UQCA 1XSIA 1TTJA 2DIJA 1Q6CA 5CPLA 5EMMA 3KVLA 5A6KA 1DJHA 4QLKA 2NQZA 3BC9A 2QNEA 3VK5A 3ORWA 3PUDA 2QF7A 4RL3A 5D04C 3VKJA 1BSIA 2CCRA 1AZ1A 1UR4A 3VFLA 3SSJA 4I7VA 4XD3A 3WK2A 3WFLA 5A6SA 2GVEA 4PEKA 3THQA 1QASA 2YFNA 1MSSA 1EOMA 3E96A 1I1WA 2VQTA 3BOXA 3AIVA 2PDLA 3WENA 4MUPA 4QE1A 3NURA 2ZC8A 3VKKA 1W31A 2Y7EA 2VX6A 2DT0A 1B90A 4LVAA 3V0UA 3GS6A 5BWFA 3WFAA 2IPGA 2WPBA 1B3YA 1V0KA 3VIIA 3NDOA 5PTDA 3N9KA 2C6QA 1ZJBA 2ZX6A 4RPPA 3ITXA 2Z1XA 4L61A 1RK6A 2FVKA 4AVNA 3KCLA 4EP8C 2DSZA 4HNOA 2NT1A 3R12A 3T78A 1TIMA 1EP2A 3V18A 1W9PA 2EKGA 4ALDA 2ZRUA 3W73A 4DUWA 2XVNA 1W56A 2HRWA 2UY2A 1M53A 4KEZA 4CNUA 3HQOA 3VKAA 2DUXA 1GONA 3LHYA 1BVZA 1JCYA 3BLFA 3BMWA 4LYRA 5H91A 2YA0A 3T9PA 3SRFA 1QT1A 3M16A 3E0FA 2OB3A 5DQPA 3OHIA 2HE8A 4FXRA 2DT2A 4BI6A 9XIAA 3WLLA 3I4KA 5CC5A 1Z32X 2ZVIA 4PMDA 1UWIA 3MUCA 4M8UA 3OIXA 1V6XA 3W81A 3G1XA 2DZSA 1EPXA 3OW1A 4CNPA 5RUBA 3VUPA 1F07A 2E28A 1A5CA 4PUDA 1TJPA 1EJ7L 1YE6A 4EAYA 1EPVA 3ES7A 3GG1A 4XZIA 4DJEC 3MHFA 3UY8A 4Q8UA 1JRCA 3CT7A 3A4WA 3CASA 4OZOA 1R8LA 3GW3A 4F2TA 4UR9A 3TLQA 3CWNA 3PC0A 3AIEA 1UBPC 4F2UA 1AUSL 5TD4A 2I9EA 4E2BA 5C0QA 3WEZA 4DBSA 3IJLA 1D3GA 3EX4A 1QOQA 3OLIA 4ZXLA 5C55A 2V8ZA 3ANVA 5DF0A 5C9WA 4MJ2A 4XVEA 3IVTA 3WMBA 1EJRC 4NF7A 3T07A 1EBGA 2H9AA 1ZCCA 2VKZG 1BYDA 2WK2A 1F9CA 4G2DA 4MVAA 5FACA 3LK6A 4ICNA 4MJMA 2DZPA 1VBGA 2UBPC 1LROA 4JBRA 3PNUA 4D6FA 5FKYA 4XKMA 2J4GA 4FALA 1OIFA 1U2YA 1JDFA 3ZVHB 1E0VA 5CPNA 3TN5A 3CQHA 4ROQA 2FPTA 2Y24A 3MSDA 2Y8KA 4BEQA 1ONXA 3WLSA 5EMKA 4O1DA 1O66A 1JCMP 2YCKX 3VM5A 3VNMA 1D8WA 1X39A 4J28A 3Q94A 1RHCA 5A8NA 1BSLA 2FB2A 1KFLA 1KM5A 3W1QA 3DKLA 2YZRA 4YTRA 2A6NA 4DN1A 3TEVA 1QDSA 3AS0A 1XLFA 3DFQA 2X2GA 4U2ZA 4Q4PA 5CSYA 3TJIA 3L4UA 2JBMA 4J35A 3P61A 2TPSA 3R89A 5D2XA 3QYSA 4LT9A 1DXIA 2B4GA 3HJEA 4QCFA 3PPGA 2D22A 1P4CA 2F2HA 2DPEA 4HCLA 3G8RA 3ARTA 3AZTA 3FLUA 4DPPA 4J9JA 2BMBA 1H5VA 2QUTA 3JUGA 1US2A 3BW3A 2E5BA 3ALGA 2VT0A 4LRSA 2QDEA 4RZ5A 3BAWA 2VMFA 5XIAA 3H2CA 1JEZA 3EA2A 4AISA 2VVSA 1KNWA 3O8AA 4PODA 1FBAA 3HG5A 3VKCA 3PFMA 3WLNA 2ISVA 4C6MA 3RN6A 2WZMA 5DXXA 3CAWA 3SR7A 3CO4A 3LQLA 3BAJA 3GNNA 1GYNA 1TA3A 3DYMA 3SY8A 1BXCA 3E12A 5AC5A 3GR4A 1VHCA 3QGKC 2C16A 3PBYA 5CZTA 1KC7A 2BV9A 4ATWA 3JR2A 3JZEA 3JS3A 2AGKA 2WMJA 1ZL1A 1JAEA 2OWXA 1CEOA 2XN0A 2D73A 4E38A 3PZTA 3UVIA 1XIEA 5ABFA 5A6TC 1RAKA 1S2VA 2DH2A 3TTOA 1S2WA 1K8YA 4QXIA 4DBUA 1N7KA 3PZQA 4CEXC 5BXSA 3IUIA 4A29A 1K4GA 2NUYA 3G1FA 1PTGA 1YXDA 5LIWX 3IANA 3RX4A 1XGZA 1RALA 2G8ZA 1UIPA 1X96A 3Q65A 4R3UA 4C5YA 4PUKA 4GUIA 6TIMA 3MYPA 4LF1A 2XVKA 5I7GA 4WK9A 4L6OA 4MUZA 3BK0A 2ALRA 1XLLA 4QG9A 4GZJA 4QHRA 1QNVA 4NAFA 5I3DA 4HA4A 3VDAA 3DU0A 4AEFA 5IBXC 2VI0A 4WUIA 4NJIA 3S5SA 3I6EA 1GQLA 3LCFA 3GG7A 5E0FA 4AXNA 5GNXA 3NTYA 4XKYB 3KL0A 2PCQA 1VRDA 2JQXA 2NX9A 3NG3A 4KFPA 5A8OA 4S3FA 2HNHA 3PN8A 1RZMA 2OYMA 3O0FA 4IQJA 4S3DA 4UZSA 4HOWA 3CB8A 2BGNE 3KTSA 4F48A 4ZE4A 1S1PA 1WB0A 1ZHAA 4MFDA 4HPNA 1Y5XA 3OBKA 3BL3A 4GO9A 4O10A 4WXYA 4N02A 4YJ5A 2WCSA 4RE3A 2Z29A 5F2MA 4MB1A 4LUIA 2R9RA 1YEYA 1XJBA 1WQ5A 4LYPA 4L64A 3SCNA 4E5TA 4M51A 3MI6A 1VCVA 1PEZA 4ZOBA 4H19A 2VRJA 4XISA 1N82A 4IGMA 4GWEA 4HK6A 4RZ6A 4E3TA 3EX6A 1IGSA 4LWWA 4UTMA 4NAFB 3U48A 5AZ1A 4US5A 7TAAA 4O14A 3ITVA 3CQ0A 5T91A 4B2DA 2I7GA 2YW4A 4WKFA 1KRCC 3N6JA 2R82A 2GJLA 3ERPA 3BMVA 3CZEA 4QX4A 1KCLA 3S1XA 4FF7A 2QULA 5CJNA 1TTPA 4JAWA 4BR1A 4D6IA 1W17A 4JFUA 2I5GA 2NUXA 4JYFA 1R3YA 2ZQ0A 1P7TA 4K37A 1TCMA 4N9CA 2L5HA 3TAKA 1D8CA 4JY8A 7A3HA 3BW2A 3W7EA 9XIMA 5MKGB 2QMKA 3WBWA 4Z2IA 3KOZA 4WX2A 4S39A 3W1MA 2PDFA 1GW9A 3KVJA 5J5DA 4NZ1A 3UWEA 3V4BA 3VD7A 4WQ6A 1O60A 3K8KA 2JIEA 2WVSA 4E2OA 1ZU8A 4R9OA 3TXZA 5K9DA 3OG3A 1FX6A 1M68A 5CJ5A 4A3UA 2KX9A 3GXNA 1L2UA 3SCQA 3MB9A 2VUYA 3TSMA 4BCEA 4ERGA 1THFD 2Y62A 3I6TA 2DUZA 1Z69A 3HQNA 2PRLA 5I3HA 4OOZA 2INZA 2J7GA 2C13A 3ALFA 2YJQA 3QMSA 2EPNA 2GJRA 3NYDA 2XG9A 3OGSA 1TB3A 4X0NA 4MTVA 3ZWTA 3R7MA 2PFHA 2PDXA 3LA4A 1NWTA 3M0JA 2CZDA 1OT2A 1KV5A 1Z9AA 1JJKA 4HZ7A 2PUZA 4DQWA 3STEA 3QW3A 3BLDA 7REQA 1J11A 1PX4A 1HGYA 3F4WA 2Z2UA 4M56A 3VDHA 4YS1A 2CLEA 1D2KA 2OSWA 1DQWA 4FNRA 1M01A 4RNIA 4B5UA 4CVUA 1FCVA 4W85A 2X41A 4KS0A 1BGAA 3NO1A 1OIMA 3QV7A 1A3HA 5GPRA 3TN6A 1NFPA 2VCAA 3DIPA 1NQ6A 2CBUA 3ZMRA 2CERA 2ZX9A 1KB3A 1J01A 3TMLA 3UZ5A 3LOTA 4ONVA 4W8AA 1C8QA 1YDVA 4E2DA 4DJFD 2ZUVA 2PGWA 4P8WA 4DRSA 3PJWA 5DCDA 1E0TA 2O4QA 2A1YA 2ACRA 2Z25A 1HL2A 3M6YA 1JGMA 5HNTA 1UZHA 3VIKA 2W63A 2WWCA 4GVHA 2W67A 3EEGA 5LKYA 4LB3A 2VELA 2YDAA 1FDJA 4D6JA 1JUKA 2C14A 2HK1A 1CW2A 2BX7A 2C71A 2Y89A 4I90A 4DBWA 5XIMA 4PMOA 1DVJA 3L12A 3KRZA 5FSDC 4OU1A 4WF7A 3FXGA 1DIEA 3CV1A 2ZX5A 2CLHA 4GY1A 1EA0A 1E9ZB 4N7QA 2TAAA 5FJPA 3OP2A 3CT2A 1R7OA 3MVIA 1JG9A 3RCYA 4GI9A 4B3LA 3GZAA 3BJFA 3W37A 2VZUA 1LLOA 4LUTA 3LLFA 2P76A 3W9ZA 5JBDA 3M5YA 2J7DA 2VEIA 1F2JA 1TPFA 3MMDA 4BFAA 5CPQA 2V5LA 4CKQA 2G3FA 1UPPA 3NL5A 3S1UA 1V3MA 2IPJA 2GLKA 3KP1A 2OT1A 3VVGA 2ZRYA 3ITLA 1XRSA 3LU2A 4Z0SA 3LN3A 2AQVA 1K8CA 3KDOA 4MB5A 3MMTA 4AD4A 1Z48A 1RQBA 5CLTA 4UR7A 2ZXQA 3ZT6A 3WEMA 4UC5A 4OUEA 4O17A 1VHNA 3LMZA 4C7FA 1SZEA 3QQWA 1YXCA 3ITYA 3T6CA 3SIZA 4KEVA 4TX6A 2DVTA 4TX9A 3V16A 3CYVA 3DHPA 4JTDA 1PHQA 4PC8A 2Y70A 4AD3A 4IG2A 3USZA 3LCWA 3HPFA 4GZEA 1ZY9A 5G1YA 4UOQA 3N4AA 4KCVA 1NIUA 3N13A 3IK4A 4IWWA 3R6IA 4JY9A 4NL1A 3QV6A 4BJHA 2J8GA 4CLMA 4BI5A 1R6WA 4YPJA 4AUBA 2HCVA 3N18A 1QO5A 2H8XA 1K7XA 1A5OC 4A3QA 3L0KA 5ENLA 1NP0A 1AFSA 4GCXA 4Q4RA 3GDKA 5FOOA 1PUDA 3KDNA 4J3WA 4V2XA 4KGLA 3BO9A 2DW7A 4C91A 4PSPA 1CZ1A 5A95A 1ZS2A 3GX9A 1V3HA 4TMBA 3LTSA 4AWUA 3L4VA 4IM4A 4YWIA 4S1FA 1LRNA 3CZ8A 3FYOA 3GAYA 1EC9A 4D6DA 2GPTA 4F0KA 3NO5A 4YXGA 1Z89A 2NV2A 4I5XA 5EMJA 3SFWA 3BTNA 2CETA 2C1GA 4S23A 3GYCA 5F1VA 4BWLC 4EX4A 1GZJA 3CEUA 1DWIM 3EXRA 2J47A 1M9HA 3WFZA 4L56A 4AXKA 3KWSA 3OQ8A 3SRHA 1QTWA 2PTDA 1XKJA 2WANA 2P3ZA 5DT5A 4CNTA 1I0DA 3KL5A 2J79A 1TQXA 2JGYA 3S5OA 1LG2A 3AHTA 3KRBA 4JTLA 4D2JA 1XQKA 4P61A 2XH0A 4N9DA 3WQFA 1AA1B 1M7OA 3ARWA 1B57A 2OPJA 3NNTA 3EXSA 1VBJA 1XC4A 1AH3A 2BHYA 4ZFCA 3N9RA 4NZCA 2ACSA 2FHFA 1RD5A 3RX3A 4GLEA 5C8BB 4C6CA 1HL9A 3L0GA 1H7PA 1W3JA 2CNCA 3TC3A 3MBDA 1KFCA 2FMOA 5JH1A 2CKRA 3S4TA 5C2GA 3C0SA 3QY8A 2V2DA 1TVLA 1J4EA 4GQRA 4D1JA 3ARYA 2PBOA 4DNHA 4DO6A 2GSHA 4Z2HA 4I7UA 4Q7BA 4A8LA 4NI3A 3MO7A 1EJSC 3IIOA 5F4SA 3UY7A 4X61A 4PCFA 1KBIA 1UH4A 3QGVA 3RK8A 2FYMA 3OYZA 2W4XA 1NVMA 4JL1A 4HOZA 3N6HA 1RCXB 4ACYA 3TLLA 3BURA 2FGZA 4I7WA 1A0EA 4MAZA 1XR2A 3IGHX 1EJUC 1XCFA 4KWUA 3TW7A 1ZFJA 4N42A 4EVZA 1FQ0A 5C9RA 4HHPA 1F76A 1PB0A 1E15A 1U1UA 4IQLA 1SW7A 4NP7A 3ZS4A 1VYSX 3K30A 4LBRA 2ZRZA 3WO8A 2WNQA 4D71A 3HPAA 4LC8A 4HNLA 1FH7A 2BOGX 4B5VA 3EPMA 2Z7KA 4PUMA 3C5QA 3B9DA 3V5OA 3WK0A 1Q5MA 1LTDA 4O4VA 5H8UA 1EIXA 4PFMA 2ZRVA 5DELA 1CECA 5FJRA 3BOFA 3G3MA 3CZLA 6ALDA 1NQKA 4RV8A 2ZZ1A 3EDFA 3BARA 2Z2AA 4YWSA 4JTHA 5U7SA 3GDMA 3ICJA 2XINA 4HYRA 1QK2A 3FA3A 5AN7A 4PMYA 3UXLA 1X38A 3V0SA 2XWEA 1B30A 4U3CA 4S3BA 5I3JA 5AHNA 4R7WA 1Q66A 2PZ0A 1C9WA 2ATMA 4Q4KA 4W93A 5EFDA 1FWHC 1F6KA 5C7VA 5J5RA 4HSNA 1PKNA 1EYWA 4MKSA 4E2VA 1RLCL 2GK1A 5A2AA 3MTWA 3MYOA 3O1NA 3H54A 4DWSA 4PMRA 3P67A 3TR2A 2Q3RA 4L9YA 2O0TA 1NAL1 2FMNA 2PBGA 5F7UA 1PX3A 4QAWA 2CBJA 4E3VA 4HSOA 1LRQA 4AD2A 1HKMA 5LXEA 3FJ6A 5D9MA 4JFWA 4PCSA 3R8GA 2HXUA 4FXSA 5A6JA 5KETA 2J24A 3SFKA 3VI2A 3UXKA 4RUBA 4MWAC 2PDIA 1EHNA 3C61A 3WQ6A 1WBJA 5FEXA 3LTPA 3GTXA 2OODA 3AMKA 4HNTA 5T26A 4XBKA 4ZOCA 1YHTA 3TTEA 4IH3A 4W87A 3W02A 2FTPA 4HHHA 1TPVA 1P48A 1WPCA 2ZFAA 3H12A 4PUNA 2IQ0A 4B4FA 3PUOA 3PSWA 1XBZA 2GVJA 3TROA 1ELSA 2NXIA 4F8XA 3UBPC 5BU6A 4FNUA 1RPKA 5I02A 2CLFA 3UWWA 5EB8A 2FDMA 1VGAA 1HJXA 7ODCA 1ODUA 2DEPA 1MQQA 4UFJA 3M43A 4X0VA 5CJMA 1EGMA 1C3FA 1E56A 4FLQA 3AYSA 2C7FA 4A8IA 4AZGA 5HULA 4HNNA 3E0WA 1G9HA 4M19A 3PM6A 4HTBA 1AL8A 4L7ZA 4U10A 4NJHA 3OQEA 1VCGA 1VCFA 4GG9A 4DXKA 4H6RA 3P14A 3V35A 1S38A 1XDMA 3MW7A 3WQDA 1SFLA 2Y88A 4KBXA 4E0CA 3ES8A 4Z17A 1H1YA 2YB1A 2Z1WA 3VMNA 3EDEA 4XZNX 2NWRA 1RSCA 3BLIA 3EAUA 2YXOA 5JBFA 1X6NA 3G2GA 4JX6A 3S2MA 1LDCA 4GNKB 9RUBA 4TV5A 1Q6FA 1MNSA 2HMCA 3GDTA 3C0QA 3LCIA 1AW2A 1T96A 1KM2A 1XPYA 3II1A 1TPB1 3FJ4A 3GW0A 4E8CA 5A8MA 1QNQA 1BKHA 1YDOA 1I2OA 1OC5A 1RV8A 3C86A 4QGCA 4BZYA 1IF2A 1RQEA 3M0HA 2ACUA 3STGA 4GJIA 1YBQA 1C91A 2Z2BA 4H01A 1LBLA 3A3WA 3NXLA 4QP0A 2A0NA 2W5FA 5AC4A 1EQPA 4LCRA 3AS1A 2PWFA 4RZBA 2WJZA 2WVTA 1KM4A 3EOOA 4Y6GA 1DJIA 3KS5A 3STCA 1XYMA 4ZO7A 1ONEA 4UMBA 4W88A 1E4MM 1RY8A 3DHFA 5CC6A 1FH8A 1SR0A 1KXTA 3RNDA 3W7RA 4BF7A 5CPSA 1UWUA 1P0NA 5CZJA 1XSJA 2JKPA 2PP1A 1C29A 3V5CA 4ZQMA 3CLMA 5CPMA 3SY1A 3D47A 4KERA 3S1VA 3BZJA 4U33A 3TW6A 4IIDA 4KETA 8A3HA 4K36A 5E6ZA 5HR6A 5HNNA 4YTQA 3NGJA 3MV01 1UZ1A 5E09A 3DG3A 1QHPA 4YTUA 5K9XA 3WSUA 5D02A 2QCDB 4HNVA 3SQMA 3CBWA 3P84A 4HA0A 1UP3A 4JL2A 2IKGA 3EKZA 3OO2A 3SDOA 4UTWC 4W7VA 2CZEA 2QDGA 3MWCA 3GTHA 3NQ2A 1G94A 4NNAA 6A3HA 1KWKA 3M5XA 2R1PA 3LB0A 3SUWA 5EMLA 1UIOA 1KFBA 2AGTA 1RJPA 1VRXA 2QCEA 5BMWA 3ZJ8A 2POZA 1BRLB 4O8RA 3VU2A 5ABGA 4AAJA 3E9AA 5BYWA 1Q6QA 2J7BA 2AL1A 2QDDA 1I60A 2QJNA 4RNJA 1K7FA 4Z1CA 1XGEA 4A8NA 1H49A 3HOJA 1W3LA 3ZT5A 4C65A 2VURA 3FA4A 4LNCA 3G0XA 4J5NA 1C8YA 3W7NA 2WOQA 2QQ6A 4FLSA 5HK4A 2R91A 1SYTA 2ZIDA 4XQ6A 5H2ZA 3NPVA 4QLJA 2PP3A 2CLIA 3IIZA 3RU6A 3A13A 4FX7A 2J27A 4AY1A 3AS3A 2B7OA 3VGHA 2DY3A 3DX5A 3FYPA 3M0IA 1QMLA 1W1A1 4FX8A 1G01A 3WD2A 4INFA 3EXTA 1KXHA 3PJUA 4C5ZA 1SGJA 3AIRA 4P8UA 3PTKA 4M7SA 4KKXA 1S2AA 5A8PA 1Q2RA 3COTA 1P6WA 1JYVA 5KINA 2YLLA 4IFRA 4NAEA 2Y7DA 4WGHA 2NUWA 1BWVA 1IHIA 1XM3A 1UWQA 4UFMA 1UD6A 1KBBA 1PXGA 3NFUA 3VIFA 4AB4A 4GI4A 3UEQA 3W7PA 1YKWA 2A3CA 1OGSA 3HBLA 3R25A 2HZGA 3N19B 4WZHA 2VP8A 1H11A 3BJSA 1MW3A 2BTMA 4D8LA 4PBFA 4BF5A 4P8XA 4XVDA 1KD0A 1UQYA 2CWXA 1X7FA 3OPSA 2PDUA 1DOSA 2R1MA 4LTSA 4QNEA 3QKEA 1XLGA 2NW0A 5C9XA 1IXQA 3ITCA 4ZQCA 4FP1A 3VC5A 3APGA 4IOTA 2F2KA 3SIMA 1OK6A 4XK2A 3PS7A 2VZVA 1J0IA 1V6VA 3U7VA 1BD0A 5H8PA 1SPQA 1PL9A 3FVDA 4UIOA 1VEMA 1X6UA 2VGGA 2CBVA 4NZ4A 5E5CA 4NU7A 8XIAA 4EXBA 1KFJA 3RPMA 5ECUA 2OGJA 5CSUA 1FOBA 4W7WA 5LA2A 3NJ3A 3AROA 3UJRA 1R86A 1YPFA 4JKKA 4R34A 3AI0A 5ABTA 2E6AA 3AMGA 3L4WA 4ZOAA 1XW8A 2V2HA 5FEZA 5C5YA 4C6QA 1E70M 3CEPA 1LYXA 1A0DA 5HUPA 3R94A 1QI0A 2XN1A 3C4UA 1G4SA 2A2IA 3PAOA 4QR6A 3KVKA 4MY1A 3WD0A 4P5UA 2CZ5A 4AZHA 2HBVA 3ZR6A 1DV7A 1JULA 3ISIX 3WK1A 4G7EA 3RU8X 1W1YA 4S3GA 5M5DA 2FQIA 3IPWA 1RVKA 1V51A 4GKLA 1Q85A 1UA7A 4A3HA 4OE7A 2DVXA 1UASA 2NV9A 2VX7A 2WLZA 4N4PA 3AU6A 1VYRA 4W84A 1AL7A 1HJUA 1T8QA 2WCGA 5REQA 5BOFA 2DIKA 3TXVA 3SO7A 3KLLA 2V5CA 2YR1A 3BLOA 1WOAA 2QEZA 1MVYA 5BROA 1LT8A 4X9YA 5JMUA 1ML1A 5C9UA 1E6SM 4HCDA 1Z3NA 1TSIA 1XBXA 2VXNA 1GOXA 3E0LA 1N8FA 3CIVA 3W1TA 5AKQA 1AZ2A 1TJ0A 4CCEA 1Q13A 4NZFA 1K9FA 4YMZA 1MEHA 2VFDA 2GJXB 4YN5A 1P0KA 1GWJA 1KWGA 2PRMA 3D5HA 3PTDA 4X2PA 3N2BA 1UJQA 3DFNA 4N9BA 3U2CA 1UKTA 4IL2A 1FFRA 2NVDA 5U4NA 4GRSA 2WKJA 1W3NA 4S3CA 5K3VA 1PZ2A 3QPYA 1E6ZA 2YCJA 4J40A 3GVWA 4GNVA 3W07A 3NQFA 4XZBA 3HGJA 1VQTA 1JYNA 1VB9A 3PNZA 4ATDA 1V79A 4KRZA 1X1ZA 4EXQA 4DM1A 4F0HA 3M0LA 3PK7A 4LW7A 3WCZA 3WJWA 3JW7A 1V6TA 1RLDA 3KTXA 1O4UA 1W0MA 4JQ3A 3PUGA 2FTYA 1KBJA 5EYWA 5AYYA 3W84A 2PODA 3PZ9A 1HKKA 2PRHA 3URNA 2WV8A 1KTCA 3T05A 2FJUB 1GYLA 3K8MA 3FVMA 1IXNA 4XD6A 3GG8A 5F2IA 4DXXA 5BZAA 1QK0A 1OD8A 2VRQA 2GJXA 1A4LA 1XCWA 3HJZA 1IXOA 3T55A 1HT6A 2C1IA 2AL2B 5L9FA 3QOKA 1FCUA 3QR1A 5E1QA 2PMQA 1ICSA 4FLOA 2XDFA 2V63A 5EMYA 4TTUA 4LS0A 3N2TA 2G96A 3CUIA 4JNZA 4F9JA 4PTWA 3DKJA 5LNSA 1MZRA 1S1RA 2RHGA 4LBSA 1IEWA 5D2YA 3E74A 2ZWYA 3S2CA 3FJLA 1FWAC 2PTXA 1OFOA 3IJIA 2O7QA 2J7FA 5AVHA 2WMKA 4KCUA 2W91A 3SCWA 4GACA 2UY4A 3CNYA 5B80A 4NXKA 3T0AA 3NO3A 1CXFA 1VFMA 4RPQA 5CC7A 5LGXA 1QCWA 2BY3A 5I3FA 4U4MA 1OG6A 2P53A 3V3WA 1M7XA 1DKWA 4XSLA 2BHZA 1NFGA 1GQJA 3G1AA 1IGWA 3L23A 1TMQA 1YRRA 4OV9A 2IKHA 5HMSA 1B2YA 1AD1A 3CPUA 3HA1A 2WKLA 2DP3A 5FSEC 1JAKA 2OT0A 1W5PA 3NQVA 3UD6A 4IJBA 3AMCA 4PB4A 3QLLA 5DY3A 1XRTA 5FEWA 1L2QA 1OFRA 3U2ZA 1S5WA 4QDWA 1PZ3A 2GGEA 4OQVA 3W27A 4UNIA 5A5WA 5AHMA 2ZCGA 1S5VA 3GO2A 2RKXA 2BY0A 4BEUA 1I8JA 4R9XA 1WKFA 4Y96A 1NOFA 4GINA 4KWWA 4LAUA 4Y9PA 4POCA 3LXAA 3U4AA 3KRUA 3RM8A 5ABHA 2WMHA 4WIWA 3WDRA 1R3VA 3RITA 5G4WA 3HQ1A 4DF2A 1R9ZA 3BJTA 3TMQA 1MFUA 5IDZA 2XIJA 1OVDA 2ZA1A 3LV6A 4AD5A 3OLGA 3VZXA 1BTCA 3UR7A 1KXVA 1XP3A 2INFA 2XN2A 2HV5A 2J62A 5HOSA 4YU1A 3FDGA 1HO4A 1A50A 5D2VA 3LG3A 4ILSA 4XBSA 3VDCA 3WLQA 3QOMA 1AH4A 3EDJA 3FXYA 2ZTKA 3N3MA 1WKEA 4GC4A 2GVYA 1WXZA 1F73A 4A2RA 3AQUA 4XZMX 3I7QA 3WKZA 2NX3A 4MZ1A 1Q7QA 4I6VA 1JZ2A 3W83A 7XIMA 3UW6A 3AC0A 4XTIA 3URBA 2G41A 4DBEA 3BAYA 4F40A 4K8HA 3ARPA 1V3IA 3OTRA 1GGOA 1WZMA 2PDYA 1AJ2A 2GWNA 2XH4A 1SR9A 3PJXA 4QFUA 2GK1B 4PMZA 4XX6A 4O1EA 1ZTVA 2GFTA 4M5PA 4LEFA 1B4EA 3LCXA 3LDVA 1TE1A 5LYRA 4D6EA 4HA3A 2VVNA 4H9ZA 3S6TA 1DJNA 3NIYA 4B5SA 3WBYA 4V33A 2QR6A 3GG0A 4MWAB 3Q45A 5EKYA 3MZNA 4GABA 1RVGA 2P1FA 3QGAC 4NRRA 3VTRA 4BKNA 3TC6A 2YA1A 5IBXA 5LIUX 1SO4A 4CQAA 4D6CA 1MUMA 3WN6A 1JI1A 1BRLA 4MWAA 2XZ7A 2PDKA 1TZZA 1AODA 4IGHA 2B7PA 3EDDA 1JF6A 4ZMGA 4AYSA 4QQUA 2NZLA 2CHNA 2WZHA 1N8IA 3GNRA 2VYOA 2PDJA 3WX7A 5C2XA 1JPDX 3C2FA 1UC5A 4Q8OA 3NQ7A 1XIHA 5CGQA 1UZ4A 3TCEA 3WF0A 3I7RA 1UCWA 2BVYA 3MCOA 4Z08A 2CXGA 5F4WA 3VOCA 5DT7A 2J9XA 2G4FA 3GXIA 3RO6A 1D3HA 1GOIA 3N2OA 1A4MA 1VZWA 1BQGA 5E0CA 1K77A 1K6AA 1XDJA 4J7RA 2P5NA 1TX2A 4HP5A 3MWAA 4L65A 2X16A 3GB6A 1OGGA 3SQSA 3FFSA 1QHZA 3LZ5A 3RLGA 4Q32A 1QFEA 3PFRA 2YA2A 3WIJA 5KSWA 1M6JA 1Z8AA 2J88A 4TOQA 1WE5A 1VFLA 1OSEA 2DT3A 1E1CB 4UMAA 3PJTA 1BTMA 3WUGA 4R7OA 3M6DA 1P43A 2FHCA 4KFOA 1XFCA 1CYGA 4BA0A 5EBAA 2ZE3A 4FZIA 2Z1BA 5I5RA 2HE5A 4Z42C 1RPXA 3DDMA 5E93A 2CLPA 3U2OA 4GPNA 1PTAA 2CFFA 5DMLA 4FX6M 2G37A 3D3AA 1UKPA 3HGRA 3I7SA 4MZYA 3F4DA 3KVMA 1J5SA 4BS0A 4ZENA 5I6SA 4KRTA 1FRBA 3UZWA 2PTWA 3UCDA 1ZALA 1XSKA 4PRWA 5DFAA 2JK2A 3WD1A 2F61A 4CCCA 4JQ4A 4CQ9A 4B4HA 4ZO6A 3BSHA 1WKDA 3OG2A 1MMFA 3EX1A 4IP4A 3CQIA 3LI0A 2DSUA 3M0KA 4B92A 2PB1A 4HD5A 3TN4A 1HTIA 3RPDA 2VJXA 1JZ4A 1CDGA 2C3ZA 5FF3A 3M7SA 3W74A 5HWNA 4GOAA 4LGXA 1OFBA 4LAMA 2WPGA 4GD0A 4GIAA 4FOKA 2B7QA 3VGBA 4Q4MA 3QMTA 1H7OA 2A7NA 4HT3A 2CU0A 3U0HA 4V28A 1UB3A 5HANA 4ZEPA 1XFBA 4RXFA 2EPMX 3ZVHA 3BAXA 1QATA 3A4AA 4O18A 4DJFC 5F1UA 1IR2A 4H8NA 3D3FA 5CLWA 1IZJA 3WLTA 2D23A 2HSAA 2HXTA 1QW8A 2AL2A 4BY3A 2H9AB 4C6LA 1LJYA 5CZ0A 4G7FA 1E55A 2BOFX 3KEHA 1O95A 4H7CA 2GSJA 4NSBA 3VUSA 3K4AA 4IGNA 4B5NA 3KXQA 3U2EA 1E6PA 2WMGA 3W7MA 3UJEA 2PLMA 2WSYA 1OYBA 1GVFA 5E70A 3AU2A 3W01A 4B90A 2YFOA 3IJDA 5MF5A 3K46A 1MW2A 1E6NA 2PDGA 4HPJA 5A69A 1VR6A 3LBMA 1ZBKA 4REQB 3RX2A 4PUEA 3S46A 3H6OA 2Y8UA 2VR4A 5I79A 4H6KA 2W66A 1DIDA 1XIIA 3LRMA 2V5BA 4M3PA 3AXHA 1KLZA 1EZ2A 2UY3A 4RE0A 3ZXWA 1KTBA 2XU2A 1M04A 2A5HA 3TW9A 4CD8A 4JFSA 4JNMA 2Z1KA 3CTLA 1R30A 2Y7FA 4FXFA 3R58A 2UWFA 3W1LA 2V81A 3C6CA 5D30A 2AMXA 3NCOA 5FF0A 4HNCA 1MXGA 5F2GA 3IJ8A 1VIZA 2VX5A 5SWUA 4K38A 4GCAA 2W0UA 3SECA 2PC4A 2XSXA 3A24A 3BE7A 4GYKA 3EOSA 4Z2GA 5C2CA 4H8HA 3U9IA 2F84A 5FJOA 3WLIA 3OIHA 1YNQA 4V15A 1ISYA 1KKRA 2BODX 4NYYA 2XVLA 2YSWA 2BOEX 3M9YA 3OVGA 4AZIA 1W91A 4PR4A 3VKDA 3RHGA 1LZOA 5FF7A 5KTLA 3P5ZA 1X8CA 1LQ2A 2EEXA 1UP0A 1NDWA 3SUTA 3SCPA 4WXZA 4AIUA 1DWHM 1E71M 3IV8A 1O94A 4PB3A 1JRBA 3PWGA 4LUJA 1H7XA 1RCOB 3MSYA 5I3KA 1XWYA 3CM4A 4MYXA 4C60A 3UYIA 2IS7A 2GGJA 1OF6A 4ADUA 2QPXA 2WNWA 1P5BA 3GY1A 3O2LA 3DC0A 1PX8A 4AZCB 1DQXA 1W5QA 1QPKA 4DYEA 4JTEA 1I2PA 2E5DA 3P8IA 2EPHA 1IEXA 3D46A 3SRKA 5D32A 2ZUUA 3W2NA 2HPMA 1YW1A 4MY9A 3CH0A 3QC3A 4P7RA 4R88A 1B4KA 4RE4A 1S5TA 2PSNA 5I07A 2Q71A 4IMAA 4PSRA 5AYXA 3UP8A 1AH0A 3NSMA 1N8WA 4C1LA 3WQOA 4JYDA 3TWAA 3KL3A 4S38A 3PZVA 4LVBA 4NJGA 4MB3A 4ZGYA 2BASA 3GK0A 4XWUA 3IWPA 4KEUA 4UTKA 1EX1A 1F8MA 1SZRA 3SAZA 8TIMA 1TZ7A 3A9IA 2YCLA 1F6PA 3WH9A 1ZCOA 3HPZA 2Y7GA 4FR1A 4DIAA 1CXEA 3FSUA 2G0WA 3W25A 3K2GA 4G6CA 4W8BA 3GDRA 3UYCA 2GDVA 3UT0A 4UQAA 2PWVA 1PVNA 3SQLA 2AAAA 3UG3A 4CU6A 3PWAA 4UXDA 1CLVA 5BNKA 3LHUA 3MKKA 3NM3A 3TUUA 2E6YA 4DI9A 1E1FA 3P93A 5F4XA 3G22A 3LCGA 4TQTA 1BWKA 1B3WA 1S5MA 3RF9A 3WJSA 1Q8AA 6TAAA 4MHBA 4PUWA 2A7PA 4DJED 3NM1A 3AAMA 3PBWA 1CB7B 1HXJA 4CD4A 1NU5A 5BRBA 3CGTA 3VA8A 4J3TA 3UWQA 2OU4A 2NWSA 3XIMA 3TN3A 5B7ZA 4F3HA 5FJTA 1T5AA 1IEVA 1FWFC 2ZUNA 2R1LA 3RAOA 4AG0A 4JTUA 4E6MA 1W1PA 5HINA 4IUOA 3N3TA 4JHMA 1E1CA 4HSHA 1TRDA 2E6DA 3GWQA 2R94A 4IJCA 1FP9A 5CH9A 4NYUA 2POTA 1CX9A 1LWIA 4JTKA 4ZZ9A 3TZNA 2CLMA 2GJPA 3GUGA 3QF0A 3EYPA 1HF6A 3H7UA 4W7UA 4ZB2A 1PWLA 1Q45A 3HN3A 4AHOA 4MKVA 3CV7A 4O11A 4N9EA 3DBNA 1LL4A 1T40A 2ASHA 3SADA 4TU1A 1RY0A 1I1XA 1QBAA 4CEUC 3M7WA 3SN4A 1ITQA 2FH6A 3CZJA 1EHAA 4X22A 1W2VA 5DMNA 4M6PA 3PVFA 4K7VA 3NSXA 1ICQA 3UERA 3N2XA 4JTTA 4GA8A 3L9CA 4YTTA 3DN5A 1BHGA 3TZFA 3VE7A 1MRAA