1XCQA

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
b'DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xcqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xcqA01
1FIEA 1I85A 1N3NA 5DJ8A 3D0VB 3QA3A 4PBVC 4AIXA 2DN7A 4H8WL 4KQ3L 1C5CH 5GGTH 4MSWB 4ZUVA 2FIKA 3GHBH 2DM7A 2DI7A 4H5SB 5IV2B 2CD0A 1SJHB 2AGJL 5E9DD 3ZE0E 4A6YH 4NP4L 5E0QA 4Y4HC 3I6LE 5IB5A 2IAMD 1NAMH 4OGYH 2CPCA 5BRZE 2Z31D 1T2QL 2WLYA 4RWYL 1HCVA 3RVTD 1NJ9B 4JO2L 4DGVL 2DIBA 5JO5A 2X9YA 3TGXA 3MTRA 4X6BA 5EOQH 5MEQB 1DSFH 2VLKD 3JSSA 2K9UA 1KJ3L 2BY3A 4R90H 1NFDB 3ULUE 3GMQA 1IEHA 1JNNL 4D0CB 1FG9C 5IHUH 4MX7A 1S7TB 3QRFM 3DRTA 3O6LL 2VN4A 2FLRT 4P4RB 4M4PA 1TJIH 5F9WC 2HMIC 4KROC 1VGKB 3F7VB 3HZMB 4K3JL 4ONOA 3VFWA 3MRBA 4P5MA 3SKNA 3MJ9H 1CFVL 4MQXC 4LPTA 4F7CB 4E41E 3TV3L 5JZ7D 4IDJH 4Y5VB 2VITB 2D7OA 2PW1A 1F6LL 2R23B 5IVXB 1UXSB 3GJFB 4XPAL 3STZA 3C8KB 5CJXA 1EEZA 4I5BA 4MCYA 3MBEB 2J5LB 2QV2A 1NLBL 3PXJA 3NCBB 2DMBA 3UC0H 5CGYD 1U3HD 4NN6C 3P4NB 2YSSB 3DROA 2PYED 5DRXB 3IAGC 1JV5B 1UFUA 3DXAE 4FQCL 4JREB 4OIBA 4U1HB 5KS9B 3FT3A 5EIIA 4GKSA 1UJ3A 3OR6A 2F19L 1FO0B 1JGUL 1NCDH 4BFBD 5CP7A 1QBLL 4L8SB 1MCNA 2DLIA 4EUPG 1U2HA 4DQOH 1FYTE 5FHAL 1MSPA 2P5EE 2IADB 5DYOB 3RIFF 4UAOB 1ZHBB 2RCSL 5K9OA 3KYNA 2APFA 3S35L 3EFFA 4WW1A 3TZVA 3RWHB 1SM3L 1RJYA 2CDGA 4KQ4L 5DLMH 5JOEA 4MA7L 5HVHB 3BN9C 3RFZC 3MOAH 5IJKC 4N0RA 2Z8SA 3O6FC 5FA3B 2DQGL 5IESL 1QFWH 1KJVB 1MCEA 2X44D 1UXWA 4KTEL 4LVOC 1PBYA 3UTSB 1FNGB 5C3LD 3U9UB 3O3AA 1RV6X 1EHAA 4ZOBA 3K2MC 5EO0A 2EEAA 1A9BA 1W0YT 1BLNB 4TYUA 2YUZA 3P9MB 1BQHB 2FRGP 4O2EB 2X4RA 3O3EB 3TBWA 5I18L 1R3JA 2NXZB 1RAMA 3EYFB 4JO4L 4ERSH 3O9WB 2VWEC 4N0CC 1W0VB 2VH5L 4NYLB 1EJ6A 1MAJA 4MJ5A 1NDMB 4O4YL 3T4AA 2JJWA 3L3GB 4OCYH 4XHJD 4NO0D 4F15C 5A3ID 1XGRA 5T5NG 2EICA 2EO1A 3HC3H 1F4YH 3HRZA 3LPWA 5JPMA 4U6VH 1G7LA 4Y5YC 4KJYB 1AD9A 3HPLB 1CFTA 2XZQH 1F4HA 3BWAA 2P5WD 3WFBH 1SMAA 2RGSA 5B4MC 5F1IB 5ICXB 4X6DA 3O4OB 3SDAA 1WITA 3BFOA 1FH5H 4Q7DA 1F3JA 3UJJH 2CDEA 4MJIB 5IKCB 1SHMA 2NW2B 5JORA 1F11B 3TT1L 3LKQB 1GOFA 1XF4A 3MRHB 2YRPA 4G9DA 3BD3A 3LN4A 1P7QD 3MV9B 4OLYL 4P23A 2GW5A 4KAQL 5DD6B 5JLZB 3OKDA 5DWUH 2XKNB 2XQBH 5C86A 1KCSL 3A6BH 1D6VL 3V0WH 4LCWB 5I1KL 1KNOB 5DC9B 4WV1B 2XFXB 4PRAA 3UXFA 2NTFB 1C12B 4QRRE 2E9BA 4Q6IC 1ZLUH 3EYUH 3AU1A 3IDXH 5HHOA 2CIIB 4P2RA 3ARFD 2Z4QA 3LB6D 3VWKC 2OK0L 4UI2A 4I1NB 3NH7H 1TTFA 4YBLC 4GT7A 4X7CC 4J3OC 1WF5A 2ENYA 4EI5A 3A6CH 3RIAF 3BQUA 4OFKA 1H15A 3HR5A 3JZ7A 5J11B 5HJ3A 5IGXH 2ITDB 1CBVL 3ET9F 5L8JB 4R97B 4WI9A 4KJQD 2H3NB 3SDXE 5HTSA 3UPAA 1N3NB 5DJ8B 4PLNC 3PG2A 3PWVA 3QA3B 2XQYG 3GK8H 5I1HH 3EAKA 3SE8H 3ZHKA 4O58L 4OQ1A 4D9LL 3T2QA 5D5ME 1P7KA 4JM2D 2VERN 5CILH 4ZUVB 2FIKB 1A02N 3RGVC 1TENA 5BXFA 3KLAA 3QWRD 5DHVH 2B5IB 3DTXA 2XKUA 5LQBH 1D6EA 4HXBH 3E8UH 4HG4J 4XCFH 5IB5B 3GO1H 2RHEA 5FUCE 1AKJD 2NY2C 2Y06H 5IR1A 4YZFE 1BFOA 1NCNA 3TFKC 5JO5B 3X3FL 2PF6A 2C7UA 4X6BB 1I7ZA 2VZVA 4X6CA 2IPKA 4PRDA 3GMQB 5EOTA 3EOYG 4HC1L 4OZHF 5AYUL 1V3MA 4WHYG 5DA4A 4MX7B 1ZXQA 3V79C 3DRTB 4I2XA 4NKOA 4XP5H 4TUKL 2NY7H 1TITA 1S78C 2RFXA 3VFWB 3MRBB 4Z7VE 4PJAE 2ZPKL 4YFDB 4GQPH 4P5MB 3WDJA 3RKDD 4PS4L 1GPOH 3UTQA 3SKNB 3SDDA 3KDMA 3IRZA 5E6ZA 1TZGH 1X5XA 1PLGH 4MYWB 1XEDA 1F2QA 1YEEH 4DFIA 1YEFL 2PW1B 1R6VA 4MB3A 3BP6A 2LAGB 2VDLH 3STZB 3MLWL 2P46B 1EEZB 4I5BB 5ISZA 3ULVF 4NKMA 4MCYB 5I76A 1UB5A 1RU9L 3T3ME 5C0FA 4MAYA 7FABH 1XF5A 5T1KD 4EUPH 2AI0H 3DROB 3WDHA 1V7NL 2DQIH 1H3GA 4G6JL 3FT3B 4F7TA 5EIIB 3R0NA 2WBJD 3VW3L 4GKSB 4JN1H 4PJ5D 3LRGA 1UJ3B 2GK2A 3OR6B 3QUZA 4LSQH 3FN0L 1WFNA 5CP7B 4BFEA 2DYPD 3X3GL 1DZBA 3IDUA 4WI6A 2BVTA 2HRLA 1IVLA 5DJZA 4ZYKA 2E7BA 2DS4A 2E7MA 4JKPL 1A8JH 3MA9H 5EZOL 2APTA 2UUDK 3QPXH 5B3JE 1TZHB 5K9OB 3KYNB 4D0DA 3WKNA 3AAZA 3EFFB 3ILQC 3TZVB 2CDGB 1RJYB 5I1GH 3MSPA 1REIA 5ANMA 1CL7I 3WXWL 2DWEA 4GMTL 5L0QC 2Z8VC 4P5TA 1UXWB 4Y0GA 2AQ3A 4N5UA 3EHBD 3O3AB 5EO0B 1VGEH 1A9BB 2OSLA 1T7YA 5DC4B 1G9NL 3QFJA 5ID1B 4ZO9A 3BKMH 3LPGA 2X4RB 4WTZA 2BNQE 2BRRH 3TBWB 1D9KD 1R3JB 5TFSH 3U82B 4PJHA 4AK1A 5FUCC 2Z93A 4G42A 4POZD 4MJ5B 2B1AH 5C08D 4DKEH 3T4AB 2NY6B 1XGRB 3IDGA 1EAPA 4BUHA 3F7RA 3HRZB 1I7TA 3ALPA 5JPMB 1DQMH 2V5TA 1G7LB 4M43L 1AD9B 5DUBA 4OKVA 1CFTB 4TUJA 3KWWA 1UYWH 3BWAB 4YBQD 2OI9B 4K07A 4TTGA 3BPOB 1D5IH 2EDRA 4Y4FC 2R4SL 4X6DB 1HINH 1UWEL 5D93B 3SDAB 5IVXE 1EPFA 1EMTH 1CVRA 1F3JB 5EH1A 2CDEB 1Z0NA 4WIQA 1KUMA 4XPFH 2VXTH 5JORB 5TQ0L 4HF5H 1XF4B 1FLRL 4G9DB 4G8GE 3LN4B 4XVJL 5AG9A 3E2HC 2IGFH 5CEZD 1PSKH 4LPXA 4P23B 4JQVA 2DQEL 4MDJA 5E4EB 3OKDB 5KS9E 3QUXD 1J12A 4LAQL 4RRPA 3TA3C 3WIHA 1HYSD 2HT2C 4PR5A 3HI5L 4HZLA 4IM8A 4IRJA 2QSTA 4PRAB 1CWVA 5CFHA 4HD9A 3LIZL 5K9QI 1A3RL 1CU4L 3AU1B 5HHOB 4FFZH 1B2WL 3BUYA 4RDQG 4P2RB 2Z4QB 5J1AA 1MJUH 1TIUA 3TN0A 1JYXA 3UTSE 1JPTL 5D1XD 1IGTB 1ZANL 4EI5B 1UJTA 4XBGA 3P4MA 1N0XL 3BQUB 1H15B 3HR5B 5HJ3B 1EVTC 1MF2L 1ZWIA 3DVGA 3RI5K 3EO0A 4AMKH 4CVXA 3QDMA 4JFFD 1KPUA 1MVUA 3PWVB 1LVEA 2QQQA 4N90D 3E6FA 3RAJL 5D1QA 5BW7A 1DFBL 3NAAL 1P7KB 3U4AA 1GOHA 5DR5L 3CUPA 3RRQA 5BXFB 1MCPH 3KLAB 3DTXB 2G60H 4UZGA 1KLUA 1D6EB 3L6FA 3QIBD 4FQJL 1IC1A 5ID0A 1UWXH 1CDHA 4P9HC 1OARL 5IR1B 4WHYH 1LO2L 3ZYOA 1BFOB 2DQHH 1A1NA 3QPQC 5HHMB 1YA5A 2C7UB 3VGDA 3BDYL 1I7ZB 4X6CB 5DMGD 5D7KE 2V9QA 4K23H 4XX1E 1QVOA 2IPKB 4PRDB 5EOTB 4NOBA 3Q6GH 3GJFK 1K85A 2YUWA 4I2XB 4NKOB 4KHXH 4Z6AT 4Y5VC 1JPSH 2EDLA 1QSFD 3ZLQC 5DFTA 3MLTA 2CKBH 2UYLA 4YDIH 2RFXB 1J1XH 4OGXH 3VRLE 1HZHH 1RIHL 3BOVA 1NDGA 3MBEC 2J5LC 4QRQA 3JWOH 3QCUL 4O00A 3UTQB 1K3IA 3SDDB 3KDMB 4GFTB 3ZHDA 1IL1A 5EOCH 4Y89A 1P6FA 5FB8A 4S0TD 1DBKL 2NMSA 3UEZA 1I8MA 4X7SL 5I15H 1TQCB 4JREC 2LU4A 1JHKL 3KYOA 2NY5H 4IOFC 1JK8A 1T4KA 5D71H 4GMSH 5GGRA 3I6GA 2FHFA 3IFLL 2VUYA 3BP6B 4JEGB 3IGAA 3WBDA 1FNSH 1CZ8H 1QRKA 2OP4H 2K1MA 2OM5A 4NKMB 5KTEH 5I76B 4ZTOH 2YKLL 1UB5B 3MNWA 5C0FB 4MAYB 1IAIH 4X6FA 5EU6A 1XF5B 2XI9A 1S5HA 3KYAA 4JRXA 3O0RH 2HKHL 1LMKA 4JPKH 4F7EA 4ELME 4KJPC 5HVHC 4F7TB 1RZJL 1WLHA 3ARUA 3QUZB 4LU5H 2BSTA 2AEQL 5DK2A 1GRWA 4I4WA 4M7LL 5E2VH 5LJYH 1TCMA 4HWBL 3ZO0A 4GW4B 3I9GL 4KRPB 5DJZB 4Y4KA 3Q0HA 4ZYKB 1X5ZA 3HUJE 4MDIA 2B2XL 2NXZC 3GSOA 2AJVH 3MRJA 2XN9D 3UTTA 3VH8A 2P24A 5JXEA 3O9WC 5F6HJ 4D0DB 2V5YA 3AAZB 5C6WH 4QTHA 2ATKA 1KEGL 2VXVL 5ANMB 4C57C 5L88H 3TT3L 1CD9B 2DWEB 3T2OA 3EYSL 4P5TB 2Q86A 3INUL 3GI9H 4YC2B 2VLKE 2BVOB 3QFJB 2ZUYA 1KELH 1SBSH 1R5WA 5J12B 2VZUA 5ABDE 4UMGA 2XG4A 4PJHB 2Z93B 2ERJC 1HOCA 1A22B 4XPBL 3W2DH 2DJSA 3QXAA 2ZNXA 3FJTA 1A3LL 3SDYL 3IDGB 1EAPB 1CE1L 2M26A 4X7EC 4HLJA 1G1CA 4JQXC 1I7TB 1QFHA 1MRDH 3SKJH 5GISH 3UO1L 5DUBB 4OKVB 3LRHA 4TUJB 1BEYH 3KWWB 5HYJD 4NNYA 4AY0A 4I0KA 3WFEH 4HJ0D 1A14H 3O11A 3HS0A 2IQ9H 1YEHL 4YE4H 5GXBB 1R3IH 4WV1C 2C3WA 5FV1L 1BPVA 4M1GH 43CAA 3AY4A 1Q0YL 2O93L 5F7UA 3VU2A 3QNYA 1T21A 2PYEE 2XTJB 3UTZA 5F93C 4ZTPL 3NIFF 1DEEB 4MDJB 4JB9H 1YEKH 1G7HA 3BT2H 4PR5B 3T2NL 4HZLB 3GRWA 2VZTA 4IRJB 2R0WH 1DBML 5HI3D 5J11C 4PJFF 3KXFE 4JGUA 1C7SA 1KACB 1VPOL 2K7QA 4R97C 3TIDA 1AY1L 4PB0L 4QRUA 3BUYB 4AM0A 4MHHI 2CK0L 1I85C 5J1AB 1VDGA 4RAHA 2FJGA 4XMPL 5E8EA 3TN0B 2CR3A 3NPZB 4LL9A 1FGVL 1UA6H 3NACH 1L0QA 5HHPA 4ONFH 4YXLH 4GKOA 2E27L 4XBGB 5IOPA 3P4MB 1S7RA 1RZ8A 2B5IC 1DQQA 1DLFH 1N0LA 1ZWIB 3DVGB 3P0YH 4AIOA 3EO0B 4ALAL 1KGCE 1RJCA 4NHCL 3O3BA 3QDMB 4CVXB 1KPUB 1MVUB 3B43A 3P2TA 2LABA 5C7XH 4WGVB 4LLYA 5AZ2H 5I8KL 3RVWC 4HWUA 1WFTA 5KOVC 3E6FB 4YHML 5D1QB 4BYHA 3CIQA 1J1OL 4IMKA 4Y8AA 4NZRH 3CUPB 4X7DC 3KPSD 1T7VA 3IDJA 4MVBD 4JDTH 1KLUB 3L6FB 3O6KL 3KNBA 4M8VA 3MBXL 4XAWL 5H2BA 3QNXA 1WBYA 2MQ3A 4NCC1 5ID0B 2XTLA 5T5FH 5ALCH 3QHTC 1Y6KR 1Q72L 2NZ9D 5HGAA 1V3KA 2KUTA 1A1NB 5HHVH 5FO7A 4YGVA 3TH2T 5HI5C 1DQTA 1OAZL 2PYFA 4Z7UE 1QVOB 5IK3A 3S9DB 5D7IE 1IGML 1QFWI 1A6WH 5KJRH 1DANU 1NCUA 1AQKH 1LK3H 3H9SB 3FQXA 1PJ9A 1N5AB 2R0ZH 3MLTB 2UYLB 4QNPF 4DVRL 1FFPA 2IPUG 1B3JA 3GMPA 3DV4A 3OPZH 1SVCP 5CJXC 4YDKL 4NFBA 5I9QB 1NDGB 2IMNA 2M1KA 2DQDL 4OIIL 4OF7A 1QSVA 1IL1B 3MREA 5HHOE 1YEIL 4P2RE 2FX8H 2WWKO 1KN2L 1SJEA 1I8MB 3RDTD 2HH0H 1RMFH 3KYOB 1CVSC 1JK8B 1T4KB 1UJ3C 2DM3A 2LV4A 3ME0A 3I6GB 5GGRB 5M95B 4PGCA 2C4FT 1F02I 3CSGA 3IGAB 2VDOH 5DEFA 4XP6H 3U0TA 4KY1H 2D7TL 3FZUD 3MNWB 3B5GA 4X6FB 5EU6B 1A7PH 1S5HB 4JRXB 3HNSH 4F7EB 4YAQA 4PRIE 3TZVC 4KK8C 5DMIH 3MJ6A 2EZ0C 4DGIH 3CNKA 4NN7C 1AO7D 4PGEA 5H37G 3SQOL 1A7NL 2IG2H 3FQUA 2BSTB 5DK2B 4I4WB 4UNUA 4RMWA 4TNWK 1PFCA 4FZEH 3OL2A 4M3JA 2FEEL 4K8RL 2YPVL 2GKIA 3Q5YA 3HE7D 4HUNB 2DL2A 4POUB 4Y4KB 5J1SC 4MDIB 1ACZA 3ZKXB 1T7WA 3GSOB 5CZXD 4BH8A 5BV7L 3MRJB 3VH8B 3UTTB 4GQ9L 2P24B 1UKQA 4QTHB 2ATKB 2DWDA 5GS2H 1R0AL 1FV1A 2NY6C 4P2OA 2Q86B 4N1EA 3EJZC 5IBUG 3S37X 4EQ2A 2VLRE 3L5HA 3H6JA 4KTDH 4DN3H 4XWGH 4TULH 1EEYA 5F70A 2DTML 2CXKA 2OI9C 4BK5A 1R5WB 1G7PA 1IILE 3BPOC 3HC4H 1YNTA 5E7FA 2EEDA 3T0WA 1CD8A 1HOCB 4HK3J 5D93C 3SDAC 3PQYE 5ACLA 1HHIA 3F6IA 2NY4B 2BK8A 3QXAB 1E4JA 5FA4A 1R3KA 3CDYA 2VLLA 1S7WA 1LP9A 3QI9A 4PRPD 2HJLA 3QUYD 4LVNB 3VRIA 4UDUA 2UZIH 1OTUC 4P23C 1RI8A 5E4EC 4OCRH 3OMZA 3O11B 3HS0B 4YDJA 4H8WH 3CDFA 3ZE2F 5HYSA 3WHXB 5KN5A 2EXYC 3HI6L 5ISZE 5L7XL 43CAB 4CN4A 3L3IA 4M4RA 3HMWL 3EJJX 4PJGF 1S3KH 2AGJH 2Q7YA 3QNYB 1M05A 4M6OH 1T21B 3UTZB 1A6UL 1MEXH 2ZNWA 1KTLA 5HGDB 2PN5A 5DD0L 2LU3A 3ZDYE 4RWYH 1A7BA 4GSDH 4JO2H 5LCVH 1BFVL 4DGVH 4EI5C 4MNQA 3RPKA 3UBXA 1ZK9A 3BQUC 1U41A 2DAVA 1OOAA 5DJCA 5C09D 5KAQG 4FQ1H 1MRCL 1KJ3H 2NX5D 1VSCA 4V2CB 4D2NA 4YX2L 4AIZA 1JNNH 3TIDB 3ZE0F 5IQ7H 3S88L 2WNGA 4QRUB 3O6LH 4AM0B 5J6HA 4JFZL 2FJGB 5DS8A 5E8EB 1QNZL 4K3JH 1KSRA 1S9WA 4MXWL 5HHPB 4HBCL 2A1WH 5IOPB 1MOEA 1S7RB 2O5ZH 4N0YL 3QFJE 1RZ8B 3ULVL 5F1NA 3ULUF 1DQQB 1CFVH 1ZT4A 1RULH 2PUQT 1NFIA 4PBWD 5T3ZH 4PJHE 3O3BB 4K9EH 4M02A 5C08E 2BRQA 2ZG1A 4LLYB 4EI6A 2WSKA 3PGFL 2J7LA 3WSQL 2ORBH 4XPAH 2VDKH 4PGBA 1NMBH 4XBEL 3ARVA 3IDJB 2R9HD 3OZ9H 3C2AL 4XVTL 4FQ2L 2V5SA 4XNMA 5EZIL 3KNBB 4APQA 5H2BB 2YD6A 1Z5LA 1WBYB 3QNXB 3VJ6A 1YMMA 2A6JA 1SVZA 3QDGD 2ZWLT 2YN3A 4UOW1 1OP5H 5HGAB 4F33A 2F19H 3CLEH 1JGUH 5FO7B 1F8TL 5HGBA 4MXQD 2VZSA 4YGVB 3D39D 1GGBL 1NCCL 4JHAL 4P2QA 5FHAH 1N7ML 3SDDC 3QBTB 2PYFB 5IK3B 5GGVH 3L5JA 1WQVT 2R2HA 2RCSH 1TQCC 5C71A 3S35H 3H9ZA 3FQXB 4KMLB 1WZLA 4MA7H 3K1DA 1PG7H 3V6OA 4JJHA 4LGSB 2G5RA 1OTSC 1FFPB 2UY6A 4KTEH 3DV4B 4JHWL 4HH9A 1QLEL 2W9DL 3PGDA 1DVFB 1Q9LA 4NQXA 2LTQB 4GRWH 4IOIA 4MAYC 2EDOA 4QRTA 3CFEA 3MREB 1T66C 4RAUA 4PRBA 4JO4H 4C55A 2V7HA 2W59A 1SJEB 3WL9A 4PJBE 3VRJA 1D5BA 4GAYA 3QUZC 4O4YH 3CVIL 4PGCB 1PEWA 1X5HA 1WZ1H 1AXTH 3W39A 4KRPC 5DEFB 5GZND 5H37H 3U0TB 5C2UB 3DBXA 4LLUA 5ILTL 5MERA 3EYQD 1Z6JT 4JFFE 4WO4C 4JKWA 4YAQB 4L3AA 3ZE1E 2CO7B 2B0SL 4QCIA 4PGEB 3SO3B 4EUPA 4P5TC 2WM0A 2Z8RA 4L8CA 3FQUB 4Y5XA 3PHSA 2UV3A 2A38A 3PL6A 3PP3K 3TT1H 5E9DA 3U46A 4WUKH 1JMZA 3JWNC 1WIPA 1UENA 5BJTA 5FYLE 4OLYH 5J12C 4BH8B 1UT9A 2BNRD 3B5HA 3I85A 4D9RE 2Z31A 2DWDB 4FXKA 2Y5EA 1FV1B 3QXDA 1KCSH 4NFCA 2CRIA 1D6VH 4P2OB 2H45A 3MLXL 5I1KH 3ZHLA 3RZCD 1X5LA 1X5FA 1T6VN 4F9PA 4FQLL 3WUWA 5GJSH 5BQ7A 1B6DA 2DDQL 1HSBA 1KOAA 4HUXA 1EEYB 1QTYT 3RBSA 2I5YL 3CXHJ 3A6OA 1G7PB 3QIWD 5CJ5A 4XZUA 1YNTB 5LBSL 4JFOA 1QSFE 4C56A 2OK0H 2QSCL 1CDJA 1HHIB 3MRMA 5FA4B 1R3KB 2VLLB 3LZFL 1MAML 5IBLC 5E1HB 1S7WB 1M7DA 5EU3A 1LP9B 3QI9B 2HJLB 2XTJC 3VRIB 2JJTA 4UDUB 4JQVC 3GI8L 2DLEA 3HG1A 2HRPH 3U6RA 1I3RA 3K4ZA 2D7NA 2VC2L 4YDJB 2Z92A 4OD2A 2HP4A 5KN5B 2KPNA 3O8XD 1IT9H 3L3IB 1TZIA 4Z5RA 5IVOA 2A77L 2WV3A 4NKDA 4JRXE 2Q7YB 4OGAD 1M05B 2O5YH 2X5PA 4NRYA 3SDXF 4X4ME 1YY8A 1KTLB 1SY6L 3QXTA 1CXKA 2Q1EA 2JLLA 3TN0C 3CK0L 2DM2A 3NTCH 4K7PX 5D96B 2XICA 1IGYA 1RZ7H 1NGQL 3X3FH 4MNQB 1HIML 2QADD 3MLVH 5ERWA 3UBXB 2R8SL 1KFAL 5DJCB 3VG9B 1P4IH 2MWCA 3OR7A 2AJ3B 4AIZB 2JELH 2XN9E 5AYUH 3KR3H 5J6HB 1GL4B 3NIDF 1JF5A 3RUGA 4YZFF 5DS8B 3M07A 4GLRH 5BW7C 5D1QC 3FN3A 3H9YA 2FB4H 1S9WB 4LKCA 3D18A 2ZUSA 5KVDL 4PY8I 2NNAA 2CK2A 5C0CD 4PS4H 1ZGLM 4L4TD 5F1NB 3KPLA 1ZT4B 1T03H 3LH2L 2OXGA 1NFIB 1OWRM 4WHDA 5CKGA 1P84K 5DD5H 5LWYL 5CUSH 4M5YH 4TNVK 5EBWA 1YEFH 4EI6B 4R4BB 2HLFC 4WCYL 2VJXA 4NO0A 4TVPL 4Z7VF 4PGBB 4PJAF 4JY5L 4ODUA 3MO1A 1TVDA 4OB5H 4LHUA 1Z9LA 2P5WA 5HYJE 1LD9A 3CX5J 4WW2F 4XNMB 4APQB 2W91A 1QP1A 1Z5LB 3VJ6B 1YMMB 2A6JB 4PBXA 3IS0X 4PREA 3LS5L 4F33B 4RMVA 1L7TH 5HGBB 4LIQE 3S36L 2IWGA 5I9QC 4ZUUA 3ISWA 4P2QB 3T3MF 4LSSL 4S1QH 2JKXA 3ZSSA 4JKPH 1P7QA 1OP3K 3IU3A 2R2HB 1EFXD 2X1WL 2I60L 3ARDD 3I50H 4XPTL 3V6ZA 2IFFH 5C0AE 5JR1H 4RFNB 4LPYA 4GMTH 1NANH 4BZ1L 1T04A 4Z7QE 1KV3A 4HH9B 1H3VA 3PGDB 1JI2A 1QR1A 1K4CA 4NQXB 4IOIB 2ICCA 1TNNA 3QQNA 4QRTB 2DLFL 2OJZL 3CFEB 5E2TL 3RTQA 3ABZA 4RAUB 4PRBB 5B3JF 1W8OA 2GQHA 3ARFA 4D9QD 2V7HB 4NFDA 3WL9B 1PD6A 4JO3L 1GZPA 3RI5F 3VRJB 1D5BB 4GAYB 4X98A 5TE4L 2E5EA 5FYJL 3HE6D 2R4RH 4EVNA 3W39B 1G6RA 5F9AC 4PRNA 1OF2A 1DQJA 4Y4KC 2E7LA 1VFUA 1FPTL 3MLRH 2W1NA 3DBXB 4M43H 4DGYH 4LLUB 4D8PA 4NGHL 3ZKXC 1RFDH 5MERB 3PHQA 4RA3A 2J8OA 4J8RA 4JGMA 1KCVH 4GAGL 4WI5A 4DKFL 5JXEC 4LLAA 4HJJL 5E6ID 4YFLF 4HFUH 4QCIB 1ZTXL 1UWEH 3WE6A 4JGJA 2W0FA 4EUPB 4P49A 4L8CB 2GFBA 3AB0C 2XZCH 4F2MA 4Y19D 4Y5XB 2WWMD 3AS1A 3PL6B 5F7NC 3MV7A 5E9DB 3V4VL 4F58L 4DJMA 3U46B 5IROA 1TNMA 1ZOXA 4AEIL 4XCYA 5BJTB 4TN9A 1FDLL 5TH2A 3UYRH 2GITA 3BH9A 2IAND 3Q5TA 1RVFL 2YPLA 2Z31B 4AG4L 1HKFA 2HFFA 4OLZL 2IBBA 2Z35A 4FXKB 3QXDB 5IVXF 2NY4C 5ADOL 4L3CB 3TF7C 2ICWJ 1NCTA 3WUWB 4JDZA 1W72H 4JFXA 5BQ7B 1CGUA 1HSBB 4JO1H 4HUXB 1A3RH 1MNUH 1CU4H 2MQ0A 4G6FB 4PJ8A 3MJ7A 2ZUUA 4OCSL 2EEBA 1E4WL 5KS9F 2JE8A 4JFOB 4C56B 3GZKA 4NCDA 3RP1A 2FL5A 4N8VG 3MRMB 4X9BA 1ZANH 1J1PL 1KCLA 2VIRA 4Q0XH 5IB1A 2H32H 1A6AA 3BP7A 1M7DB 2G9HA 2EYSA 5EU3B 3VXSD 4RA0C 5C9KA 5F7FA 4AQOA 1HH6A 1NSNL 3HG1B 3U6RB 2BX5A 1I3RB 3GUTA 1EBPA 5BVJA 4KUCD 2DBJA 2Z92B 4OD2B 3C9NA 1QRND 3NAAH 3O2WL 1IC7L 4JKMA 4KKAC 1QBBA 3MCG1 3LKRA 1TZIB 4NJ9L 4YPJA 4Z5RB 2PW2A 4NRXA 2C1PA 5DK3A 1MHEA 3UTOA 1AD0A 4NKDB 1U3HB 5HYFA 2R56L 4AQ1B 5EUOE 4GAFB 1RZFH 1CTOA 4NRYB 4FQJH 1W2KT 4WWKD 1YY8B 4KI1A 5KVFL 1FNLA 4PJ5A 3DX7A 1OARH 1LO2H 3OG6B 1MCLA 3GM8A 1ZA6A 4H88L 1IGYB 2YPKA 1HHKA 3GSWA 5ERWB 2Y23A 2C1OA 4PRHD 1GGIH 1KIPA 3OR7B 4LP4A 2GJ6D 2P42B 4J3TA 4Y16D 2X41A 1DJSA 3B6SA 1Z0MA 1BAFL 3RUGB 2CRZA 3ZDXE 3S5LG 3MLYL 1KLFA 4WEBL 2EH8H 4LKCB 3D18B 4YEFA 4IMKC 2XT1B 3U7WH 2NNAB 1NAKH 5LGJA 3QCUH 4HPYH 3KPLB 4PIRF 1D9KA 1IM3A 4LDEB 4X7SH 1JIBA 4KWUA 2YMXL 5F7YC 1MIML 5EBWB 3GB7A 5C8JA 3I3BA 3AVEA 1F58L 4NO0B 3DX6A 4P9ML 4PJDA 3IFLH 4U49A 5IG7A 3VRLF 5F3BA 2EDFA 3FO9A 3RNQA 2NXYD 4ODUB 4FHBD 3MO1B 3CVHA 4PRPE 4O5LL 4M7JL 4XCCH 2YKLH 5E70A 4LHUB 1Q9WA 3WNMA 5D7LD 2P5WB 1LD9B 3VXRA 2W9LA 1MELA 2MPAL 1WISA 4PREB 4IOSD 1F6AA 3M8OL 3QJHA 4RMSA 3WFDL 2AEQH 1DVFC 5I1LA 5KBNC 2LTQC 4ZUUB 4HWBH 3PWPA 4Q6YA 4IBLT 4OI8A 4BQCA 1EHLL 1OM3L 1P7QB 5DZOA 2B2XH 3IU3B 3VDCA 3DGGA 3QXUA 3OKEA 2ADJA 4ELMF 5GS1A 4WTWA 1RUPL 3V6ZB 5I1EL 3QUXA 1YYML 1KEGH 2VXVH 5GS0L 3GKWL 1J0HA 2R29L 3REWA 1H0DA 1ZLVK 4CN1A 1BD2A 2X4SA 1T04B 3INUH 4MNQE 4YH6A 2FLBT 3SCMA 4BQBA 1B6UA 1QR1B 1X7QA 1K4CB 1Z3GH 1TFHA 2NX5E 5F9OL 4Y1AE 3ELAT 1A1MA 2Y07H 3HUJF 1LQSR 5IIEA 3THML 3RTQB 2H41A 3ARFB 3MRIA 1GZPB 3ZKNC 3MV8A 4R4ND 3ARBA 3BDXA 4X98B 3VGAB 4XPBH 4KXZH 1YEJH 5ICYA 1A3LH 3NCMA 4HSQA 3SDYH 4EVNB 1G6RB 4PRNB 3TJHC 1OF2B 3BUTA 1KXVC 1INDH 1VESA 1H3WM 3FONA 4D8PB 1V7ML 3PHQB 4J8RB 3OJ2C 3QUKA 4I3SH 4HH8A 3WE6B 1FZJA 4W68A 2W0FB 4P2OC 1T89A 4FMKA 2GFBB 3MFFA 4F2MB 3MXWH 4KK9D 3FT2A 4FQIL 2FIRT 4HV8A 1AH1A 1LDSA 1EHXA 1Q0YH 3MV7B 3GSNA 1MHPL 3QIBA 4DW2H 4XCYB 3VDBA 3FFCA 1QPXA 5TH2B 2GITB 3BH9B 3HZVA 5CWSA 4BQ9A 1WFUA 2YPLB 2X1XR 5D4QA 1JNLL 2HFFB 3EJYC 4H26A 4EDXA 5IMOA 1FFNA 1I1AD 4JJ5A 4XB8A 4CMHB 5EIQA 1E4XL 1DBMH 4JDZB 4MA3A 4JFXB 4JFHD 4M7KL 5GS2D 3QI9C 35C8L 3FHAA 4PJ8B 3MLZL 3MJ7B 3BP4A 3ULUL 5DMYA 3T04D 5I66A 2H6PA 4PB0H 4ZNEE 2CK0H 4L5FH 3BKJH 2X1QA 3DECA 5B39A 4XMPH 4X4YA 2FL5B 3CU7A 1FGVH 1LO5A 1RD6A 2VIRB 4NKQB 5IB1B 2HAZA 1A6AB 3BP7B 2G9HB 4X99A 4NUGL 2EYSB 4RGNB 3RBGA 1DN0A 3E3QE 1HH6B 4NPYA 3MYJA 4U4BA 1MCOL 3H7BA 3GUTB 2YD2A 1NH6A 1WWCA 5BVJB 1J8HA 3HPJA 5KW9L 5D96C 3C9NB 3U36A 2W38A 2UUDH 1J1OH 2JF1A 1NC2A 1BQHG 3LKRB 5I8OL 2PW2B 2P43B 2C1PB 4NRXB 4QXGH 4YWGH 3VG9C 1MHEB 1AD0B 3VFNA 4U6YA 2HTLD 4P5KA 2MMXA 2OR7A 3O6KH 4LEXL 1ZGLA 3MBXH 4XAWH 5CCKH 4PJ5B 2OCFD 5HHQA 3DX7B 2FATL 3U1SL 5CMAA 3QEUA 1PYWA 2R0LL 1Q72H 2VXUL 1ODAA 2RR3A 1ZA6B 4DN4L 1P6AB 4HKBA 2YPKB 2VNCA 1HHKB 3VFTA 1RZKL 1U36A 2C1OB 2EIZA 3KAAA 5ALBL 4OGZA 2RAMA 1KIPB 1IBGH 4KKCC 2Y25A 5D2LE 3TJEH 4LLVA 3B6SB 2AEPH 3BXNA 3QEQD 4B5EA 3V0VA 4P59L 5IVZA 1AJ7H 3WO3B 2BVEA 3MR9A 1U91A 1D7FA 1A6TA 5JOFA 3MZGB 5LGJB 1TTUA 4XPHL 4LQFL 4Z7UF 3LD8B 4AEHL 1D9KB 1B4RA 1M7IA 2XA8L 5D7IF 4APQC 1LK2B 1IM3B 1WTLA 1YEIH 2PTTA 1KN2H 4EQ3A 5A2FA 3GB7B 4PJXE 1I9IL 4HGMA 5C8JB 5SWZD 4PJDB 3DX6B 5IG7B 5F3BB 5T3ZD 1GSMA 3FO9B 3RNQB 3LVEA 4MMZC 3SGKA 4BFGA 4O9HH 3CVHB 4NBYB 4JQIH 3KLDA 4HCRL 5E8DL 5HY9A 1Q9WB 4XCNA 4HXAL 4PJEA 3BP5A 3W11C 3HG1E 3VXRB 1I75A 5C2BL 5DMKA 3PP4H 1VENA 2NQCA 4J3WA 1FL3A 4RFNC 3V6OC 1CXIA 1PKOA 1F6AB 1JZ3A 4G8IA 3QJHB 1A7NH 3SBWA 1EO7A 3SE4C 3QWOA 3PWPB 4TPRL 4RZCA 2YPVH 1T1ZA 1E6OL 3LHPL 2NY3B 5E5MA 1F45A 2WUBL 5I1DA 1P5UA 4LHQB 5EORL 3DGGB 1RY7B 1ULVA 1I1CA 3OKEB 5F21B 2ADJB 5TDOA 5GS1B 3QUXB 4FQPA 1CDGA 3U9PL 1R0AH 4JM4H 1QA9A 4M1CD 2JCCE 4UT9L 5INCA 4LF3A 1H0DB 3MODL 3REWB 1BD2B 2X4SB 4LOUD 4M6ML 4CKVX 4FTVE 3SCMB 3BEVA 1X7QB 4B7IA 2VR9A 4XP1L 2VXQL 1A1MB 1XGYL 5C1MB 4OD1H 4LASH 4N5EC 5IIEB 1AGDA 2M8XA 2XXCB 1DQDL 1QBMH 3IETA 1Z9OA 5EO1A 3MRIB 1DR9A 3MV8B 1QKZL 32C2A 3ARBB 4OZGE 1OPGL 3O4LA 4ZO8A 2APWA 4FRWA 4P9HH 2C4XA 1X5KA 1DBJL 5BS0D 4Y5XC 5ICYB 3PL6C 4YK4B 3IRPX 4L4TE 1EHNA 2ICWI 1HWHB 3FONB 5F88A 4TSAH 2A2QT 5E1AA 2FBJL 4K2UL 1OWWA 2Z31C 3P11L 2V2XA 3QUKB 3U7AA 3GSQA 4GXUM 3RVTC 3SKUD 4NQSA 1NMAH 1FZJB 3ES6A 4Z0XA 4OD3L 1CGVA 4F9PC 3MFFB 5F9JA 3GJFH 5D8JL 5L7XH 3AMKA 3FT2B 4HV8B 3HMWH 3WKML 3QQ3B 3GSNB 3CZFB 3QIBB 4WGWB 2BFVL 3FFCB 4OLVH 1BJ1H 3HZVB 1T1XB 4ETYA 1VEMA 1XF3A 5DD0H 4DVBA 1EGJH 4H26B 4EDXB 1RZGA 5I1JL 1JNHA 4XXCA 5IMOB 1FFNB 3VWJA 4JJ5B 1BFVH 1FO0H 4MA3B 4YHPA 3OKMA 1MI5D 4GLRI 2DKUA 2JJTC 3BP4B 5C07D 3S88H 1J0YA 5I66B 5T1MA 2H6PB 5EC2A 1FIGL 4GG8A 4RMQA 1J0IA 5KSBE 4GG6E 5EU4B 1F4XH 1AE6L 3B2UD 3TO4D 5B39B 3ZDYF 4X4YB 2EDQA 3HZKA 1K8IA 4MXWH 4WI3A 4HBCH 1LO5B 2OS7A 4D3CL 5CLWA 4X99B 3LY6A 1MPAH 4L4VD 4NJAL 1DN0B 1U3HC 4L1DA 1JCKA 4WU7A 4ZSOA 4XTRD 4D9QE 3MRGA 3MYJB 4NPYB 3WDIA 5DFVD 4IS6A 3L3JA 3H7BB 3IYLW 3TBVA 3KPPA 3D87B 1J8HB 1BFSA 1CLOH 3HPJB 5DUPL 3U36B 3QEGL 1KYOK 4CDGC 1E0OB 3UPCA 4EN3A 2E6JA 4G3YL 2WAHA 1NC2B 1PY4A 1JRHL 3VFNB 4YXHH 4U6YB 3C2AH 1KBGL 4P5KB 4FQ2H 1WVZA 4QTIH 3X12A 2K3TA 2HWZH 4LCUA 1CGTA 3QAZC 1ZGLB 4PJHF 1J18A 3KG5A 4PUBH 5IEKA 5D72L 4ZQKA 1AO7A 5HHQB 5CMAB 3QEUB 1PYWB 4GRLA 5SX5K 2YK1H 4DCQA 5I6XB 1C16A 5KOMC 4HKBB 4OF8A 5TJWK 4XVUC 2AK4A 3VFTB 2CR6A 1NCCH 3MV7E 2EIZB 2WW8A 4KK6D 1NANI 5EBLA 2IANE 1UVQA 4LLVB 2YPLE 4HBQA 1DTUA 1CR9L 5IWLA 3WYRA 2EDWA 3BXNB 3V0VB 1QSEE 4XHJC 4HC1A 5JQ6L 5IVZB 3NVQA 4JHWH 1TTGA 3MR9B 3MXVH 1U91B 2ZSVA 4N9OB 1A6TB 5DZLA 5JOFB 1AFVL 2X89A 4WHTA 2PXYD 4U1KA 4Y7MA 3RWIA 5IUSA 1S9KC 1IAIM 1M7IB 1ZSDA 5TPWH 1NGZA 3QHFL 2PTTB 2QLVB 3NCCB 5HD8C 4R8WH 1ACYH 4X5XA 3QYCA 1JFQL 1ZVHA 1KCKA 5C92A 4PJIA 5BOPA 5HY9B 4XCNB 1BF2A 3WLBB 4PJEB 3BP5B 5FOBA 3HA0A 4PJBF 1FL3B 1H9VA 4NBXB 1DDHA 2B0SH 3T4YA 2I9TA 4OFIA 2AV7A 1QRNE 4G8IB 1QR4A 4XNQA 2IBZX 1M71A 2JB6A 3E6HA 3VXUE 4D94A 2I26N 5GPRA 3QWOB 4RZCB 1XT5A 3QQ4A 4XGZA 1T1ZB 2H2SD 4ZDHA 3RTQC 5I1DB 5E5MB 5KSAA 3ARFC 1GYAA 5TDOB 1F4WL 2H1PH 4NWTL 1G7QA 3ZE1F 1QA9B 3VGAC 5INCB 4LF3B 4FFYL 5CP3A 3NCEB 1IAKA 4BQ8A 3BEVB 4FQLH 4MQ7A 4CRPA 5CAYB 1FL5A 3TH4T 2IFGA 1BHGA 2DDQH 4OFVA 2GIYA 1AGDB 3N0PB 1KB9J 2I5YH 4N0UB 1UCBL 5DK0A 3IETB 1TJHH 1IM9A 5EO1B 1HQ4A 4NC2B 2X4NA 3Q1SL 32C2B 2EE2A 4ZFOL 2DD8L 3O4LB 1DBAH 1NC4D 4JM2C 3SPVA 1BJ1J 4TNVF 1F90L 2WLZA 3LZFH 4WUUD 1MAMH 5E08L 4Y4HD 5IROC 2KH2B 4A2LA 5F88B 1OAUL 1MFNA 1A7RH 2BNUA 1GVIA 3MRNA 5E1AB 2DLTA 4MA8L 4XNYL 3UJTL 3EZJB 3SJVA 2V2XB 1P9MA 4YHLL 2P8MA 2ZUWA 3GSQB 2VC2H 1LDPL 4I0PD 3T3PE 4TQEH 4PJDE 1CFBA 4LHJB 4MD0A 4NQSB 3WO4B 3ES6B 5DRWA 3H3KA 2JB5L 2VRAA 4Z0XB 4FOMA 3HFML 5GIRA 3P40A 4CMHC 4QGTA 2CGRH 1UH4A 5F9JB 3H42H 2A77H 4HMEA 5D7LE 4PJ8C 2HLAA 5C0JA 3HNTL 4KROD 3MRFA 4N8CL 5CLTA 5D7SL 1UCTA 1CK0H 5DVMA 5MHSD 4UV4L 1XZ0A 1XF3B 4DVBB 1RZGB 1B9ZA 1YEGH 4O51A 1JNHB 5L8KB 2YRLA 3VWJB 1M4KA 1NBVL 2V6HA 3D39A 3G6JA 1I1YA 1EZVY 1IGIL 4UNVA 4MQXD 4XI5C 3V8OA 4YHPB 4X9IA 2ZCHL 3OKMB 2R8SH 1CLYL 4RGNC 3S96A 2VDRL 1AGFA 2EH7H 2F58L 4J3UA 1SJXA 5T1MB 5EC2B 4GG8B 2ESVD 4FFWD 1ZVSA 3MRLA 2OL3L 4CUCA 1NL0H 3HZKB 4AYFA 5CZVH 3QDJA 1K8IB 3L95A 5DUMH 2AABL 5FUOL 3T0XA 2HJFA 2NR6C 1OD9A 3WN5A 2VOTA 4WU7B 4ZSOB 1V3LA 15C8L 2YC1A 2AQ1A 3LH2H 3MRGB 5JHLL 4IS6B 3RHWK 1FNAA 3L3JB 3TBVB 3KPPB 4WCYH 3HAEG 1G84A 2BP3A 5IFJA 2P49B 4XWOC 1BVKA 4PYGA 4WEUD 4WTZG 3NMEA 4DAGL 1B0WA 1V5JA 3MRKA 1OAKL 3BN9D 3WLWD 5F7KC 3DGCR 4LCUB 3DHJA 4NNXA 4OFYD 5A16A 5IEKB 4ZQKB 5ADPL 1AO7B 4U7MA 3BJ91 3LS5H 4GRLB 4GH7B 1UM4H 4DCQB 3EHBC 5FGSA 1C16B 2LFGA 3V6BR 1Z2KA 5HHXL 4LSPH 2AK4B 3CFBA 3V5HA 4Y2DA 2DQFA 3I6LD 3LD8C 4LSSH 2DBLL 1LO4L 1D9KC 3OAUL 5BRZD 4DKAA 3HB3C 2BJMH 5EBLB 2I60H 1UVQB 2BNRA 2X05A 4XPTH 4MNHA 5H94B 3REVA 3SO5A 3D69A 2MNUA 4YR6A 3IXAA 2E9IA 3S3JA 4QXUL 2ZCKH 2ZSVB 4Q9QL 4M6AA 3BZEB 1ETZA 5C0RH 1AI1L 4WHTB 4U1KB 3RWIB 1MCQA 2DLFH 5A1AA 4KXZI 1Q38A 1NGZB 4KI5E 1NPUA 2FD6H 1U3YA 2F54D 4RRPG 4OZIA 4P3CL 4X5XB 1I3VA 1L7IL 2ZUXA 2WWKT 1AC6A 1ZLWK 4GBXD 5F44A 4XPGH 4Z7QF 1MJ8L 3FQNA 5JW4M 4DKDC 3BMVA 4E41D 1P4LA 1FPTH 2J8UE 2NY3C 4NGHH 4EOWL 5FOBB 4DKFH 1GGCH 5GS1C 3QUXC 4XVSL 1OGTA 1DDHB 3VFOA 3T4YB 2I9TB 1HYSC 2AV7B 2QHRH 5DVKA 4XNQB 1JHTA 1M71B 2JB6B 3SCMC 4YHNA 3U4EA 4W81A 1N5YH 3GSRA 3TNNA 1NCAH 3E6HB 3S37L 2GJZA 1FSKB 4XGZB 3QQ4B 4F58H 3I2CL 1I3GH 3VWKD 3EOTL 4NQEE 4ZDHB 1D3CA 3ARQA 4AEIH 5KSAB 4DEPB 4YHIA 2Q20A 4XT1C 3BD5A 5DD3L 4HWBA 5D6DC 3ARBC 1G7QB 4W4OA 2VDQL 3EDJA 2Q3AA 4X9FA 3SKOA 1IAKB 4X83A 2ADFH 4KMTL 4YK4C 4MQ7B 3CFIC 1FL5B 4G80A 5EZLA 3IVKA 3UP1A 1A7OH 4OCSH 3FAXA 5DK0B 4OCXH 5SWSA 1IM9B 4M48L 4UIKL 1HQ4B 2X4NB 1DCLA 2VL4A 3RGVD 3K4DA 1T89C 1TVHB 3SPVB 4S1RL 1YJDC 2BCKA 4KKBC 2J6EL 2B1HH 1J1PH 2Z8WC 1JL8A 1BVLA 3QIBC 2NY2D 5HDBE 1JMXA 1U8HA 2BNUB 3MRNB 3S3PA 4QHNB 2O26U 3TFKD 1BM3L 3NPSC 3SJVB 4GW5A 3V52H 3MQIA 1A4JA 3SE3A 3EUUA 4N8PA 4MD0B 5DT1H 4OLUL 5DRWB 5GIRB 3JWDC 5I8CB 3AGVA 1RIVH 1CCZA 1KXTB 4NCC2 2LQRA 3WXVH 2W92A 2GT9A 3H3BC 1KPVB 4PJEE 3AUVA 3D9AL 2HLAB 3L1OL 5C0JB 4AL8L 3MRFB 1MFAL 1CQKA 1S78D 3AS3A 2GY5A 4Z8FH 4U1MA 1N6QH 5KVFH 4NWUL 1XZ0B 3BKYL 5AD0A 3B8SA 5BVPH 1H8SA 4O51B 4K3EL 4H88H 3D39B 3G6JB 1I1YB 2DM4A 3KYKH 4HT1L 1BQUA 4MD4A 3MCKA 3BPCA 3S96B 1AGFB 2AXHA 1FE8L 3IAQA 5EUOF 4LKXA 2D7PA 3GBML 2D9QB 1ZVSB 3MRLB 4XCEA 1MCSA 2DOCA 3QDJB 3L95B 2HKFL 1JPFA 2GTZA 5C0EA 4GKNA 5TQ2L 1XGPA 4LVEA 5JIKA 3WN5B 3VH8G 4NQCA 1VFAA 2YC1B 4PPTA 4NZJA 2EO9A 4GRWE 3BSZH 1OY3B 2YMXH 1MIMH 1RZIB 2FH8A 2CRMA 1DUZA 1UEYA 3O4LE 3ZDXF 3UZQA 2D4DA 3GSVA 3HE6A 2XIDA 5IFJB 3VFMA 1BVKB 5J7CC 4CAGA 4W6WB 4O5LH 4M7JH 1N4XL 5GHWL 3ILQD 3MRKB 2BMKA 2FX7L 5IHLB 1ZGLP 1NCWH 2MPAH 5FM5O 4NNXB 5A16B 4RCAA 3NZ8A 5IB2A 4WI4A 4U3XA 3WFDH 1T83A 3F6LA 5FGBA 3V5HB 4BKLA 3CFBB 1WJ3A 4Y2DB 3OQ3B 2XZZA 3STLA 4ZD3L 4LBEA 3QZWA 1EHLH 3CDCA 3R1GH 1IAOA 3L3KA 5D1ZD 3DUSA 5FYKU 4H20L 2BNRB 1ZLSH 3S5LA 4R7DA 3BVNA 3C5ZA 3TWCL 1RUPH 4MNHB 5JDSA 3REVB 3D69B 2CRYA 5CS7A 3CFDA 3GKWH 4YR6B 3IXAB 3PDDA 1VFBA 3WIHH 5BO1L 3RNKA 4ZS6C 3SGKC 1WFOA 1D5MA 5F9OH 4ODTH 4OUUA 1MI5E 4ZODA 4S1DC 1B88A 5K9JH 3GNML 5E4IA 4MNGA 2R1YA 5A2KH 1CQYA 5DURB 5B22A 4WFGE 3V2AR 2EDKA 4OZIB 2J4WL 1ITBB 2AJYL 1JVKA 5ELIA 4M93B 3SBWC 5DD1L 1BOGA 3FQNB 2EDJA 2YD1A 1ZKAA 1EK3A 3T0AA 3C6SA 4B7LA 3ZT6A 1P4LB 3SN6N 2IPUK 1V7MH 4OF0A 1II4E 5FGCB 1D5XA 3TA3A 3DUHA 4M8QB 2OR9L 1FGNL 1Y6NR 2HT2D 1OGTB 2COQA 3VFOB 1MCCA 4RX4A 2A9NL 1RUAL 1JHTB 3Q3GA 3K2UH 2Q8AL 5HI3C 3U4EB 4YHNB 3GSRB 3TNNB 2GJZB 1I9EA 1QBAA 1GGUA 3H3PH 3TEUA 5IM7A 2XWBA 3QH3A 2ZKHL 2F8VA 5DJ6A 1CXHA 4JFEA 4YHIB 3N1QC 4HUKB 3IU4L 3O3UN 3RVUC 1OCWL 5FYLH 3KVQA 5FO8A 1JNLH 2KL6A 2DJUA 4NUJA 4OV6F 4TSBL 3RVVC 2QADB 3SKOB 2AK4E 2BOBA 1RHFA 1LWRA 3BGMA 4M1DL 4G80B 1JHLH 5EZLB 4NZTH 5FGRA 35C8H 3IVKB 5M94B 2HVKA 43C9A 2DRUA 3MLZH 2SEBA 1JI1A 3O2DA 2NYYD 1A21A 1F3DH 5SWSB 1RK1A 2A74A 1MJJA 3WO4C 2R69L 5F72S 2X4UB 3HZYA 2AP2A 1IFHL 5CEYA 2KZ1B 3IJSA 2BCKB 2BNQD 4XNUL 5GGQH 4EBQL 1YN7A 4MVBC 4YNYA 4LMQI 3MOBL 3L7FA 4CU6A 4WVRA 2ARJQ 1BVLB 4P4RA 1KG0A 3NA9L 1U8HB 3B9KA 4NM8L 1G7MA 2WQ8A 3BE1L 4W70A 3QPQD 4CJ0A 3DO7A 4GW5B 5DJDA 3WV0A 1A4JB 2NZ9C 1UG9A 1GHFL 4XXCC 3VWJC 1OP3H 4K7PL 2E9WA 4NM4L 4PJIE 2RB8A 3KYMA 3S35X 3MUGA 1DL7L 4TTDC 2GT9B 1PG7X 1Y18A 5FO9A 5ITBL 3FRUA 4LEXH 3EOAA 4U1MB 3BHBA 3HMXA 1AXSA 5AD0B 4G9FA 5L2KE 4LSRL 3UYPA 3ESVF 3TESA 1ZEAH 3F12A 2QEJA 4OZHA 2XV6B 3ARXA 4HG4K 4MD4B 5KSVA 3MCKB 4XP4L 4NQDA 3BPCB 4BQ6A 5ALBH 1WV7T 4IOFD 4LKXB 2DQJH 5CEZL 4U1JA 3RX8A 2PCPA 4OJFL 4XCEB 4YUEH 4G7YL 4P59H 1AGBA 3FQTA 2VABA 2UWEE 2F74A 3O45A 1JPFB 3VXMA 1KEML 4JZOA 3GMLA 1HK6A 5F9DC 1Q1JL 4GKNB 5C0EB 4LQFH 1XGPB 4AEHH 5I30H 4NQCB 2V2WA 1VFAB 2IEPA 5D2LF 2D0GA 2VDNH 5DGRA 3UTSD 4Z78A 1MFCH 2HN7A 2FX9L 4L8DA 2VB5A 2BHUA 1CICA 3KJ4B 1JGLL 2V9TA 1DUZB 1I9IH 4GRLC 4M62H 1BQHA 3GSVB 3FL7A 3HE6B 4WUUE 3VFMB 5CBEA 4MZ3A 2EDYA 3O9WD 3C6LA 5E8DH 5AYQA 3T0BA 5ECJE 5F7LB 3K0WA 2BMKB 3ARGA 1A0QH 5C2BH 5IWLC 4OBRA 4HQQH 5T5NF 4PJXF 2EDTA 2X70A 1UACH 3NZ8B 5IB2B 1NUNB 3N1MC 5LGHH 1KULA 4BKLB 3O2VL 4OIAA 3STLB 3HLAA 2YRZA 2EDXA 1Q9KA 4LBEB 3D3VA 3QZWB 1IAOB 3L3KB 1RUQL 3LHPH 3DUSB 1OAQL 3GSNL 3GIZL 3PV6A 3NCJL 4WENB 5EORH 4KJWD 3LEXA 1IQDA 4B0MM 3S5LB 4R7DB 1DBBH 3BVNB 3C5ZB 5JDSB 4MJID 3NCYS 1I9JL 3U9PH 4EIGB 3ARPA 3CFDB 12E8L 5D7KD 5D70H 1VFBB 3MODH 4YEEA 3RNKB 3T1FA 3MV9D 1D5MB 3C87A 5JXAH 4XP1H 2VXQH 3P0GB 2R1YB 4X9GA 3GGWA 5T33H 2ESVE 1LO0H 5HPOA 4LCWD 4ENEC 3LQMA 4JZNA 5E99H 3FO0L 4RGOL 4L8BA 4X5WA 3C8DA 1OPGH 2JCCF 3UBXG 3DIFA 4LSTL 1BOGB 2F5BL 3OF6D 1FSKC 2DQCL 3C6SB 4I13B 4KVNL 4L3EA 4CVWA 1Q0XH 1E28A 5KSAC 1H3PL 1P84J 3QQ9D 4XRCA 1D5XB 3MPCA 3TA3B 5TDPA 3RWFA 4F3FA 5FYKH 3EGSA 3OHXA 4G5ZH 3EFDL 2DQUL 4OZGF 4YPGA 5C9JA 1N64L 3Q3GB 1F3DJ 4OD3H 3WD5H 4OLWL 4PGDA 6CGTA 3H8NA 3JVGA 5IM7B 2XWBB 3QH3B 2YZ8A 2BFVH 4WJ5A 3MRRA 5DJ6B 4JFEB 3TVMA 4ZFGH 1JGVH 2PR4L 1G9NC 5FO8B 4RAVA 4NUJB 1G9ML 5JTWA 2UZYB 4F8TA 5BV7B 2BOBB 3U0WH 4V1DE 3BGMB 2VWEE 4PRHB 4G43A 5DQJB 2GJ6B 2HVKB 4HW6A 43C9B 2SEBB 3RVWD 4QXTA 3JTSA 4D0BA 4LSDA 1JZ6A 4ZFZA 3C8HA 1P9MC 2FGWL 1AE6H 1RK1B 2A74B 2VSCA 1MJJB 3D5OF 4FMFA 2H2PC 5CJQL 3HZYB 5CEYB 2XPGA 3IJSB 4N1CA 1KB5L 1YN7B 4NQUA 4YNYB 3L7FB 4PV9A 3EO9L 1KG0B 4NJAH 4F57L 3B9KB 1JZ7A 2B8OT 2F54E 1G7MB 5KSBF 4GG6F 3DO7B 2VDPL 5J89A 2EKSA 5DJDB 3MLSL 3RL1A 5MENE 5HI5D 3I3DA 2MJWA 2F15A 3QEGH 4K71B 2NXYB 4NN5C 4OLXL 4G3YH 4P3DA 5DQDH 5C0BE 1T5XA 1MAKA 3KYMB 1JRHH 3MUGB 3RU8L 1Y18B 1ZLVH 5FO9B 3FRUB 1Q94A 4LNRA 2P8PA 4LP5A 3EOAB 3BHBB 3MGOB 1AXSB 2O61A 4MB4A 4G9FB 4Q58C 3GIVA 4HS6A 3F12B 4OZHB 4RMTA 3LKSA 3MCLL 1SY6A 4QRPE 4LIQL 5KSVB 2VDML 4NQDB 4F7MA 2D0HA 2CUMA 5C6PB 4XC1L 3WN5C 4MZ2A 1YQ2A 1C1EH 5TE7H 1CTNA 4HZAA 2OZ4L 4K7PY 3ZKSD 4P57A 2JJSA 4U1JB 2PCPB 4Z18A 1AGBB 3FQTB 1MREH 1UADC 2VABB 3KXFD 5JQ6H 2XZAL 1YDPA 2F74B 1A64A 3O45B 5GZNC 3VXMB 5B8CA 2BSED 3GMLB 4JZOB 1TZHA 2FJFA 5EULV 5GRUL 3TZVD 5KVMC 1J0ZA 4LRNL 2V2WB 2EDEA 3QHFH 4QHLA 4QHUA 4Z78B 1QYGL 2HN7B 4L8DB 1CICB 4AEFA 4YHYB 5DO2D 3W82A 3B8YA 5ID1A 3WUWG 4KKLC 1VHPA 5CBEB 4Y2DC 4WNQA 1IQWL 2JIXD 1KGCD 3C6LB 1B4JH 2GCYA 3JV4A 3ARGB 3GSXB 2AQ2A 4WY7L 3IB4A 3EJZD 4YHZH 2X70B 5I1CL 3DYOA 5GS3A 3FMGH 3RVXC 2YUXA 4LQ1A 1G1YA 5DD5L 3Q5OA 3MLUH 1FVCA 3HLAB 1Q9KB 1X5IA 3D3VB 4OT1H 4JFDA 2ERJB 4U3HA 4ZOAA 1C5CL 5GGTL 3QIWC 3PV6B 1GGTA 3LEXB 4PLJC 5FK9A 1IQDB 1JWMA 1SBBA 5EWIL 1F4WH 5IW6A 2EC9U 4KUCF 3B5TA 4ORGA 4M93C 4NC1C 4FFYH 5MEOA 5DRNA 2XRAL 5IBTL 4ZXBA 3T1FB 4P23D 4OGYL 2X7LA 5C07A 4TOYH 1L9MA 3GGWB 2I9LA 2FR4A 4JZNB 5EOQL 2WBKA 4Z76A 3N1GC 3Q1SH 1DSFL 1V05A 3L3DA 3QR2A 4L8BB 4X5WB 2Z91A 3PABB 5T3XH 3DIFB 3DX8A 2H26A 3EOBA 5JW3L 2D03H 1H8NA 4NO2A 5HHOD 5E08H 1KN4H 1RZJC 2D7MA 4P2RD 4L3EB 4KU1A 4RDQF 4NQCE 3ESUF 1E28B 4QOKA 3LN5A 3ZKMD 4XRCB 5DF0A 3EBAA 1R5IA 4PJCE 4UV7L 5TDPB 1IGTA 1X4YA 3RWFB 3T8XA 4F3FB 3UJTH 3EGSB 2PKDA 2ZCLL 3HRPA 3OHXB 5F96L 4YHLH 2Q6WA 4EI5D 4W4OC 3BQUD 4HPOH 3MJ9L 2ED7A 4YPGB 4Q9BA 5C9JB 2QADC 2JB5H 4X6EA 3HFMH 1INQA 1WBXA 2EE9A 4ODHL 4PGDB 3V9FA 3A67H 4IDJL 4JZJA 1EO8L 4PRID 1Y0LA 4JAMA 1PX4A 2XWJA 4WJ5B 3MRRB 5D7SH 3TVMB 3CPLA 4QEGA 1HXMA 4U7SA 4G7VH 4RAVB 4XNZB 3T3PF 4PJDF 3DURA 1NBVH 2X6MA 1QHPA 4ZMAT 1IGIH 4LHUG 2ZCHH 4UB0H 3ULSA 1E6JL 4G43B 4U1GB 5I17A 3NIDE 2F58H 1NCDL 4QXTB 2I24N 3JTSB 4D0BB 2ICEA 3QEQB 4ZFZB 4FP8H 3SE3C 1T20A 1DP0A 1N2RA 3GMRA 2VLRD 2A0LC 4E5XA 2J3SA 1WT5C 2XPGB 3S3SA 2AV1A 2PXYA 4PV9B 5DLML 4MNGE 3MOAL 1QFWL 3Q48A 15C8H 1Q9OA 4OM0L 2HFEA 3IFOA 3PQYD 1L6ZA 5JW5A 2R1XB 3SDCA 4JRWA 5LXGH 1S7UB 1K4DA 3D85A 4K3DH 1RUML 2EKSB 3RL1B 3C5SA 3EO1A 3SDDD 3EZ8A 4P3DB 2F9BT 1EO5A 3B2VH 4ERSL 3NCFB 1T5XB 2Q3ZA 3HCVA 5FFLA 3RWEA 1EJOL 1CDBA 1GGYA 1MRFL 4XC3H 3KPNA 4P46D 1OTSD 1Q94B 2W0LA 3QSKB 4LNRB 2P8PB 3HC3L 2O61B 2G2RA 1OGAE 1K6QL 5ISZD 2BVQA 3GIVB 2QQNH 4HS6B 2QSQA 4MAYD 3P73A 5IFAH 3LKSB 5HHXH 3QUML 3BRGC 4F7MB 2OR8A 2DBLH 3OAUH 1UM6H 4JFEE 1IC4H 1FH5L 4UDTA 1CGWA 3UJJL 4P57B 3Q6FA 2ED9A 5IW1A 3KJ4C 3P77A 5CGMA 2L7UA 4GW4A 4PJ7A 3HE6C 3PNWA 1YDPB 5EB9A 5HXMA 2QQKH 4Q9QH 5B8CB 4WO4A 5GJTL 2FJFB 1AI1H 3V5DA 1FZMA 3T0EA 3GDBA 4NN7B 1VEPA 4OQTA 3IFNL 5CINL 3A6BL 3V0WL 5E6IC 3PWUA 4QHLB 4P5TD 5FUZL 4QHUB 5EIVA 3RIFK 3HAEA 1RIUL 3P30L 4DUVA 1L7IH 1NC4A 1NFDE 2BVOA 4LCCA 3QFJD 3EYUL 1T83C 2WWMC 1OAXH 1KJMA 1QACA 5FGBC 4JFYA 4WNQB 1BQLH 2BSSA 3NH7L 2GCYB 3C08H 4EOWH 2ZUVA 2A6DA 3GKZA 3FQRA 3JV4B 3QNZA 2BSRA 4WI8A 4KI5F 5KVEL 3C5ZC 2F53A 1PVHA 3OKOA 5GRJH 1IMHC 4HLZG 3N85H 1NQBA 5IGXL 1TJGH 1B0RA 1OW0C 1T2XA 1FVCB 1U8MA 5B38A 3LKNA 3J7HA 4JFDB 2J8UF 3GK8L 3I2CH 5I1HL 3EOTH 3SE8L 1IC5H 1S7VA 4ZS7L 5FK9B 5CILL 1INEL 1JWMB 5DD3H 1EA9C 4G9FE 5IW6B 2CQVA 1ND0A 4J3VA 4ORGB 3UROR 5IBLD 2QHLA 4HWEH 2EIEA 5MEOB 5DRNB 1QPPA 3E8UL 4ZXBB 4XCFL 4KMTH 1ZHNA 4LLDA 4NQDE 1DEEA 2X7LB 4J2XA 3LQAC 3W0WA 3MRQA 5L6YL 4P4KA 2Q8BL 2WANA 2VZ3A 1G0XA 5C07B 5CD3A 4HUWA 2I9LB 5HVFB 2FR4B 1TQBC 1UZ6E 4NQTA 3RY4A 4IRJD 4Z76B 5I16A 3L3DB 3LKOA 2Z91B 3DX8B 2H26B 2J2ZA 3EOBB 4NO2B 5E94A 3N50A 4Q9RH 3D25A 5A40E 4G6ML 5SX5H 2GTWA 4QOKB 3LN5B 5BZWA 3GMNA 1R5IB 3TO2A 1PQZA 3T8XB 3KPRA 1BM3H 4K8RC 1FBIH 2Q6WB 3F65A 3EYOA 5IHBA 1UM5L 2NLJA 5BV7C 1TZGL 2C26A 5EC1A 1PLGL 4X6EB 1INQB 4LMQE 5C6TH 4JHZA 4RBPK 1WBXB 5C0DA 3QDMD 1YEEL 4JZJB 1TPXB 3AM8A 4YO0A 3RJDA 1CFNA 1Y0LB 5HDBF 5CD5C 4JAMB 5DZNA 2RJMA 2XWJB 3BGAA 1MFAH 5EA0H 4AL8H 5D1QD 2VDLL 3CPLB 4OFYA 1I7UA 1HXMB 3BKYH 3DURB 5I74B 4JANA 2LVCA 3BISA 2R2BA 1C5BH 1CN4A 3KPMA 4HT1H 4LAJH 3BPNB 5FYLD 4GAJH 1IGFH 4M3KB 3ULSB 5I17B 4D9RD 4JN1L 2P7TB 4PJEF 1IKFL 3B9KC 1U8JA 2HLFD 4XMKH 4ZAKA 3GBMH 4MJIE 1VFOA 2ICEB 3UDWA 4LSUL 4FQXA 2OTUA 5CJOH 3QIUA 1T20B 1N2RB 3GMRB 1QFOA 4FFVC 3T2PA 4E5XB 4K71C 2NXYC 3MV9E 2VQUA 1KTKE 2HKFH 3IDYB 2AV1B 5IFHH 3QG7L 2PXYB 5TQ2H 3VFGL 1KC5H 5I1GL 3H9SA 1N5AA 1ADQL 3N9GH 4LCWE 1Q9OB 1CF8L 2HFEB 2VXSH 2VO5A 1YZZA 3IFOB 5JW5B 3SDCB 5DEZA 1VGEL 1K4DB 3D85B 5E7BA 4WFHD 4PFEA 3C5SB 3QO0A 5DJ2A 4GBXA 3EO1B 1EX0A 3WFHA 4UT7L 2BRRL 4PTUA 4EDWH 4E41A 3HCVB 3SGDH 1G6RH 4KZDL 1N4XH 5GHWH 5HDLA 3RWEB 5CIPA 1MCIA 3L5IA 5C0NC 4AT6A 3KPNB 1ZAGA 1G9EA 4GRWF 4JPWH 2G2RB 4S1SH 5FV2A 1CS6A 2BVQB 2VKWA 2HT3C 1KPRA 3P73B 1U8NA 5EU6D 3VGBA 4CJ1A 4JRXD 1OT2A 1D5IL 1TETL 1OSZA 3DXAA 3WJLA 2HYMA 1HINL 3BX7C 3WNLA 1EMTL 3ZL4H 5LGKA 4UDTB 1DE4A 4Q74A 3OKLA 1VADA 3Q6FB 2VXTL 1CICC 5IW1B 4YHOL 3ULVC 3P77B 3N06B 4YHYC 1FYTA 4JFQA 2P5EA 4PJ7B 1E27B 4OFPA 3PNWB 4Y4KD 3SGEH 2VMFA 4I8DA 1W8NA 4XMLH 4WO4B 5JXED 3C6LC 2BOCA 4HFWA 1FZMB 5EFIB 3T0EB 1U6AL 3V5DB 1GXEA 3ZT7A 4KPHH 4L4JA 4X80L 3ARGC 3KJ6L 3B3IA 3PWUB 1J11A 3HAEB 1NEUA 5FDYA 2AJYH 3KGRA 2OTPA 1NC4B 4LCCB 2MCPH 4HLZH 5DD1H 3BIBX 1KJMB 1OLLA 4JFYB 4OV5A 4HULB 1H8OA 4QY8A 3CJJA 5DGQA 5HGHA 3UX9B 1HYRC 1OQOA 2BSSB 2A6DB 3FQRB 3QNZB 2BSRB 5EU7C 3DWTA 1HHGA 5B39G 4JPVH 2F53B 3AREA 3OKOB 5BCAA 4HCRA 2FBOJ 4NHUA 1KYOJ 4GXVH 1B0RB 5JIPA 3G6DH 1G7IA 2Q8AH 4AMKL 3DI3B 1U8MB 5B38B 3LKNB 1I8IA 1S7VB 4GUPA 2J88L 5T1LA 3WHXA 3JUYA 3TBTA 4M5ZL 1OCWH 1ND0B 2G60L 3DMMA 1NLDL 2GAZA 1ZHNB 3FQWA 4LLDB 5HGDA 1JUFA 3W0WB 3MRQB 1QG3A 1CGYA 4P4KB 4UQ2A 3W9EA 4R2GB 3R8QA 5C0AD 3R06A 2DQHL 5CD3B 4GO6B 4HUWB 1T22A 4KKAD 2EE3A 4HEME 4QRRA 4K23L 3LKOB 5I16B 2R69H 2NZIA 3LDBB 1IFHH 3LEYL 5KAQF 1HILA 1ZA3A 3ZTJG 2Z0BA 1MWAL 4OAWA 2XKSA 4XNUH 3Q6GL 5E94B 5IT2L 3PDOA 3MOBH 3D25B 2C4FU 3JVGC 1SMOA 4JKKA 1WUNT 3NA9H 2GTWB 1JNJA 4UTAH 4NM8H 5BZWB 3GMNB 3TVMC 4EEEA 2BVPA 3BE1H 1PQZB 1U8OA 3TO2B 3KPRB 4F37F 5GZOD 3VD5A 3F62A 3JWOL 4XNZC 1JRHI 3EYOB 1CG9A 3CFJA 2X9XA 3MA7A 4PJGB 1S7QA 2NLJB 2NY1B 4NM4H 5EC1B 5D9SA 4IRSA 5C0DB 5FYKD 1C5DA 2Y9RT 2XY1A 1S5IL 2NY5L 4U1GC 3C09B 5D71L 4YO0B 3CVHH 4PJ9D 1CFNB 1TCRA 5ITBH 5AAWA 2BERA 3MZTA 2ARWA 1FNSL 2V17L 5D5MA 1I7UB 1X5JA 3G5YA 2BY1A 5KTEL 4BSVA 1CE6A 2AXJA 4HS8H 4LSRH 3RQ3A 3MMEB 1IAIL 3RX5A 5JHDA 4CDHA 4JANB 3DOSA 2HT4C 3O0RL 4XXDA 4WI2A 3IDNA 2R2BB 4PJIF 3KPMB 3JV0A 4XP4H 4Z77A 4JFDE 3B4NA 4X6DE 1WWAX 5EOCJ 3T1WA 1ZLWH 3VE0A 4LU5L 1U8JB 4QWWC 4ZAKB 5CEZH 4PY8J 5ACMA 4EXKA 4ESKA 1WEJL 5E2VL 4OJFH 4FQXB 2OTUB 4JVPA 3QIUB 3OBAA 4HIXL 5F7EH 1HWGB 4KMQA 2AJVL 3D0LA 2BHYA 3L5XL 3OJDA 2W0PA 4BSJA 3QHZH 3QFDA 2IH1A 4KZEH 4Z7VA 1ZS8A 2FX9H 1DVFA 4MQTB 4O2CA 1JGLH 1S7SA 3QO0B 3IS1X 5DJ2B 4GBXB 3WFHB 1MY5A 1KELL 1SBSL 1BGXH 2UWEF 4PTUB 4WW2A 3V6FA 4E41B 4LDOB 1UWGL 3BPLB 1QFPA 3G5VA 5CIPB 4N68A 3LQAL 1AP2A 3W2DL 4AT6B 1C7TA 3MJGX 1JZ2A 2JJSC 3FB5A 1CDUA 4M1CC 3DVIA 4K3HA 2VLJA 1GAFH 1EXUA 1JJUA 3SKJL 1KPRB 3B9VA 5GISL 1U8NB 4KRLB 5B8CC 1F3RB 1KJ2A 3CX5K 3O2VH 1YJDH 4NSKA 3GHEL 3WFEL 1OSZB 3DXAB 1A14L 4BM7A 1FVDA 3ZKND 1AIFA 3GSNH 3GIZH 1I3UA 1OSPL 25C8H 4HKXA 3NCJH 2A9MH 1R3IL 4Y2OA 5I2IA 2D31B 1DE4B 3OKLB 2FYYA 1VADB 4M1GL 4Z95H 1PW3A 4I77H 1G7JA 3QP3A 1FYTB 4JFQB 3UBXI 4LEOA 3TJHD 5L9DH 2P5EB 12E8H 2OMNA 4G6KH 4JB9L 3JWDH 1YEKL 2BOCB 4HFWB 3VI3E 4ODSH 2VUOA 3BT2L 4WTXA 1MCBA 3U4BH 1CT8A 1BBJA 3SEPA 3B3IB 5HHME 4DK6A 4P2OD 3QCTH 2GI7A 1YNLH 2R0WL 3O2DL 3AB0B 4X6CE 1JPGA 4JE4B 4R9HA 2CSPA 3ZZ1A 2X4OA 2BNQA 2C3HA 3DVNB 5GRVK 2F5BH 4OV5B 4I2XE 2DQCH 4QY8B 5HGHB 3K3QA 1H3PH 3EJYD 3NA4A 1JWSA 1UA6L 2PETA 3LMJL 1HHGB 3NZHH 4ONFL 4YXLL 3LS4L 3AREB 4TUOA 5D7JA 5HDQH 3CFCH 4NHUB 3EFDH 2DQUH 1X9QA 3BRDA 4E0RA 1DLFL 2XOTA 3QI9D 5HYQA 1G7IB 4ZXBC 2ITCA 1Z9SA 2BHZA 4HAFA 4OZFA 1P1ZA 5EO9A 3FT4A 5AZ2L 1I8IB 4GUPB 4KQ3H 4J4PA 5T1LB 3TBTB 4BJLA 3B2UC 2MFNA 4NZRL 2PR4H 1JGEA 3HMXL 2CUIA 2FEDC 3NFPA 3DMMB 4G8GA 1MJ7L 2GAZB 3CMOL 3KS0H 4MLSA 4NP4H 3FQWB 1JUFB 2GK0A 3ZTJH 5T5FL 4UQ2B 4XTRC 5ALCL 3W9EB 1T2QH 3R06B 4CADA 1SJVA 5DQ9A 2GSGA 1HH9A 1T22B 4MNQD 4QYOA 4QRRB 4PJ7E 4IHOA 1U58A 4Y1AD 1HILB 2AJ3A 1ZA3B 5E2UL 1A6WL 5KJRL 4OAWB 1AQKL 1LK3L 2BDNL 3PDOB 4IIQA 4JZJC 1TPXC 4ZFOA 1FC2D 2R0ZL 5ANME 4JRYA 5T3XD 3AC0A 2AXGA 3LOWA 2BVPB 1WAAA 1U8OB 2VDPH 1CG9B 3CFJB 3MA7B 5I74C 1S7QB 2F5AL 3V5KA 5D9SB 3ROOA 4KKCD 4IRSB 2FX8L 4AJ0A 3BPNC 4YBHA 4KK6C 4R26L 1C5DB 4JDVA 3TBYA 1RMFL 3PWNA 3P4OA 2FZ3A 3TV3H 4AZ8A 5JNYA 1TCRB 4R4BA 3QDHA 1DQLL 4M61A 2F53E 5D5MB 4TRPL 3G5YB 3U48A 4Z7OE 4XP6L 4BSVB 1CE6B 1ES0A 4KY1L 1AC0A 4FZ8L 1NLBH 3EDFA 4C54A 5JHDB 1A7PL 4BA8A 5J06A 1VKXA 4XXDB 3HNSL 3IDYC 3MCLH 5HDOA 4APQD 3IDNB 3STBA 4G6AC 2PXYC 2V7NA 4DGIL 4FQCH 4Z77B 7CGTA 4JVUA 1YMMD 4QKXB 1IZJA 3C60A 5MEPA 1VEOA 3VE0B 5FM4A 1T2JA 3SDCC 4W6YB 1QBLH 4U7KA 1E4KA 2C3GA 4FZEL 1UEMA 1BFTA 4P2QD 1VA9A 3H0TA 2XTJE 4KGLA 3D0LB 4JG0L 4P2YA 2OL3A 3OJDB 3W0WE 4RQQA 1C8PA 1WC7A 1SM3H 2C9AA 2HFTA 4KQ4H 4LRNH 5F1KC 3QFDB 2IH1B 2DB8A 2DQGH 2J12B 5IESH 4ACPA 2GEEA 4KV5E 4ZPTA 3ALWA 3WS6A 3WFZA 4Z7VB 1ZS8B 4O2CB 4KTDL 4DN3L 1S7SB 3WMSA 4XWGL 3SE4A 2YWYA 1G0DA 2AK1L 2BVYA 3X13A 5I18H 4WW2B 3V6FB 1PG7W 1WZKA 4ZUSA 3JV5A 4H0HB 2VH5H 3G5VB 1AP2B 2FECL 3VI4E 3B9DA 3KPRE 1ZT1A 5DSCA 3FB5B 4WY7H 5I1CH 1T7ZA 2VLJB 3HI1A 1EXUB 2HJKB 4CU7A 2UZIL 3NFNA 4N5ED 1LGVA 3L3HA 2YR3A 1KJ2B 3MUJA 3QDME 4OCRL 4PP1C 3RA7L 3U7YL 4NSKB 4ELMA 3T0EC 1K9TA 2D3VA 4UIMA 1YPZA 4C4KO 1FVDB 1AIFB 4PD4K 3U30C 4HKXB 5I2IB 4MXVE 2FYYB 5EWIH 5I73B 1JE6A 3PL6D 1G7JB 4LEOB 1S3KL 1I9RL 2GYSA 4LCCC 1D5ZA 1HI6A 4ISVA 2EXWD 2XRAH 3HUJA 4M6OL 5IBTH 1XMWA 1MEXL 1CLZL 5IF0B 2IAMA 4BZYA 4KAQH 3WEXA 2KQMA 1XR9A 1IJ9A 3SY0A 4GSDL 1NUDA 2WMPA 3ZDZE 1CT8B 1BBJB 5LCVL 4L3CA 4A2MA 4I0PC 3MV01 2VLKA 1JPGB 4FQ1L 5EUKA 1DEDA 4FG6C 2X4OB 5IQ7L 2BNQB 4G6FD 5JW3H 2J8HA 1F97A 3H9SE 4NOFA 2ARJA 2YD8A 3ZKQD 4C56D 5FHBL 3KS0J 1JWSB 3DLQR 4UV7H 3TYGL 2A1WL 4TUOB 4WFHE 2ZCLH 5D7JB 5F96H 2O5ZL 1ZHLA 3P4LA 4E0RB 2KDGA 5HYQB 1RULL 1CBVH 1JYWA 2X4QA 4JR9L 2W07A 2ITCB 5T3ZL 2AS5M 4ODHH 4OZFB 3HG1D 5GS0C 4K9EL 1LNUA 1P1ZB 4P4KC 1EO8H 3DRQA 1RJLA 3FT4B 5EO9B 5GGSY 3DYMA 4R2GC 3BI9X 4O58H 2ORBL 4FFWC 3TPUA 4PJCF 4D9LH 2VDKL 1NGPL 5ESQA 5J6GA 4R6UA 2OX5A 3ZT5A 1NMBL 1JGEB 2MSPA 3NFSL 2C5DC 1N59A 2BZDA 3MUHL 2NY0D 3LDBC 3NFPB 1YNKL 3OZ9L 2VL5A 3UZEA 5EU6E 5DMJB 1U3HA 4G8GB 4QT5A 2OJEA 2PYEA 4H0GA 3U83A 4RSVA 5DC0A 3MX0A 4OM1L 2GK0B 1E6JH 4M9PA 1QFUL 4MS8C 4CADB 3CLEL 5DQ9B 2GSGB 2I25N 1HH9B 4FTVD 3F7YA 4QYOB 1YQVL 2NCMA 3KXFA 5GGVL 3GBLA 4IHOB 1U58B 2NY1C 4KK5D 5JDJA 4HC1H 4OCNC 4U1IA 3UTTE 4IIQB 4ZFOB 3C09C 4TUKH 3AM8C 1PG7L 4JRYB 3WLWC 1RQ5A 2J6EA 4OM0H 2D0FA 2AXGB 1OL0A 4HEPG 2DI8A 4JFPA 2ZPKH 3X17A 3SGDI 2FWOB 1BZQK 1RUMH 4XVUD 3G9VA 3V5KB 3BD4A 1I4FA 1NCBL 3ROOB 2JIXA 4JDVB 3TBYB 3PWNB 3P4OB 2FZ3B 1ITCA 5AZEL 1BIIA 4O02L 1EJOH 5JNYB 1XF1A 1KTDA 2VZ1A 4ZAKC 1MRFH 4PP2A 5T1DL 4M61B 1WZ1L 1AXTL 1ZT7A 3UDWC 3MLWH 4E9LA 4FQXC 3MFGB 3QIUC 1K6QH 1ES0B 4Z0BL 5J3HD 1RU9H 3ULUC 4LHUD 1VKXB 4LCIL 2QKIA 4ETQA 1V7NH 4R0LB 5J9PA 2V7NB 3QUMH 5F71A 4G6JH 1NGXA 5HD8D 3C60B 5MEPB 3VW3H 2V9RA 3SGEI 3EDEA 1MQKL 3FN0H 5GRVL 4DFHA 3X3GH 3UZVB 4GBXC 4WUKL 4Z7UA 3H0TB 5D7IA 5EZOH 2QTEA 5CP3H 5J8OA 1MVFA 2OL3B 5GJTH 1Z9MA 4UBDC 3BPLC 4RQQB 3UMTA 1WC7B 5IMKA 4M03A 4F9LA 5CINH 3RPIA 4ODBD 1TDQA 3IFNH 3WXWH 2FHCA 4ZPTB 4G8EA 5DJAA 5FUZH 1HNGA 1JF6A 2Z9TA 5GJSL 1RIUH 3OGOE 1BQSA 3P30H 1G9NH 4K94C 2OLDA 4OF3A 3X13B 3RTQD 4WEMB 1JP5A 4M6NL 4JY4A 2IBGA 4ZUSB 3WJLC 5LAXA 4RISL 3OB0K 5KVEH 1A6ZA 1U3ZA 4FNLL 3DPBA 3GM0A 1ZT1B 1RZKC 5DSCB 2A83A 1A47A 3HI1B 3CDGA 1NFDF 2YOCA 5K9KA 2FSEA 3NFNB 5FYKE 3L3HB 2HRPL 5IB3A 4ELMB 4PRIA 2JK5A 4UIMB 1YPZB 2R4SH 4NKIL 3FO1A 1MUJA 4ZS7H 4JM2A 1IT9L 1INEH 5KZCD 1X6LA 2VQ1A 3QWRA 5EN2A 2EECA 1ZVYA 5JHDE 5TQ0H 2DICA 3MV7D 1D5ZB 3ZYJA 1HI6B 4ISVB 1FLRH 3HUJB 2O5YL 3VD7A 2OXHA 2RQ8A 1AR1C 4XVJH 5JW4Q 2IAMB 3WEXB 2DQEH 1AKJA 5H8DA 2YPLD 5L6YH 1XR9B 3SY0B 2Q8BH 2AJSL 4LAQH 2C3VA 4J6RL 4ZO6A 2FJHA 1QSED 1J88A 3NTCL 3K81A 1RZ7L 4J7RA 3BGFB 3AREC 3N1PC 3HI5H 3MLVL 1M6OA 3VCLA 3K8LA 4Z7NE 2VLKB 3LIZH 3OX8A 3X11A 2VLRA 5E5UB 2E8YA 5EUKB 1P4IL 2EC9T 2JELL 5F7WC 4PJ8D 3MACL 3KR3L 1B2WH 4OUOA 4G6MH 2ARJB 2B7DT 4YGAB 4DZBA 3PQYA 2FB4L 1JPTH 3KPQA 4HAGA 1G6VK 1BOYA 3BKCL 4U0RB 1UZ6F 1N0XH 3GEWB 3OKNA 4XI5D 3DO3A 2DQTL 1ZHLB 1UM5H 3DMMC 4RGND 1T03L 3NIGE 1MF2H 1MCWW 2X4QB 3I3EA 3JUZA 5CUSL 4HIHA 4M5YL 1LNUB 1MQ8A 3DRQB 1RJLB 3VXNA 2X42A 3FN9A 2EYTA 1BX2A 4P46A 3RAJH 3TPUB 1DFBH 4TSCL 5ESQB 5J6GB 3PWJA 4MLIA 5DR5H 2VLJE 3IJHA 1N59B 4OB5L 3F58L 3VXUD 1SYSA 2VL5B 3NABL 1AGEA 5T1KA 2NR6D 1A7QL 4QT5B 2OJEB 4ZO7A 2QR0A 4OLEA 2PYEB 1AQDA 4L9DA 1CD1A 3V95A 2WBJA 1JPST 3KLHC 1IKFH 1UH2A 1X4XA 5FDWA 1QSZA 1L7TL 3K46A 1QLFA 1KCRL 2DYPA 5F7DA 3BDYH 4GW1A 4LSUH 2MKWA 3F7YB 4XWOD 3KXFB 4S1QL 4S10A 4Q2ZA 2ZJSL 4IRSC 4U1IB 3QZWG 3I50L 3QAZB 3QG7H 1L9NA 4WW1B 3VFGH 1X3DA 2IFFL 5JR1L 5I71B 4PTTA 1ADQH 1CF8H 2BXZA 4OQTL 1KIQA 2IH3A 1RIHH 4JFPB 1TMCB 5DRZA 1BJMA 2X09A 4UT7H 1I4FB 4UOW0 2AJUL 1R5VA 1LK2A 2JIXB 3HB3D 1DBKH 2CKNA 1JHKH 4KZDH 5D1ZC 5ICZA 1BIIB 5C08A 4OCLC 4MAUL 1MFBL 1KTDB 4PP2B 5GGVY 2R4RL 4OKDA 1BF8A 1ZT7B 3FB7A 3PE9A 4PLKD 4JG1L 1LP9E 4DGYL 5I75B 3MLRL 4YDVA 3KLSA 1RFDL 1KCVL 2HKHH 2QKIB 1NFKA 3VFSA 3VXRD 4ETQB 5IB4A 5J9PB 1TETH 2E7CA 4XAKD 3FKUS 1NGXB 4HFUL 1RZJH 4FQQA 1QFWM 1BIHA 2XZCL 1S7XA 3LV3A 2P44B 4M7LH 1CGSL 4YHOH