1XC9A

Structure of a high-fidelity polymerase bound to a benzo[a]pyrene adduct that blocks replication
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a High Fidelity DNA Polymerase Bound to a Benzo[a]pyrene Adduct That Blocks Replication
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA primer strand
total genus 198
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1xc9A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1xc9A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xc9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xc9A01
4O3PA 3M9MB 5KFOA 3IS9A 3KD1E 4J9QA 2KQ2A 4KLOA 9ICQA 5SWMA 3MGIA 5E41A 3KK2A 4ECQA 1RBVA 4F5NA 5C25A 4QAGA 4BE0A 4CERA 1U47A 4YCXA 4RPYA 2MUTA 5HRRA 4AHSA 4NYNA 4G1QA 4B9TA 3KLIA 4FK0A 5DDYA 4P2HA 2ZTCA 3GV7B 5HRPA 1KTQA 2KFZA 1RXWA 4M41A 2IS3A 4P4OA 4P4PA 3SQ2A 4CJKA 3H40A 3C21A 1ZBHA 2X6SA 4RT2A 3C23A 1IKYA 3IG1A 3K5LA 5KFAA 3WNGA 1S5JA 3GFKB 7ICTA 3RB6A 2QXFA 5KFPA 1J53A 1SZPA 1BHLA 4GMJB 3UQ2A 1CEZA 3SQ4A 3AVAA 2QK9A 3VQ9A 3PV8A 2RN2A 3HPGA 5EWEA 4MFAA 1T4GA 3EZ5A 5KT2A 1ZYQA 1KLNA 4Z4CA 2AQ4A 3VA0A 5CHGA 3B6PA 4M9NA 4J9LA 4I27A 1ZQAA 3SUOA 4RW9A 1RTIA 5KFFA 5DBBA 3B6OA 4GW6A 5KFEA 1UOCA 3V6DA 1BI4B 2XY6A 9ICFA 5J2GA 1KSPA 4M3WA 4CJTA 2ZTEA 1CLQA 3ZDEA 2OPQA 3GQCA 1JIHA 1SV5A 2GV9A 1WAJA 3OYJA 4UQGA 2X6NA 4JRQA 3BGRA 4KHQA 3T19A 2E4LA 2Z1IA 1HRHA 4CIGA 2ITGA 4AILC 3SV4A 2DPIA 3ZD9A 4E19A 4EYHB 2Z1HA 1NK7A 4DSKA 4ED6A 3LAKA 2E6MA 4LVSA 8ICPA 5CJ7A 4YR0A 5IIKA 2ISOA 3ZT4A 4W5QA 4RW8A 4IQVA 5KT6A 3LDSA 3E01A 1VSLA 3HVTA 5HNKA 4IQTA 7ICUA 4KLMA 3EPIA 3OYKA 1RTDA 2C2EA 4W5OA 1KVBA 5J0WA 4FM1A 3ZSOA 3QE9Y 1CUKA 3ULDA 5HRSA 4YR3A 3ZDBA 3C2LA 5I42A 3ZDCA 3OS0A 3NH0A 1RDAA 3RJKA 1KFSA 3OHAA 4ECYA 1ZQDA 3AVBA 3TAGA 3V6HA 4E7KA 3K5MA 2JEIA 2YV0X 4LSLA 1B22A 4M9JA 5KFUA 1BPBA 7ICOA 2JLEA 4PA1A 4O0JA 3O3GA 4KLEA 4UB4A 1BIZA 2ZQBA 2FBTA 1JLAA 2ATQA 5DDMA 4DQQA 2X78A 1Q9YA 3DM2A 3AUOA 5CZ2A 2OYQA 5KFIA 3T5HA 2YNHA 2LSNA 3VQPA 4E1NA 2JGUA 4DQPA 4N76A 3C6UA 4ED1A 4CJ5A 1UT5A 4I2HA 4E89A 4CFDA 4CGIA 1KDHA 4RT3A 2AU0A 2PI4A 3K5NA 1RYRA 4Q8EA 2RPIA 2FMQA 4DTXA 5KFCA 2ZD1A 4ECTA 1ITGA 1S1UA 3QERA 4BWMA 2NRWA 3S9HA 4HYKA 3LANA 1EXNA 2BCSA 2I9GA 1L3SA 2B21A 4CJFA 4DTSA 5CP2A 3O4QA 3WNFA 1SL0A 3QNNA 1QHTA 1BI4A 4CJRA 1HJPA 3T5LA 2VG7A 4YG2A 1RT3A 2R7YA 3IAYA 4FJMA 1MC8A 2OZSA 4KTZA 3SPZA 2FLLA 1IKXA 1KLMA 4J9OA 4I9LA 4H4OA 3PW7A 4O55A 3TWHA 1XO1A 5KFHA 4KLDA 3K59A 1RT5A 2A1JA 4KV8A 4FLZA 2FMSA 2HVHA 9ICIA 2JEJA 4CGFA 3DOLA 1RCHA 1J5OA 1CXUA 1NK9A 3H8SA 9ICKA 1WCLA 3DI6A 2FPKA 4CK3A 4UB5A 4EEYA 3LZJA 2BANA 1VSJA 1ZJMA 4LSNA 3ZSXA 1VSDA 3RJIA 4RQ2A 1I39A 4LZDA 3Q8QB 5J0OA 2UVUA 4UB2A 4H4MA 1COOA 1TVAA 2D0BA 3NGYA 2KN7A 3ISCA 2XCPA 1ZQFA 3OYIA 3HP9A 1ZQMA 1ZQBA 1ZQPA 4I2DA 1XS9D 2YNIA 3PX6A 3N4MB 4QZDA 4OPKA 1ZJNA 5HMLA 4RNOA 3DRSA 1QS4A 3JSMA 2ZUDA 3ZSVA 4E7HA 1UAXA 2ZUBA 1ZQVA 5KFJA 4JV1A 1NKBA 4FJ5A 1T3NA 3EWAA 4HCCA 2C2DA 1FK9A 3OYDA 2BQ3A 8ICOA 3HT3A 4DTNA 4Q44A 1RTJA 4B9SA 3C2MA 3RH6A 4J2DA 1GOCA 3RH4A 4Z6FA 4KLSA 3U3GA 3OY9A 3TABA 3HWTA 4J9RA 3QO9A 4B8CA 3THVA 4O5KA 4N41A 4B08A 2PFNA 7ICHA 5JS2A 1Z00A 3V7KA 4ECWA 3MEGA 3OS1A 3C1YA 1IO2A 4ECVA 4M6WB 3MFHA 5KG1A 3KJVA 4RUAA 1ZBUA 1JLGA 2EHGA 2ZUCA 4I2EA 2P51A 3V9UA 4CEBA 4QZBA 4I2QA 3QIPA 4NCGA 2ZJ8A 2PYLA 4ELTA 5DB8A 3PMLA 4Z4IA 3RRHA 3MDAA 3PW4A 9ICWA 2HHTA 3RB4A 2FBVA 5J2BA 7ICRA 4MQ3A 4J2EA 3AA3A 4BWJA 3OSNA 1S6QA 2Z1GA 1DOQA 3G10A 2XY5A 3Q8LA 7ICJA 1JN3A 5DQGA 3V72A 5J2IA 2ASJA 4J9MA 4RG8A 4XIUA 4TURA 5DGAA 2P5GA 9ICNA 5FRMA 5KG3A 1FKOA 4MF2A 5KGWA 8ICGA 1RNHA 4JRPA 1RBRA 1C6VA 2BCVA 5KT5A 3NCIA 4TQRA 4KFBA 4HUFA 4OLBA 3VQBA 3G6YA 3A2FA 4CGHA 3TAPA 2PFOA 1EKEA 4KI4A 1NKCA 1NKEA 4XUSA 1TK5A 2W9CB 2DPJA 9ICBA 3ZDDA 4BE2A 5C24A 4YXMA 3CFOA 1NK4A 3PO4A 2XO7A 3DLHA 3HXMA 4OLAA 5D46A 4C8OA 3AO4A 3U3YA 4DEZA 2AGOA 1C0MA 3OYEA 1EX4A 4J2AA 1Z3EB 1ZQNA 4RU9A 4KN7A 1S9FA 4I2AA 3K2PA 2RDJA 4DWIA 1QLNA 4KLJA 4M3ZA 4XA5A 1XC9A 1U9LA 5BPCA 3SYZA 4FK2A 4FJ7A 1VSEA 4CJWA 2AJQA 1Z26A 3F9KA 3T5JA 1A5WA 1Y97A 2Q3SA 3H4DA 2G8VA 3RTVA 3P1GA 3NTUA 4JLHA 4OKJA 3OYLA 4YMOA 4O5EA 2VA2A 5C42A 3OYHA 8ICZA 3PR5B 3EPGA 3GV5B 5J2MA 4FM2A 5KTQA 4FJXA 3PW5A 5KT7A 2BE2A 4GXKA 3UIQA 4KLHA 1TL1A 4R65A 5KT4A 5CYQA 2KFNA 2DFEA 4OKKA 3NDKA 3QZ7A 1ZQSA 2XY8A 3JPTA 2KW4A 4ED7A 1BQNA 4Z4GA 4RQ0A 9ICPA 4CEDA 4LD0A 3QETA 4OKEA 4FLYA 5F9NA 3U6FA 5C5JA 1WLJA 4YMNA 4CECA 1S1XA 1L3TA 7ICIA 5J2DA 3NGIA 3RR7A 5IIIA 5J2JA 5DB7A 3GIKA 2HHWA 4I2PA 1ZQXA 4F4KA 5DB6A 1HNVA 3RH5A 1RT6A 3RBEA 4ECSA 3KLEA 3GILA 3LPUA 4FZYA 2VA3A 1VSMA 4CJ3A 3O4NA 5DG9A 3L3UA 1JMSA 1BPYA 3NGZA 1S9GA 1S76D 4IBNA 5CYMA 4IRCA 3GIMA 4HTUA 2YNGA 5SZTA 4CJPA 3TFRA 3MXIA 4UAYA 3RB3A 4CFCA 1J54A 5DG7A 2OPSA 3L8BA 4NXZA 2VWJA 1WSJA 3SV3A 4Z4HA 3AVNA 4F4YA 3HL8A 2ZJ5A 2W9MA 3OYNA 1SKWA 2BR0A 2IBKA 1D5AA 4E0DA 4ZTFA 2W9BB 4E3SA 4DOCA 1T05A 2F1HA 2XC9A 3IRXA 1QTMA 2MAXA 2HB5A 3LALA 1Z00B 1FKPA 1LAWA 3LP1A 5FDLA 4EYIB 3NE6A 1S9EA 5EOZA 4KTQA 5CY4A 1EXQA 3V1OA 3AVKA 2F1JA 4LH4A 4PUOA 3SZ2A 3T1AA 3QINA 3QEWA 4GXJA 3ETLA 5J29A 1ZQJA 5J0PA 1VK0A 1O1WA 4OJRA 4K8XA 3Q8SB 1S1TA 2JEGA 4JUZA 4N56A 3AVLA 3AVJA 2J6TA 1WAFA 4M6WA 2OPPA 2FBXA 1A5VA 3BDPA 2AGQA 5FRNA 4OVLA 3C1ZA 2DFHA 3M8RA 4IR1A 4O3QA 1TFRA 4R8UA 2ETJA 1BL3A 4ECUA 5KFTA 4CK2A 4KLQA 5KRTA 3HP6A 3QEPA 1W0HA 1IH7A 3JPOA 4B9LA 8ICIA 4DTMA 4B9NA 4DFMA 4IQWA 8ICSA 3PX0A 3BQTA 1DLOA 4DLEA 4PQUA 3HW8A 5IINA 1KRPA 9ICLA 1A77A 2PXIA 4PHPA 1ZQWA 2ZTDA 1ZQRA 3RJEA 3KHLA 4B3OA 4KMUA 1RILA 3AVHA 2DFLA 4IKFA 3OYGA 1TKTA 4TSXA 1HUOA 4BXOB 1JXEA 1VSFA 4RQ5A 4DL4A 4M3TA 3BQ2A 1D9FA 1BCOA 4W5RA 4M42A 1NK8A 3OS2A 2ATLA 1SL2A 5DBCA 1B92A 1CZ9A 9ICGA 4PGYA 4YN4A 1WSHA 5KRSA 5K14A 3DLGA 1S0VA 2PFQA 2BDPA 4DS4A 4EBCA 1NK5A 9ICSA 5KGXA 4GVMA 5BOLA 1XSNA 4MFBA 3CM5A 5CR0A 3JPRA 4DQIA 1XI1A 4FVMA 4DFJA 4M2YA 4PH5A 4DU1A 1N5YA 3ITHA 3LWMA 4M3YA 4BDZA 3CFRA 3AVCA 3QZ8A 2UVVA 3B0XA 1SUQA 3QLHA 3HYFA 1ZQZA 1YTAA 4RPZA 3ZSYA 4DSIA 3SQ0A 2W42A 2D0CA 4DTJA 4KHSA 5J2QA 5J2FA 4I29A 2F1IA 3F73A 3LDAA 4O3NA 3KKRA 3CG7A 4LZGA 3ZT3A 3T5KA 2A1RA 3MEEA 4FLXA 4O3OA 8ICVA 4XQ8A 4F50A 3SQ1A 1JL1A 3DRRA 1S77D 2F8SA 4F93B 3HM9A 3G0ZA 2VG5A 5J2NA 2UVRA 4YFUA 4GC6A 4O0IA 5FROA 3CFPA 3TI0A 1XU4A 3V9SA 4ECRA 3LAMA 5KG0A 3TANA 4R8UB 1NK0A 4FS2A 3PX4A 5KFZA 4Q8FA 4HCBA 4E1MA 1GOBA 4KREA 1Z25A 3LK9A 4JWNA 3OVNA 2HHXA 3V9XA 4QWDA 1T7PA 1KFTA 3RBDA 1UT8A 4HUGA 4F91B 5J2CA 4RQ6A 3UPQA 3ZSWA 1ZQLA 5KFSA 4DL6A 9ICAA 4I2JA 4LY7A 4QWEA 5HP1A 1TVRA 1JXBA 3BJYA 1RBTA 1YVUA 2JZBB 1KVCA 2FPMA 2BKEA 4PHAA 1WSFA 2BPGA 3H8JA 4FJGA 4NCAA 4O9MA 4MEYA 4CEOA 2Y1IA 3MGHA 3DOKA 5J2PA 4RQ7A 4O4GA 2G8UA 4OGCA 3TR8A 3EY1A 2XY7A 4DTPA 5J0YA 3ISDA 4N5SA 4F2SA 3TFSA 2YKMA 1BISA 4PPXA 2IHMA 4RQ4A 4DU4A 5KFDA 2HHUA 8ICMA 7ICKA 2YKNA 4NYFA 4CF9A 5T7BA 9ICTA 1B9DA 3AVGA 1LAVA 1QQCA 3JYTA 1TV9A 5DMRA 3CM6A 2QKKA 3AO3A 1WSIA 1WSEA 1W9HA 3AU6A 9ICVA 5JS1A 5DQHA 2R8HA 1JL2A 4RUCA 1RPLA 4KHUA 4I2IA 5J0RA 1T8EA 1DTQA 4CIEA 5KG5A 2NRVA 7ICLA 3MR6A 4DS5A 3RMBA 5IIMA 1ZQHA 5KG4A 4KLUA 3RAXA 3VA3A 1MQ2A 4K4IA 1J9AA 1QSLA 4QW9A 4JK1A 1UA1A 4CGDA 2AQ0A 2GUIA 1QSSA 4FZXC 4FJIA 4CGGA 3AU2A 3HX0A 2FBYA 4K8ZA 1RBSA 3PVXA 3C5GA 3RMAA 2Z1JA 3M9NB 2Y1JA 4X5VA 4KLIA 3OYAA 3PMNA 2GBZA 5KFRA 2HHQA 3AV9A 3NH1A 4IG0A 4CHYA 2W9CA 4M45A 7ICEA 4QZFA 2BHNA 1YT3A 1C1AA 5KFLA 2VANA 1X9WA 5D4BA 3ALYA 8ICUA 3I0SA 3M8PA 1X1PA 4FM0A 2ASLA 1QSYA 4MF8A 3JPNA 4CJVA 4DTUA 1N48A 1LV5A 4K4GA 2BCQA 9ICXA 4KITB 4QZIA 2FMPA 1ASUA 1XSPA 2P6RA 1WSGA 3HO1A 4CCHA 2IAJA 3AA5X 2UVWA 4R63A 3AO1A 4CESA 3SNNA 5IIOA 2BGWA 1WCNA 4Q43A 2C22A 2OA8A 3SUNA 4Z6DA 4NLZA 5L1JA 4JWMA 4IRKA 3OJSA 1ZQGA 1S10A 1BPEA 5CZ1A 8ICTA 1NJXA 1S0MA 5EWGA 3FYHA 4J9NA 3OSPA 3V7LA 3MAQA 3K75D 1NK6A 3NF9A 2NRXA 5DQIA 4H8KA 4BACA 2PYJA 3C94A 3K57A 5J2AA 3SI6A 3RWUA 4I2GA 4ZTJA 2NRZA 4ELUA 2W8LA 4KHNA 4IG3A 3LWLA 5I3UA 4F5RA 4RQ1A 5CB1A 3TQ1A 9ICJA 4EP5A 4FJJA 3I8DA 2PFPA 1BQMA 3O3FA 3RR8A 4AHVA 1TK0A 8ICYA 4QZCA 4KRFA 4ECZA 3N97B 9ICUA 4M9HA 2WOMA 4KLGA 4ED8A 4YR2A 3HPOA 3UXPA 4M04A 8ICQA 1LWEA 4FW2A 3UXNA 9ICRA 4UAWA 4DMNA 2BPFA 5KFNA 1DGSA 4Q45A 4C8NA 1IXRA 1XWLA 4RNNA 1EP4A 1K1SA 2JZBA 5CA7A 3KIOA 3VQQA 5D49A 4EBEA 3RMDA 4MFCA 1ZBIA 3SUPA 4QZEA 4DG1A 1HYVA 2WTFA 2V4RA 3SCXA 1CZBA 1IKVA 4YXJA 1S6PA 2QKBA 4EZ6A 4O5BA 2I5JA 8ICRA 4F92B 4CFAA 2Q0ZX 4CEQA 2XRIA 5DLGA 4DLGA 1RXVA 2DFFA 2DY4A 4I2BA 3Q8MA 1JX4A 8ICJA 5HROA 4M0AA 4DQRA 1HNIA 4B9UA 9ICCA 4ED0A 3H7IA 4CF8A 4FJLA 8ICAA 1Q9XA 4FBUA 4ECXA 3E2EA 2BQRA 3AVIA 1I3AA 4RNMA 5HMMA 3JPQA 5HHIA 2LYHA 1K6YA 1ZBLA 5IILA 1H38A 4IFYA 4PHDA 4F4WA 8ICKA 3G6VA 4KHYA 4DL2A 4K4HA 4ZH4A 4KB0A 2HW3A 4ID5A 1IKWA 4M9GA 3OHBA 4BGDA 2M9NA 1U4BA 2PZSA 3KLFA 5DLFA 1JLEA 4BDPA 9ICOA 1LW2A 4O5CA 1ZQTA 4IRDA 7ICQA 1XSLA 4Z6CA 3ISBA 4F5OA 2P1JA 3C95A 3OGUA 4CF0A 1RT2A 4EBDA 3HPHA 4CEFA 5KFGA 4FW1A 1S0OA 4KPYA 4DFKA 4I28A 2BGGA 1JLFA 1BVSA 5CWRA 1B9FA 3QNOA 1RDBA 4E7IA 7ICNA 3LP0A 3ISNC 2A1JB 2HHSA 4DL5A 1TKXA 4CFBA 4UAZA 4UBBA 4TUPA 9ICEA 4O44A 3FDSA 3G6XA 2ALZA 4WE1A 2ZE2A 1RBUA 1TKZA 3L2WA 1L3UA 3QEAZ 5J2HA 1ZETA 4F8RA 2BCRA 2R8JA 3KK1A 4FLUA 4FYDA 5TZVA 4I7FA 4J2BA 3NF8A 3MR3A 2BPCA 5DKWA 1C7YA 4FK4A 4NLKA 2XHBA 1DTTA 3VQAA 1IM4A 3DMJA 4FXDA 4UB3A 2XGPA 1ZBFA 8ICFA 2YHBA 4KLLA 1GOAA 4F3OA 4B9MA 4QWAA 1C0UA 3V1RA 5L9XA 2OPRA 3WNHA 1L5UA 1MU2A 4YD1A 4FS1A 3KKSA 3V81A 4FCYA 3KTQA 1RTHA 4DTRA 4TQSA 1RZTA 1N6QA 2P66A 3KHRA 2IA6A 3DLKA 4Z4FA 4J9SA 4M47A 3FFIA 1R0AA 3ZT0A 4PHEA 3DLRA 3NAEA 2ISPA 5J0TA 4NY8A 3VN5A 2IHNA 2YNFA 4QZHA 2AGPA 2D5RA 1BCMA 1HMVA 3L3VA 4RQ3A 3TAEA 4FO6A 1LB2B 3QEIA 4R64A 5L1IA 2X74A 1A5XA 5L1KA 3V9ZA 4NLGA 1BGXT 4KO0A 4M3XA 3TAFA 3AA2A 4CJUA 4M3UA 3V1QA 2IOCA 5HBMA 4QW8A 4IR9A 5HLFA 3CQ8A 3DRPA 3DLBA 4EZ9A 3LP2A 4JV0A 3KHGA 4J9PA 4I2CA 1CXQA 2HMIA 4ED3A 1LWCA 3PR4A 4GXIA 3QEXA 4B9VA 4JV2A 1U45A 1JXLA 1S0NA 3L2RA 3RJJA 4CEAA 2JEFA 4PWDA 3M8QA 1VSKA 4NCBA 3RJFA 3OYMA 4OGEA 4DOAA 4QWBA 5J0UA 3PY8A 8ICEA 3C5FA 3V7JA 4AH9A 1X2IA 1ZQUA 2B5JA 3MFIA 4FBTA 3HK2A 3H08A 4DF8A 1UWBA 3JPPA 3OYFA 3MABA 1S97A 5KFXA 3WNEA 3NFAA 1LW0A 8ICBA 5KFMA 2RDIA 1F21A 1D8LA 4YQWA 3SPYA 4O3SA 4R5PA 4LH5A 2R8IA 3B0YA 5J2EA 5EWFA 4CHNA 2G8IA 4C8KA 3SUQA 5KI6A 3M9OB 3QESA 1KEJA 1ZQOA 1KVAA 3D45A 4I9QA 2J6SA 3RMCA 3VQ5A 1ASWA 5HP4A 2BQUA 4N47A 2HNYA 4F5PA 9ICMA 3MEDA 4RW4A 2VWKA 4DSEA 3HJFA 2RF2A 3HSTB 3PO5A 1AROP 1X9MA 4CJLA 3PUFA 3ZCMA 3UXOA 1QE1A 4W5NA 4IQUA 5JUMA 4GLXA 3VQ8A 1HYSA 1C1CA 4NM1A 4TUQA 4IFVA 4JS4A 4JS5A 1NJYA 4AHTA 3MDCA 2IC3A 2IMWP 5J2KA 4XRHA 3AA4A 3EYZA 3T3FA 4F5QA 3KLGA 1HJRA 4UBCA 3O3HA 4FLWA 3C2KA 3HVRA 4QZGA 3Q8PB 1B43A 2FPLA 4F3TA 1VRUA 1BPDA 4DSFA 1TK8A 3QEVA 4CE9A 5KFBA 3NGDA 1MQ3A 2VA8A 3TAQA 4CHPA 3ZT2A 1N56A 4FJKA 2OZMA 4MFFA 2ZJAA 2XGQA 7ICSA 8ICWA 4AHCA 4M3RA 1ZQQA 1WN7A 3MR5A 5KT3A 4Z0UA 3ZT1A 8ICLA 2DTUA 3GDXA 1Q8IA 4CF1A 4IDKA 5DBAA 4Y1CA 2O4GA 4QOZB 3ZSZA 2KTQA 7ICFA 3K58A 2EX3A 3OJUA 4GC7A 3NBPA 2RKIA 3ZD8A 5J0SA 1X9SA 5F9LA 1D8YA 3VQ6A 4KHWA 1G15A 1UA0A 2E6LA 3KHHA 1PZNA 1MSWD 1JLQA 2R8KA 2B4JA 5HRNA 4Q0BA 4YVZA 1ZQKA 1V9PA 1TAUA 4DTOA 4BXOA 3PW0A 5KG6A 3IM1A 4C8MA 2HHVA 4FZZA 2G8KA 2HNDA 3P5JA 3V9WA 1U49A 1VSIA 2O4IA 4KTWA 3QIOA 1VRTA 3P83D 4BE1A 3Q8RB 2F8TA 1SKSA 4CJ4A 1ZQIA 1ZQCA 2MUTB 4YMMA 2KZZA 3K4GA 5DG8A 4O3RA 4DSJA 1VSHA 4DU3A 3KK3A 2FLPA 1TV6A 1JLCA 4UB1A 1HQEA 4CHZA 2VG6A 3AVFA 2W9AA 1BPZA 2FLNA 4FJNA 5DGBA 2W9BA 1LWFA 3NH2A 3GIIA 2A1SA 4FJ8A 2V4QA 4PGQA 4R66A 3GV8B 2HVIA 4NLNA 4NM2A 3VQCA 3TAMA 1HYZA 1RT7A 4FLVA 5J0XA 4DF4A 1RT4A 3ZSQA 4QZ9A 1EETA 3C6TA 4FJHA 5KFVA 5KFKA 1NOZA 3RRGA 4DL3A 3DYAA 2G8FA 7ICPA 3ORYA 2PY5A 2KZ3A 2F96A 4PY5A 7ICMA 4I2FA 8ICHA 2D0AA 2R8GA 3M8SA 4CK1A 4E7JA 5DK5A 1S1VA 2W8KA 3H4BA 1JKHA 4DFPA 5KFWA 2YHAA 1HPZA 3RAQA 3ASMA 2NRTA 3ZDAA 3DLEA 4CGJA 4FLTA 4RQ8A 3MXJA 1C0TA 2B6AA 1JLBA 3V4IA 4YP3A 3MXMA 1TGOA 1HUZA 1L3VA 4Y1DA 1K1QA 1BPXA 4KN4A 4CHOA 2GWSA 1U04A 3VQDA 3Q8KA 3SJJA 3IHQB 4CEZA 3S3MA 5EU7A 4Z4EA 2J6UA 2PI5A 3S3OA 1SKRA 1REVA 4CHQA 3VQEA 3GIJA 1C1BA 2G8WA 4CJQA 4E7LA 2KZMA 4KAZA 4AHUA 4KI6A 4DQSA 3EW9A 2H5XA 2C28A 4CIFA 4BDYA 1XHXA 5DB9A 1SL1A 3QEBZ 1RDCA 3L2VA 4OPJA 8ICXA 1RT1A 3OYCA 5KFYA 4G3IA 2I1QA 1BIUA 4F2RA 1HQUA 4KLTA 3TARA 5D3GA 4EP4A 2IDOA 1RYSA 2G8HA 3H8WA 4DOBA 4ELVA 4KB1A 4ED2A 4MEXA 3VQ7A 2IGIA 3D0PA 3V6KA 9ICHA 4RW6A 8ICCA 4HHTA 1ASVA 4Z6EA 4CJEA 5KG7A 3MR2A 3PNCA 4HVJA 4QZAA 4F4XA 3ZSRA 3JPSA 4QCLA 1TL3A 1D9DA 2HNZA 4W5TA 3KLHA 1IG9A 4RPXA 1WNSA 2P6UA 3I0RA 1TAQA 1T03A 4P4MA 3AVMA 3RB0A 3PW2A 1FXXA 1Y88A 4J9KA 4DO9A 3LZIA 4AHRA 2ASDA 3NF7A 4ID1A 4KLFA 4RZRA 3K5OA 3BQ1A 3OYBA 4KKOA 4DSLA 3MECA 4CJSA 5L1LA 1YTUA 1KCFA 4B8AB 4ZHRA 3SI8A 3L2UA 4QWCA 3UQ0A 3V6JA 7ICGA 3LP3A 4CF2A 3KD5E 2WONA 2BCUA 1XHZA 1U48A 5HHHA 3NF6A 3AO5A 8ICNA 1S1WA 4HUEA 1KFDA 5IIJA 4C8LA 3AO2A 4CEEA 4PGXA 3S3NA 4F4ZA 4L8RB 4Q5VA 4FJ9A 1ZQEA 4DL7A 4YNQA 3MBYA 3L2QA 2NUBA 5J0QA 3NHGA 5KFQA 7ICVA 3CYMA 1NOYA 1RDDA 1NJZA 1NJWA 5J1EA 4M9LA 2C2RA 4QZ8A 1A76A 4ICLA 2V9WA 4TUSA 2XCAA 4YD2A 1TKDA 4RW7A 2OWOA 1NOMA 3LPTA 1ZQYA 2P5OA 3RJGA 3VQ4A 4YFKA 5BOMA 3RJHA 5KG2A 2FC0A 3BQ0A
chains in the Genus database with same CATH superfamily
5KNIA 3IS9A 5A0YA 3R7SB 4KHRA 4EX6A 5F41A 5F8GA 4KLOA 4LR8A 2YXLA 3OXGA 4X4NA 1GO3F 1MN9A 4CZHA 5LSRA 4B3RF 4NYNA 5ITHA 4G1QA 5AKGA 4P2HA 2HGNA 2ODGA 5AKEA 1PILA 1HNIB 3AQOA 2FXUA 2CUYA 3R7BB 3R2CJ 1OPZA 4YOYA 3CCVS 2CDQA 5E0OA 2UU9J 4RT2A 4M7YA 3OW2M 2G2ZA 1O0PA 1G6BA 1FRHA 1YJNS 3DRXA 4DKWA 5AM5A 4IOCL 2GW8A 3SMVA 3RB6A 2E1MC 5IFMA 3GL1A 4CZMA 1YJTA 3KKFA 3SQ4A 3WU2U 1Q79A 4U7BA 3H1VX 1FRLA 2H51B 4EO6A 1T4GA 1TR0A 3KLGB 2OEJA 2BJ3A 1UW9A 5CHGA 2OEKA 3AH6A 1E3MA 1F60B 4J9LA 4I27A 3DRRB 1ZQAA 1RBLA 1YXQA 1CZAN 3BF1A 1HQEB 1M1HA 5IXUA 3U4LA 1FX4A 1YBTA 1WTBA 5DBBA 3W60A 4HEA9 3B6OA 3SAGA 2G1HA 2HZVA 2XY6A 9ICFA 4H5TA 3AAWB 2QWQA 2ZTEA 1CLQA 1OY8A 4YY3F 3OYJA 2YX1A 4JRQA 2DCLA 1ECWA 3BGRA 4RQMA 2NS1B 3MEKA 3I9V9 1F0MA 3UVJB 2Z1IA 4X4OA 5AXNA 1S9GB 4DV1J 3MWTA 2HQFA 2ITGA 3K0SA 2DPIA 4ZP7A 4HH0A 3ZD9A 4OJ5A 4JKCA 1ZRMA 2HBMA 4PG4A 2RE2A 1NNLA 3TU5A 3UWTA 2L5YA 3OA9A 4DV7J 4GV6A 2HRTA 4HACB 2DR8A 5ALKA 2H54B 1HBNA 4K2XA 1S1TB 1MWKA 4YR0A 2LMIA 5IIKA 4QR2A 3CC4S 3O1LA 3ZT4A 1CI4A 1YUWA 2ALYB 5KT6A 2IRUA 3LDSA 5HVGA 4YMEA 3A0BU 3H0MB 2QC3A 3OHRA 5LJVA 5J8YC 2FGOA 4QU7A 1KR4A 2C2EA 1XO0A 1KVBA 5J0WA 4FM1A 2RQMA 2BABA 3ZSOA 3RW7A 3ULDA 4IJNA 3WQPA 3ZDCA 3O0FA 2XNRA 3OS0A 5DDPC 1U26A 2BXJA 4NLRA 1K44A 4QIWD 4ECYA 4CQ1A 1NI3A 3CNHA 4LSLA 2YV0X 4JAXA 1IN0A 1Q8LA 2QA1A 2P9NB 3M6ZA 4CLZA 4B02A 2E1PA 7ICOA 1SB3C 4GKJJ 3OR2A 4UB4A 2B6AB 2QFIA 5KL1B 1QVFR 3KWGA 4PPZA 2EZYA 1FEHA 4LFAJ 1SZHA 3VTIA 3DM2A 3PSTA 3NVZA 4M7XA 2FJAB 4QR1A 3LVWA 4NJ8A 3VQPA 2VD3A 3EGWB 4DQPA 3C6UA 4ED1A 3DXKB 1CULB 4USMA 4CGIA 3SFGA 1PC5A 2WTUA 2AU0A 4B1ZA 2PI4A 4Q8EA 4P0QA 5KFCA 1JLCB 1PJ5A 2ZD1A 3OD2A 2KOBA 3HFVA 2VONA 4KBIA 4HYKA 1EXNA 3SAHA 2KSOB 5CP2A 3O4QA 1SL0A 3HOTA 4MH8A 1BI4A 2H5EA 2QB1A 4YG2A 3NMRA 5ALGA 4C0OC 1RADB 2G13A 2VFVA 1MC8A 3VQSA 3WUHA 5BPMA 2QYCA 2F65A 3DXBA 5E2QA 1KLMA 2ZNYA 2CPHA 1OSCA 2FD2A 5KFHA 1N34F 2HVHA 1HNZF 1RHKB 4CGFA 1RCHA 5KAKA 2CIMA 1J5OA 4WQ4A 3H8SA 3WK9A 9ICKA 4UB5A 3LZJA 3VAMA 3BH7B 1VSJA 5ETQA 4ILJA 2BJ1A 4RQ2A 4LZDA 1JNZB 4NLQA 4ENOA 5CYJA 2MQOA 5LMUK 2XQCA 4LF9F 3BM7A 2UVUA 4H4MA 1COOA 4H0OA 2D0BA 4CLSA 3L95X 5ALFA 4K4TA 4XH1A 1FTCA 5M2PA 2DHSA 2WSCC 4OD0A 3JSMA 1NSPA 1N34K 5B08A 4E7HA 4LQ9A 4AL5A 5GVQA 1HMVB 1VQMS 3TACB 4QS9A 5CH7B 3EWAA 4MO4A 4JV5K 1FK9A 4DX5A 2WAQC 8ICOA 5CCLA 4B9SA 1FKPB 2A2DA 2RRDA 3D3CJ 3JXOA 2LFVA 4CLFA 3NWRA 2FDNA 3QU7A 3W9HA 1XMQJ 3FBCA 4NYPA 3U3GA 3TABA 4H4KC 1UHUA 3CJAA 4DR1J 3THVA 4JI8J 3ZETB 2Z2ZA 4JI6J 1BA0A 2ZIVA 3G96A 1IBMK 1N2XA 2GC8A 5JS2A 1Z00A 2C2ZB 1VAZA 3OS1A 3C1YA 5EN1A 3A0HU 3CEDA 2EPIA 5G4DA 4YDDB 4FSVA 1VBXA 3BBCA 1NWKA 3MFHA 3DGVA 1F5AA 2V8DA 4BG9A 4RUAA 2KL8A 4KYZA 1NDCA 1V4TA 1JLGA 4WJBA 2EHGA 4DR6J 3JTOA 2R4FA 3W61A 4CEBA 2YMMA 4DV2K 3QQCD 2ZJ8A 3HT0A 4ZOSA 4ELTA 3PMLA 3PW4A 3O9SA 2WVEA 4C7QA 1RI7A 2GJIA 1JCEA 1ZTTA 5E79U 4CI6A 7ICRA 3G8SA 4J2EA 1S6QA 2Z1GA 4RX6A 5DQGA 1X8DA 2E5JA 5HMWA 2PGCA 5J2IA 2ZM6K 1H72C 2W3RA 2O3DA 4WP3A 4DR4K 5DGAA 2OEMA 9ICNA 1FKOA 1UEUA 8ICGA 1RBRA 3ULHA 3EGVA 2Z0GA 2BCVA 5ALWA 4ZCMA 3WKCA 3KZIU 1FDBA 3R6GB 3MM8B 3ISZA 3EE3A 4HUFA 4DXLA 3N28A 3A2FA 3TAPA 2PFOA 3TRGA 1YJ7A 1Y4ZB 1RTZA 2ZWOA 2IBOA 3WKBA 2EK6A 1NKEA 1KVIA 1EJ7L 1TK5A 4DX7A 4LVNP 4RPFA 2F8MA 4JI3K 2HS0A 3CCMS 2KYXA 5J1PA 5BR8J 4YXMA 1V3SA 4Y2AA 3HXMA 5TKYA 4OLAA 3U3YA 4DEZA 1DARA 1E6YA 2E29A 1YJ9N 1C0MA 1FJCA 1EX4A 5DM6Q 1B4SA 1FWPA 4KN7A 4JYAJ 1Q81O 2UUCF 4I2AA 2WBMA 2K4PA 1QLNA 2HBZB 1SXEA 1N5YB 1NNDA 1X4HA 3WT0A 5BPCA 3SYZA 4FJ7A 3QX7A 1VSEA 2ZH8A 1YRXA 6FD1A 3F9KA 3QATA 3T5JA 3T1HK 3VZIA 3H4DA 3T41A 3NTUA 2VA2A 8ICZA 4BREA 5A6WA 3C14A 5KTQA 1FO1A 5J2QB 1RAIB 4LF7J 4KLHA 1TL1A 2VICA 5KT4A 2LEPA 4CRJA 4FKYA 1Z2LA 1FFGB 2BVZA 3NDKA 1HBUA 1MNEA 3PTWA 3JPTA 4LFBJ 5ETMA 3CCTA 5I3UB 9ICPA 2OPSB 3QETA 4H5RA 3KNAA 5HMYA 2Q0RA 1NMDA 5C5JA 1S1XA 7ICIA 5J2DA 2H3EB 3ZEUA 2OHFA 4BHQA 3I96A 3NNHA 2PFUA 5J2JA 5DB7A 3AJ2A 3GIKA 3D2FB 2POKA 4WTYA 2GMHA 3DNCA 2CPDA 3JAMY 4ECSA 3TA2A 2L08A 4Y2UA 1VSMA 3UCZP 4ANEA 2XMKA 1JLGB 4LF4K 2WB1C 4A48A 2HF4A 3CQXA 3GIMA 2IDLA 2FJWA 4FVUA 3VGVA 2BJ9A 3GR0A 1P8ZA 3E58A 4H5NA 1SB6A 3TFRA 2PN6A 1KP6A 4NI2B 3K9KA 5IQQA 5DG7A 1MW7A 1SI9A 1ZOLA 1DRZA 2IVNA 4MYUA 3AVNA 1S9EB 4X4PA 5E26A 1D9AA 2IBKA 4JYAK 4ZTFA 1IXKA 3C16A 2V2ZA 1TL3B 2ZVIA 2F9WA 1CJTA 2CH6A 5JXSA 3K89A 1S49A 5E3PA 2HB5A 1X6IA 2DKZA 4MLHA 1FKPA 4EYIB 4Z37A 4FDFA 4F36A 1Y3KA 1QJHA 3W8PA 1KN5A 3U8XA 5AKJA 5D6GA 4CVNE 2QGFB 1M90O 5H9FK 2F1JA 3CD6N 4G9ZA 1R8AA 1RWMB 2F44A 3CUNA 4GXJA 2YN4A 2E5LJ 3A5NC 3MZIA 2MKHA 3MUVP 2JEGA 1DK2A 3HRGA 3AVJA 4HDHA 2J9DE 2FBXA 3BDPA 2AGQA 5FRNA 3ZFVA 3R6LB 1N33K 4IR1A 3VALA 4R8UA 2ZC3A 4IFYB 4Y6IA 3NLCA 4CK2A 4KLQA 5FPDA 3QEPA 3UDVA 4F3QA 1RZMA 3VEWA 1UVKA 3CNQP 3CIMA 8ICIA 2XS5A 4IQWA 4IO1A 2IYIA 3PX0A 3BQTA 2AH5A 4DLEA 3HW8A 5IINA 4ZVQB 4DUTA 1KRPA 3ULEA 1HKBA 1A77A 2RLTA 1ZQWA 3IBWA 1Y11A 5ETLA 4B3OA 4GKKK 4KB7A 4PABA 2IRXA 4BXOB 1EWQA 3B4MA 4C0ZA 3BSNA 2PO4A 1U1NA 1YJNN 1D9FA 1JWWA 3MEEB 1ZBSA 2KLAA 2DNYA 4W5RA 1NK8A 1O08A 1NB7A 2ZDOA 3KDNA 4L3NA 2R7UA 2OTLN 2PMWA 1S12A 4S0MA 1AFIA 5HSPA 3GU3A 4PGYA 1CLFA 1R0CB 4YN4A 1WSHA 1KD1T 4WFZA 3ENBA 3DLGA 1S0VA 2G06A 2PFQA 1O13A 3CCRN 4LF6J 3WXMB 1NK5A 9ICSA 2GUPA 2D7SA 4YOWA 3M5RA 4N7TA 4MFBA 2EKNA 2WW4A 4W92B 2KE7A 5CR0A 2I0XA 4USIA 4OV6A 2KNJA 4DFJA 1Z19A 4PZNA 1VCTA 4DU1A 1WUDA 1RACB 1RP5A 4A2AA 3QZ8A 4N8OA 3GG4A 1NU4A 2HPUA 1SJ4P 2GO7A 5J2FA 3FZMA 4I29A 2RKIB 2AKWB 2HFZA 3F73A 1N33J 4O3NA 5AQUA 2CPXA 1SJ3P 1WEZA 2XMTA 3MMJA 2P9GA 5BR9A 1J5EJ 1R0AB 1ICEB 5IV4A 3HZEA 4Y28C 1X6JA 3O6QA 1OWXA 4Q0BB 3GG1A 4XQ8A 3KKAA 4M5MA 5IC4B 3OTQA 3D9BA 1JL1A 5JLHA 3C28A 3T69A 1URRA 2RHQB 2F8SA 4F9OA 4F93B 3G0ZA 2QMWA 2GLEA 1NM1A 2VG5A 3CDAA 4W98A 4O0IA 1XNSA 3H2LA 2YX7A 4ECRA 2CJBA 3TANA 3M8PB 2K3IA 5AM1A 5IM0B 1BG3A 1GOBA 2MZJA 5HN0A 3OVNA 3HVTB 2HLTA 5ALSA 1WKKA 4WKRA 3UCGA 4HUGA 4PXDA 5J2CA 2XB2D 3UPQA 1ZQLA 2OH2A 1VC6A 3R8EA 4OYXA 5HOOA 1ATSA 5EE3A 2WVCA 3GU0A 2P9PA 2D8CA 2FPMA 4LR7A 3FZLA 3H8JA 2OAUA 4NCAA 2UXBF 4RQ7A 5BN8A 5AKZA 4O4GA 4UZCA 3TR8A 1JB0C 2LDIA 3ZX2A 3R9PA 4C11A 2LXFA 4IEIA 5AQHA 2HEKA 2XTJP 5K8MA 3TFSA 1YDLA 3X3UA 5HQMA 4OX6A 3E9OA 3JTPA 5L1MA 2IHMA 4DV0F 5KFDA 2H3ZA 5DDOC 1S48A 2KB2A 2GO9A 5T7BA 3C66A 3IMXA 3GWCA 3AVGA 4Z2XA 2DNHA 3CJ7A 2NLXA 2F63A 1DQ8A 4JOUA 1CJUB 3A8EA 2P9SA 3J80O 2QKKA 2J0QD 3AO3A 3ILIA 2ZIWA 1ZA1B 1PSDA 1X40A 2ROPA 3AU6A 2X1GA 5F0WA 1WDDA 2A5XA 1JL2A 3HI9A 1V3RA 4GMKA 3VVTA 3A8IA 2AYBA 5IZHA 3G8TA 5KG5A 4X66K 4FWMA 4WIQA 1B7FA 1VIXA 3CCRS 2OD4A 1ZQHA 5KG4A 3F2BA 4KLUA 1NGEA 2KV2A 1J9AA 1M5PC 3CDUA 4JK1A 2Q2RA 1JLAB 1UAWA 2GZOA 4MYTA 1QSSA 3B8HA 2RS8A 3AARA 1COKA 2FSJA 2FBYA 4E2FB 1RWKB 3O9RA 3C5GA 2V52B 1RISA 3M9NB 2Y1JA 5AQYA 4KH1B 5KFRA 2G07A 2W9CA 3O9UA 2H48B 2BANB 3HD2A 1NGJA 1R27B 3PM9A 1YT3A 3DHXA 1S72S 1G2EA 8ICUA 5EVZA 2HVZA 1QSYA 3D0IE 4MF8A 3KMSA 2MPUA 3UI3A 4LFAK 5AQNA 4QYRA 2MJUA 3ZZRA 2HYIB 2QB0B 3QU2A 2P6RA 3NKYA 4BC3A 1WSGA 4IFEA 2CGJA 4QIFA 2DNRA 2DYAA 1NLVA 3GR1A 4OLPA 1Z05A 4JI7F 3IG1B 2HNDB 2JZ5A 3SNNA 1UKUA 2BGWA 1WCNA 4DL0C 3SUNA 3JQKA 4NLZA 3GTYX 1ZQGA 1T9YA 3MN5A 3ET6B 4W90B 1XBWA 3LW5C 1REVB 2F4FA 3LPYA 2LA6A 1GTHA 1X0PA 4O23A 3J81Y 5A6PA 2P9UA 5JU5A 2Z4PA 3LO3A 1NK6A 3BH6B 5DQIA 4H8KA 4UW9A 3WC0A 2G1DA 1EKRA 2RHFA 3JQJA 4BACA 4EU0A 2PYJA 3M30B 5J2AA 3RWUA 3WK7A 4ELUA 2H4WB 3MCOA 4USWA 4PXCA 2D1KA 4GIBA 1SC1B 1S4EA 2JFKA 5CB1A 2MZ1A 4IFVB 3I8DA 2PFPA 1BQMA 3A5LC 2M9KA 4B1WB 3TOQA 4YN3B 3NAHA 3NGSA 2PT0A 2RH3A 9ICUA 4MDBA 3HPOA 2J0XA 3K9JA 5KPZA 2FQQB 3UXPA 3ZZPA 4K25A 4C0BA 3T1HF 1DTQB 1DGSA 4Q45A 5CRXA 4ZPBA 2YJFA 4C8NA 1GLDG 1IXRA 1EP4A 2HURA 1K1SA 3O1BA 2JZBA 1N54B 4KFBB 5SUHA 3VQQA 4KGMA 1AQ6A 1ZBIA 3SUPA 3FC4A 2MEWA 5HJXA 1BMQB 1PO6A 3SCXA 3CULA 4IOAQ 3CIZA 4YXJA 4CO2A 4CFAA 2E1FA 4NL9C 3TSQA 4CEQA 2HHHK 5ALMA 3G6EN 4CYUA 1P6TA 1B4FA 1DJ0A 3D3BJ 2GTDA 2R7XA 3QFWA 1M1KT 2HMPA 3OR1B 8ICJA 5AQTA 2RQCA 1HNIA 1QAJA 9ICCA 4FWPA 4CF8A 4FJLA 1Q9XA 3W8GA 2E9TA 3US5A 1I3AA 1RGIA 3IBPA 1T95A 3ZZOA 1ATRA 3G6VA 2F8HA 1P9YA 1T9UA 3OL8A 5BXIA 2KO1A 4DV3J 4KB0A 3RVCA 4Y65A 4ID5A 3HKZC 4JKGB 1YZ7A 2A10A 3OHBA 4BGDA 4JD2A 3CXCM 5ALEA 3EZOA 2A3VA 2B56A 2PZSA 1AYEA 4BDPA 1SH3A 4C4TA 7ICQA 2CXYA 1MMNA 1Z1ZA 2PFFB 2BH1A 3H59A 4BRDA 3ZYYX 1NGGA 3ISBA 3VPZA 1X60A 4NRTA 4F5OA 5EUHA 3CMAS 3VAJA 5C15A 4EBDA 2HS4A 3QWUA 2NO4A 2GIQA 5KFGA 1U0HB 4FW1A 1YK9A 5F8MA 4KPYA 3AD8C 4OYOA 4BROA 1UEVA 4I28A 1JLFA 2KT2A 4Z7CA 1B9FA 3QNOA 4E7IA 3ISNC 3NNAA 2A1JB 2HHSA 2DT9A 1VC5A 4TUPA 5AQKA 3FDSA 1VQNN 4WE1A 4NA2A 1L3UA 1DGKN 5J2HA 1ZETA 2MY7A 3P4UB 1YBUA 1MROB 3KJVB 4J2BA 3MR3A 2W2OP 5DKWA 1C7YA 4CM0A 4KV8B 2XHBA 3G4SS 4FXDA 3OR2B 2PMZC 3PEHA 1GFWB 2YHBA 5CCMA 3IWLA 5DDRC 1GXTA 4I6WA 3TADC 4B3SK 3P3DA 1PYSB 4HACA 1MU2A 3KKSA 3WEEA 1QQ6A 4ZPAA 1RTHA 2QT7A 1VQKS 2WFBA 3VV2B 3KHRA 2IA6A 3VEXA 4ED5A 2VG5B 4ZVSB 2Z7JA 2RQ4A 2AJ2A 3PJXA 5LSOA 5B0CA 4QBUA 2M2BA 1F0XA 4C48A 3GJTB 4GRSA 2FC8A 2HOEA 1CJKB 3TAEA 4NZ0A 4OX9F 2CH5A 4LF1A 2GIFA 4MIWA 4R64A 1IBKJ 3PIOQ 3AJ1A 3MHYA 2ZGZA 4KO0A 2YY6A 5BPNA 2OELA 1OVQA 2VGNA 4AXIA 3AA2A 2ZOGA 4CJUA 2CG4A 5JICA 2DF4B 4F72A 2IOCA 5HBMA 3DRPA 2Q6BA 3MM8A 5GAHP 3W2WB 2XZWA 3HX9A 1CXQA 3THPA 2QG9B 4GXIA 1NSAA 2FI1A 4B9VA 4C4SA 4P71A 4TY8A 3GYXB 3RJJA 2JEFA 3EMTA 2MQLA 3WK6A 3I87A 3OYMA 8ICEA 1X31C 4BRNA 2NXUA 3C5FA 3Q23A 2CRLA 5IWAF 3O8WA 4P2XA 4X2BA 4QR0A 2B9YA 1W7WA 3HK2A 3JPPA 5EHHA 1LW0A 1K8KA 2I8EA 1F21A 3WKDA 4YQWA 5B09A 1YRTA 4CF5A 2KKVA 4R5PA 4LH5A 1NHKL 3E8OA 1O03A 4CDIA 1ATNA 4LF8K 2BW2A 3W1YC 4CHNA 2NLWA 2B0CA 2DKXA 2VCPA 5KI6A 2CQ2A 4HI1A 3WIUA 5C25B 3M9OB 3QESA 5D15A 4A5AA 3D45A 4GFJA 3DCAA 2LKZA 5LL6d 2JDJA 2Q4TA 4N47A 4UY8T 4KKOB 3MEDA 2GVZB 5K8PA 4YHHK 3FQLA 5GIPA 2RF2A 4CJLA 3LGMA 3TZWA 4IQUA 2KJVA 5IWAK 1HYSA 1T94A 1JLFB 5IC6B 5JVHL 4QQBA 3DLLL 1UFLA 4TUQA 2QE5A 2OSQA 2XMAA 4JI1K 4AHTA 2QL5B 3CJTA 5J2KA 3M4XA 4DN0A 4XRHA 4WK3A 3AA4A 2V94A 5GADI 2V4JA 3H42A 3KLGA 2O8FB 3C2KA 4LF8F 4QZGA 4JI2F 4OIXA 1YTYA 4ID8A 3A3OB 2FPLA 4JHDA 5LMUF 3D5MA 1VRUA 3T9ZA 4AYBD 3JSMB 1T02A 2HFNA 1R89A 4CE9A 4EI2A 2YWFA 1VLYA 3NGDA 4YB5A 1VRQC 3MAAB 1MQ3A 3TAQA 4CHPA 1HEKA 1N56A 3WBZA 4C23A 5MLCV 4OYWA 4CH0S 4K5RA 4HT5A 2VFUA 5E3CA 4M3RA 2VFRA 1ZQQA 3NRWA 1BNOA 3PIPL 4CF1A 4NZ6A 1SH0A 2O4GA 2MLZA 3BKUA 2JH7A 1I5OB 3ZSZA 1LEOA 5T41A 4P74A 2EX3A 4GC7A 3MPUB 2I7PA 4KIAA 5AI6A 1X9SA 2XSFA 4JKFA 2J7UA 5I3PA 2YVSA 1UA0A 3DEEA 1TMJA 1MSWD 4LF7F 1JLQA 2XHCA 3D1OA 1ZQKA 5AJ3K 2ADBA 3TA0A 4BXOA 3PW0A 1G1XA 3EVWA 2RU9A 5JRTA 4XDCA 3V9WA 1U49A 2V50A 4KTWA 1GNKA 3P83D 3Q8RB 3UR3C 5AK6A 3RBXA 4NRUA 4CJ4A 1ZQIA 2E2OA 4KT0C 4YMMA 2KZZA 3K4GA 1VSHA 3JB9k 1KD1O 2CFXA 3TZZA 3LP1B 4ES2A 1HQEA 3TADA 4CHZA 2W9AA 1DGJA 1GAOA 1V97A 4BUGA 2ROGA 4ACOA 7AT1B 3FSXA 5F8HA 2P9PB 2W9BA 2VFTA 3NH2A 4NLPA 4PGQA 5AI4A 3BEGB 2KVSA 2EZZA 2EI5A 1U02A 4Y2KA 2W24A 1H2VZ 2MMYA 3ZSQA 4QZ9A 3M32A 4IO8A 3BBBA 3D2EA 3DYAA 3ORYA 1IBLJ 2VODA 2KZ3A 3O5BA 2EKYA 5T14A 7ICMA 1MDUB 2R8GA 4DR2K 3M8SA 2FSNA 3MURP 1S1VA 2W8KA 1JKHA 2ZJPQ 1AZSB 4C0HA 3D6FB 3QUCA 4DMZA 2MKCA 3WXKA 3OV7A 4FPRA 3QFUA 2ZH4A 4PQUB 3SMZA 1HUZA 4WQ5C 2CJQA 5DDQC 4DCJB 2PBDA 1T9VA 1BPXA 2RUGA 4WCEQ 5KOXA 3Q8KA 3MTJA 5ADZA 1Q82T 2Z2YB 4LBHA 4V19X 4PYDA 2RIJA 1B0VA 5EU7A 4Z4EA 3S3OA 1SKRA 1HHQA 3DRYA 3VQEA 1C1BA 1HIWA 4E7LA 3FBEA 4YOEA 3CERA 4M5HA 2PIIA 1T9XA 5AQXA 4JI8K 3PZPA 3L2VA 4DCPB 4OPJA 1S6PB 4GY2B 1XR7A 5KFYA 1XMQK 2I1QA 4CT9A 5K9FA 1HQUA 5AQMA 3M6KA 2AEMA 3C6AA 1U1LA 3GG0A 2P5VA 4MJKA 2DGWA 2G8HA 2EH9A 4DV3K 4DOBA 4PKHA 1C0FA 4KB1A 2KG5A 4X64F 1MN8A 2VQEF 1JALA 3ELHA 4AYBF 1Y10A 4RCHA 2W55A 4CJEA 3R8YA 4FNIA 2OMLA 3P96A 4P2SA 3MM5B 3FE1A 4QCLA 3JPSA 4H4OB 1TL3A 1WD6A 2E20A 1D9DA 2ZH6A 5K5MA 2YWHA 2KHQA 4DG1B 1X4AA 4WXWA 1SV4A 1TAQA 2H5JB 4RW9B 3AVMA 1GMWA 4WPAA 3NY0A 4RW7B 1FXLA 1HNZJ 3NF7A 3T7ZA 2YH0A 3K5OA 3OYBA 2NUHA 3M8QB 5H1SQ 1JJ4A 5L1LA 2G0AA 1HX1A 1Q16B 3DAWA 2HQGA 4KGZB 3L2UA 3UQ0A 5J2PB 3LP3A 4CF2A 1BO5O 2C3OA 2UXDK 1XHZA 3L7UA 3BQ7A 2D4WA 2O6KA 4CEEA 3OTOK 4IO9L 4ZJOA 2HBQB 4FJ9A 4LFCF 5AM3A 1PYTA 4MK9A 1YJ9S 4BVPA 2A1AA 3L2QA 1N36F 4ISFA 5GMDA 3LTOA 4NLBA 7ICVA 5ALLA 1Q46A 1N63A 1NJWA 3KLHB 3N6MA 1GLJO 1KTVA 1YIJN 4ICLA 2YTUA 2JC0A 3H0LB 2OWOA 5GMKa 5BOMA 1N33F 3IAYA 3M9MB 2UXCF 4J9QA 2NO5A 3MGIA 5AQIA 1RBVA 3QGGA 5C25A 3HILA 2G5IB 3MDQA 5CZXA 1Y9OA 2OP5A 5ALHA 2BEFA 1RFQA 3C8YA 4FOIA 1KQFB 2VFSA 1S1WB 2MUTA 2RB7A 3FCVA 3CDBA 3L4QA 2ZTCA 1ACMB 4I2QB 4ES3A 1WG4A 1RXWA 3B6BA 4RU2A 1H2TZ 4LFBK 2IS3A 4I6YA 4P4PA 3SQ2A 5HP1B 2QB0A 3ADAC 2YNHB 4DR7F 2W1BA 4CNQA 1Z4OA 3J80U 5H9EJ 5BR8F 3IG1A 2G2YA 5AQZA 5KFAA 2VPWB 3WNGA 2RQ5A 1XTZA 2QXFA 5KFPA 1VHIA 5IT0A 2ZHOA 1J53A 2AP6A 5HR7A 2P9NA 3SCKE 3CJ9A 3UQ2A 4PWUA 1CEZA 3TUPA 2QK9A 2MYFA 2WB1D 2QWMA 1O8BA 3PV8A 3HPGA 2DY9A 3ICLA 2AWZA 3S7RA 2V69A 2KKPA 1IV0A 4MFAA 2MA1A 1TL7A 1RLDA 1KLNA 3B6PA 1U0SA 4M9NA 1DTTB 1UVJA 3N9UC 4KY3A 3PACA 2WHOA 3GFYA 3TWZA 1QY7A 1OXJA 2DRDA 2OI2A 2V63A 3UKRB 5KFEA 4CJ7A 4M3WA 3NVKA 2OFHX 2GWKA 2OPQA 1PC4A 3QBWA 2X6NA 2LKYA 3CD5A 1RDWX 1IQTA 3QRQA 4DV6K 3T19A 2E4LA 2LMRA 4MAKA 3RW6A 1NGHA 1HRHA 2HQIA 3OLAA 3CPWR 3SLCA 4OJHA 2J7KA 4E19A 3UB5A 3ZO7A 3HRDD 1RQ0A 2OIHA 3KZXA 1UVLA 1U25A 4JI0K 1N62A 2Z1HA 1WHWA 1SKUB 2DISA 4DSKA 3LAKA 3QGIA 5GAEP 2I6WA 3H25A 2E6MA 2ZITA 4C2MA 4LRAA 2ISOA 4OZJA 2VOOA 4ED4A 4P73A 4Y0WA 3NRBA 1PBAA 1UVNA 5CR4A 1VSLA 2ZBQA 1U1PA 4KLMA 3OTCA 3WXLA 3OYKA 3NASA 3N6LA 2LBOA 4OJPA 3J7ZO 1HNVB 2P9EA 1TFWA 2HOFA 3ZDBA 3C2LA 5I42A 4XPEA 2WAQF 3NH0A 2E9RX 3RJKA 2BW7A 3WKAA 1KFSA 3VWSA 2GOLA 2L3MA 3OHAA 1ZQDA 3F9MA 2CPJA 4E7KA 3K5MA 3WIVA 3ENAA 4OHVA 2KKZA 4RUBA 4M9JA 4UUWA 3O44A 3O3GA 1SQEA 2F5GA 1FJ7A 2F9DA 3DXMB 2ZZMA 5M1QA 5A2QO 1WI8A 2ZQBA 4LF9K 2FBTA 1D8BA 1VQ5S 5DDMA 1VQPN 2YKNB 1Q9YA 3AODA 3AUOA 5CZ2A 3UDCA 9RUBA 3T5HA 2LSNA 4FWKA 4E1NA 4TYAA 2JGUA 4JV5J 5AK4A 4DR3K 3QNMA 2O01C 4ATNA 4I2HA 3U1LA 5FLXY 8RUCA 3MM7B 4CFDA 1ZS6A 3P8BB 3B54A 4RT3A 4C8ZA 2HCFA 2A6MA 1RYRA 3CCVN 2RPIA 4DTXA 4YORA 4BVOA 3I0SB 2Q1NA 1XMBA 3THYB 1ITGA 3QERA 4BWMA 2NRWA 4OHZA 1BUPA 2FYXA 3LANA 2BCSA 4DTSA 3J7YU 5HBMB 1NGCA 1YSJA 1K0VA 1HJPA 3T5LA 2VG7A 2CN1A 4ZVUB 4P0QB 2CQ0A 2KI2A 2D6FC 1RT3A 2R7YA 3I32A 4DV0K 4FP9A 3TW0A 2OZSA 2IM0A 4KTZA 3VGMA 2FLLA 4J9OA 2CWXA 1NXIA 3PW7A 4O55A 3TWHA 1XO1A 4KLDA 4DHVA 4FLZA 4KV8A 3TJ8A 1QQMA 1NH8A 1Q86T 1X42A 9ICIA 5M1OA 2JEJA 2W03A 2GMLA 2QLTA 4HTLA 2P8IA 1NK9A 1SXLA 3DI6A 1WCLA 1R8BA 3A12A 2FPKA 2W04A 2XLJA 5AK5A 3EEQA 1VISA 2J7WA 2VPYB 3KMQA 1R7IA 1TUYA 2JX2A 2CQBA 5KAIU 1ZJMA 4C7YA 3AT1B 1SC6A 2NRHA 4C98A 3B78A 3RJIA 1FIQA 3IR7B 2E2NA 3MUMP 1TVAA 4IEEA 3NGYA 3MMVA 2KIVA 2X3GA 3ETRA 4FXVA 5LJ3Y 1ZQFA 1MWZA 3CCEN 2OXOA 1ZQBA 4PKDB 3K17A 1Y5LB 1QE1B 2IPOB 1XS9D 3VGUA 2WC9A 1LVHA 4DR5J 1ZJNA 4RNOA 5HMLA 3IFEA 2C2OB 1ZM4A 2RAQA 5AI5A 2R7OA 3CCMN 1HLWA 2MKSA 4JI6F 1LOTB 4JMUA 4PXBA 4YB1P 3DKDA 3NVYA 1ZQVA 5KFJA 3TX0A 1RWNB 4JV1A 3K1ZA 3R3LA 4MFBB 3R1LA 2R7SA 1KWMA 4C6AA 2EG1A 2F4VJ 4E8UA 4PPDA 5IT9U 1X7VA 3VAIA 3OYDA 3NOCA 2VKZG 3HT3A 1P1TA 4LFCJ 4DTNA 1RAEB 3RH6A 3I55N 5LMNK 2BX6A 1RAFB 4JI3F 3FJ2A 3NS5A 3M8ZA 2XS2A 4Z6FA 2EAPA 1VLBA 4KLSA 2YKAA 3HWTA 1VQ7N 3QO9A 4JP8A 4N41A 4B08A 4L75A 2J0SD 4PKIA 2PFNA 3FSIA 2E66A 2EWHA 3V7KA 1ZTWA 4ECWA 3MEGA 4USUA 1FDAA 1NAQA 3LA0A 4M6WB 4I1TA 1YJWN 5GIOA 2FIUA 1ZBUA 2H3FA 3UE2A 2ZUCA 4I2EA 5HO4A 4I2QA 1BUXA 3RFAA 1RAAB 1V6HA 4NCGA 4ZVOB 4OYPA 2PYLA 5DB8A 2MHEA 1L3KA 1Z4UA 2W4CA 2FBVA 5J2BA 2KKHA 4MQ3A 2W40A 4N77A 3L0QA 3MEGB 4NLWA 2VG6B 4EELA 5GAEU 2DO0A 3NCQA 4YOUA 2KM8C 3V72A 4JK7A 3D7EO 2CGLA 3M2VA 5KQDA 4EEKA 4RG8A 1J2NA 1B0XA 3N79A 2YH1A 2V6AA 5KG3A 2KHDA 4DUYJ 5KGWA 1RNHA 3QT8A 2ZWHA 1J5EF 2CPYA 4BC4A 1KNZA 1O5JA 5KT5A 2ZEJA 4OZ0A 4WFAQ 1VHXA 4KFBA 5ADXA 2W11A 4OLBA 3G6YA 2GGPB 2Y3YA 1EKEA 5CYQB 4U6PA 1TU0B 1R31A 4PRFA 2VF3A 4ZVEA 4XUSA 2X7IA 3H98A 3C14B 3ZDDA 3CFOA 1UJ4A 2XO7A 1LWCB 4NZ7A 4CH1A 1ZA2B 2IVMA 5D46A 4C8OA 4BQLA 4BS2A 4DOZA 4GVBA 2VQFJ 3QXGA 1Q81T 4J2AA 1WC6A 3ZZYA 4IOCQ 2HRUA 3QFHA 1S9FA 2C2MB 2VV5A 3CDEA 2RP5A 1KL9A 3K2PA 3BGFA 5TKWA 4DWIA 2JOQA 3MR7A 2VH7A 1F9EB 4KGVB 1T3QA 3HM8A 2ZH3A 3CCJN 3KOAA 1VC0A 4PXEA 5J1NA 2F8EX 3ENHA 1XQSC 3R9KA 4WTOB 4FK2A 2JLFA 3Q0AA 5A8WB 2UP1A 2CPZA 2AJQA 3OPKA 1J27A 1BY9A 4EENA 3KNGA 2HG4A 2WMMA 1HR0J 3UQSA 4KPCA 3KVGA 4JLHA 1JCFA 3EXCX 1H6KX 2DXEA 3O4WA 2GVDA 2C3UA 1S1VB 3L3CA 5D0RA 2JHEA 4Y2VA 1HWKA 1MWQA 4Z94A 2GS8A 3GV5B 2W2QP 4DPUA 1K0TA 5J2MA 4FM2A 3SQGA 4P7TA 1QQ5A 5CXTA 3E9LA 2KJ8A 4K50A 4R65A 5LXRA 1BWEA 2HZAA 4AM7A 4KHMA 3MC1A 1BQNA 4Z4GA 3SBMA 3PIPQ 4WFYA 4CEDA 5JMVA 4FLYA 2LEBA 3MAAA 2D3UA 2WFAA 4WP9A 2A3JA 3G9CA 2IOFK 4C11B 5I3QA 2E5SA 3NGIA 4CTAB 3F2CA 3TSUA 2E5GA 3UR0A 4IWVA 1D1UA 3F56A 2HHWA 1B64A 3GZ7A 4UF4A 2XI2A 3SIPB 3RBEA 3DXSX 4TNOA 1IBKF 2B4UA 3AB2B 3LOUA 2VA3A 4CJ3A 2EAMA 1X66A 5A0YB 3L3UA 1JMSA 1BPYA 3UD4P 3NGZA 4F71A 2YHXA 5KAFU 4IBNA 5CYMA 2A19A 4ICLB 1U1QA 2ZOMA 2CJYB 4G6VB 2AYMA 2VBWA 2YNGA 2BDUA 1BLUA 4UAYA 3RB3A 2UXCJ 4TY8B 2D74B 4DUZF 2YWWA 2UV8A 4JKBA 3L8BA 4FYXB 2QEXS 3SV3A 5BRHA 1YJWS 4F4YA 2W9MA 2ABYA 4MK7A 3MMBB 2ZM6J 1SKWA 4L3KA 2CQ4A 3HKZD 4E0DA 1LWFB 4E3SA 1MG7A 2Y9HA 1T05A 2XC9A 4BGAA 4KMOB 4IQMA 2MAXA 3DGPB 3LALA 4FWOA 1M90T 3LP1A 4DJBA 2CQGA 2H65B 2XLIA 1VQLS 3NE6A 2G9OA 1S9EA 5EOZA 4KTQA 5CY4A 3H7HB 1EXQA 4CBXA 4ER8A 3UFCX 4GNIA 1P7DA 1BNPA 5F3TA 3NAIA 2GIRA 4LJXA 4K8XA 1RTJB 2ACYA 1S1TA 4KHPK 3AVLA 3GPAA 4M6WA 2WVFA 5F3XB 4EWTA 4Y2SA 1HR0K 2BOPA 2AXTU 4OVLA 2NXNA 5ALVA 2VPZB 3AGRA 5JTIA 2FB0A 4A8EA 2F40A 3F2DA 3IUCA 2GH1A 2YWKA 3UKUA 4BRAA 4DFMA 3A3NB 8ICSA 3O8MA 5AIAA 4PQUA 4KR0B 3EL2A 1L7PA 1YX2A 2PXIA 2VQFK 4PHPA 5AXKA 2ZTDA 1ZQRA 3EWGA 3KHLA 2H4YB 1W2BM 3N4QA 3ZTSA 2DFLA 2D3ZA 3UVJA 1KC8T 3EKUA 1U1MA 4I6MA 3EKSA 4RQ5A 1TL1B 3SSSA 2EEYA 4RUHA 4DL4A 2KN4A 3BQ2A 1BCOA 3SDEA 1RHQB 2L48A 4B3OB 1ZD2P 4HAIA 3MAHA 5DBCA 4CLKA 4LF5F 9ICGA 1HBNB 2FHKA 4HI2A 4DN9A 1NJIO 3HZGA 2VJVA 2QLFB 5M2UA 4GVMA 5BOLA 5AXMA 1GMWD 3I5BA 3K0JA 3DWLA 1CC8A 3CM5A 3H46O 3IG8A 2A40A 3QDKA 2P35A 4USKA 2A6AA 3JPRA 4DQIA 4FVMA 3CMES 2PD1A 4LRCA 3FK4A 2BUPA 4BY9C 3MCPA 5AZIB 3D67A 4BDZA 3SK3A 1RAHB 1SUQA 4OJOA 1FRXA 1MA9B 2YHWA 3N7PD 2ZZNA 4P72A 1ZQZA 1WHXA 3NOGA 2O8EB 1RU2A 3ZSYA 4DSIA 4DTJA 2WF5A 1Q7LB 3I76A 3CG7A 2LEAA 5ETNA 3ZT3A 2X1FA 2A1RA 2VOPA 3C7NB 2W2MP 3OTBA 5E5NA 2Z56B 8ICVA 2GQQA 2MKJA 2ZUAA 3VMFB 5HVFA 2ESEA 1S4FA 3QU9A 3WC2A 5J2NA 3N5BA 2UUBF 4GC6A 1DRGA 2D1CA 3CFPA 1Y64A 2H3GX 4X4VA 4ISGA 3CJKB 2Y0SD 3LAMA 4K0KK 4B3TF 4CZJA 4URGA 4FS2A 5H9EK 4WU2A 2E2QA 1VJWA 3Q2TC 4QPTA 1U2RA 1RUSA 2MQPA 2PDAA 4E1MA 1QTNB 4CZLA 4KREA 1Z25A 3LK9A 2B4PA 5DO2A 4ZVHA 2HHXA 5B0EA 4IOAL 2HWHA 2ILYA 1FHTA 1UW4A 4DR4F 2RDDA 3V6DB 3L6QA 4BC2A 2ZBRA 4ZP6A 4OPAA 3P39A 4L3QA 5HR6A 5L46A 4RQ6A 2RMLA 4Y2YA 1DY3A 4LY7A 4I2JA 4ZLNA 4QWEA 5ALRA 1N8RO 2ES6A 2KFYA 1RBTA 1YVUA 2JZBB 1U8SA 3GDQA 2BKEA 2V7YA 1NPPA 1AW0A 1G99A 2UUAK 4CEOA 2RILA 2Y1IA 3MGHA 2BJDA 1Y3JA 1WC4A 1HBOA 1AZSA 3FMBA 1G7CB 2A42A 3EY1A 5HQLA 1S6OA 1I6JA 2MRLA 3ISDA 3UD3P 4LFAF 4LSNB 2QYGA 2FVSA 3GBTA 3QBCA 4H5VA 4PPXA 4F3MA 4OYZA 4FOEA 4JI4F 1PUZA 2I7NA 2UUCK 2PKEA 3ALRA 3KWMA 2J5AA 1B9DA 2X1AA 3MD3A 1Q4RA 4ZCLA 5BPLA 2M88A 2OPQB 1QQCA 1YZ6A 5HQ8A 2F7TA 1YVNA 1WSIA 2K1RB 2DGSA 1WSEA 4ZPWR 2GVZA 3KYLA 2ZJRQ 2Q66A 4NXMK 3QGHA 3EICA 5J0RA 4C3KA 2B6GA 2BKPA 4LF9J 4DV5J 1Z4NA 1HKAA 4BX9C 2R3VA 5IIMA 4BC5A 4BRKA 1HHSA 1UWBB 3RAXA 1LKYA 4JD2B 2AF6A 3IDWA 1VJQA 4PG7A 1CRXA 2ZG6A 3ZTQA 1Y7PA 1UA1A 3CC7S 5C2DA 4O3MA 4FZXC 4FJIA 1OS5A 2EFQA 1XMQF 4F25A 3AU2A 3JS6A 3ILOA 1VJ5A 2HRYA 3DDNA 3K2YA 4CZCA 3PVXA 1Q95G 4X5VA 2DTJA 3D7SB 3AD7C 5GTIU 3PMNA 4M5DA 5A0LA 2V34A 1FFWB 1R6VA 5EGYA 2KHCA 1C1AA 3CO9A 4BJQA 2E3TA 3QJPA 3OL9A 4ZP9A 4R25A 1F3VA 2YPYA 4QS7A 3QIPB 4FM0A 3WQUA 3JPNA 2BBEA 4CJVA 2Y9TA 3NUQA 1PCAA 3VEVA 1A0OB 4K4GA 4KITB 3C16B 2FMPA 4CCHA 1U2VA 2IAJA 4MN4C 1YQHA 1FD2A 1EO1A 1VBZA 3CDWA 2W54A 2UVWA 3AO1A 2QLXA 3CJ0A 2YTCA 4WFBL 1PGZA 4FF1A 1G3OA 5AHXA 2WK4A 4YY3K 1S10A 4Y2TA 5CZ1A 3GONA 3GOIA 2A6OA 4WQ5A 1EWRA 1VQ9N 1S0MA 1IV8A 5FJ4A 4JEPA 4AF1A 1XR5A 2B4VA 3MAQA 3VZHA 4DR5F 2MKYA 2NRXA 5D8HB 1ROFA 4J9VA 1WG5A 3O08A 2BV3A 1WKLA 1NDLA 3SI6A 4ITSA 4I2GA 1RWOB 2NRZA 2N3OA 2W8LA 2XMVA 4WFAL 3W9JA 2M3DA 3H0PA 4OI4A 3L3FX 4FJJA 1HL6A 3CCWA 3M2RA 4WZQA 1Z6RA 2E1ZA 2E5HA 1ILYA 2W7PA 4ZPTR 5F3ZA 4GKJK 2J9EA 2YJEA 3EDRB 4X62J 4DR6F 1VFJA 8ICYA 4KRFA 4PZOA 2FGCA 2HBKA 3N97B 2KT3A 4KLGA 3LUYA 3KFUF 1VQSA 3OBYA 4YR2A 4DV6J 4M04A 4CRXA 8ICQA 1XNRK 1N0UA 3UXNA 4UAWA 1BC6A 1URNA 2EXUA 4CO3A 4RNNA 3F0NA 3D2QA 4M63A 1JJ2M 5CA7A 3V81B 3N5FA 4A8YA 4KC5A 3KIOA 2AZ3A 2QKQA 1Z1BA 4MFCA 1I51B 3CF5Q 4PL1A 3IBFB 1CZBA 1IKVA 1VRTB 2ZFHA 2K7KA 3D4JA 4XTTA 3E01B 1RT1B 3ZTRA 4NLVA 2QKBA 4O5BA 1FDDA 4DHYA 5BR8K 1RTDB 4CIOA 3Q89A 3QRPA 3P31A 2GAHC 5AKYA 3KBBA 2NCKL 2VJUA 3P49B 1C2PA 3CIPA 3QMQA 4CNZA 4B3TJ 4DV7K 1XJWB 5J8YA 3VENA 2QTWA 2JH1A 1RXVA 2RRAA 2DFFA 3TJAA 3L7OA 4AQYF 1JX4A 2NPIA 3L4BC 4LBPA 1JLBB 3IM8A 4JHDB 2BA9A 4B9UA 2GJFA 4ED0A 2P9CA 3O5TB 1FFVA 2PC6A 8ICAA 3GZFA 2JV3A 4FBUA 5G5HA 4HT7A 2E8MA 2JNJA 1UFWA 1ESVA 3R97A 2DGVA 4PHDA 4OMFG 3R27A 4KHYA 4DL2A 1LKZA 2N7CA 1X4BA 3M6UA 4ZH4A 4UB6U 2ZHAA 4EIAA 4BRQA 2HW3A 2IYGA 3DLJA 4M1KA 3VGLA 4FN5A 2FVPA 2QFJA 3UE5A 1QH9A 3QO9B 2CWKA 2JWNA 1U4BA 4P0PA 2DNGA 3DOLB 3KLFA 3HULA 1LW2A 2YQ0A 4USAA 5D77A 1XSLA 3S41A 3TR5A 2P1JA 4MKBA 3C95A 3OGUA 2KJ9A 3CJKA 4BRLA 4DV4J 3SQIA 4WBFA 2HIYA 3QT7A 2KXFA 2JRSA 4L73A 3H8YA 2BGGA 1C1CB 1BVSA 4EX7A 1RDBA 7ICNA 1XC3A 4UBBA 5MLCQ 1PK1A 4O44A 4OZ1A 3G6XA 2F76X 1U0HA 2ZE2A 1K8KB 1F2HA 4V1Ak 1RWXB 3QEAZ 3M7VA 1IBMJ 3S1TA 2N4CA 2R8JA 4UY8O 5ETOA 5TZVA 3PEJA 3CVKA 2XWYA 3CD7A 4FK4A 1RT5B 3VQAA 1IM4A 2XGPA 1RA7A 1ZBFA 3MX5A 1W2IA 4CO4A 3A8YA 1C0UA 3WNHA 1L5UA 2CNLB 2EFPA 3ATUA 4P6QA 2O5DA 3PDNA 2EFOA 1XNRJ 2CPIA 3KTQA 2MXYA 4C80A 3J81O 2CVIA 5DRKA 2HFVA 4N8NA 1VBKA 3HKWA 4UOCA 1XUPO 4Z4FA 1N5VA 4J9SA 4I0WA 3FFIA 3EUB2 5FPNA 2DK2A 3ZT0A 3DLRA 1VQON 2HK2A 2G0JA 3LPEA 2E5LF 2ISPA 2IHNA 2XZDB 1ZZFA 2D5RA 1HMVA 1HARA 1NDKA 3G4SN 5CHCB 4DBQA 4QIWF 3QEIA 1QVGM 1XNQF 3C0BA 2Q3PA 5BREA 2JRZA 1NZPA 3FEYB 3UPFA 1BGXT 2DITA 4A8KA 3SMSA 4M3XA 3ILJA 4AUKA 4YB6A 4U8YA 5AQOA 2HBJA 2ZIUA 2A41A 4M3UA 4X64J 1F2GA 3V1QA 3H20A 4J91A 3DLBA 2R2RA 3ENWA 4J9PA 4I2CA 1RHRB 5FD1A 3A4TA 3PR4A 1XMOJ 1PJ7A 3QEXA 4USJC 1CJUA 2P9SB 4CBUA 4USTA 2OPRB 3HJEA 1U45A 3MM6A 1F5BA 5K4LA 1MMDA 2ZM6F 2QM1A 5FLXO 4PWDA 3PSFA 1VSKA 2GHVC 2RVJA 2JMGA 1N5TA 4NCBA 1RE1B 2JL9A 2FJXA 4OGEA 3C19A 3IN5A 3SDEB 3V7JA 1VQPS 4HHJA 4OFZA 2KICA 4BR7A 2B5JA 5GAHI 3M3ZA 2IM2A 3MFIA 5AXLA 4JKAA 3H08A 2HSEB 3GB0A 1YI2N 4C1NI 1S97A 4DPTA 3WNEA 3NFAA 3GE1A 5KFMA 3MF5A 4FVCA 5FDLB 1FD8A 3QYPA 1D8LA 4O3SA 5LM7E 4KH0B 3B0YA 4LSLB 4WIIA 2OSRA 2LQ9A 3OVAA 1RWUA 5AKHA 3SUQA 5F0XA 2IC3B 3AL0B 4K0KF 1KEJA 1ZQOA 1KVAA 4LJMA 2AJFE 2HHPA 2J6SA 4I9QA 1ASWA 1RLCL 5HP4A 3UM9A 4F5PA 1XEZA 2VWKA 3FCWA 4LF7K 3PUFA 4P10A 1BQXA 2VZ9A 4H54A 3UXOA 2VUGA 4X62K 2Q31A 3VAGA 2B7CB 2CG8A 4Y2MA 4ZPCA 3VQ8A 4A59A 1C1CA 3LGNA 5KPRA 1JRPA 2CPFA 3TYTA 2G4BA 3QT5A 4IFVA 1VQOS 3QFPA 3PYGA 1BWVA 1IKYB 1NJYA 4NLCA 3V4IB 1LWXA 2IC3A 2IMWP 4J8FA 1GLBG 4MKYA 5IT4A 3POTA 1Z2ZA 2KSOA 2E7VA 1TL7B 2PEBA 1HJRA 3N4PA 4FL9A 4UBCA 4FLWA 1Y00A 4B3RK 3I4HX 1Z1VA 2E88A 2DH7A 2F3JA 1XR6A 1JLEB 1IR1A 4F3TA 3W5ZA 4YOXA 1JKHB 1FNMA 1CQNA 5D0HA 3DDIA 4DSFA 2DR5A 5GINA 5KFBA 3LDOA 3MK6A 1Q86O 2WSFC 3FEXB 3CMEN 3K8WA 2VA8A 3QNWB 4RR5A 4DDFA 1CJKA 2OZMA 2ZJAA 4MFFA 1JJHA 2XGQA 2MSNA 3KUEA 8ICWA 4C1NK 1ELOA 2DNOA 1WN7A 2A2CA 4BRHA 1X4EA 2UUBJ 5ALIA 1W97L 4BR9A 1VOMA 3GDXA 1Q8IA 4OYIA 4IDKA 4A8WA 5DBAA 3A8KA 1Q0NA 3QLHB 4A8FA 1VGYA 2Y1LB 2JVOA 3AEVA 4Y2JA 3E51A 1OQ3A 3ZD8A 4CGZA 3OR1A 2OO4A 1SV0C 4RJVA 3CB4A 3R5GA 2E6LA 5C2FA 4HKQA 2BJEA 1PZNA 4LF4F 1SWVA 2FVCA 2DR9A 4YVZA 1RWWB 1RU1A 1TAUA 4DTOA 5KG6A 4MDAA 1IJFB 5M1PA 1GLEG 2GCFA 2YY3A 4FZZA 5LJ5Y 3CCJS 2HNDA 3P5JA 5ETRA 3AM9A 4GO5X 1ZC6A 5M1KA 3QIOA 1KLMB 4OI3A 3BDEA 4JI1J 1HBMA 4CLUA 4ILGB 3IBCB 4DV2J 1ZQCA 2MUTB 3CGIA 4PYAA 1FK9B 5DG8A 4O3RA 4DSJA 4DU3A 1TV6A 3QGPA 4RKUC 2VG6A 1FXRA 2E1EA 3HHKA 4AE5A 2EK1A 2V5HG 5ALPA 4DV5K 2WF9A 1N88A 3VCDA 3GIIA 3VR1A 4FJ8A 2UV8G 1RQNA 1M5VC 5AQQA 3NBPB 4IOXA 2N82B 2HVIA 2H1YA 3HD1A 4NLNA 4NM2A 4TKTA 4YS2A 1HBUB 3VQCA 3TAMA 4F0KA 4PQAA 2UU9F 1J97A 1B0PA 4DF4A 3BS9A 1RT4A 1NHVA 2XSJA 4DPWA 4YEAA 2F96A 4PY5A 8ICHA 2D0AA 3ENVA 2CNOB 4E7JA 3EZWA 4MKVA 2YHAA 5AM0A 1P9QC 4F04B 3RAQA 4A62A 3RBZA 3ZZTA 4O44B 4RQ8A 5B0GA 3MXJA 4RQNA 1JLBA 2MZQA 4YP3A 4UATA 1N34J 3R2DJ 1IM6A 4PHTX 3MXMA 3FGUA 4ZCKA 1L3VA 1SCJB 1K1QA 1NB2A 3H3NO 2LM1A 3VQDA 3PRVA 2K2PA 4ZCIA 3VF0B 5AZJA 1ZM9A 3N7SC 1REGX 3S3MA 2HVEA 4A8MP 1OQ6A 1REVA 4CHQA 3MD1A 1QZ5A 3FGVA 2WUSA 2G8WA 2V8VA 3H5UA 4BRPA 2DEIA 3I28A 4DQSA 4DV1K 4U8VA 2C28A 1P8GA 2P9KB 1DFDA 1RDCA 1WB9A 4K5SA 2CAJA 3HHLC 2ZXHA 4F2RA 3NGRA 3J7AP 2B9XA 3ZNUA 1ZAVA 4OI0A 3B9JA 3TARA 1H2UX 3VF6A 1GEHA 4OJ6A 2OYYA 1RYSA 4ELVA 3MGVA 1P27B 2FHOB 1BDGA 5H1SV 4MEXA 2EC0A 1BU6O 4B3MK 9ICHA 8ICCA 4X4SA 3U9DA 2DCUB 3AQPA 4PWWA 5J2NB 3IDHA 4MK8A 1GTEA 2YX6A 4EFHA 3IRUA 1CJVA 4MT1A 4F4XA 4H0XB 3J7YP 5AQLA 2LYBA 2DHXA 1KQSR 3KLHA 1IG9A 3KK3B 4TLQA 3C29A 1J2MA 1A6SA 1CQMA 2XICA 1T03A 2LVWA 2BTFA 3JAMO 4P7VA 4DFDA 4GVEA 3LZIA 2DBYA 4OX9K 4RZRA 3BO3A 2FJVA 3BQ1A 4O8KA 4DSLA 3CE8A 3AXKA 4DR1K 4CJSA 1S57A 1RWVB 1KQKA 2AHOB 3V6JA 5EXWA 2I9SA 2WVDA 2ZIXA 2RSQA 2VL1A 2BCUA 1U48A 3NF6A 1WWHA 1CJVB 3D1QA 1S1WA 3SFUA 5AM2A 5IIJA 3AO2A 3S3NA 4F4ZA 4L8RB 4Q5VA 4DL7A 1CULA 3I1YA 4K8RA 4KQZA 3IC1A 3NHGA 3F41A 4M9LA 2H5IB 1FF2A 5D4OA 4BRIA 4DX8H 4TUSA 1GK8A 1E6YB 1ZQYA 1X9XA 3M32B 3BQ0A 3MEDB 4OZ5A 3TVYA 3ZC4A 1FCAA 3KK2A 3CF5L 3RJMB 1K73T 4F5NA 3THYA 3U26A 2BMBA 5GADU 2JSXA 2M70A 2F9TA 2N3LA 1KXPA 1IJEB 2ACMA 1UCVA 4CERA 1U47A 4YCXA 5HRRA 4AHSA 3J80Y 3M2UB 4B9TA 3KLIA 4FK0A 5DDYA 3N4WA 3GV7B 2CA9A 5L8RC 4DCHA 3O9TA 4U67L 1KTQA 2KFZA 3OTDA 5DJBA 4WKYA 1N32F 2EANA 1DBDA 5ETSA 3ZX0A 4DZDA 1VQ8S 1ZBHA 2X6SA 2CQHA 2LI6A 1IKYA 1N4LA 1OJ4A 3KK2B 2NPFA 2CRXA 1M5KC 4DUYF 3T6BA 3K5LA 2P6SA 1VRUB 4TU9A 3GFKB 1S5JA 2ZC4A 4M8LA 4ZK7M 3DM2B 5JLFA 1OYEA 4CZEA 1NJIT 1SZPA 3SQGB 1B99A 2HDOA 2DRAA 1MWYA 2F8KA 2JC1A 5EWEA 3PYDA 2W4DA 3EZ5A 1EAYC 5KT2A 2Z30B 1ZYQA 1F5CA 3AY0A 5HMZA 3NGTA 1IJJA 4Z4CA 3VA0A 4GO7X 4F4AA 1X4GA 1Q5VA 2FPHX 1UETA 1AT1B 1VQ7S 4UTGA 2FZCB 3MCNA 3BN4A 2R42A 1VK8A 2DJWA 2CADA 4BC9A 2NV3A 3KD3A 1F44A 3IR5B 1M5HA 3UD5A 4CTAA 3JTNA 2QWOA 4K4XA 1BI4B 5J2GA 1TKXB 1KSPA 3X1LB 1HWJA 3GQCA 3E0FA 4CO0A 2GV9A 1WAJA 3Q22A 1RT7B 2X1BA 2FVQA 1ZOTA 2B3TB 4KHQA 5C24B 2R7VA 1SQFA 5ETPA 3L9ZA 4LF6K 1NRKA 1S59A 4AILC 4E98A 4BGBA 3VQTA 1VDVA 5C7PA 2ZXIA 4NPOA 3NL0A 4EYHB 4B3TK 4CZFA 1NK7A 2B43A 2QLBB 2ZH1A 4DV4F 1CSJA 4ILHA 8ICPA 1XERA 1YKWA 1KVKA 4RW8A 4IQVA 4O5FA 3E01A 4ZS6A 5M2RA 4LIRA 5HNKA 3EPIA 1RTDA 5ALQA 4B3RJ 2PMZF 3PYEA 4RW6B 1VBYA 2K8CB 2IJFA 4OYMA 4F26A 2V51B 3QE9Y 1CUKA 3P5TL 4EFAC 4YR3A 2CJKA 3LP0B 1YITN 2E8AA 3PFOA 1BWFO 1S8OA 1RDAA 4JI5F 3EUNA 3UNGC 5AE1A 3OUYA 2WONB 5LMNF 2AEJA 3V6HA 5CHIA 1T9WA 3BGRB 2JEIA 2Q1LA 3HHLA 1WI6A 1CPZA 1BPBA 3VEOA 4M5NA 1F5SA 2JLEA 1RDRA 4PA1A 4O0JA 2QA4G 4KLEA 1BIZA 2DWQA 1YF5L 1R3NA 2KG1A 1JLAA 3I9ZA 3W9IA 4DQQA 4HHUA 2X78A 2YNGB 2OYQA 5AK3A 5KFIA 2B5JB 3LDLA 4Q2MA 2YNHA 3Q2SC 1ZH5A 4OL8A 4N76A 3M30A 4CJ5A 2E1CA 2CQPA 3QWPA 2O1PA 3HF5A 3A1YG 1RCXB 4E89A 2CGKA 4YDUC 5J2MB 2QL9B 3ENQA 3S01A 2BM1A 1D4XA 4DPYA 2FMQA 3DGPA 4YOVA 1N5XA 5D4LA 2UUAF 1FJGF 1S1UA 3S9HA 2VKRA 2LLZA 4YY3J 2VIXA 1L3SA 4CJFA 4QU6A 1R0BG 2N1RA 2LPEA 3CI5A 3HSGA 3SBGA 3O3LA 4F0HA 3IS9B 3RU0A 3WNFA