1XBZA

Crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound l-xylulose 5-phosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
213
structure length
210
Chain Sequence
b'LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIDLTGYWTWEQAQQWRDAGIGQVVYHRSVDAQVAWGEADITAIKRLSDMGFKVTVAGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
publication title Evolution of enzymatic activities in the orotidine 5'-monophosphate decarboxylase suprafamily: structural basis for catalytic promiscuity in wild-type and designed mutants of 3-keto-L-gulonate 6-phosphate decarboxylase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 82
structure length 210
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xbzA00
3EXRA 1UCWA 2DP3A 1ML1A 5CZ0A 3W88A 3VKJA 2HMCA 2JGYA 3N9SA 1LBLA 1F5ZA 4GJ1A 5FF3A 3BGGA 1Q6QA 1KBJA 2QCFA 3I65A 4IPJA 3G18A 5CSRA 1L6YA 2V82A 3UY7A 1K7FA 2ZRYA 2B7QA 5KZMA 5LHFA 4MJMA 3W2UA 5FEPA 3C0JA 1QPQA 2PRMA 3N19B 1I2OA 1TB3A 3G22A 1P4CA 1P5BA 2W79A 3W73A 4DBDA 3W07A 1LDCA 1OVDA 3TCEA 4CLMA 5TQLA 4JY9A 3NL5A 3A24A 4UTTC 1F74A 3GXPA 1GPWA 3PBYA 4OWGA 3FJLA 2E77A 1I4NA 5AHEA 2ZRWA 1GG0A 4M6VA 3EX3A 3TC6A 2XN1A 1TMHA 5BW6A 2NUXA 5EA9A 5A5WA 2QR6A 4LVFA 4QM1A 3OVQA 4GFSA 3UYCA 1VC4A 3AO0A 3IV3A 3I6RA 1KFJA 1UUMA 1JCXA 3L5LA 4Q33A 3FEMA 3LDVA 2ZYFA 1YLVA 1Q3NA 1ZFJA 1ME8A 2TRSA 4Z0JA 2PRHA 1VH7A 4R53A 4J9JA 2VFDA 4O15A 4L4LA 5U4NA 1OYCA 1RPXA 5LNWA 1F05A 3BLFA 4IQLA 4UUIA 1QPNA 4JS3A 1JCLA 1TJPA 4N4QA 3WK3A 1ZNNA 1QO5A 1T0OA 1TPUA 3E02A 3FYOA 3KRSA 3V75A 2V9DA 3QC3A 4DPPA 3B04A 4LVDA 1OABA 3NDOA 3NEVA 3WJWA 3GDTA 2RHGA 3W7GA 1XM3A 5F2GA 1VR6A 3CU2A 1I2NA 2QEZA 3M9YA 4FX6M 1VHCA 3CC1A 2HSAA 3EX6A 4N9BA 3W7PA 4EWND 2YGYA 1I2RA 2FQIA 5CG7A 2VFHA 1WA3A 5TIMA 3STEA 4PCFA 3GXNA 4AVFA 3VCRA 5F1VA 4OT7A 5FF7A 4IUOA 1FWSA 2YZRA 3NQVA 1GVSA 4E0CA 3SIZA 4WOQA 3TUUA 3AJXA 3TV8A 2V0TA 3GAKA 2PE4A 5F4XA 2GQ9A 3R12A 4O4VA 3GB6A 3TIMA 3HG5A 3PR2A 2R8WA 4ZQMA 4BI6A 5LGZA 4GWEA 1ZAIA 4LC6A 5KTLA 2NZLA 2Z2UA 1R47A 5LKYA 1VYRA 1K7EA 4ZL1A 3T4CA 2X16A 3IVSA 4NUWA 3W9ZA 1HL2A 1XC4A 2RH9A 3GKAA 5LGXA 4WY0F 4JTFA 3SR7A 4B5NA 1ZAJA 3B8DA 4O4WA 2QUVA 4AEOA 3EEGA 3NQ8A 2V8ZA 3MI6A 4JTHA 3HF3A 1AL7A 3PAJA 2YX0A 4BF9A 1KM5A 5L9FA 2DJXA 4CNNA 1ALDA 4DBEA 3L0GA 1ICQA 3FKKA 2QCNA 3W1MA 1LRTA 1VCGA 1VRDA 3TA6A 4IMEA 4L4MA 3PSVA 2QCDA 4FIRA 5CZTA 1TQXA 4KWWA 2Q8ZA 1SW3A 4LS1A 4E38A 1TRDA 5C2XA 5EPDA 4Y6GA 3NQFA 1SZEA 3HJZA 3NPUA 3TE9A 4ALDA 1FCUA 3STGA 3DHDA 3B03A 3STFA 5HR7A 1WX0A 4OV4A 2E6FA 5HWJA 3N2MA 3M5YA 2NXGA 3W7LA 3HMJG 1ZHAA 4BI5A 2OZ0A 1G4SA 1H51A 1X7FA 3WJZA 1TPDA 4A22A 1GTHA 3IIVA 2RKXA 1W5PA 1KM2A 4JX6A 1JRBA 4IGHA 2RFGA 4NX0A 1OX4A 3DENA 4TR9A 1S3HA 2R94A 3NYZA 3NOEA 1VYSX 2QCMA 1DOSA 4A2SA 2ZZ7A 4P61A 4W9TA 3LRKA 4S2CA 4JN6A 4IX2A 2ZZ4A 1W37A 1ZJIA 3SECA 4QSHA 2V2DA 3P7YA 3TFXA 1PHQA 4XTIA 5LNRA 3FS2A 1YYAA 3HG3A 4HN4A 2FLIA 3ABSA 5U7SA 3WK1A 2YFOA 1M7PA 2QF7A 4DELA 5KMYA 2OMAA 3GYEA 3B4UA 3L66A 1G7UA 2ZZ3A 1K3UA 3UWYA 2Q8LA 4KFOA 2FTPA 3CM4A 1HO1A 2BWGA 1F73A 3GR8A 1N55A 1H7PA 2G95A 2YCEA 1QWGA 1L6SA 4ORMA 3IGXA 3TR2A 3W72A 2Y63A 3LCIA 3TDFA 1H7WA 2CW6A 3O07A 3RLVA 1TJRA 1L2UA 3NQEA 5IM51 2QJGA 2FPTA 2ZRXA 3L0NA 3HIJA 1TTIA 1UUOA 1NFBA 5E0KA 1UB3A 3EXTA 4MYXA 3PULA 4R33A 5AYZA 3A5VA 4A29A 1SR9A 2QAFA 1ICPA 4O12A 4OV9A 3MI3A 5G1YA 3PM6A 3CWOX 3PG8A 3OBKA 3TK7A 1EUNA 4FX8A 1FDYA 4GRSA 5EKYA 4JIPA 5LNVA 4LS2A 4DO4A 2ZQ0A 2B4GA 5CKSA 4N2YA 4NZJA 2Y85A 3PB0A 1JRCA 3LHTA 2CLFA 4N6EA 3THAA 4LVAA 5CPMA 2C6QA 3QSTA 3S1UA 4NVTA 1FWWA 1KFEA 3VFLA 1YTKA 4PEKA 5L6UA 3HBLA 3W7RA 2WPBA 2GVJA 3BO9A 4NJKA 3NPXA 1LOSA 2FFCA 4UMBA 2ATMA 1ZALA 1XBVA 3HGRA 3KOFA 2OJPA 3UZJA 3B06A 1OFBA 3MHFA 3NM1A 3LXAA 1K7XA 3UXDA 1OFDA 3CLMA 1KM6A 1FXQA 4LVGA 4LW7A 5C5YA 1X8FA 3P61A 1OK6A 3FOKA 4O13A 1OYAA 5CZJA 5IBXA 3EX1A 3S1XA 1VYPX 2DZWA 3TW7A 4IMGA 5CZSA 1GVRA 3W70A 1ZY9A 2FPYA 3DI0A 4GE8A 1SQ7A 1QPRA 2VENA 3P5YA 5H2ZA 1B4EA 1I2PA 4UTUA 1LRNA 1ZENA 2E5CA 1O5KA 4M6QA 4UTWA 2W0UA 2F84A 4Z1AA 5J5RA 4Z1CA 3QQ0A 5DN1A 5FEZA 4YL2A 2HS6A 2ZZ1A 1AL8A 1KFBA 1BKSA 1Q6RA 3LGEA 1VGAA 3QMTA 5DXXA 4ICNA 1SSDA 4IPIA 2IQTA 1HG3A 5G4WA 1V5XA 3FJ6A 2C0AA 2B7NA 1TPB1 2G5WA 1VCVA 2TPSA 3QSRA 4N02A 1KTCA 3B0UX 1FWTA 3NNTA 2C16A 5DY2A 3IVUA 4JTEA 3O05A 4IWWA 4KFPA 1WBHA 4IX0A 4UTLA 2RDTA 3V1PA 1NF7A 4O18A 4IMDA 3MHUA 4FIQA 5IBXC 2NUYA 1UBSA 1X1ZA 4IXXA 3A21A 1Q6OA 3OHIA 3O6YX 1OHLA 3NGJA 5EYWA 1TPFA 3LBCA 4ONVA 3P82A 5D32A 2H3DA 1TPC1 2A0NA 3LI0A 3MI2A 4O0ZA 2DU2A 3O63A 3Q94A 1XFBA 4UTWC 4MY1A 1QPOA 3INPA 1NVMA 3CB8A 3NQ2A 4U4MA 4EIVA 1KFKA 2CZ5A 3IIXA 3ELFA 1WOBA 3W7KA 3QRHA 4K38A 4DEFA 1Z41A 1F6KA 5AHMA 4TU1A 2C18A 3W7HA 3TU9A 3QPYA 4DO6A 3W2JA 1W5NA 1O95A 3S5YA 4Y8FA 5F4WA 3GVGA 3P80A 1R30A 1KM3A 1OX6A 1W5OA 3GIYA 1YXYA 4YCOA 3HQ1A 2E6DA 3W1PA 3OG3A 2JBMA 4WD0A 4JNMA 3FYPA 3W7OA 4TO8A 1Z42A 4CNOA 1XDLA 4N9DA 1HO4A 4X3ZA 3L68A 1KM1A 1TPEA 5DBUA 4O14A 4BK9A 4QQ3A 1FWRA 4YWIA 3F4NA 3MBDA 1EUAA 3MUXA 1IXQA 2A6NA 3DKLA 2TYSA 3M5XA 3GNDA 5AYXA 3ANYA 1OFEA 6ALDA 3QMSA 3LHVA 3JS3A 1W8SA 2HTMA 5BRBA 2ISWA 2RDUA 4UTJA 2CZFA 2QCHA 4H3DA 5EL1A 3O1NA 5AC7A 3BLEA 2ZTJA 5EMUA 3NQAA 3S5OA 3UWZA 1SUXA 1M6JA 1Q45A 1Z48A 4NJJA 1DL3A 4C1LA 1IGSA 1H7XA 1EWEA 1VCFA 3BG3A 4JD4A 1FXPA 1T96A 1W5MA 1W56A 4Y9AA 3SFKA 2X1TA 3M6YA 4UMCA 1AG1O 1O60A 5FESA 3DI1A 1TV5A 2H3BA 1D9EA 4E2BA 4HKPA 3G8EA 4LRTA 4CCEA 4PH6A 3GNNA 3DGRA 1R2SA 4HSOA 1P0NA 3QQ1A 3PS7A 3HB9A 1GVOA 1L6WA 4H4IA 3F1QA 3TW6A 3G0SA 1H1YA 3EWZA 1GG1A 5TBOA 4M7SA 3LBMA 1P0KA 3WJYA 4UNKA 1WOAA 3E9AA 3E12A 4RX0A 5LSMA 4OGZA 2ISSA 3RF9A 1KW1A 1MXSA 4FXSA 3LHYA 2YYTA 2V5BA 3U8GA 1KM4A 2YW3A 3Q37A 4A2RA 3I7SA 4DPQA 3TROA 5KZEA 3CEUA 3ZFHA 4AHQA 4BI7A 1SO3A 4UFMA 4WOZA 3BVJA 1JJKA 2AGKA 1H62A 4YCPA 4K6AA 2VEPA 5DBTA 1YPFA 4NT0A 3T40A 4GUGA 2E6YA 2ZFAA 4JDBA 4CQ9A 3S5NA 1M5WA 3HPXA 3P84A 1XBZA 3LRLA 3C3NA 1RQHA 2BTMA 1TPH1 1TIMA 2JGQA 3LCFA 3L2IA 3P62A 3M47A 1MEIA 1BEUA 4WY0A 5HJLA 1DORA 3MW7A 3W2KA 4X9SA 4JR5A 1E51A 1OX5A 4OHQA 3BG9A 4PC8A 5KINA 1FCBA 3W1QA 4MYAA 1N8FA 2FB2A 4O16A 5AN7A 4GC4A 4RZ4A 4YLWA 1SW0A 3G0XA 1SO4A 1RV8A 4JTSA 1WDWA 4Q32A 2VEIA 2DORA 4LUIA 3TJLA 3TMQA 1QMLA 3DFPA 4AWTA 3W2LA 4BR1A 1C9DA 1SSGA 4NXKA 5CPNA 5LZLA 2CLOA 3M5ZA 2FDSA 3MBFA 1YPIA 2Q3RA 3NG3A 4I7VA 3NZRA 1NF0A 4K37A 1FCQA 2JKAA 1W54A 1A5BA 3W6YA 4E2DA 3DFQA 3W22A 2CLKA 3LX9A 3U6WA 3P60A 1P1XA 2Z6JA 4UFHA 4AAJA 1RR2A 3WK0A 3QFEA 5D33A 1VS1A 4XKYB 3KVJA 2OT1A 3G1XA 3STCA 3EKZA 2P1FA 3LI1A 4ORIA 2NXIA 4QISA 4RXGA 3TAOA 4ZQOA 1G67A 2Y61A 1QFEA 3LCGA 5CPLA 1CW2A 4O11A 1FDJA 1T99A 4O1BA 4I9AA 1ADOA 3W7EA 1TPWA 2TMDA 2WJZA 4GXMA 5G2IA 2H8ZA 4QIUA 4HNTA 3CWNA 5DXYA 3OVPA 5CGQA 3A23A 4CQAA 4BWLA 4DF2A 3PB2A 4XWUA 4ZQCA 3EX2A 2ALDA 3TXZA 4K8HA 4ZZ9A 4JX4A 3MYPA 1G4TA 4Y96A 5BMWA 1OG0A 3PBVA 3W7NA 2V5LA 4JXCA 1LLZA 4WXYA 2WNNA 1PCKA 3S9YA 2WQPA 1A50A 2FPVA 2Y70A 3G1YA 2GJLA 2D73A 4GUIA 3R2GA 1SZNA 2VFGA 4AMAA 2NX1A 1QO2A 2YDAA 1YDNA 1MZHA 5HNRA 2ZA1A 4AHOA 4C1KA 4YMZA 4O10A 5F2IA 3ZWSA 3H55A 3CQ0A 2G96A 3M5VA 4N9EA 1W31A 5KITA 4UFJA 1JUKA 3IIZA 4TIMA 3W7CA 4UIOA 4RK8A 3H54A 2O7QA 2DZSA 5I3JA 3T55A 2A1YA 3HGJA 5I3GA 5D04C 2BZNA 4MLJA 4AF0A 1J5TA 4IMCA 4NNCA 3PUEA 1O94A 4K7YA 3G1AA 3W2MA 1DQXA 4IXHA 1LLWA 3QJAA 3UWUA 3CHVA 3LCXA 2VELA 3C4UA 3N3MA 1LZOA 1Z44A 4WQ6A 3UD6A 3TSMA 1G7VA 2X30A 4MPQA 2A5HA 3KFTA 1OFAA 3QZEA 1D3HA 2C19A 5BOOA 3G1HA 3H53A 1V7YA 4MJZA 4KWVA 3W7QA 4LC8A 1PS9A 4HNUA 2VKZG 5G4EA 3LHWA 2A85A 3ATZA 3NL3A 2VFIA 4JEQA 1EEPA 3QEZA 4KFNA 2ZZ5A 3S5ZA 4AWSA 1SU5A 1XBYA 4NZFA 1EX5A 1PHWA 2QCLA 1H7OA 3W23A 2WV8A 5HUPA 3W85A 2A7NA 2QUUA 3TH6A 1LOQA 3NVTA 3GDKA 1H63A 1UJPA 2F7FA 1KM0A 4UC5A 1YDVA 4OQVA 4Z1BA 3UNDA 1JUEA 3NPWA 1TTJA 3G1VA 4PTNA 3RK8A 1KFCA 5D38A 3E96A 4GBUA 1K03A 2XN2A 4NQ1A 3USBA 2E68A 4LUJA 5D02A 3W7JA 1JCNA 3O8AA 2QJIA 2V81A 1X6UA 4PL1A 1EA0A 5DCEA 5AHIA 1VLIA 1DV7A 4XTDA 1IXOA 3I68A 3EWWA 3HO8A 5DLCA 3P81A 3N34A 5MHBA 4M19A 1W1ZA 5LNSA 4ZQRA 1QR7A 2VEMA 4DF1A 1XI3A 2ABBA 3GK0A 4NXSA 3NM3A 3NQGA 1AW1A 1NSJA 3PBUA 4Q4KA 3GLCA 4MZ1A 3MJYA 1GT8A 3GR7A 4UTKA 3UQNA 2PRLA 3LERA 1IF2A 4PODA 3F03K 4H6KA 3TSDA 1VQTA 2EGZA 3CT7A 2FJKA 1EP1A 4X22A 2GVLA 3HPZA 3TJXA 2RDWA 4FNUA 3NQDA 3JR2A 4AB4A 2DZVA 2ZTKA 2UV8G 1J4EA 4O50A 4CNPA 1O4UA 5FF0A 3C2OA 2NX9A 5LNUA 1WV2A 4ADUA 5ABTA 4JTJA 1BTMA 2I9EA 1ONRA 4JTTA 1K8YA 1A53A 3LTPA 4GUFA 2B7PA 3YPIA 3S8HA 5T26A 1R46A 3NXFA 1OK4A 4JX5A 1DJNA 4MVAA 4ZMGA 4HHPA 4JGDA 3TKFA 3A22A 2QCDB 2DJLA 5K9CA 1JUBA 1I45A 3W3OA 2WOQA 3DFOA 2C1HA 4ZQPA 2CLEA 2AQWA 1XUUA 2EHHA 3P8JA 3LLDA 3PSWA 2ZRUA 3HG4A 3HG2A 1PVNA 2Z1BA 4FX7A 1GTEA 1LBMA 3BPWA 1XDMA 1SFJA 3DKJA 4AWUA 2BLEA 2QUTA 3LV5A 3VE7A 1H60A 2E09A 1I8JA 3UPBA 3P67A 2E1DA 4QNWA 4NU7A 2CFFA 4LWWA 2E6AA 3M16A 3W86A 4O19A 4WXZA 5E1QA 3T7VA 3JRKA 1AW2A 1SW7A 2ZRVA 4WX2A 3NL6A 1BWLA 3DHFA 3NQ6A 4XBSA 3R89A 2V2HA 5K4XA 4JTLA 4LS0A 1OX4B 1S5WA 3IVTA 3SGZA 3C2FA 1GQNA 3W2NA 1YTDA 2NX3A 4FHAA 1L9WA 1JCYA 3EWBX 2HS8A 3DU0A 3LTSA 4EF8A 3W76A 5AC8A 5D09A 3L21A 5G2HA 2NV2A 5I3HA 1TRIA 4YXGA 4N9CA 2JK2A 3M7WA 3KRUA 3OIXA 5AHLA 1THFD 4RCXA 1VPXA 2A2IA 4UMAA 5HWMA 4NNAA 1OFQA 1PV8A 3B0VC 3TC7A 1KLYA 4JY8A 2EF9A 3S6DA 4JTKA 2OT0A 5C54A 4IOTA 3MMTA 1MO0A 1GYNA 4DO5A 3MYOA 2Y88A 3TFCA 1PIIA 2QCEA 3NPVA 4RR4A 4JDYA 4O28A 4FNPA 1IIGA 3BGJA 1TTPA 5HUOA 4S1FA 3UY8A 4XQ6A 3DFTA 1XKYA 1LROA 3BW2A 2JKEA 1RZMA 1B9BA 4QAIA 1EP2A 3C2VA 1GVFA 3PF3A 1F6PA 5HMSA 4K36A 4HIBA 4QNEA 5D2VA 1TCDA 1IXNA 3S42A 2NXHA 3VNDA 4Z08A 4O0KA 4JYEA 2E5BA 1WAUA 4FNSA 4DXVA 5H91A 5HINA 1A5SA 3L65A 2QCCA 3TAKA 4RV8A 1FWNA 1GWJA 3OEXA 4RKAA 5AHFA 1AMKA 4WJEA 3W1RA 3IGUA 4O8RA 1MEHA 3MWAA 1C8VA 4DF0A 5K9DA 1FBAA 3CIWA 3LCHA 4K8EA 4RXFA 2XN0A 2J27A 2GPTA 3KVLA 4NJGA 2CZDA 1Q6LA 2ATSA 3F4WA 1DVJA 5I3FA 3G8RA 4JYFA 2Y6ZA 2Z6IA 2NWRA 4O54A 3GKFA 4HNNA 2NLIA 2GOUA 5J5DA 3SSJA 1WYIA 2WSQA 3LLFA 4UFLA 3WJXA 1A5AA 2WNZA 1GJPA 1QOQA 3LTYA 4TMCA 2WKJA 2R91A 2J9YA 2JKPA 2YW4A 1B57A 2I1OA 5GVJA 3SJ3A 3K30A 3FFSA 4FXRA 4UNLA 1D3GA 5KZDA 3S1VA 4O17A 2W6RA 2WSYA 5EBUA 4JTGA 3WJSA 1QCWA 4Y90A 3SY5A 1X1OA 2CLLA 4PL2A 3W7DA 4MFEA 1W3IA 4N4PA 3G1DA 1YXDA 4CCCA 2Y89A 3N9RA 2PURA 5DCDA 2DZTA 3HOJA 4ML9A 3L0KA 3N14A 3MP4A 4RLIA 3TSBA 4GNJA 5F2LA 3CEPA 3W7IA 4ADSA 1M7OA 3EB2A 3R5EA 4MFDA 1TV7A 1I2QA 3RFAA 2X1RA 1FDZA 3VE9A 1OFOA 2YYUA 1OFRA 4AHPA 2OCZA 1H5YA 3SGUA 2P10A 2ISVA 3GAYA 2EAWA 3W1TA 3A9IA 2ZA3A 4FNQA 5FI8A 4MIMA 2WO5A 3EWXA 1VZWA 2G97A 4XZ9A 1EP3A 3TQVA 4UFKA 3G1SA 2GQ8A 2C13A 3NA8A 1TYGA 3N2XA 3TXVA 1JVNA 2VC6A 1TO3A 4MKNA 5E93A 3RNDA 1EIXA 2EPHA 2VXNA 5D2WA 4X2RA 5DY3A 3GDMA 3TNOA 5G5IA 3FIGA 3SZ8A 4MLRA 5D05A 1ME7A 3DFSA 1XXXA 3IEBA 3W71A 7TIMA 2WSRA 4FB7A 4UTHA 1IXPA 1KV8A 4BFAA 1TV8A 4P2VA 4LV9A 3RU6A 4CQ8A 3PUOA 4LRSA 2FB3A 3KAOA 1LP6A 4FNTA 4Z1DA 3LHUA 3W7MA 1W0MA 2FIQA 1HFBA 2Y7GA 5K9XA 2J88A 4G1KA 1AK5A 5FF2A 1F2JA 2QDHA 3W1NA 1JQVA 2O7SA 4U28A 1NEYA 1R2TA 2BSLA 3L5AA 3NZ1A 1MSSA 4M7TA 3OA3A 4AH7A 1PE1A 1F76A 1K02A 2DZUA 2EKCA 3RLUA 3WK2A 4TMBA 3W74A 1UASA 2J9XA 4K39A 4LV4A 1IIHA 3LV6A 4NJHA 3ZR4A 3WFAA 3E49A 1C29A 1S5VA 4IMFA 4MOZA 3ATYA 3IIPA 1Y0EA 3CPRA 3M0ZA 2QAPA 3S0CA 4KKXA 2YSWA 4UCGA 3KHJA 4FEZA 2XFWA 4WZHA 2DZXA 2J24A 3NQCA 3LRMA 5F4SA 4FNRA 4RZ6A 3UWWA 4LY8A 3O15A 1TTQA 3Q58A 4O1AA 4MUZA 3NQMA 4OE7A 5FF4A 3M41A 1RVGA 2VOMA 3C2RA 1AW5A 1GVQA 3KVKA 3LCLA 4DQWA 2H8XA 3W87A 1FX6A 5K7JA 1QOPA 4EVZA 1OFPA 5C55A 3R8RA 4HNVA 3QF0A 1LYXA 1GYLA 4O1CA 3LM7A 4I7WA 5KSWA 4I7UA 4Z0SA 4GUJA 3TX9A 4MY8A 2VFFA 4PA8A 3M44A 1SO6A 2A6LA 1DJQA 2Y7FA 4TX9A 3ABQA 3NQ7A 3BW3A 1JCJA 4O1DA 3IRDA 3N73A 5D2TA 3W83A 5D30A 2C3ZA 4BWLC 3GX9A 1QNVA 3T44A 3DZ1A 3HGOA 2KZHA 4FF7A 1ZAHA 3MHGA 2GQAA 2J9ZA 2ZA2A 3BG5A 3CTLA 3I7QA 2ZZ6A 3UXAA 1DQWA 3ABOA 3IGSA 3M1ZA 1LCOA 1H50A 1W5QA 2QCGA 5D03A 5FEXA 5C6MA 1K8ZA 1BWKA 3QH2A 1DKWA 3G1FA 3I7RA 4JTIA 1G6CA 3LXCA 3HPSA 1YTEA 1CX9A 4QITA 3EX4A 3DXIA 4QJ1A 1JQXA 2Y62A 4FO4A 1W3TA 3KX6A 3FA5A 3BW4A 2A4AA 1J2WA 3UZ5A 3GDRA 2CLHA 1KFLA 3NL2A 1GZGA 3BLIA 3OVRA 5DELA 6TIMA 4WY0B 1XBXA 5G2WA 1WQ5A 2Z0IA 2Y7DA 2ZDRA 3PUDA 3QMRA 3QW4B 5F2MA 3TQKA 4OU1A 4WUIA 1G69A 3G3DA 1XUZA 3B0PA 4O52A 5D2XA 3THQA 4XUGA 4ADTA 3C6CA 8TIMA 1A5CA 3PVFA 1S5TA 3PWAA 5AC6A 1R2RA 4RJEA 2VEKA 3NO5A 4ZVJA 1RQEA 1G4EA 1JULA 1F7BA 3W75A 1XCFA 3D0CA 2ZZ2A 2QKFA 3UPWA 1YXCA 1KTNA 3NAVA 2PC4A 3GDLA 5K4ZA 1OJXA 1ZCOA 2I14A 2Q3OA 2BX7A 1OF6A 5EY5A 3GXTA 3TMLA 2X1UA 5I3KA 1QAPA 1WXJA 1G4PA 1LTDA 1T8XA 2GVGA 4MZYA 3P8IA 5HWNA 1H61A 3W1XA 2V30A 3PY2A 4LTSA 2BXVA 4NNBA 4OBTA 4MY9A 3T78A 1O5XA 1OYBA 1VJIA 4RZ5A 3QYQA 4HPXA 1PL9A 2A7RA 4M5PA 5FEWA 1SFLA 4UR7A 2E5DA 5AB3A 2GJNA 1W3NA 3EWUA 2ZRZA 4A21A 3W1UA 2Y7EA 2LLEA 3W1LA 2J6XA 1FUYA 1KA9F 5CSSA 4JIQA 2QDGA 1PCWA 3E0IA 5DCBA 3NR0A 1ME9A 4UFIA 3P5ZA 3Q2DA 2YPIA 4EOUA 1DBTA 4IJBA 4UR8A 3PBWA 5D37A 3EKLA 3BARA 2PCQA 2OX1A 3GZ3A 4N6FA 2QJHA 3C52A 2B7OA 1KTBA 2TSYA 3MP3A 4JICA 3ABRA 3FKRA 5I3IA 2NUWA 4PFMA 1XL9A 4O53A 5F1UA 1TREA 3C8FA 5A8GA 5AFDA 4LU0A 3C56A 1FQ0A 5BMXA 3RMJA 1SO5A 3U2OA 2C14A 4LOCA 3VI2A 3BK0A 3L9CA 1U83A 3DFNA 3W84A 1JR1A 1YDOA 5BNKA 4UTMA 1HTIA 1DHPA 3G3MA 1LM1A 5G1TA 5HULA 3KVMA 4POCA 1SPQA 5HQEA 3ZS4A 1GOXA 1CI1A 1EWDA 1VHNA 3LXBA 3HGSA 4HPJA 1EPXA 1KV5A 2CZEA 2CWNA 2A21A 2YR1A 3DBPA 3B05A 1TPVA 2V2CA 2B0MA 4LVBA 2AAMA 3DAQA 4HSNA 1N7KA 1RD5A 3PG9A 3C2EA 5K2ZA 1B4KA 3A5FA 4HT3A 2ZBTA 3O6CA 3O16A 4AF0B 3CIXA 3L5MA 2ZCGA 2C15A 2WNQA 3LB0A 1KBIA 3SW6A 2GUUA 5CPOA 1TSIA 1GEQA 4EF9A 1JCMP 3PC0A 3EWYA 3SI9A 5K3VA 4A3UA 1TQJA 2NWSA 3KXQA 1OF8A 3O06A 3C61A 3R13A 3DH7A 1RQBA 1SZGA 4NX5A 1FCVA 2H90A 3M43A 3LHZA 5D2YA 1LORA 3G0UA 2P0OA 3QPZA 2H6RA 2VFEA 2YFNA 1HUVA 1EB3A 2CLMA 2DZPA 3ZWTA 5AYYA 2CU0A 4XKYA 3MP5A 3TQ0A 4R7JA 3BV4A 4S2BA 4AXKA 1B3OA 3MO7A 1LOLA 5AOUA 1NAL1 5HR6A 3L67A 2NV1A 2X2GA 4R34A 1K8XA 3EXSA 4MZ8A 2CLIA 4K7VA 4XBKA 4D2JA 5LHEA 1LRQA 1LBFA 3IIOA 1WBJA 2ABAA 2R14A 4NJIA 3FLUA 4M6PA 3O6DA 4JYDA 4GUHA 4JTUA 1H7RA 3P74A 4LT9A 1SZFA 1YADA 4LNYA 3UWVA 1KLZA 3G24A 1FY6A 2YXGA 5AHNA 1VLWA 3QW3A 3QM3A 1H7NA 1QDSA 4UTTA 3KRZA 3UWQA 1MEWA 2X1SA 4UXDA 5SWUA 4UTIA 3W1AA 1ICSA 1U5JA 4O57A 4ZQNA 1H1ZA 3S1WA 4CCDA 3LOTA 2A7PA 3LCWA
chains in the Genus database with same CATH superfamily
3LG3A 3EXRA 1MUWA 4M8UA 3AXIA 1ML1A 3F4DA 3GO2A 4F66A 2JGYA 4DJFA 1XINA 3BGGA 3GG0A 3RM8A 3GFXA 1ESWA 1BYAA 5CSRA 2NVCA 1L6YA 1OCQA 4F40A 3EMQA 2B7QA 1C7TA 3O0KA 2B81A 1WP6A 2PDQA 2Y24A 1X38A 2NQHA 4J28A 4AD5A 2R82A 1R3VA 4C6FA 3ARUA 3G22A 2BV9A 3W73A 4RW3A 1DJIA 3UERA 1AUSL 4CLMA 2BB0A 3B8WA 1CLKA 4JY9A 1VFFA 1LWIA 4IT1A 3UXLA 2A3CA 2W92A 3TYUA 1GG0A 3QV8A 3TC6A 1PZ2A 3PWIA 1FWJC 2NT1A 4GFSA 2OX4A 3QPEA 1BG4A 3AIWA 4DJFC 2HE8A 2VC5A 3I6RA 1UUMA 3L5LA 2ZYFA 2BGSA 1YLVA 2VZVA 1UH2A 1W1IE 1ZFJA 4DN1A 3LGDA 2PRHA 4YVXA 2ZE3A 4L4LA 1RPXA 1D3CA 1F05A 4IQLA 1AODA 1QPNA 4JS3A 1JCLA 4N4QA 1QO5A 3VK5A 1T0OA 1TPUA 4FA3A 1UOZA 1KQYA 2PUZA 2V9DA 1EIBA 5I78A 1OABA 3NDOA 2OO6A 2OWCA 4M6UA 2RHGA 4H8NA 1W3HA 5HOSA 3QYSA 2QEZA 1VHCA 2Z28A 3TN5A 1E73M 5T91A 4N9BA 1HXJA 1W17A 3EB4A 4CN4A 5TIMA 4E6MA 2J7GA 1JZ3A 2E9BA 5F1VA 1RJRA 5FF7A 2G3FA 2YZRA 3TTEA 4E0CA 3SIZA 3MSDA 4WOQA 3GIPA 3NZQA 4S3CA 3N15A 2GQ9A 1B3VA 1T6MA 3TIMA 2IXUA 4PULA 4JEJA 4ASTA 4X60A 4GWEA 1NDZA 1P0EA 4LC6A 3IJ7A 2J75A 1R47A 1GQJA 3FK4A 5I02A 4HGXA 9XIAA 2WVSA 3UZYA 1OIFA 3IVSA 1MQQA 5LGXA 2OLAA 4JTFA 1ZAJA 4F0KA 3B8DA 4O4WA 5TNVA 2QUVA 3NQ8A 1DP0A 1EHAA 3WFZA 5L9FA 1Z8AA 3R79A 2DJXA 6REQB 3GXDA 3M0MA 4F9DA 2R1LA 1XGEA 1ICQA 1GZ1A 4GI8A 3KDNA 3PJWA 1AH3A 3GY1A 3R4IA 3TA6A 3UR5A 4IMEA 3DHPA 4KCVA 4L4MA 3BAKA 3VFCA 2QCDA 4ERAA 1GW9A 2Q8ZA 3WLJA 4J3VA 5C2XA 2DIEA 3SURA 4W88A 7XIMA 4UOZA 1VKFA 3T42A 4NAFB 3DHDA 2E6FA 4CU8A 3N2MA 3HMJG 3MJMA 5AY7A 1Q6DA 5JUVA 1H51A 1YMYA 4A22A 2Z00A 2I7GA 1W5PA 4JX6A 1JRBA 1M68A 2XUCA 4FXJA 1PWMA 1S3HA 5FJTA 2R94A 3NYZA 4GZ7A 4AZ5A 1GQIA 1DOSA 4J4KA 2QLYA 4Z1YA 3LRKA 3TTSA 4QS6A 2WJEA 3UESA 3QGVA 2V2DA 2D3NA 2YB4A 3P7YA 3WH7A 2BDQA 4U31A 3WNPA 2J47A 4HCLA 2EXOA 2YL8A 3ABSA 5D9NA 5U7SA 3WK1A 4RL3A 3CPUA 4S38A 2OMAA 4AEFA 3WMBA 4ZB2A 3IGXA 3IAQA 3BLOA 3TR2A 2GGGA 3W72A 2Y63A 1AMYA 3UU0A 4H41A 1GW1A 1L2UA 4P7QA 2ZRXA 4JTCA 2YXOA 4DBUA 3OGVA 1KB3A 3HIJA 1NFBA 5XINA 1KO0A 2ZICA 3KTCA 3PULA 4AZCB 3WUFA 2VWSA 4A29A 4OV9A 2JALA 1NOFA 2DSUA 3PM6A 2C7FA 1KRBC 3M0LA 3ES7A 3PZTA 3TWBA 1E0UA 3WLIA 2B4GA 1AH4A 4UQAA 1A5NC 1DPMA 4TVUA 4C6PA 3MWCA 4GKTA 2P88A 1J0IA 1TV4A 1DQUA 5FKYA 2J7BA 4O1FA 1JZ6A 1EC9A 3HBLA 3ITGA 4H9XA 3AXKA 3W7RA 1C91A 4AYSA 3BO9A 3ZMRA 3NPXA 4B15A 5A2CA 5DRIA 3UZJA 3B06A 2QW5A 2Z4GA 3MHFA 3NM1A 3LXAA 1K7XA 4Q4OA 3W24A 3UXDA 1AJZA 3COTA 2XGBA 4LVGA 1IZKA 3FOKA 4FF5A 4MB3A 1JDDA 2VDGA 5CZJA 1RCXB 5HA7A 5IBXA 3S1XA 1VYPX 3TW7A 4PCNA 1E55A 3AWOA 3W70A 1UC4A 2Y8UA 2FPYA 1VF8A 5MF5A 1B4EA 4LEFA 2GDVA 1HKIA 2OVLA 2PTZA 2E5CA 1TR9A 3AMCA 5J5RA 4LYKA 3TC3A 5DN1A 4KEVA 2HZGA 1K1DA 2ZZ1A 1AL8A 1KFBA 2Q71A 1VGAA 3WF1A 2FMNA 2PGFA 3T4WA 1MQPA 4IPIA 1C7SA 3AIUA 1QJWA 2CBJA 4TV5A 2B7NA 3KE0A 1VCVA 1US0A 3EDJA 2OPJA 3B0UX 2UZ9A 3NNTA 5DY2A 5M1TA 4UTLA 3VMPA 2RDTA 4S23A 3P6LA 8XIMA 1NF7A 4DJFD 3U2EA 5EMKA 5ECUA 5IBXC 1EO5A 1X1ZA 3TYZA 1QASA 2XHYA 3LBCA 4HU4A 3BZJA 5D32A 4D71A 3RX3A 1HW6A 4O0ZA 2IQDA 1XFBA 1SGJA 5HMDA 1NVMA 2QZRA 4U4MA 3BICA 3IIXA 3ELFA 3VD5A 4DJEA 3QRHA 4DEFA 4F48A 3IJQA 3CZKA 2C18A 3E38A 3FEQA 1LQAA 3W7HA 1W5NA 3S5YA 7TAAA 1BVNP 1L2QA 1OX6A 1W5OA 4KQNA 4F0HA 4ROPA 3GIYA 1TA3B 2E6DA 1XLEA 3B8IA 4WD0A 3CQJA 4N9DA 3UA4A 3L68A 3CUIA 4QE5A 5BRPA 1KM1A 4EWJA 5DBUA 4BK9A 4N0RA 1FWRA 4YWIA 5I7GA 3F4NA 3MBDA 3EPOA 3MUXA 4ZTXA 1GOIA 3DKLA 3LK6A 3UGRA 2QNEA 3QMSA 4XO7A 1H0GA 3N25A 2J13A 1FHVA 1LG1A 5BRBA 1BRLA 2ISWA 2RDUA 2CZFA 1J8VA 5HNNA 3O1NA 3BLEA 3O3RA 2ZTJA 4GKLA 1D8WA 3F5LA 3SRDA 1SUXA 1XCXA 4S3AA 4AZBA 3LEPA 1DL3A 1EGVA 2YBVA 4CKQA 3F4CA 1FXPA 1T96A 1W56A 3SFKA 3H7RA 4IIFA 1AG1O 4PCSA 5FESA 1TV5A 3S2LA 2H3BA 5J04A 4FOKA 4XZWA 4LRTA 4CCEA 4W5UA 3SM0A 4ERIA 3G0SA 1TZ7A 2PDJA 5HATA 4R85A 3RILA 2BOGX 2PGWA 1GKQA 4PBEA 3M0IA 2H9AB 1WOAA 3E9AA 4RX0A 5LSMA 2BVTA 3M0KA 4OGZA 3P0XA 3CO8A 3IAPA 3H8AA 4FXSA 3LHYA 3RO6A 2YW3A 3Q37A 4DRSA 4A2RA 1O1ZA 1F3TA 2GFTA 4K2SA 3ZFHA 8A3HA 4WOZA 1JJKA 3STPA 5DBTA 4BZYA 5DRCA 4NT0A 3WQ5A 3SQSA 3ZJ8A 4I6VA 2D2GA 3S5NA 1M5WA 4FZIA 3DDMA 3M47A 5I77A 1JL8A 3GSMA 4JIRA 2XIIA 3W2KA 3APGA 4JR5A 3V3WA 1E51A 1WKYA 5ABGA 1TVPA 3ZT5A 4WEVX 3TOYA 4W5ZA 1E4NA 4YLWA 1RV8A 4JTSA 1WDWA 4C91A 3K8KA 3W6LA 1AFSA 3VKKA 3K1GA 4AWTA 3NZPA 4KETA 5C9XA 4BR1A 1C9DA 1K6AA 4GK8A 4NXKA 5CPNA 2Y5JA 2VGFA 3WQEA 3GZAA 3BUVA 4C6BA 1NF0A 4K37A 1PPIA 4Q8VA 4I6KA 1FCQA 4GY0A 4HYRA 3CK5A 3OBAA 4ZR8A 4MJ2A 1YW1A 1WCGA 3RCYA 4E8GA 4E2DA 3AHYA 3TN4A 1HT6A 1M7XA 2E8YA 3ZM8A 4AAJA 1PTDA 1RR2A 1NFGA 4XKYB 3G1XA 3VPLA 2IXVA 1EJVC 4GY7A 2NXIA 4RXGA 4ZQOA 1G67A 4DX3A 1DWHM 1WXZA 4O11A 1FDJA 1XLDA 2ANUA 4KCTA 3OVGA 4O1BA 4I9AA 3DFHA 4GVGA 2FVLA 3MUCA 4LYPA 1JYWA 5I23A 1ZU8A 2GJPA 3RR4A 1TPWA 1CNVA 2TMDA 2WJZA 4S3JA 3C3UA 3URNA 2WKGA 4CQAA 1H09A 1C8XA 4BWLA 2WC4A 1MRQA 4ROQA 3UG8A 2XIBA 2J7EA 4RW5A 5MKGB 2EQDA 1TMLA 2V5LA 1LLZA 3W53A 1PCKA 2FPVA 4AY7A 3WUBA 3G1YA 4F0MA 1JI1A 1PYMA 3R0KA 1PKMA 3GC5A 7PTDA 4AMAA 1YDNA 5HNRA 4R3UA 1E1EA 1RCOB 3VOFA 1NDWA 4O10A 3HFYA 1UP0A 3ARQA 1ODZA 3FV9A 2JIEA 4LUTB 3WF2A 4TIMA 3W7CA 4UIOA 5I07A 1MW1A 1V4YA 1Z6KA 3MSGA 2A1YA 5JIWA 5I3GA 4ZOEA 5D04C 1JI2A 5ECVA 4UOJA 3WLTA 5I06A 1J5TA 3GTHA 4NNCA 3WDJA 2PWUA 1LL4A 3CL8A 4CQBA 2PDCA 3R0UA 4LCSA 1LZOA 2X30A 4MPQA 3WLSA 3DECA 3KFTA 4XAFA 2OQYA 3VU2A 1QVBA 3QZEA 2X0SA 4WSKA 2PDHA 2ON3A 5BOOA 4LNCA 1LL7A 4MJZA 2V3DA 1V3KA 4LC8A 1PS9A 4GD0A 4GIAA 1EYEA 2A85A 2VFIA 4JEQA 3PPGA 4KFNA 5CJMA 1VENA 3TYCA 1EX5A 4BQ5A 1ZGDA 3E2QA 3RPTA 1EDQA 2WV8A 2A7NA 2QUUA 3TH6A 3NQBA 4DXKA 3NVTA 3RPDA 1VBHA 3EA3A 3T0DA 1GHRA 3PP7A 1F9CA 3NPWA 3WQDA 3RK8A 1BD0A 2VWTA 3W28A 1XSJA 1E4IA 4BCEA 2QJIA 3TN3A 1EA0A 3ME3A 2POZA 3DERA 2VZTA 4XTDA 4PCTA 1WDDA 4M19A 1H3GA 4ZQRA 2DH2A 1A5UA 3BCFA 3GK0A 2ABBA 4NXSA 4AC7C 1B2YA 2VX7A 3NQGA 1AQMA 3URQA 1PX3A 1TFVA 4DJED 1GT8A 4UTKA 4DLMA 4XKMA 2DSWA 2CKRA 4YYCA 4PODA 3AIRA 3W6MA 3TSDA 3CT7A 5LA2A 3VCNA 2FJKA 5AZ1A 3HPZA 3S2NA 1XIIA 4FNUA 1V0KA 4BEUA 2ZTKA 2UV8G 1J4EA 1O4UA 4X0VA 4L61A 5FF0A 3C2OA 2NX9A 3OOQA 4ADUA 3B9DA 2I9EA 1K8YA 4GX8A 4GUFA 1UZ1A 4MWAB 1ELSA 5A6MA 3G6LA 1JNEA 1N2VA 2Y5SA 3SB0A 1DJNA 3IJ9A 4ZMGA 1JYNA 2REQA 3ZOAA 3U7BA 2WCGA 2ZUUA 2XGZA 3AHTA 4C6LA 3HG4A 4KEZA 3IANA 1LBMA 3BPWA 7ODCA 3VE7A 5BXTA 3AJ7A 1DE5A 2CFFA 1EJTC 3Q4DA 3PANA 4XV0A 4O19A 4WXZA 1IZCA 3JRKA 1I6NA 3GNOA 1E5NA 3GTXA 3A3HA 3NQ6A 1DTNA 4R88A 4XBSA 4JTLA 2HWGA 1RJQA 4AVOA 4LAZA 3KL0A 4WRHA 3W2NA 1L9WA 1JCYA 1AVAA 3WSUA 1BVZA 2CLPA 4O0QA 3LTSA 1X1NA 1EYWA 1E0TA 1ISXA 1KXQA 5D9PA 5BOFA 4N9CA 1NU5A 1KXVA 2D22A 3M7WA 1WDRA 3KRUA 5T9CE 1V8EA 1THFD 4XIMA 5HJXA 4RCXA 4IIBA 3B0VC 1PIFA 5C9UA 4KWSA 3S6DA 4ZO9A 2GGJA 3MMTA 1MO0A 2AOSA 4LGXA 2Y88A 3TFCA 3NPVA 2WCAA 3F5KA 5A6JA 4JDYA 4O28A 1V0MA 3T2PA 5BZAA 1KR0A 3BW2A 1RZMA 1U1HA 2EPMX 3BQ5A 4CD5A 1AD4A 1EP2A 3PF3A 4IM4A 5E6YA 3LMZA 2QDEA 4HU8A 1TCDA 1XH2A 1J0HA 2E5BA 1XV8A 4ICMA 1J5SA 1OADA 1UWUA 4NZ4A 4HHHA 3OYXA 3HV8A 3U2ZA 1MEHA 5I09A 2Y4SA 3IPWA 4QG9A 3IUIA 2J78A 3LCHA 4FLSA 3HPAA 2XN0A 3KVLA 4NJGA 2XZ9A 4HD5A 3WENA 4B5VA 3F4WA 1X39A 1RLCL 3G8RA 2Z6IA 2NWRA 1UYQA 3RM4A 4O54A 3IK2A 1W9BM 2YA2A 3VINA 2PP1A 4F0SA 2VCBA 4QJ5B 5E9AA 2WM1A 1E6NA 1S1PA 3WJXA 1E71M 2PZNA 3LTYA 4TMCA 2WKJA 2J9YA 3AMKA 2JKPA 2V3EA 2P3EA 4NY2A 2I1OA 3WH5A 4W89A 3K30A 3FFSA 3TYBA 1RK5A 3PTDA 5FJJA 1S2WA 3QHNA 5KZDA 1OGBA 2VI0A 3WJSA 2W6RA 2WSYA 5HBFA 1ZBKA 2XIQA 4R7WA 3WNLA 1A3HA 1LF1A 2R6OA 3H26A 2VZUA 5DCDA 2HEJA 3L0KA 1RK6A 2ACSA 3MP4A 4RLIA 5F2LA 4H7ZA 3CEPA 3RU8X 3ITCA 5DEZA 1UWIA 3R5EA 1TV7A 5GJNA 3RFAA 4LB4A 3VE9A 1DE6A 1OZQA 1S1RA 2OCZA 3F2CA 2ISVA 3KOYA 3W1TA 4DWDA 3A9IA 4YVPA 4RZBA 4OOZA 5LA0A 4PMQA 1WZKA 4GVHA 2FGBA 2G97A 4XZ9A 1EP3A 1VEOA 4UFKA 2PP0A 4V28A 1UWAA 7A3HA 2C13A 2J25A 3TXVA 4DM1A 5C0QA 1E6ZA 1EIXA 1WZMA 4PRTA 2OZ8A 4QLLA 3SZ8A 3LQLA 5XIMA 3DFSA 1XXXA 3OHMB 2WVVA 1Q4NX 1DIKA 4UTHA 3A4JA 4PMNA 4P2VA 1LQ0A 1PSCA 1A4MA 2FB3A 4FNTA 1LP6A 1DXEA 4NL1A 1A5LC 2YB1A 4DIAA 4XAGA 1TX0A 1VRXA 4PUKA 4G1KA 1AK5A 2ADAA 5FF2A 4XZLX 1ITCA 1GVIA 1JQVA 2VRQA 4U28A 1NEYA 2E0PA 2Z24A 4JTDA 3RRAA 2GWNA 2WLZA 3IJIA 4M7TA 3S9IA 4MNMA 4W4QA 2EKCA 3WK2A 3MCOA 1CGTA 2WVUA 4DM2A 1XRVA 2FFIA 4LV4A 2VR2A 3LV6A 4UZSA 3WFAA 1S5VA 3H22A 1XQLA 3S0CA 1ONXA 3H21A 1JF6A 3LENA 2F2KA 2J7DA 3NQCA 3LRMA 1KCLA 5F4SA 5A94A 3ONCA 4H7CA 2PZ0A 3Q58A 4O1AA 1UIOA 4MB1A 3NQMA 3O2LA 2VOMA 3LCLA 1GVQA 1PZ0A 4FMVA 1OSEA 4KEMA 3W87A 2EPLX 2ISDA 3QF0A 1VFLA 2QMJA 3KHDA 3QLDA 4I7WA 1UP2A 3TX9A 1ITUA 2I16A 3CH0A 3M44A 4MTVA 2A6LA 3NCOA 1JCJA 4O1DA 5D2TA 1F6YA 4GOAA 3GX9A 3GC4A 3HFTA 2PGEA 1G5AA 1IEWA 1GUVA 4Q8TA 2ZA2A 3ZT7A 2ZZ6A 4LBRA 1V77A 2QPXA 1JG9A 1RHCA 4JHMA 1NWTA 1H50A 2QCGA 4IFKB 2Q6ZA 4DZHA 1DKWA 3H4WA 1A0DA 3FAWA 1CX9A 3MZNA 2CERA 5C2GA 3TTYA 1RP9A 4QS5A 4QJ1A 4J3WA 4C6CA 1HNYA 4ATWA 3BW4A 4GQGA 4B90A 3GDRA 4GI4A 1KFLA 3BLIA 2ASHA 4I3GA 3OVRA 3CWHA 2XIJA 4WY0B 2A3BA 3UF9A 1XBXA 4LUSA 5G2WA 3PZUA 2Y7DA 3I10A 3VUPA 1G69A 3G3DA 1XUZA 3PPCA 3K4AA 3B0PA 5D2XA 3C6CA 8TIMA 1A5CA 1S5TA 5AC6A 4ZSTA 1RQEA 4ACZA 1JULA 1F7BA 3W75A 3D0CA 1EZWA 1DEDA 4PUEA 3CB3A 1KTNA 4Q4RA 4PYSA 4B5TA 5EY5A 2GZXA 1QAPA 1G4PA 1LTDA 1MW3A 3WLKX 4XZBA 3W01A 1R9YA 1O5XA 5IXEA 3QTPA 3RHGA 2G3IA 3EZ4A 4ZOCA 2ZIDA 3KOZA 3U57A 2GJNA 1W3NA 2ZRZA 3N18A 1V02E 2LLEA 4B3ZA 2XTKA 5DMYA 5A95A 2WJFA 3V0TA 3IS4A 1R8LA 2X41A 2QMKA 1S2CA 4WGXA 1UR0A 4J3TA 5A8PA 3S5SA 1VFHA 4ZB5A 3S6TA 3Q2DA 2WCSA 3GHRA 4YPJA 4IJBA 4UR8A 1PYFA 5DMMA 3EKLA 3AYVA 3BARA 2OX1A 3GZ3A 2TSYA 3MP3A 2P50A 4AUBA 1XL9A 3VGGA 5AFDA 2Y2WA 3SCOA 5HDRA 3C56A 3B9AA 4WDWA 3VI2A 3W84A 2XM2A 3WFLA 1RALA 2J8FA 5I03A 3EEZA 3G3MA 5G1TA 5HULA 3QN3A 1SPQA 5HQEA 4OTKA 2WZIA 4NAEB 1CI1A 3WH8A 1UR2A 2W91A 3T0CA 1M41A 3BJFA 2YCLB 2E8ZA 2A21A 3A3XA 1UQYA 4LVBA 5E0FA 3VZYA 3DAQA 2MANA 4WLCA 3LLXA 1WZAA 1KXHA 4HNOA 3C2EA 4HT3A 1FHDA 3O6CA 4KERA 1JFHA 3VX0A 4IG2A 1DXFA 3RJYA 4AF0B 2E9LA 2XIMA 3MY9A 2FJUB 1KBIA 1E6SM 4Q8WA 4GZIA 1GEQA 5FA5A 2GJXB 4RDWA 4E4UA 5K3VA 4JN8A 2OO0A 3VZXA 3KXQA 4PTWA 1SJAA 3FNDA 3EOLA 4NX5A 1BPLB 1W3LA 3P3BA 1NQKA 3IARA 3GUGA 5KEZA 4Y9MA 1CCWB 1QBAA 2D20A 3FN9A 3C5QA 3U4FA 4EACA 4JPGA 3KBWA 2VFEA 4HHLA 4V27A 4ZOBA 2C1GA 3AALA 1A0CA 3C86A 3EPMA 4IIHA 5JIPA 5CCZA 5A6AA 1B3OA 1ZLPA 2E28A 4YHGA 4ZENA 2NV1A 1Z89A 2X2GA 4R34A 3OZOA 4MZ8A 4K7VA 4D2JA 2CHNA 1LRQA 2NT0A 2WBGA 3IGHX 1WBJA 4HZ7A 2R14A 4D6GA 4M6PA 4JYDA 2FH8A 4JTUA 2QT3A 1POJA 1E15A 1SZFA 4LNYA 1KLZA 3G24A 2G37A 2YXGA 2INEA 3QW3A 1QDSA 4UTTA 1MEWA 4M56A 4UXDA 3W1AA 1ICSA 1CYGA 4O57A 3S1WA 3PZGA 3U3HA 1V02A 5FL0A 3LQGA 3RR1A 1LBLA 1F5ZA 4GJ1A 5FF3A 4W7UA 2XH0A 1KBJA 2DPEA 4Z17A 5A2BA 4PMXA 3VDGA 1TR1A 1XRTA 4QDMA 1L8NA 1W3JA 3UY7A 1K7FA 1MZRA 5LHFA 2DVUA 3BH4A 1HJSA 1JPKA 3QY8A 2PRMA 1TB3A 4K8GA 4Y2WA 1P4CA 4AVNA 4DBDA 1LDCA 4AY1A 5TQLA 3MT1A 3KOWA 3A24A 4UTTC 2PTWA 1PTGA 3GG8A 3FJLA 1J11A 2E77A 1I4NA 1W8GA 1J2BA 4Y8EA 4DWSB 4HP5A 2PGRA 5BW6A 2NUXA 1Z69A 4WKAA 2Z7GA 5JBFA 1KGXA 1VC4A 4Q33A 2GUYA 3LDVA 1CLXA 1Q3NA 1ME8A 4EP8C 4KGJA 3WDRA 4Q8MA 3FSTA 2GK1B 4D6EA 1U33A 3UR8A 2GL5A 5EMLA 4QEEA 5LNWA 4KRTA 1X97A 4TVDA 2VUYA 4BF5A 4AEEA 5FOOA 4JQ3A 3E74A 3QXBA 3REQA 4JN7A 3FYOA 3KRSA 1DIEA 3FA4A 3NSMA 1EXPA 3KW3A 3GUWA 4HK6A 2I57A 2XSBA 3NEVA 3VNYA 3WJWA 4E3VA 3GDTA 4V33A 3W7GA 1XM3A 1VR6A 3KCLA 1JZ7A 4P7OA 5FJUA 4P7NA 2EPKX 4FS9A 3DC0A 1UA3A 3EX6A 5I5RA 5DO8A 1UD4A 3DEQA 2YGYA 1I2RA 4XD3A 1UWQA 4PZVA 1UROA 1TCMA 4IICA 3NDYA 3WYZA 3GXNA 3VCRA 5C8BB 4OT7A 2CBIA 1FWSA 1AH0A 3QOKA 3VVGA 2G3JA 4NZ3A 3L4WA 1CPUA 4HNCA 1HJXA 3TVAA 1XYFA 2PE4A 1F61A 3N6JA 3R12A 5F4XA 4H6EA 5LIUX 2BHUA 3UETA 1JPHA 1UR1A 4XZMX 2R8WA 2WC3A 1O1HA 1WAWA 1ZAIA 5KTLA 3WKZA 1VYRA 1K7EA 4ZL1A 2W63A 4Z2IA 1XD0A 1XC4A 3DBNA 2VRJA 3L4XA 4YU1A 2VTFA 4HPNA 3THCA 3AYTA 4XO6A 1ISYA 2I5QA 5DQPA 3BV7A 4KESA 2V8ZA 1FP9A 1JZ2A 3PAJA 3GD6A 4BF9A 4H7VA 2WHLA 1HL9A 4CNNA 1ALDA 3M0HA 4DAIA 1FHUA 3BAWA 4DBEA 4Q8OA 3QR3A 2QCNA 1BF2A 4HOXA 2NQ5A 3AXXA 4B2DD 5CZTA 1TQXA 4FXFA 2OEMA 4E38A 4Y6GA 3KTSA 3VGDA 4DYKA 6PTDA 1SZEA 3DG7A 3HJZA 5BYWA 3MMDA 3BTNA 1G1YA 5A3HA 1B3ZA 1J0ZA 3MTWA 4J1OA 4OV4A 1CTNA 3VD3A 3AIEA 3EKGA 3W7LA 1J0YA 4I5XA 4JQ4A 4IIGA 5CXPA 1ZHAA 5XIAA 1E1CA 1X7FA 3KWSA 2EJAA 4AWEA 3VIMA 1GTHA 2Z2AA 2OGJA 2XVNA 5T8GA 4ZFMA 4ZA0A 1OX4A 3SAZA 3DENA 3VNZA 2O9RA 3NOEA 4IL2A 2QCMA 2WVTA 1REQB 1UUQA 4A2SA 3PJTA 3MKVA 4P61A 4W9TA 4AFYA 4S2CA 4EK7A 2F6XA 2ZZ4A 1XYLA 4F4RA 1U5VA 3LA4A 2PCEA 1VPYA 1YYAA 3FS2A 3VYLA 3EAUA 5FSEC 2FZMA 2OFJA 4NZCA 1BXNA 4AZGA 2QF7A 5KMYA 3FJ4A 4CN1A 2Q8LA 3CM4A 3E2SA 4JNYA 3R94A 3VKAA 4ORMA 3CUFA 2PAJA 3GQYA 1H7WA 5CSYA 3AIQA 3GVRA 2ZUSA 3R11A 1JZ8A 4W8AA 4PTMA 1HX0A 2V5DA 3SQMA 4R33A 1SR9A 5IHRA 1ICPA 1E56A 5B7ZA 1XW8A 5FAJA 3CWOX 3E1F1 4LS2A 1JGMA 1HKJA 2OOFA 2Y85A 1M03A 4H9YA 2F8QA 2FZ9A 4KIEA 2FMOA 3TA9A 4N6EA 4GPNA 3CAWA 1R3TA 3VNMA 3WF0A 7ENLA 5JH1A 2C6QA 3VD7A 4NVTA 1FWWA 1BVWA 3VFLA 3BWWA 5CSUA 2O55A 4PEKA 5L6UA 2BVWA 2GVJA 3ITTA 3AU6A 2FFCA 3M46A 4UMBA 2OR2A 1F07A 1RH9A 1XBVA 3HJEA 2OJPA 1JYVA 4O8AA 1OFBA 3DCPA 5DMNA 4MPKA 1OFDA 2NW0A 1FXQA 4LW7A 5C5YA 1OK6A 4O13A 1EOKA 1IZJA 2INZA 3EX1A 1U1UA 1SQ7A 4QQUA 3NTYA 3F2DA 4U5KA 1M65A 4GYJA 1WKFA 4BEQA 1I2PA 1ZENA 1O5KA 2YBUA 1OB0A 4M6QA 4UTWA 2F84A 1E6QM 3QQ0A 3MSYA 2R9RA 4AIEA 1BKSA 4CVWA 4AISA 2VZSA 1Q6RA 2VT0A 3LGEA 5DXXA 1HVXA 3SGGA 4ICNA 2IQTA 1XSKA 3FJ6A 2HVOA 3FXYA 2C0AA 4HCDA 3OTRA 3S46A 1TPB1 2G5WA 4WF7A 2FZDA 4GO8A 3CXOA 4N02A 1W9XA 1EXBA 4J27A 4GJJA 4LSBA 3IVUA 4JTEA 3O05A 4KFPA 5TF0A 4O18A 4IMDA 1CB7B 4XX6A 3MHUA 2NUYA 3OZYA 3ARSA 4IXXA 1XIGA 3EYPA 1Q6OA 4H19A 1FOBA 4Q4SA 6XIMA 4U2ZA 4C1NB 4JKLA 4ONVA 3VDBA 1SFSA 1TPC1 4DVOA 1WE5A 1GGOA 1UH4A 3O63A 4UTWC 1QPOA 3PHAA 2GDUA 2GLKA 1WOBA 3W7KA 3CHFA 3O6AA 3CAVA 5AHMA 4TU1A 3TU9A 4MUPA 4DO6A 3SY1A 1O95A 1V08A 3I3DA 2D2HA 4Q7NA 3GVGA 1KM3A 1NWSA 4EXAA 3HQ1A 3OO2A 1V93A 5M2FX 1XIHA 4JNMA 3W7OA 4TO8A 1ZJHA 1Z42A 3EB3A 1XDLA 4XD5A 3OBEA 2YJQA 1TPEA 2PDPA 5A6BA 4QQ3A 2PC8A 4QEHA 5DF0A 4J2PA 3GNDA 2YLAA 2D23A 2CZVA 3ANYA 1PB0A 1OFEA 2PDMA 3JS3A 3B9OA 1W1TA 2C1IA 3A9BA 2J77A 1W8SA 2YXXA 4AYGA 7REQB 4UTJA 3P2VA 2O0TA 4IGMA 4C6OA 5J8LA 5EMUA 1DTUA 3UWZA 1V7AA 1QNSA 4NJJA 3ZLFA 5HJYA 4ERGA 1QI4A 1H7XA 1VCFA 3KBSA 4U33A 3O7UA 5G1MA 3BG3A 3UXKA 4JD4A 1YBQB 5FIPA 3V36A 1HJUA 4Y9AA 5AYIA 2P3ZA 2NSOA 1K9EA 3FHQA 4IGNA 4L6OA 3DGRA 1R2SA 4CD4A 4GIRA 4BY3A 1XYMA 1GVOA 2FZNA 3HQNA 4ICCX 3BAJA 3H2MA 5JBEA 1GG1A 1UMLA 1XIMA 2DT0A 3IK4A 4Q7BA 1B3WA 4A8RA 2DT3A 3RITA 3LBMA 4PUWA 4X9YA 1C3FA 4UNKA 3WJYA 4BQ2A 3E0VA 4ENLA 1LWJA 5FACA 3RF9A 3AROA 1MXSA 4NKCA 1KM4A 4IPNB 3FHAA 3I7SA 4W93A 3S47A 5DFAA 4EX4A 3S2JA 4AHQA 1GCYA 3ALFA 2AGKA 2XM1A 3TWAA 1KKRA 2HE5A 4GUGA 1ONEA 4CQ9A 1XLIA 1KBKA 1XBZA 3MDWA 4HZ6A 3N2OA 3C3NA 1RQHA 2OXNA 5H1WA 3USZA 2BTMA 4GX9A 2PU1A 1TIMA 3P62A 3L2IA 4IPLA 1DORA 3MW7A 1M04A 3N2BA 2J62A 2CITA 2OEKA 2ZUMA 1XLHA 3GHUA 2FB2A 3KZSA 1W1PA 1SW0A 4UNIA 3CZ8A 1NQ6A 3G0XA 2EG7A 4NZ1A 5A69A 2XFRA 4IQJA 3GU1A 4ZXOA 1ITXA 1MXDA 3TJLA 4E2OA 3W2LA 1US3A 4DUWA 1OQFA 2PLCA 3ARWA 4CNTA 4FOUA 1Y65A 2IMRA 1E4LA 2Q3RA 2FHCA 4FR6A 2CXEA 1O68A 4HMNA 4KH2A 4OECA 2JKAA 3UW6A 2VQTA 1F8IA 4IJRA 3SDOA 3LX9A 3P60A 2FVKA 4UFHA 3TZFA 2OZ3A 5D33A 3ZJKA 3NOYA 1QOXA 1PEZA 4LY4A 5AC4A 1UR3M 3EKZA 2P1FA 2BVYA 4ORIA 3TEVA 4QISA 3BLKA 3TAOA 2Y61A 3A47A 1QFEA 3MUAA 5EGRA 3IJ8A 2FTYA 1EGMA 1T99A 1ADOA 5RUBA 3H6OA 1FWDC 3W7EA 2VVSA 5G2IA 2H8ZA 2NQZA 2QJNA 4QIUA 1HKKA 3CWNA 5DXYA 3OVPA 4DF2A 1FWHC 5CQ1A 3AXHA 3EWCA 3EX2A 2ALDA 1DWFM 4K8HA 2POTA 3QZ6A 2WBKA 1HJWA 3TW9A 3SUTA 2XISA 2XH7A 1C92A 1OG0A 1ZZMA 1E9ZB 2WQPA 1A50A 4J3UA 1CEOA 3N04A 2GJLA 3R2GA 1CB2A 1P0BA 1QO2A 2YDAA 3UZXA 3RGTA 4YMZA 4LX4A 2CIPA 5F2IA 3CQ0A 5I3DA 4NRSA 4PGLA 5KITA 2CHRA 3IIZA 4JTQA 3UWEA 1LUCA 4RK8A 5LIYX 3SJNA 1OD8A 3T55A 1R86A 1QNPA 4J7RA 2VCAA 2W62A 4B3KA 4IMCA 3PUEA 4K7YA 4L9ZA 4PFHA 3N4FA 1LLWA 1T8QA 1IR2A 1GVEA 3UWUA 3C0SA 3CHVA 3WNMA 4WQ6A 1S39A 1G7VA 3WDIA 5AC5A 1EF2A 2A5HA 4D6CA 4ZOAA 1E6RA 4QP0A 2BHYA 1TE6A 1VBJA 1C8QA 4LBSA 1FWBC 1V7YA 1ODUA 5A6LA 4ZSUA 1QK0A 3W7QA 3WELA 5G4EA 2O9TA 4JFTA 1GHSA 3LHWA 4JQ1A 3ATZA 4YVVA 3QEZA 3S5ZA 4AWSA 2PDBA 4L5ZA 1MNZA 1SU5A 4NZFA 1JAEA 3ZVHA 2EG6A 2Y8KA 1EZ2A 1MW0A 2QCLA 2HISA 1PBGA 2WZHA 3WBAA 3W23A 3VKBA 3OQEA 3GDKA 1H63A 3WEMA 4GQRA 4J2MA 4OQVA 4Z1BA 3S4TA 1JUEA 1TTJA 6TAAA 2AL2B 2R1KA 3BQ6A 4XIAA 1DIOA 4BJHA 1K03A 3GM8A 4NQ1A 3C8NA 1DJYA 1NIUA 5D02A 3V4BA 1JCNA 4JQAA 5E5CA 3SQLA 4EE9A 4PL1A 2XGIA 4ZCWA 1J0JA 5DLCA 4W85A 3WMCA 3N34A 3QLLA 5MHBA 2Y0FA 1W1ZA 5LNSA 2VEMA 3E2VA 2CWXA 4MAZA 1NSJA 1LQ2A 2YBTA 4UQEA 1MQRA 4MZ1A 3MJYA 1Z7AA 2PRLA 4IFRA 4IISA 2NV9A 1VQTA 3FXGA 3BMVA 5E09A 3UVIA 1B54A 1M1BA 4UOQA 5GNXA 1T41A 1UWSA 3WNNA 1YNQA 4RPPA 4UB9A 1EBHA 3NQDA 4AB4A 2OYKA 4O50A 4CNPA 3UJFA 5LNUA 2DSVA 5A6BD 4JTJA 1ONRA 4OVXA 1OT2A 1A53A 2HXUA 3LTPA 1OC7A 3ZYZA 4R7OA 3DESA 5REQB 1TKKA 2V5CA 4MVAA 4HHPA 1G01A 3MUZ1 3TKFA 1GNXA 1QK2A 5K9CA 1I45A 2KX9A 2WOQA 4C7GA 4MM1A 3GH4A 4ZQPA 1OCNA 2AQWA 2VOTA 2EHHA 3P8JA 3LLDA 3UCQA 3PSWA 4HA1A 3DOPA 3HG2A 1ZJBA 1XDMA 2PLJA 3PN8A 1UKQA 3LV5A 3W81A 1I8JA 1IWBA 3UPBA 2E1DA 4QNWA 1XX1A 1NWUA 5CLWA 3M16A 3W86A 1AW2A 2ZRVA 3EOEA 4WX2A 5CAHA 3DHFA 4I9MA 3APYA 1UMYA 1E5JA 3R89A 2OZTA 2V2HA 5K4XA 3FDGA 1DJHA 4US6A 4LS0A 3QV6A 1UG6A 3IVTA 3SGZA 1FWAC 2HS8A 3GDBA 4EF8A 3W76A 4I8YA 4OIFA 3ITLA 5D09A 3L21A 3UPMA 1PKLA 2NV2A 5DANA 3NJ3A 1TRIA 3EGJA 4LFYA 4W8BA 2JK2A 3VGEA 1HF6A 5AHLA 2SFPA 3ARTA 4NNAA 3TC7A 2EF9A 3BOFA 4HZ8A 4C6NA 4JTKA 4DO5A 3MYOA 4Q7IA 1PIIA 2QCEA 5GNYA 2DSKA 1PDYA 4RR4A 1QI5A 4Y7EA 4RNHA 3S6OA 4H9VA 3BGJA 4S1FA 3DFTA 2JKEA 4A3YA 2UWFA 1B9BA 1KGWA 3U2CA 3C2VA 4KW2A 1F6PA 1R3QA 5BU6A 1GQKA 4QNEA 4FPSA 1WPCA 5D2VA 1KWKA 3VTRA 3VNDA 1A0EA 2DEPA 4O0KA 1WAUA 4FNSA 1AQHA 6REQA 4C7DA 3L65A 5C9ZA 1XYAA 3TAKA 4RV8A 4JAWA 1GWJA 4RKAA 4WJEA 4W86A 3W1RA 4O8RA 4KCWA 4KCUA 1C8VA 1XIFA 4M81A 1L0PA 2WQDA 4RXFA 2GPTA 2CZDA 2PBGA 4NAFA 3GFYA 3VIGA 1QHOA 4WCJA 3CZLA 1AA1B 2NLIA 3V16A 1R0MA 1XF0A 2WSQA 1XJBA 2WMIB 4UFLA 4TTUA 3N4AA 2A79A 1A5AA 4G6CA 2YW4A 2XPKA 5HAOA 2VURA 2WANA 4PB4A 1ZUAX 1XGZA 4EPDC 4L6DA 3NEHA 1W6TA 3SY5A 7CGTA 4PL2A 3W7DA 3W0KA 5JMUA 3GXIA 2Y89A 4F2UA 4GYKA 3N9RA 3SRFA 1R7OA 2D0HA 4GABA 5FD0A 3BSMA 3CUGA 1RXOB 1QI2A 5A8MA 2QIWA 3GYCA 3GVVA 1BGAA 1MVYA 1CZ1A 1JPMA 5EFFA 3W7IA 2FGLA 1HN1A 5LXXA 4XAYA 3EDEA 2YYUA 2PPGA 4CN6A 3SGUA 3MDUA 5EFDA 2HV5A 2E3ZA 2D2OA 2ZA3A 4FNQA 3BURA 3DYOA 5FI8A 4NG3A 2WO5A 3EWXA 1VZWA 3T0BA 2PB1A 3TQVA 4IQEA 4LUYA 3N2XA 3VC5A 1TVNA 2ZXBA 4ZODA 2VC6A 1TO3A 4MKNA 2WZTA 3L4VA 4AZCA 2DFAA 5GQBA 4X2RA 5AVHA 2GDQA 3FIGA 4GC3A 1ME7A 3GTNA 3IEBA 3L4UA 2HNEA 4GLEA 1KXTA 4LB3A 3RPMA 4FB7A 1IXPA 2X40A 1UBPC 1KV8A 4BFAA 2FH6A 4NYYA 5B80A 1GJUA 1OWQA 3E5BA 3PUOA 4LRSA 2Q09A 2VNCA 4FI4A 3RIKA 1W0MA 4YTTA 4E4PA 2DQXA 1OT1A 2X7VA 4GI6A 2J88A 4YTUA 1I9CB 3ZT6A 2ISFA 2VC7A 1R2TA 3PUGA 2DV0A 3ARYA 3L5AA 3KBMA 2WXDM 1U2YA 4WKHA 1XLLA 1VIZA 2XVGA 4AH7A 4O1EA 4Q8PA 3K1DA 3K8MA 3DYMA 1TMQA 5LIKX 1IEQA 2ACRA 3WLRA 3WZ0E 1UASA 1QXLA 4NJHA 5CPTA 1C29A 1OCBA 4MOZA 1Y0EA 4OZOA 4H9ZA 4ZEPA 2QAPA 4UCGA 3BCJA 3KWXA 3KHJA 1O7AA 5ABHA 1Y8BA 4C90A 1RJPA 1BSIA 2VP8A 4FNRA 1TG7A 2QUNA 3T1GA 4MUZA 4OE7A 1HIZA 4TX6A 5FF4A 1F3XA 4D72A 3C2RA 3TCSA 3M64A 4H00A 4PTXA 5K7JA 3KP0A 4EVZA 1CIUA 2F2HA 5C55A 4HNVA 1NDVA 1OZMA 2ZADA 1GYLA 4O1CA 5BXRA 1I1XA 3VD4A 4XSLA 4IP7A 3U5YA 3ABQA 3N73A 1J79A 3W83A 3K5XA 5D30A 3AIVA 3SCWA 5D8WA 1EGZA 5M3WA 3H23A 3FGCB 5FJRA 3UBPC 3I4EA 1SVDA 2KZHA 1PX8A 5A8OA 2GQAA 4QLJA 4G2DA 1DWJM 2YL6A 3UXAA 3ABOA 4I9JA 3M1ZA 2P53A 5C6MA 1MRAA 1XH0A 3UG3A 1BWKA 3GU2A 4JTIA 3WF3A 3HPSA 1EJXC 1FWEC 2Y62A 1RAKA 4FO4A 1MNSA 9XIMA 3O9NA 2DH3A 1TA3A 4GH1A 3UZ5A 1A5MC 5DELA 1VFOA 4QE1A 3S9ZA 2JEQA 2ZDRA 3L2MA 2VD9A 3QW4B 5F2MA 2JF6A 3REQB 3THQA 3NURA 1ZL1A 2VD8A 1EOMA 4FK9A 1DXIA 3PVFA 4C5YA 4JFSA 4HHMA 4RJEA 2VEKA 3PBGA 1B5TA 4L4OA 3M0VA 2J7FA 3GR4A 3PJXA 1M3UA 3NDZA 3CAKA 1UZHA 3W4RA 4MG4A 1ZCOA 1D8CA 2Q3OA 3GXTA 2X42A 3TMLA 2X1UA 1Q5MA 4HK5A 1WXJA 1UC5A 2AL1A 3L4YA 3CV1A 3SUSA 3OJGA 4G9PA 1K9FA 1SM9A 3P8IA 1SJBA 1H61A 4DLFA 3WMSA 2BXVA 4NNBA 4MY9A 3T78A 1VJIA 1BQCA 1S5MA 1R3YA 2CESA 3UJ2A 2A7RA 3P93A 1A49A 4UR7A 2E5DA 4CD6A 1H2JA 2Y7EA 4GMEA 3KL5A 1G0CA 2WSKA 1XP3A 4JIQA 3IJLA 2QDGA 3E0IA 4XUYA 4NILA 2H9AA 1ME9A 3L12A 3AOFA 3CS2A 3G2GA 4GACA 2YPIA 2GJRA 4QSFA 2V38A 4B5SA 5KZ6A 4N6FA 4MADA 1L6FA 4PMJA 1ZP3A 2XH4A 4L64A 5I3IA 4O53A 3W25A 5A8GA 1CBGA 2BVDA 2BGQA 4D6JA 4RNIA 1EO7A 4LOCA 4B9YA 1GOOA 3L9CA 3BK0A 1T7LA 1U83A 3CBWA 3DFNA 3EOOA 3ZSTA 1YDOA 4UTMA 1Q7MA 1HTIA 1RA5A 4D6HA 4L4PA 2F61A 1LM1A 4POCA 1GOXA 3LXBA 2BASA 3GU9A 5CG0A 1ONWA 3HGSA 3V1HA 1JD7A 4HPJA 1EPXA 1KV5A 1CT5A 4WJ8A 1EBGA 2XVPA 3VNLA 2I17A 3DBPA 1OC5A 1WB0A 2V2CA 2AAMA 1QU4A 4GXPA 1T40A 1WDPA 3KTXA 4S3EA 1V6XA 4DUXA 1B4KA 3A5FA 1VEMA 4GGHA 4I5UA 3L5MA 2ZCGA 2C15A 2WNQA 4ML4A 5CPOA 1TSIA 1JCMP 3XINA 3CV2A 2XVLA 3VXGA 1Q2SA 1Q85A 1TIWA 3R13A 1RA0A 5HPOA 2YDRA 2IKJA 5HQLA 4HBKA 5H8PA 3BC9A 2UY3A 1Q63A 3G0UA 4MF4A 4PE8A 4MB4A 4PRWA 3VNJA 5A6SA 3QPZA 5E0CA 3OLIA 2CLMA 4D8AA 2GSJA 3KRBA 3KLLA 3ZWTA 1AQFA 5AYYA 2CU0A 4XKYA 4IP5A 3UG5A 1BSLA 3MP5A 3TQ0A 5EMYA 4Z2KA 4AXKA 4PMDA 3MO7A 5AOUA 3L67A 1K8XA 4S39A 3PNZA 3BSGA 3UZWA 2JIWA 3SIMA 3UG4A 5C2CA 3H2FA 5HMFA 2ABAA 2QHAA 1F8MA 3ENLA 4NI8A 1BHGA 4GUHA 4JIEA 2YCJA 4M29A 1H7RA 2F6KA 3N13A 4LT9A 1YADA 4JZ5A 2D2JA 4E4FA 2D0FA 1VLWA 4M82A 1PX4A 5MKGA 2R1PA 4C6KA 4D6IA 4TOQA 4CCDA 3LOTA 4UQCA 3UJSA 4UQBA 4JTAA 5CZ0A 1TWSA 4MNLA 3VKJA 4MMWA 1RY0A 2O9PA 4MWAE 3CHCA 1HKMA 4C6DA 2Y8VA 3RM9A 4L80A 3OA5A 2ZX6A 3G18A 1U5HA 3GTIA 4YTSA 5C71A 2UY2A 2V82A 4LUTA 4MJMA 1XICA 3ZLGA 2VJXA 3N19B 4K1GA 5C7HA 1I2OA 3ANUA 5EMJA 1VFMA 1P5BA 4CNSA 3W07A 1OVDA 3TCEA 4DB7A 4FLOA 3GXPA 3PBYA 4OWGA 1P7TB 5AYBA 3UJRA 4M6VA 2ZVIA 2XN1A 1VPQA 1R85A 5EA9A 5A5WA 1VEPA 1UD5A 3OVQA 4CD8A 1IR1A 2PDUA 1IT8A 1KRCC 5LA1A 3IV3A 1JCXA 2EEXA 5LIXX 3FEMA 4E3TA 3JZUA 3GXFA 4KEUA 4LBUA 2FKPA 1O5QA 1V6VA 2TRSA 3W26A 1ZP4A 4J9JA 4C6MA 1J96A 2MUCA 2VFDA 1BF6A 4O15A 5U4NA 4Q22A 1ADDA 4GQBA 1O66A 3BLFA 1TJPA 2GVEA 3EA2A 4PBGA 1ZNNA 1FWFC 1EQCA 1CGUA 3E02A 3WH6A 1UOKA 4G1NA 2WM0A 2UBPC 2W67A 1ISWA 4CEUC 3GBEA 2D24A 1B90A 5F2GA 3CU2A 3N2CA 3M9YA 2HSAA 2YKKA 4L1WA 3D3AA 4QAWA 3W7PA 4EWND 3V5CA 4XISA 1Q6CA 5CG7A 2VFHA 1WA3A 4I9TA 3STEA 3T2QA 3UGVA 4AVFA 4RPQA 4M0XA 1NY1A 2E4TA 2X09A 3PBMA 4KWOA 3NQVA 3WD2A 3BL3A 3UFYA 3FVMA 4PR4A 2VMFA 2C91A 4EXQA 3II1A 3GB6A 3SCPA 3HG5A 3PR2A 2XSXA 1YDYA 5I00A 1PKYA 1GONA 1XYCA 2BMBA 2NSXA 1OY0A 4ZQMA 4BI6A 1XIEA 2NZLA 3OLGA 5A1AA 2NQ9A 4LAOA 3T4CA 4UTFA 2WMHA 2XINA 2PI6A 2RJHA 4WY0F 3W37A 4PMUA 3NWRA 3VIPA 5H6HA 3VDHA 4AEOA 4EAMA 3EEGA 3MI6A 2IKHA 3HF3A 1AL7A 1QNOA 3SSZA 2YX0A 1KM5A 1QI3A 3K2GA 1CENA 1CXEA 3AMLA 4MWAA 3L0GA 4EANA 1BKHA 1VCGA 5C9WA 1VRDA 3G6MA 2CYGA 3SFWA 3PSVA 4FIRA 3P14A 1LT8A 3M0JA 1SW3A 3TTOA 1E40A 5EPDA 2D1ZA 1UWRA 3NQFA 3UYIA 1V6WA 4YYFA 3NPUA 3TE9A 2HDJA 3H70A 1FCUA 3VMOA 4A3RA 5BXPA 3POHA 3B03A 4ZE5A 1AZ2A 5JBDA 1WDSA 4XK2A 4J40A 3ITXA 3KBNA 1E4MM 1R9ZA 3RN6A 1B9ZA 4D9PA 4BI5A 1SJDA 4G5DA 1G4SA 1P1MA 3WJZA 1TZ9A 1TPDA 1Z9AA 3DG6A 4PMOA 4L9XA 4AIOA 2A3HA 2RKXA 1KM2A 4IGHA 4NX0A 4XSMA 1VYSX 4MWAC 3U9IA 3MMUA 1QUMA 4JN6A 1ZJIA 4QSHA 3E3HA 3KCJA 3TFXA 1PHQA 2WAGA 4XTIA 5LNRA 3HG3A 2OQLA 4HN4A 2FLIA 4OBRA 1M7PA 3CO4A 4DELA 3VCCA 1KFWA 5M5DA 2PDXA 3L66A 3VC6A 3EDDA 1IWAA 3UWYA 2FTPA 3WNKA 3LY0A 1QNRA 1HO1A 3QHMA 1F73A 3GR8A 1N55A 1H7PA 2G95A 1L6SA 1M7JA 5JH2A 3GRIA 5CBJA 4EAYA 4AY8A 3TDFA 4IIDA 3NXLA 2CW6A 1HKVA 1BLIA 3RLVA 3PTKA 5IM51 1JDAA 2DUAA 4QJ3B 2QJGA 2FPTA 3L0NA 3E0LA 1EJWC 2EKGA 1KWGA 4IZGA 4HB7A 4INFA 3WQVA 4OUIA 5AYZA 1BXBA 3N2TA 3TLQA 4O12A 2GYIA 4V15A 5G1YA 1W1VA 2PD5A 3OBKA 2PS2A 2W9MA 1EUNA 4FX8A 5EKYA 3OODA 2PWEA 1IGWA 5LNVA 4DO4A 2ZQ0A 2DY3A 5CKSA 1JDFA 1AZ1A 1JRCA 5HANA 1RBLA 2CLFA 4Y9PA 3MKCA 4IQDA 1TZZA 5CPMA 3S1UA 3QSTA 3LMYA 3R8HA 3U4AA 4PRRA 3CAQA 1KFEA 1YTKA 1Z32X 2HNHA 4LAKA 3T0TA 2RAGA 3VOJA 2G50A 2WPBA 4KRUA 5FJOA 5CBIA 3SUVA 1QHPA 1LOSA 1ZALA 4JFUA 1TWZA 3HGRA 1XHGA 3ECQA 4OBSA 3G5EA 4GNVA 4PMVA 2FZ8A 4QG6A 2E1WA 3CLMA 3A13A 1KM6A 1E6XM 1MFVA 3P0WA 1X8FA 4FALA 4DI9A 3AI0A 1XYBA 3KP1A 4D6FA 1IEVA 4CQDA 2D69A 3VIOA 3QFWA 4IMGA 4B91A 1I75A 5CZSA 1GVRA 4ECLA 4UQ9A 1ZY9A 4GE8A 1QPRA 3ITOA 2EPOA 3W29A 3TNBA 3P5YA 5H2ZA 3BANA 4K3ZA 3ALGA 2X05A 4AIBA 2W0UA 1C9WA 4L1XA 3NO1A 1SZRA 2YDQA 4F0RA 2HQAA 5FEZA 4YL2A 2ZUNA 1FKWA 1VFSA 3CL6A 4AZIA 1SSDA 4UWMA 4HMCA 3WX7A 5G4WA 3R25A 2VGIA 1XR2A 3D6NA 3DIPA 5ENLA 3CQIA 4HVXA 3QSRA 4XB3A 1KTCA 1V0NA 1UPMB 4IWWA 1WBHA 4IX0A 4GHRA 5I2UA 1RY8A 3V1PA 4CNUA 3PPFA 2FYMA 3SCUA 4Q4QA 3AHZA 4WSJA 1UBSA 4HMDA 2WHJA 1XYZA 1OHLA 4CGTA 1Q6EA 4YTQA 2GGIA 3WCZA 5M03A 3C0QA 2H3DA 4MJ4A 4RV3A 4LAUA 1H11A 3MI2A 4PUNA 3RX4A 3INPA 4NIRA 2HXTA 4L1GA 2DIJA 1ZJAA 3AICA 3TTQA 1ECEA 2V6AA 2PF8A 2MNRA 2BFGA 2IKGA 1OINA 3AFBA 5DT7A 3RDKA 1YIXA 4MNKA 1JNDA 1T5AA 3B8TA 1EFZA 4PMZA 3P80A 1R30A 3CMJA 3BSHA 1EH9A 1XFCA 4PUDA 3FYPA 4ZGYA 3L4ZA 4CNOA 1HO4A 4X3ZA 3AMGA 4O14A 4GZJA 3PZQA 4M1BA 1IXQA 5AYXA 1KBBA 1GOWA 2PDKA 3ZR5A 5CH9A 2DZBA 2WZMA 2NVAA 5EL1A 5AC7A 1R38A 3NQAA 3S5OA 1UZ4A 3N9KA 1QI0A 3SN0A 1Q45A 5CBBA 4LEQA 5LXEA 1UKSA 4HPHA 4C1LA 2BXYA 1IGSA 1BWVA 1WO2A 1E70M 2RGMA 1W5MA 3DGBA 3AC0A 3LS9A 3M6YA 4UMCA 3VUSA 3UXIA 4LALA 4GFIA 1QRQA 5C7VA 3OGSA 1D9EA 4E2BA 4XAPA 3F2BA 3KOXA 4XVDA 1GKPA 5FL1A 3CHDA 2TODA 3GNNA 2J7HA 1P0NA 4B92A 3QQ1A 3PS7A 3HB9A 2INFA 3XIMA 3F1QA 3TW6A 3RXZA 1TE1A 1XS2A 1R7AA 3TYDA 4DI8A 3BOXA 5IFPA 1H4PA 4M7SA 3B9NA 1ZS2A 3FX4A 3WNOA 3WQ6A 3AIBA 3EPNA 5ABFB 3SO7A 4LF2A 4RE0A 2ISSA 1KW1A 3ZZ1A 2V5BA 3U8GA 1V51A 4R27A 1KNWA 3TQPA 1VJZA 1J18A 4KPLA 1PAMA 2PA6A 3TROA 3AMDA 4IFKA 5KZEA 4BI7A 5BROA 3BJSA 4UFMA 4Z2HA 1FHLA 3BVJA 4RE4A 2XU2A 1H62A 3LM3A 4YN5A 1Q6FA 1W1YA 3T40A 2UY4A 4CVUA 1RBAA 1OCJA 4LXFA 4JDBA 4IF2A 2XFYA 2J8GA 3LRLA 1EC7A 2VR5A 2JGQA 3LCFA 3VOCA 4D8LA 4AX7A 1BEUA 4WY0A 5HJLA 1IT0A 1EPVA 4MWAD 1J01A 2ZWYA 3SCNA 4X9SA 4DHGA 4OHQA 3BG9A 4PC8A 3VIKA 4WVXA 5KINA 1FCBA 2R1NA 3K4WA 1IQ8A 1SO4A 3RMEA 4Q32A 5EBAA 2VEIA 2DORA 4LUIA 2W66A 3TMQA 1QMLA 3DFPA 2GGEA 6ENLA 3ONBA 3ABZA 3K46A 5DT5A 2BGNE 5LZLA 2ZXQA 2CLOA 2QGHA 4HTYA 5C9RA 1XRFA 3NG3A 3RAOA 2OELA 3LBOA 4U2YA 2ALRA 1TV2A 4QG8A 2V63A 5TAOA 4IFOA 1MDRA 1A5BA 3DFQA 3W22A 3KS6A 2CLKA 2DGAA 1VD6A 1P1XA 4ES4A 1JGIA 1K4GA 4IPPA 3QFEA 3RLHA 3WK0A 2X7WA 3POCA 1J12A 1O12A 1VP5A 1Q8AA 2I9UA 3STCA 1NOUA 3AS1A 1KR1A 2G3MA 3VIFA 5CPLA 1PIGA 2ZX8A 4K68A 1GORA 2DVTA 2J74A 3GXMA 5M17A 2YDSA 3NYDA 1I1WA 5A6TC 3A23A 4KT2A 4B5WA 3AXMA 3NSNA 3TN6A 3PB2A 2HK1A 3TXZA 2GVYA 5CGTA 3KDOA 3ZXWA 1G4TA 4PTDA 4Y96A 2AKMA 5BXSA 3FDKA 3PBVA 3W7NA 2RDXA 3VOHA 4JXCA 4WXYA 1NARA 4A6GA 2NQJA 3ITVA 3GG7A 2Y70A 1K9DA 4KRZA 4GIYA 1GVYA 3B0XA</