1XCQA

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
b'DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein C
molecule tags Immune system
source organism Finegoldia magna
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
total genus 42
structure length 220
sequence length 220
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xcqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xcqA01
3K2MC 3I02B 3OKDB 3RJQB 3MLRH 1U8NB 2VE6B 3LEVH 5CD3A 2AV1B 3HZYB 1RUMH 4FG6D 3LQZB 2EH7L 2G60L 4WV1C 5EC1B 2X5PA 2AJVH 1C8PA 4PJXE 4MJ6A 5JMRA 2KBGA 4POYA 1S9WB 1I8KB 4HX1B 1INDH 3RWHB 4J1UA 2JB5H 1H9VA 4NFDA 4LAQH 3NACH 3NCEB 1H3TA 5ID0A 5CSZA 4DKFH 3QXAA 1F6AB 2EE2A 4F7EB 5INDB 4HPOH 4GRMA 4JVUA 4MJ4A 2NY1C 3TJHD 4PJBB 5JW5B 5C0DA 3BZEA 3QRGH 4HULB 1MCFA 4YHIA 5HHMB 3OWEA 4WUUA 3MCKA 3RWFA 2H3NB 3KR3L 4KY1L 3GJEA 3KXFA 4O02H 4WI9A 3VFGH 3UTSE 5GIRB 2DLEA 4NJAH 1AY1H 3O6ML 3A6BH 1F4WH 3UTTD 1CF8L 5IBTH 3WXVL 2PXYB 2HKHH 2IQAA 4Z0BL 5FYKH 1EHLL 2HKFH 3VMNA 3KPQB 1DL7L 2HT3D 4QF1A 1DQML 5EO0B 1DANT 1A1NB 4XBPA 5DD3L 2VLKD 4WW1B 3GSXB 4WI8A 1CZ8H 4HWEH 3AY4C 4PRIA 5FF6B 4WUUD 5MEQB 1AY1L 1BD2A 1QSEA 5GS0D 4I4WA 1L0XA 4PGDA 3VXRE 4GRMB 2D03H 4ZOEA 3QXAB 3HMXH 5GRUH 3HR6A 4LSUL 1WBZB 3EYFA 4OZGB 1FYHB 3SGDH 3HI5H 1PX4A 1G7HB 4HS8H 4AM0A 4MQ7A 4LHUA 5D1XD 4E41B 4R90L 3O6KH 1AGCA 4U1NB 5ALBL 4R4FL 3VFRB 4Z0XA 2CGRH 2UUDK 4G7YH 1MPAL 4LIQH 2C5DC 1J9CT 5C0GB 3SKMA 3QEGL 2NY1D 3TJHC 5GGTL 4WCYH 3IJYA 2O5XH 5AUMB 4P3WA 1ZLUK 3GO1H 4N8VG 3ARQA 4PY7B 4F33A 1KYOK 2R29H 1S9VA 2R9HC 4LKCA 2PF6A 1WZKA 1JFQL 3HMXL 5GRUL 1KLUB 3CC5A 2LU3A 1P7QD 5FDYA 2AS5M 3C2SA 1BFSA 5SWZB 1KGCD 1F42A 1EFQA 2GSIA 5HHXL 1GGYA 3MV8A 1I1AD 1KF9B 5D6CB 2EICA 4Y16A 4R96B 3TT1H 3AGVA 4MJIA 2ZUWA 3MROB 1X9QA 1EHLH 1I1RA 1IKNC 3QUKA 3WO4B 1VFAB 3SDAD 4FQIH 1LEIA 1UWGL 2Z4QB 3OKOB 1C1EH 1JHTA 4HFUL 4XRCB 3A6CH 2SEBB 1RIHH 2XFXA 3IAPA 3TNNB 4P4RB 2DKSA 1U6AL 4JRYD 2P46B 15C8H 2QSCH 4PRIE 3C8DA 1X5XA 3CFKA 3H7BA 4YHOL 2I60H 4G8IB 2EDRA 2J8UA 1G6RH 3FRUA 1HXYA 1LO0L 4CBPA 5E00B 3MQIA 4PR5B 1LWRA 3LS5L 5FECB 4X6FA 4XPBH 4K3HA 1NCAL 5D7JA 3TPUA 1BJ1J 2CIKA 4KKLC 1MCHA 4JO3L 5C71A 4MX7B 3WN5A 3M45A 4HZLA 3BEWA 2PYFA 5EH1A 2IEPA 5D1QC 2R4SH 4U3CA 2E9IA 4M61B 2QADC 5F1IB 2Q7YB 5C0ND 3MJ9L 1K5NB 1E4WH 1FH5H 2P7TA 5I6XB 4N0UE 5DRXA 5FGBC 2EH7H 3N85L 3TZVB 1A02N 1A1OA 4ZD3H 3TH2T 5DJZB 3OJDB 4F9LC 2HJLB 3BKJL 1I9JL 4X5WA 1FL5A 1OARL 1NCNA 3ET9F 4PJEE 4FP8H 1KCLA 4V2CB 4IRSA 3MRLB 3LZFL 4K7PX 5FOJA 5JHDD 1RZIA 1F13A 1DVFA 4XC3L 3VFVA 4QLRA 5BV7L 5CCKL 1KPVB 2E8ZA 3FL7A 2GJZA 1T3FA 1FYTA 4PJGA 3QUXC 4KWUA 1XIWA 2XQBL 4OLYL 1KCRL 1E6JH 4CMMA 3G04B 2BC4B 4XNXH 4Y16D 4JM2F 4F8TA 1FFPB 3TM6A 4N0FB 4WWKA 2GTWA 4FRWA 2OI9C 2ADGB 4X0KB 1DZBA 2QQLL 3WD5L 1XF2A 2WW8A 4QWWD 5AWNL 4BM7A 5D2LB 1T1ZB 1U91A 4IMLB 5E2TL 1TVDA 3PGFH 1I8LA 3L3HB 4JREB 4PJ9A 3QNXA 3PXHA 4X7FC 3OXRB 2VO5A 1ZHNB 1C5BH 2FH8A 4PJ7B 4CAGA 3P4LA 5J1AB 3FKUS 1JV5B 3SE4C 5FCUH 3W9EA 4KJWC 1FL6B 2HLAA 5F88B 4R26L 4F58L 2FEEL 3SKOA 1MQKL 4XMPL 5JOPD 2I9TA 2H32H 1J88A 1T0MA 2NY3B 1FDLL 4HXAL 4FA8A 2FGWH 1ZGLP 1J1OH 5C0BE 3TFKD 3PIQA 1QO3A 2QQKH 2NR6D 1DQDH 2F54A 3QUZA 2ICWA 1Q72H 4G8GB 1FLRH 4XWOC 1X5ZA 1NKRA 1NGXB 3UZVB 4U33A 4NO5B 5F8RC 3DX7B 4JY5L 1BX2B 4JJ5A 2O5ZH 4JHAH 1HXMA 3ZKXC 3KHOA 4PJFB 1FHGA 1EZVX 3IFOB 1CGVA 12E8L 4Q0XL 1TZHB 4TVPE 4Y7MA 4YIQA 2R0ZH 5HVGB 3SE9H 1MWAH 4LU5L 2C3VA 2VL5A 2IMMA 3O3BA 4FXGB 2F74B 4CN1A 4UOW0 1PEZA 2GJ6D 1VHPA 1CCZA 5IVXE 4PJXF 4ESKA 1K8DA 4NN7C 1R3KB 5SWSA 5IMMA 1AIFA 2OR9L 1JL8A 5I71B 3ETBF 1DLHA 1AQDB 4BYHA 4GLRI 4JZNB 7FABL 1A64A 2I5YL 2D7PA 1J5OL 2X4RA 3UO1H 1X4XA 2DYPA 4XP9L 4WFFD 1SJEA 1NDGA 4N0UB 5D71H 5T5NG 1D6VL 1QD0A 4H1LA 4OJFL 1QFPA 1C5BL 8FABB 4RBPH 4I3SH 5DFVC 1M7IB 4KVCL 3FFDB 3MRKA 2AJZB 1PZ5A 1ZEAH 2KZ1B 3VI3E 4OZHB 2HG5A 4Y1AB 1CD8A 1DQLL 4E5XB 4ZPVB 3MZGB 2NCMA 1E6JL 1FCGA 4JO2H 3ULVE 1VFUA 4U1JA 5BS0A 2GJJA 3EO9H 1NUFA 4JFOA 1IGJB 2DL9A 3D3VE 3SPVB 5FO8B 5CBEB 5IUSA 2OXGA 4JANA 2ADJA 4L8SC 3ARDC 3SKJH 1M7XA 5DUBA 4X6BB 3GM8A 4ZS6C 1I8LC 3V79C 3O6LH 3O4OB 3HC0B 4G8GE 2VH5L 4LSPL 2I9LA 3GBNL 2AJUH 4DVRH 1CXHA 3PWPB 3F7QA 4NWTL 3WL9B 4YQXH 1NCCL 5I30L 2ZUTA 3TA3D 5DJDB 1DBBH 1NMAL 3HI1B 1A5FL 2BJMH 3HRZB 4IIQA 3DO7B 3JWDC 3S35X 5E8OA 1XIWD 3C5JB 4L8BB 4XH2A 3V0VA 4ONHA 1MJ8H 1ODAA 2Q76A 4PBVC 5KAQF 3IGAA 4JZJB 1YN6A 1K6QL 4ONFH 1K4CA 4E42B 4YX2H 3BIBX 3IDXH 1ZS8B 2HT4D 2C3XA 2F8OA 5CHNB 1AR1C 1S7WB 5BO1L 3C60D 4L4TD 3RY4A 5LKNA 3MR9B 3OXSB 4LOUD 1NUNB 4FQCH 3HNVL 5ANMA 1F45A 2WUBL 4LU5H 3QNZB 5GZND 2B8OT 5IB4A 1H15A 2ZCKL 4EUPA 2EDDA 2JJVA 4Y8DC 1U8IB 1S7QA 4XNMA 1IJ9A 1BJ1H 4PRDA 3ZYZA 1YEFH 2DQDH 5HHVL 2J6EA 5GSVB 4OLUL 4OD3H 3AY4A 1FFOA 2BXYA 3QXVA 4Z7VF 3UTOA 3E1F1 1YMMB 2IFFH 2UWEA 4YBHA 5DC9B 4NQEB 3WN5C 4P5MA 1FNAA 1G7PA 5CINL 5DR5L 3KPNA 4L3CA 3T1FB 2P5EA 1I1AA 1UZ8B 5IOPA 3JV4B 3NCFB 2DIBA 2AK1L 3TO2B 1Q9WB 2EDFA 1YQ2A 5EUOA 3KPSA 3L3KA 4IRZH 4MB5A 2BHZA 2GW5A 4C83A 3RHWF 3I6GB 5GSRA 3V4UH 3RY6A 4OD1H 2WWKT 4JY6B 3FQXB 4LCIL 4HG4K 5HD8C 3INUL 4XVSL 5TH2A 43C9A 2R29L 4KTEH 3T4YA 2HT3C 4F3FB 1DTUA 1DEEB 4KMQA 3CVIL 5IMKB 2BRRL 5ACMA 5TE7H 4LSTL 3MBED 2P5WE 3QEUA 3QPXH 3V7AG 4JKWA 3QNYB 1F8TL 2H32A 1PKQA 4LCCB 3C6SA 3C5SB 4TPRL 4MCZB 1HQRA 5DJ6A 5FFLA 4R90H 4HXBH 2OR8A 3MJ7B 5BVJA 4NQSB 2MMXA 2F15A 1HNGA 1FNSL 4FTVD 4NUJB 1XGRA 4Z7VE 2J5LC 1N8ZA 1T20B 3RVUC 1AKJA 3OAYH 2Q76B 2X4SB 4NO3A 4NBYB 5CGMA 3UJIH 2FBJL 2J8OA 5SV4A 3X3GH 4PJCB 5E8OB 5IBUB 4PRHA 3QIBB 2DM7A 3MRMB 5DMGD 2OP4L 3QFJE 4M4RA 3QZWA 4OLWL 4HMDA 5K9KA 4YC2B 3BPLC 5A2LH 1T22A 3NH7H 4D9QD 5J13C 3NCBB 3KPMB 1FH5L 4ODHL 1ZHLA 4PJEF 4CN4A 4Z7UB 3O2WL 1ROWA 2BNQB 5J12B 4R0LA 2YKLH 3NH7L 2F5AH 1CF8H 3EO0B 5CIPB 4HIHB 3W9DB 1A4KB 4W6YB 1L4IA 3UJTH 1HCFX 2DQHL 1FAIH 2LV4A 2RR3A 3HI6H 2EDXA 4UI2A 1TITA 4LPYA 3HUJE 5HHPA 3IRZA 2VTFA 1QBML 4NZUL 4JFEE 4F37F 1D5ZB 3MLYL 1ACYL 4GG6E 4QRRB 4S1SH 3ULSB 2XWTB 5EBWA 1RQ5A 2X4QA 5D1ZA 5JO5A 2HFGH 4NC1C 2AJZA 3VRJB 1KIUA 3PWPE 4LNRB 4YHOH 5E70A 4YAQA 8FABA 4NQTA 4OFIA 3DWTA 1I8MA 3NFSL 3D39E 3ARFA 3CLFL 1KB5H 3KYNA 4TQEL 3QEQA 4TPRH 4D94A 1CDBA 1NSNL 1FNLA 1L0YA 3AMKA 3PJSA 3U9UA 1F6LL 1ZVSA 5ACZB 3RDTC 2BY1A 3L7FA 5F97E 1ZLWK 1IAIM 4TNWK 5KW9L 3SE8L 3GK8L 1Q1JL 2VZUA 4Z7VA 4IOSD 3SO5A 2ZOLA 4HUUA 3T1WA 5L0QC 3DURB 5HYIA 1NH6A 3MRQB 4N8CL 1RUML 2Z8VC 4O51B 4N90E 4CMHC 5DT1H 1P1ZA 4L29A 3MCLL 4DQOL 5BW7C 3BRFA 3U7YL 1S78C 1X5AA 3C08H 2GTZB 3GSUB 4BSWB 4OCXH 2E7LA 5DZOA 1XF1A 3QIWC 2B7DT 1HXMB 5E5UB 2ZNWA 1XZ0B 4P2CG 3S3JA 4M8QA 2PCPB 3ULUD 1JIBA 3MTRA 4S10A 1FO0L 1LK2B 4EI5B 4LNRA 2J4WL 4NQUA 2YD8A 1UM5L 4NHCH 1S5HA 3PQYE 3GRWH 4M3KB 2FX7L 5KS9B 5I1DA 1WAAF 4DW2H 5HHPB 4GRWH 5HHOA 3HUJA 4JR9H 2VZ1A 1JWSB 2EDYA 2A6JA 2OZ4L 1DE4A 3HI5L 5ERWB 2VLJD 3MLSL 1QRNB 2XWBA 1J8KA 1NLBL 2PO6D 1C16B 3JZ7A 1DQJB 3LN9A 3ZKMD 1KFAH 4JN2B 3RTQC 5LWYH 1DDHA 1P7KA 3O9WB 4GAYB 2BZDA 1U91B 4YNYB 2R2EA 5DK3A 3QWQB 1UB5A 4N1HB 4P46C 1YNTB 2GHWB 4U6VL 1BOGA 2F5AL 4MXVE 5T1MA 5BXFA 1TETL 1LEKB 3AREB 4I18C 1CBVH 4K9EH 4AMKL 3ZKND 3Q6FB 4OUUB 1XIWB 4F7PB 1NCUA 3IB4A 4WW2F 2GJZB 4PLOB 4K71B 4OT1H 2GAZB 5K59E 3V4VH 1UYWL 3WKMH 2MPAL 3GIZL 4L3EE 3TEUA 1H3PH 3VRLE 4EOWH 5SX4H 1YEJL 5DRZB 5D7LD 3RUGF 1FORH 1M05B 1TZGL 3DRTB 4JRYB 5INCB 4WW2B 3VFWA 4TSCH 1U58B 4L1DA 4DCQA 4HXBL 5E5MB 1A1OB 1YYML 4OLZL 1F2QA 3OX8A 3NIGE 5E9DA 2Y5TB 5HJ3B 4JFDA 3SJVD 3FQWA 1EJOL 4G80A 1NANI 1XT5A 4KVNH 4DGVH 3DXAD 3OAZK 2E6JA 4FFWC 4K71C 3P73A 5I9QC 1W72B 1A8JH 3TO4A 3O4LE 1N3NA 1MJ7H 1ZEAL 1IQDB 4ZPTB 4LSTH 3QQ3B 4JY6A 3E0GA 2RGSA 4LEXL 1YC7A 3GB7A 4LVNC 3SGJC 5HY9A 1SMOA 1GGBH 5HHOE 3TPUB 2FHBA 3O2DH 4NQVA 1U8HB 1JUFA 1RJZB 4Q9QH 5FECA 1CFBA 2FJHA 4PLJC 2I07A 3DSNA 2LU4A 1QKZH 4QXTB 2FECL 3MACH 4XPAH 4MNQB 3ILQD 1CXKA 4OCRL 1JF6A 4IRJC 1UCTA 4KTDH 3DSFL 3EYVA 4BELD 3FTGB 1NBZB 1VFMA 1OHQA 3TNNA 3D3VD 5FHAL 2J2ZA 2YPLB 3PF2A 4FQHB 1NAKL 1MCQA 4KI1A 1MWAL 2EIZA 2YXMA 3IS0X 1KENH 1FGVH 3GMNA 1CT8A 1XF3A 1CXIA 3N1PC 3ZHKA 3ZO0A 4AENA 2DBJA 5IEKB 5IB4B 4XWGL 4X5XB 5T5FL 4MWFA 5F6IC 4M5YH 1LNUB 3MXWL 1MFEH 5FGBA 2CDFA 2NW2B 5GRWA 4JHAL 2EYSA 3MR9A 3OXSA 3QI9C 3BUYB 1BFOB 4JY5H 4QXGH 1D5MB 1FE8H 4GRLD 3ZTJH 4WO4A 3G5XA 5EUKA 3UXFA 3GZKA 4YUEL 2XTJB 4PRPA 1OVZA 4K94L 1EEZB 3GSWA 3DI2B 3W11C 2JIXA 4EUPG 3CXHJ 1UM4L 1MI5A 3MUJA 2APFA 4JKMA 4EEEA 2GJ6E 5EZIL 1MSPA 1HHKA 3HI1A 3ZSTA 5TE6L 2OL3L 5KS9E 3AU1A 4UNUA 2P5ED 2XIDA 4MVBD 5ITFA 4POZC 3UCRA 1F02I 2YWYA 3VFRA 1PYWA 5JOFA 2OK0H 3IF1B 3MCG1 1RJLA 1NFIB 4X6BA 4MQ7B 5EU7C 5T3XE 5T3XD 5DRWA 5FHBL 3E8UH 1F2XK 4RISL 5FO8A 4F9LA 5HI3C 4LARL 5CGTA 4FN0A 1FPTL 1PGRB 5EO9A 2VH5H 4QRQA 4LDLB 5FGRA 3O11B 1GHFH 4MSWA 4OGXH 4L8DB 4UILH 1HKFA 3NTCH 4M7ZC 4LKXA 4OIBA 25C8L 3WFHA 1NAKH 2CDGB 1U3HA 3RRQA 2A38A 4MYWB 5EBLB 4NZJA 2YSSA 3C6LC 1HOCA 4JHWH 1KNOA 3E6FA 4NRYB 4OCWL 5GS3A 4PJXA 4X6CE 1F58L 1P5VA 2ZCHL 4OI8A 3TBYB 2VSDA 2FIKA 2F8VA 2EXWC 4DEPC 4P4KC 1ZHBB 1P4LB 4V2BA 1D6VH 2VDNL 4RGNC 4KRPD 4RAUA 3VDCA 1PG7W 4I3SL 1AQDA 5BV7C 3CVHL 1TNMA 2DL2A 1X6LA 3BPLB 3PWVA 1G0XA 4DVBB 2IF7A 1R3KA 5F7LB 1Z2KA 1G7MB 4OZFA 1T1WB 4U1KA 3DUUA 4MNGA 3HMWH 4Y5YC 2Z35B 1NC2B 1X5FA 3UDWA 1EAJA 5B8CB 2YR3A 4QYOB 2HTKC 5C0BB 3MBXL 4IJ3C 3T3ME 4WTZA 4ZO8A 5CJXA 2GY7B 2BVQA 1U95A 1U93B 3LEXB 4F2MA 3KLAA 3JWOL 4K3EH 1XCTB 4PTTA 5EN2B 4GAFB 1HINH 2NZ9D 4PG9A 3ARWA 3AB0B 1I1FB 2FD6L 3H3PH 1J11A 4BZ2L 1BWWA 1WT5C 4WENB 4JJ5B 4L8SB 4MZ2A 4C56A 4NCC2 3VGFA 4Y5YB 1QLEH 3TT3H 3BQUD 5GGTA 5KSVB 3G08B 1TVBB 2DLIA 5L2JA 3QJFA 3O4OC 5IW6B 2VITA 1QYGL 2XTJC 3GSVB 5DQ9B 1KTRL 1CBVL 2ZSWA 3AS1A 4JGUA 4P2QB 3BDBA 3OKKA 1DQDL 2W65A 1BD2E 3E6HB 2OM5A 2VUYA 3B4NA 2I9TB 1NEZA 1VEOA 3PQYB 5TDOB 1JNLH 5IQ7L 2ADFH 1II4E 4RAHA 1CXLA 5HHXH 2DQIL 5I16A 4Y4HC 2NTSP 3C5ZB 4U6YA 3T2NL 3QIUC 1FZOB 2V7HA 2XKNA 5LJYH 5F9WB 4RX4D 4JRWA 3EYUL 3IYLW 4YXKL 1YPZF 4PRAB 5EORL 4YDIL 4ORZC 2FWOB 5E2TH 3T3PF 2X42A 1KB9J 4P2YA 3MV7D 4NJ9H 3X13B 1GZPA 5GJTH 1F4XH 4NT6B 3U0PB 2R2CA 5FUOH 4GKNA 1I7TB 1IM3A 3IRPX 1X5IA 2UZIH 1L9NA 3S3PA 5E5RB 3T0EA 1RUPL 2AJYL 1TJIH 4Y4HB 1YY8A 3CUPB 3HC3H 3PL6D 2DS4A 3FQTB 5E03A 4M6AA 4XNXL 2Y7QB 4NNXB 5J13B 2EDJA 3DARA 4MLIA 2ZKHH 3GI9H 4GW1A 4PB0L 1DUYB 2WINA 2C4XA 3RWDA 4DZBB 2X09A 3NA9L 3S37X 4HCRL 4D9RE 5FB8B 5GGRA 4P0DA 2FB4H 3VFSA 1H3VA 2YN3A 1OLZA 1BBJB 5GGUB 5IVZB 3RBGA 1H0DB 5I66A 1OARH 5EIIA 3QUMB 4KUZH 2NXYC 3PGDB 4KKAD 1ZLVK 3MLPA 1A3RL 5F7WC 4S1QL 4ELKA 2GUOA 1KGCE 1INQB 4YWGL 4HK3N 4MAUL 3TN0D 3BW9B 3Q5OA 5IFHL 1FVCA 5DFVD 3S9DB 2EYRA 2X9WA 3TWCH 3L3GA 3MBEA 4K9EL 2P44B 1FVDB 2PYFB 2VAAB 2EYRB 5F7HA 1FVCB 4LLQB 1T5XA 3TIDB 1P84K 3M8OL 1K4DB 5D7SL 5D7JB 1ORQA 2VNCA 3LHPH 3B5HA 1NAMA 3H3KA 5C1MB 4OTXL 1N6QH 1KELH 4OF5A 3QPQD 4PV9B 4G8IA 2ZSVB 3MUHL 1UXSA 4QRUB 1HQ4B 4OZHF 4UNTA 1IM9A 4L4JA 4K7PH 2CRZA 1OSPH 4NNXA 4N90D 2WANA 3RX5A 2CKBH 4EIGB 3CFDB 4PGCB 4UAOB 2VDOH 4LMQI 1U2CA 4NN5B 1XGQB 1FO0A 1UM5H 4X7DC 4ZAKD 4OBSA 5KSAA 5J6GA 1KT2A 4B41A 2J4WH 1IGFH 2Y6SD 3ALPA 1MF2H 2NXZB 2ZNXA 4PLKD 3TNMA 2QSTA 4JG1L 1YJDC 1BVLB 4UU9B 1PZUB 1ERNA 4OCXL 3O6FA 4HMEA 1CR9L 2PKDA 2ZPKH 4OD2A 2E27H 5LG1A 4PJEA 4BSVA 2EDTA 3C5ZA 1JGLH 3RA7H 4JPIA 4O2EA 5EZJB 1A7NL 5B3NA 4MXWH 4YE4L 2QEJA 1GGIL 4PS4L 4KU1A 5JZ7D 4DJMA 2FL5B 4BQBA 2EE3A 1RUAH 1T04B 4LCWB 6CGTA 5D7LA 4P2QA 4X9HA 1NCBH 4GXUM 5AUMA 2N1KA 2NNAB 3LKNA 5IJKC 2X89D 3KGRA 1FO0B 2XTJE 1AC6A 4CGTA 5I18H 5JIPA 1GXEA 2RJMA 5JA9A 1J05B 3EOAB 4A6YB 2R9HD 4RMRA 2VAJA 3NMEA 1MEXL 3A67L 4M1DH 4OQTL 2W9EH 4P3CH 4EI5C 5C0JB 1Y0LA 3ARBA 4W4OA 2WUCH 5DUPH 5E2VL 4NGHL 3VXRA 4GKOA 4A2LA 5IG7A 4QRTA 3ARRA 4L9LB 2Z91A 3BPOB 5A40E 3FO0H 1WCBA 4HUVB 1FG2B 3I2CL 5EORH 4I4WB 3CLEL 3DUSB 4NYLA 2WBJB 3TIDA 1KIQA 4HIXH 1EHXA 5GGSY 1KCVL 3ULUF 2B20A 1BQHG 2VMFA 1W8NA 2VISB 4JVPA 1A1NA 3STBA 4LCUB 3GKWL 4ZFGH 4RFNB 4ZXBD 1CE6B 3V0WL 1FNHA 4XNYH 3ARSA 1MH5B 3EW3B 3TA3B 3BN9C 3S4SB 4QNPF 2Q20A 1FC2D 4MS8C 4ZQKB 3RGVB 2P8MA 1F4WL 5E56A 5GRJL 5D1XC 1LP9E 2NTFA 4DZBA 3LDBC 4P2RD 1VGKB 3BP5A 4GW1B 4LFHG 1BREA 1YEKL 2GFBA 3RZCC 2A6IB 5J8OA 1IC4L 1DJSA 1G9NH 3RVUD 3MRHB 1OAXL 3FZUC 4FMKA 2XPGA 2QHLA 1OPGH 4PG2C 2Z8RA 3QQ9D 3U36A 1NC2D 1XH3B 5HHQB 5IFJB 4NSKB 4MNQE 1A7OL 5JR1H 4Y4FD 2VDRL 3LV3A 4R8WL 3LRSB 2OTUB 2H2SD 3OZ9L 5ID0B 5BO1H 2JCCA 1J1XL 4ZFZB 1CE1L 4NFBA 4LBEB 3RWHA 4V1DB 1S9WA 4UB0H 4LLDB 3VXTA 2DIJA 2E6QA 4LMQE 4R9HA 1PYWB 1ZT7B 1T1XB 2AEPL 3FB8A 2A6DA 4PJGE 4R2GC 1JPTH 4WFGD 4G43B 2HJFB 3RAJH 1G7QB 2MSPA 5BRZE 4KTEL 1A3QA 4I3RH 4TOYH 1QR1A 4JFEB 1X5HA 4DN4L 1OQXA 4PJHB 2ZSWB 4G8GD 2X05A 4PGZA 1G7QA 2FCBA 1OM3L 1IGTB 2QR0B 4CVZA 4HEME 2GSGB 4FTVE 1JZ8A 1KLGA 2YEZA 4ETQB 2YMXL 1LE5B 3SKJL 3I75B 1E6OL 1FFNB 5IFAL 1LE9A 3T3PE 1R6VA 2EYSB 4HQQH 3F7YB 2YA0A 1BVKB 2F54D 3QUZD 3LRSA 3TO4D 5I8CA 3ZDXF 4DGIH 2VQ1B 4F2MB 5GS2H 4LOUC 2DQGL 5GHWL 3QFDB 2P24B 2VKXA 4AT6B 1A47A 1HSBA 3IXAB 4HWZB 1V05A 3S36X 3DJ9A 2V5RA 5CP7B 2K7QA 3DUUB 4HWUA 3ISWA 3BP5B 3GMPB 5LGKA 3LRGA 2IG2L 1LO5A 1UJ3B 2WAHA 2ARJQ 3LS4L 3KDMB 4RFNC 3AMLA 4ODTH 5I19L 1T2QH 3P30L 4XNZB 3T2NH 2ERJC 4TULH 2Y06L 4ZO6A 4G6MH 2Q86A 3HC4L 1OY3B 3RU8H 2MQ0A 1P4LA 1I9RH 1CFTA 5E08H 2JCCE 2ZCLL 2FIKB 3TBYA 4EBQL 4RGND 3FCTB 3KYMA 4ODBD 2CQVA 4UDUB 2X4TB 3TH4T 4LCUA 3CGTA 1MCSA 3AXLB 4W4OC 3MLZH 2HRPL 4KDTA 1I7ZA 3MRBA 3UYRH 1A5FH 1N3NB 2BJML 5F7EL 2XZQL 1JI2A 5C0EB 2YPLD 3DROB 3EFDL 3DUSA 3UAJC 4LKXB 2A77H 1OSZA 4HUVA 4PV8B 2AVGA 4WTWA 1DBML 1DEDA 3TV3H 3OX8B 2B2XL 1A3LH 3B8YA 5I1IH 2FD6H 3H3PL 3PP3K 4PLJD 1XF4B 5FUZH 2BOCA 4UBDD 5K9QG 2ID5A 4IDJL 4CN6A 5C0JA 3OSKA 5I2IB 1AFVL 1KJ3L 1UQSA 5SWZE 2C1PB 1FZMA 3KS0H 1DQLH 3VFPB 1R3JB 5DZNA 5GZOD 2E7BA 3BQUC 4P5TD 3WJLC 4EJ1C 5D70L 5DUMH 5DVMA 4EUPH 3NFNA 1U8JB 4LCWE 4D8PA 2EDBA 1FRGH 2MOVA 4U1MB 2ORBH 1TZIA 3B5TA 4KHXL 1R24A 2X1QA 4L4VA 1X7QA 4Z8FH 4M7KH 3BEVB 4LLUA 3BESR 1G7IB 5FKAA 2VDNH 4NC0B 4YNYA 3GHBH 1J5OH 1WC7A 2FLRT 1EAPA 2IANA 4H5SB 1IAOB 5EZLA 4ZDHB 2E3VA 1W8OA 4JRXD 2NW2A 2CXKA 3QDGD 4PJBF 4YGVA 4BZ1L 1NDMB 3AM8C 3TH3T 2AV7B 5D72L 3JV6A 4U1IB 3IDMA 4J6RL 1IGCH 2VDMH 1UACL 1U92B 3OBAA 4UOW1 5KJRH 3BKCL 3KPRD 5HDQL 3L3DA 1T21B 5EIQA 2IPUG 3MLXL 5D5MF 4GSDL 5E6IB 3FTGA 1JI1A 1RIUL 3V5DB 1ZVHA 4E0RB 2ED9A 4RISH 3BP6B 5SWQA 5DEZA 3RY5A 3V7MA 3OKLB 1GOFA 1G1YA 4N5UA 4PJ8C 5F1KC 1OAZL 4NQED 5ANME 4HJ0D 2KUTA 4JM4L 3VXUB 1KB5B 3QG7H 5L6YL 1A4JB 1JUFB 1NAMB 1WJ3A 1MJUH 2IPTL 4PGEA 5CFHA 1PEWA 1AJ7H 4WEUD 4JFFD 2DRUA 1UB6A 1NGPL 1S7UA 1S9XB 3RNKA 1S7TA 3WS3B 4C59B 1KC5L 3QIUB 4X6DF 4Z7VB 5AYUH 3MBEB 4HF5H 3ARGB 4XVJH 1RIVH 4F9PA 4XPTH 3B6SB 1G7LB 5DMYA 2HFFB 1VGEL 3P30H 3SGEH 3BW9A 1JNJA 4OBRA 3C60B 3QO1A 2BY3A 5HYSA 4Z7QE 4XPBL 2GCYA 4UQ2B 4YXLH 2O93L 2IALA 5C08E 5EFIA 1HI6B 3DVIA 4MAYC 5F7YC 1U2HA 3GSOA 1BM3L 2X2YA 1M05A 3L7EB 3FAXA 1I8MB 1CICD 3BVNA 1RZJL 3BPCB 1FZKA 4MD0A 1WFNA 1KBGL 4P3DA 3RZWA 4X4YA 3CUPA 1NLDH 2HP4A 1A21A 2UV3A 2XWTA 1JHLL 3O2VL 4LP4A 4O4YH 5EBWB 5FM5O 3VG9B 3QR2A 2MCPH 3BO8A 1NCWH 5DDHA 2D9QB 4K3JH 1CI5A 4X99B 3PWNB 3V52L 4PRID 3TC9A 4KTYA 5DT1L 2VXQH 3L5HA 3BWUC 3MGTB 2XYCA 1TENA 4Y4FB 1JZ5A 2DF3A 2ENYA 1I7UA 4N8PA 4WHTA 1MHPH 1WF5A 5CD5C 4OF8A 2Z9TA 1DDHB 1GPOH 1ZHLB 2NY5H 3QCVH 4MDJA 1I75A 2Q3AA 3HB3C 3REVB 3BX7C 3NCJL 2Z92B 3LKQA 3PQYA 3WNPA 5DURD 5EOQL 5KZCD 3O3UN 1V7MH 4WI3A 5HHOB 2W0KA 3ULVF 2A83B 2NPLX 2W07A 4RWHA 3VD4A 5I1DB 4Y2DC 43CAA 4RCAA 4EXKA 5IW6A 1T66C 2VABB 5EULV 3U0TB 4IBLT 4X4YB 4BFIB 1AHWB 1GL4B 5EA0H 1Y18B 1F00I 1MNUH 1QFWL 5HSFA 5E6ZA 4Y5YA 1JTOA 4R8WH 4UMGA 3WFBL 1G6RL 2VJXA 3SJVA 2DOCA 2W0PA 1XZ0A 5KANG 3ZT5A 4JM2D 5H8DA 2B4CL 2YUWA 4HGWB 1A1MA 4MA8H 1YUHB 2HWZH 2EDOA 1UH2A 3VH8G 3Q5TA 3ZSSA 2XZCL 4WDIB 1NEUA 4PJ5B 1TQCB 1XCQB 1V3KA 4ZFOB 1R3LA 3L3IA 3GUTA 1DLFL 5L7XL 2NY7L 2UUDH 2EXYC 3RNKB 3CSYA 5A16A 4GBXB 5LAXA 5IB1B 5IMLA 3HHRB 3MRCB 3VWKA 3NA4A 3HNSL 3KPSB 5LXGH 3LOWA 4ZFGL 5FUCC 4AEHH 4OF3A 5DD5H 2OR7A 2WM0A 1PLGL 2VXVH 4HLZH 4L3CB 4Q74A 2PTTB 5GRVL 1TIUA 1P4BH 4JRYE 4M62H 5EU6E 3H0TB 3RNQB 1CGSL 4Y4KB 5HDLA 2NY5C 5BZWA 3WHE0 3FN3A 4FZ8H 4OZHE 2BNRA 4X5LA 4LVNB 4YK4B 3W39B 2JLLA 4CDHA 5GGTH 2DQJL 2YRLA 5GSVA 5HGAB 4ORGA 7CGTA 1UKQA 3MO1A 2CDGA 3P9WB 5HGBB 1AD9B 5FGCB 3D18A 1BEYL 2A1WH 2BMKB 2DDQH 1RULL 1ADQL 4NM4H 3FB5A 2NY2B 4OQTH 1A4KA 2BOBA 3ECBA 4HK0B 2C7UB 2R1WB 1KIPB 2FZ3A 4PIRF 2EO9A 3HE7A 3EO0A 4UINL 4CADB 4EDXA 3GRWA 2P49B 2BNQA 1FAKT 4R7NB 3M1BB 5JOFB 4KGJA 5F9AC 3ZE0F 3VW3H 4LLUB 5MEPB 1LGVA 3I84A 3IDGA 4P2QD 1KTDB 5DD6A 4MDIB 1AXTL 5EU4B 4OQ1A 1OWRM 4LCYA 1JYNA 2Y72A 5C09D 3C5JA 4ZXBC 4EN3A 4I18B 1ES0B 3BZFB 3NCYP 3F7RA 1KCSH 5IW1B 4DFIA 2ZPKL 1R3HB 3V5KB 2W60B 1R3JA 4KAQH 1MF2L 5IK3A 3ZKMC 2A2QT 2W9DH 3O6MH 4RGOL 3VFOB 4OD3L 3RKDC 4RA0C 1U8PA 4S0SD 3MOAL 4XX1E 2EDLA 1BFOA 1CL7H 4CADA 4OV5A 1RURH 2AGJL 5A3ID 4WW2C 2ITCB 1XF4A 2J8UF 1OAYH 3GMMA 4ZMAT 3QQ9C 3DXAB 3ULVC 3RX7A 3QNYA 2BMKA 2VZTA 5JDJA 4FQJH 2X40A 3D18B 3P11L 2DLFL 5EU6A 1XF3B 3G9VA 5IROC 4EQ3A 1FSKB 4NBZB 4OFYD 4OZHA 4HPOL 3S96A 4X80H 5TH2B 5IB5A 5I73C 3NIDF 5IB3B 2YXFA 3I9GH 4G3YH 1ZK9A 3FCTA 5F7UA 1NDGB 3CX5J 4Q97A 5EUOB 4R2GD 2NY6C 4HKBB 1IZKA 4URTB 4H8WH 2XKUA 3P9MB 2B1HH 2P5EB 4M93B 1RMFL 2EECA 1S7VB 1UZ6F 3WEXA 2AJUL 2JELH 2BNQE 4KRPC 3MRGB 4LSPH 4DGYL 4FFWD 3VXSA 5EB9A 2IGFH 2DLTA 2CRMA 3UDWC 4FXGA 3A6OA 1EH9A 4QTIH 3S36L 2H1PL 1BQHB 5ICXA 4ZAKC 5DK2B 1W72A 1P6AB 2OSLA 2Y6SC 3G6JF 2FX9H 2G75B 5JQ6H 4HCRH 3WNOA 2CK2A 2Y5TA 1CLCA 4LLWB 3IFOA 3DXAA 4GJTB 5EU6D 5BW7A 4PJ8D 1BVKA 1RULH 1OGAB 3QDMA 3L95A 4QXUL 1JPFB 5TF0A 4OCNC 3L3JA 5IBLD 4V1DD 4BFIA 1I3RA 1VCAA 1PG7H 3ZKXB 1R3HA 4NUGL 4BFGA 3QB7C 4XH2B 3V0VB 3IJSA 5D2NA 5HPMA 5E2UH 3DYOA 1W0WA 2FJGA 4JPWH 4XAKD 4LNVA 2HJFA 3ZZ1A 3F58H 3EYQC 2A6DB 4K7PY 4ODXA 5DWUH 1P6FA 3T0WA 1J18A 5FA4B 2X7LB 4IRJB 3V0AC 1NL0L 3QNXB 3U6RB 1RHFA 1YDPA 3QIUD 2FH6A 2C7UA 2R1WA 1QRNA 2VLRD 3FQUB 4XVUC 3MGTA 3CCHB 3PWNA 3PP4H 3H9SA 1C7SA 3IFPB 2BC4A 5KS9A 1GVIA 1FYTB 1KLFA 4R0LC 5J11B 4PRBB 1X5GA 3UPAA 3W39A 3RVWC 1IGCL 2VDML 1T2JA 3WFBH 4E41E 2GFBB 1ETZB 1JPSH 3I50L 4NHUB 2E7CA 1QFWH 4H1LB 3S37H 1FL5B 4HKZB 1X5LA 1R0AL 3OJDA 3MODH 3RGVA 1EHNA 1YQVL 5KTEH 1T0NB 4BUHA 2MHAA 4G6FD 4R26H 3GGWB 3QDME 5FCUL 4XP5H 3ARTA 3UP1A 1QNZH 3BH9B 2BSRA 3CH1A 4JFZH 2Q7YA 1OAUL 1MFDL 1U9KA 3MRQA 2ADIA 1JHKH 3P0GB 3DURA 4MA3A 1I9IL 3PWPD 2ZOLB 1ZSDB 3SGEI 4GUPB 4L4VD 1KXTB 1S9XA 3O3AA 4PJ5A 4D0BA 4ERSL 1UB6B 4PPTA 1F3JB 2DI7A 4F37K 4OCWH 1LP9B 3B9KA 2BDNL 3GFUA 1TQBB 2XKSA 3ME0A 3SDDC 1ZVSB 1CLZL 1EMTL 2EXWD 4YZFE 4X6FB 3DX6A 2YPKB 4O58L 5EOCJ 2PNDA 5K9JH 3MJ8A 4L9LA 5L9DH 3UZEA 2CKBA 3P4NA 4JM2C 4Y2DB 3IKCA 3VXRB 1T7WA 3KYOA 4IS6A 2FATH 5C9JB 4ZUWB 4O4YL 3V5DA 4YR6B 4P4RA 4NCC1 2IBZX 5E6IC 4HUMB 5T33H 2IQ9L 3U4BH 3P3YA 2ZUQB 2A74A 3IFLL 5CZKA 1JHTB 4QRRA 2XY1A 1OCWH 1U92A 3LKNB 2CIIB 1EEQA 4KHTH 1T7XA 4TUKL 1N59A 3BZ4B 4J4PC 5DJ8B 5JXEC 1MAKA 1KEMH 3V4PL 5CKGA 2HJKB 5D6CA 4YDLB 4YGVB 2OK0L 3CSGA 5F88A 1IARB 1CFNA 3C5ZD 3G6DL 3MGAA 2VLRE 2V5TA 1NBVL 1JV5A 1CD1A 4DUWA 1GGUA 4PG2A 3GSNA 1RK0B 4J3WA 1JRHH 4NQEE 2RHEA 3RU8L 1T22B 3NABL 4K8RC 2QADD 4PD4K 1VPOL 2JIXD 3ROLB 2VRAA 3G6JA 3QFJB 4OM1H 4PJCA 3ZTNL 1N0LA 4P2OA 3BYYA 5SWSD 3MA7A 1UEYA 1KEML 4K3GA 1D7FA 32C2B 1OGTB 1E4XL 2AI0L 1U36A 3CFDA 3VFPA 4JZJC 4O2FA 3LQAL 4HBCH 4F9PC 2X41A 3CX5K 4OLXH 2Z31C 5J06A 1CIUA 3MXWH 3QDMD 2YUZA 2R56L 3MJ7A 5BVJB 5BCAA 1TNNA 1BWMA 3HN3A 5I1KL 1HQRB 2FATL 1DSFL 1P53A 2HLFD 2HH0H 2APWA 1LK3H 3BRGC 1PAMA 1XGYL 3MRRA 3SGKA 4PV8A 3UEZA 5E99H 1K5NA 1W0VA 3DROA 1EBAA 5ICZA 4KKBC 1Z9MA 3B6SA 2HTLC 5HYSG 1WLHA 4NKQB 3T4YB 4F3FA 2LTQB 1PSKL 4QWWC 4LGRB 2VLLB 3CDGB 4PBXA 3AXLA 4HC1A 3LCYA 2AQ3A 4DFHA 5KN5B 5I8OL 3WN5B 2M1KA 4NQXA 3T2OA 1XEDA 4MS8D 5B39A 5C2BL 3MSPA 2D7QA 1NKOA 3ULVL 3IFNH 1A4JA 4FNLL 3WIHH 5GGUA 2YUXA 4HJGB 5IVZA 3WV0A 3RZCD 4DKDC 3MODL 1MJ7L 3OKLA 4P5MB 5FIEA 1D5BA 4BH7A 3BP6A 2M2DA 3G5ZB 1YMMA 1N2RB 2UWEB 5F1SA 1Y6MR 5SX4I 3MCKB 1E4KC 4JPVL 4WUUB 3T8XA 4OLYH 1AFVH 2VXSL 5L8JB 4UAOC 5TQ0L 4PJGF 2P24A 5F9JA 2H1PH 5EPMB 3ZE1F 1RHHA 1QBLH 1QFWM 4EUPB 4NKOA 4AL8L 4BQCA 4WFEE 2PTUA 4YDKL 4XAKE 5ALCL 1TPXB 5D8JH 4AZ8A 1MCWM 2VWEE 3QDGA 4QXWA 1NFDB 1Z3GL 2J3SA 5DD1H 1SMAA 1LE5A 2CMRH 3U9PH 4U6YB 1MCWW 4XCEB 2DQUL 4LKCB 5ILTH 1NEZB 2W0LA 4GRWE 4PY7A 5C6WH 4HV8B 2ATPA 1AE6H 5JLZB 3TZVC 3IKKA 4NWUH 4WU5A 3OG4B 3KR3H 4KY1H 5I1GH 1RZGB 5DMIH 1KN4H 3HNTH 2OZ4H 3PWUA 1DBJL 3HCVA 1HDMB 3PUCA 1UH3A 3HLAB 4FXKB 3HE7D 1KEGL 3THML 2K9UA 1CN4A 4AG4L 1P2CB 3HS0B 5DJ0B 3BMVA 1K8IA 1OAYL 4NQCA 1MFAL 2D7OA 4MJ2A 4DKEL 4CVXA 2BOCB 1GAFH 2OTUA 3WXWH 1WAAA 2W92A 5DUPL 5E2VH 5I6XC 1MHHB 3DYMA 1TVHA 4OI7A 5EU3B 5GHWH 5D7LE 5ESQB 1U95B 5C6TL 5KSBE 4M7JH 4Z95H 3AAZA 4CJ1A 3W2DH 3ARBD 5IT2H 3SDCA 1WWBX 5C0BA 2AXFA 3VD5A 3VXMB 3FQRB 1FL3A 3S36H 4ZYKB 4MGXA 1J8HE 5KANI 4UT7H 2CRYA 4QF1B 5CMAB 2X4TA 4OAWA 1FBIL 5T1KB 3HG1E 3T04D 4UOJA 4XGZA 1JGDB 2R39A 1X5KA 3TA3A 2WWKO 2BFVL 1RFDH 3SE8H 5IBUG 1JJUA 4JFHD 1FC1A 5DZLA 3W2DL 5C0FB 5CMAA 5KW9H 4QHMB 4B5EA 3F7VA 4O5LL 5I1HL 4M7JL 4LL9A 4Y4KC 1XGPB 3I9GL 3GJFK 4NPYA 5I1AB 3O3BB 3QULB 4HWZA 3IU3A 2IPUK 2I24N 3W5NA 2CGRL 5DYOB 3L9RB 5C0DB 5IHBA 4FQXB 4OZIE 1ZLSH 1BFVH 2CJUL 4GQ9H 1HSAB 4L8DA 4P2QE 1BBDL 3T0BA 5EO9B 4HKJB 3RIFK 3IU4H 4WNQA 3LKSA 4GXVH 4LSUH 5DRWB 2VXVL 1MCKA 5DD5L 3ROOB 1JGUL 1MFNA 3QWRA 2RB8A 3H9ZA 3HLAA 1KLGB 2YEZB 3CFJA 5DQJA 5T3ZH 1WK0A 1QP1A 2KZWA 1G6RB 1YEKH 2EYTB 2MJWA 4R2GB 4M9PA 1J1PL 2QR0A 1ZT4B 2YKLL 1QLRB 3PIQB 5CD3B 5F3HB 5FYKU 5EZOH 1N0XH 5KSBA 1JN6B 1DQMH 4KZDH 1T04A 5GRVK 4XCNB 1QR1B 4NZRL 3ZE2E 4P2OD 1FL6A 2HLAB 3QWOA 3K8LA 5MEOB 1JGEA 4O2EB 2EC9U 5DFTA 4PGBB 4MQSB 4F7TB 5AG8A 3EKCA 5ALCH 3L3HA 4NJAL 4QHNA 3HG1A 3O6FB 4HWNA 2HMIC 1UVQB 4YH6A 1I3VA 4P23A 5E8DL 1IAKA 4QHLA 2CDFB 5C2UB 2A9NH 4LVOB 4AENB 2GTWB 3GM0A 3D9AL 5TQ2H 2R1YB 4JPVH 1CT8B 3MLWL 2OTPA 4CMMB 1AGDA 4M7ZB 2XI9A 4JQXA 1S7RA 4HW6A 2XZAH 2G2RB 2WWMD 4RWYH 3QUYA 5A2FA 2Y36L 1YECH 2VOTA 5I73B 3MNWA 1UXSB 2AEIT 3QO0A 5CIPH 3HFMH 1SEQL 4MNQA 2P8MB 4PLKC 4CW1A 5A3IC 3BD3A 3DV6B 5CLWA 1EUUA 1M7DA 1MRFL 2WIIA 4HZAA 3CFBA 4AEIH 1FNEB 5HY9B 4LSRL 1JYVA 5KVEH 1AD0A 5TGBA 5GGQH 4OFYA 2VISA 3OB8A 1FVDA 1OP3H 3CDGA 4KPHH 4KDTC 1OB1A 3W5MA 5E8EA 4K3JL 1A9BA 1DQQA 3P73B 2ZOKA 1QOKA 1W0VB 3BGMB 3CFBB 1I9EA 2WIIB 1A6AA 4JFDB 1TJGH 4CL7A 3MRRB 1YEHH 5GGVL 5I66B 2B1AH 2KQMA 5GS1C 3SDDD 4EVNA 5GGRB 2E7MA 4RQQB 4P49A 1HIMH 1SJHA 1R3IL 2CKBL 3QUYB 4ACPA 2G2RA 4OGAC 3HZVA 4L3AA 1L6ZA 5E1HB 4Y19B 3EHBC 4F7PA 3UTPD 2HVJB 3KPRE 4N8VA 5DF0A 3BT2H 3VRIB 4P2OB 4I5BA 3S98A 5D7LB 5JPMB 1EEYA 1YEDA 4D3CH 2I25N 4MJIB 1CLYL 1WTGT 3H42L 2NY1B 1H5BB 3G6JB 3MV8B 4DKAA 4UV4H 4XCYB 5CD5D 2CDEB 3U0WH 4N1EA 3PWLA 2AABL 1F4YL 3ARGD 1FZOA 5BVPH 3B9AA 3LIZL 3O9WA 2IPTH 1MFCL 4GAYA 5SWZA 1ED3A 4CVWA 2HFEB 2VZSA 4OD2B 3GSNB 1P7QB 3MMEB 1MVFA 3DETC 5D1ZC 5ICYA 5HHME 3TWCL 3CZFB 4R4NC 4G6AC 3O6LL 4WI6A 1NCCH 5JW4R 4WEMB 3FT3A 4M9OA 2WLZA 3GBNH 1IGML 4GRWB 2GI7A 2JJSC 3E6HA 4OUOA 5KSBB 3BZ4A 5KSAB 4TVPH 3V7AE 5A2KH 4H88L 4FQQA 1OAQL 3EJJX 3VFTB 3P0YL 4TRPH 5DQJB 4PY8I 3HE6B 1IFHL 4RBPK 1CQYA 4C56B 3QDJE 4ZNEA 1HQ4A 5D5ME 1Q9LA 5FM5M 4E41D 3FT4B 2KH2B 5DXWA 1Q9OB 1ZA6A 3LKSB 2CKBB 3P4NB 5C86A 3E8UL 1U8MB 3EJZD 4HT1H 4MCYB 3WDJA 3DGCR 5E8PA 4AIXA 4M43L 5T1LA 4BKLB 1K4DA 5GJTL 1VEPA 5E2WL 5MEQA 4G6JL 2OJZH 1JK8A 4XAWH 3HAEG 1HZHH 1RY7B 3LD8B 4QYOA 4DUXA 1VGEH 2VAAA 5HBBA 5TJWK 1RIVL 1ZSDA 2PYEB 4OB5L 3W82A 1EV2E 5MEND 5C0FA 2J5LB 3QFJD 2AEQL 4GMSH 2DQIH 1RZ7L 1VKXB 1UCBH 3W11D 2X9XA 1ZLVH 5ACZA 1H3UA 1MY5A 3B3IA 1N64L 1WWCA 1SM3H 2A9MH 5JXAL 3QQ4A 4QRPE 1FE8L 3D39B 2J88H 2GK0B 3TCLA 3CAFA 4N5EC 5CUSH 5T1KA 2CUHA 4NM8L 1UA6H 1KNOB 4NRYA 4RGMB 4UDTB 1G7JA 2Z0BA 1FVEA 4ZYKA 4HS6B 2RQ8A 5T3ZD 4XPFH 5JO5B 4Y4HA 3PP4L 2P47B 2X4QB 1ADQA 1RZ8B 1D5ZA 3BAEL 5F7EH 4ETYA 3DVNB 1B90A 1SM3L 4MMXC 3UTZA 1FLRL 2BRQA 1S5IL 4XXDB 1OQOA 2VXUH 1GZPB 3ILPA 4G7VL 1UCBL 2VLME 4UNVA 1RV6X 4B7LA 1RK1B 3QDJA 2CD0A 4V1DE 4MJ6B 3HC4H 1A14L 4KK6C 3L6FA 3EJZC 1KTLB 2RFXB 5D7IE 1XR9B 3UTTA 3D25B 5E2UL 5F7KC 4RRPG 3U79A 4GG6B 5IJKA 2LQRA 1E28A 4NUGH 1T2XA 3U83A 5IEHB 1A6UL 1TTUA 4LLYB 3VXPA 4PREA 1AKJD 2R1XA 1MAMH 5E8NB 3K4ZA 1IKFH 1L0QA 5HYJE 1K3ZA 1TVBA 2EDHA 3D0VA 3LPFA 4NUJA 1CG9A 1QFHA 5DGRA 1SYSB 3GSRB 5J0BA 3TBWB 4XP1H 5D93B 3UYOD 2V7NB 4M3JA 4FZEL 1R5IB 5CP3H 4IDJH 1FORL 4JFYA 1CGWA 3RDTA 2D3VA 5E8DH 3NTCL 3WFDH 5BV7H 2J6EL 4LRIC 2DN7A 4QTIL 5K33A 2R2HB 2UY6A 3GMNB 4Z9KB 5ICXB 2R8SL 4IRSD 4RFOL 4YJZL 2UVEA 4K07A 5B8CA 1IL1B 2NR6C 4JRXA 2FR4A 3ARDD 5HVWA 5FM4A 3MYJB 3C6LA 2EE6A 2HRPH 2EDNA 2NY6D 4NZRH 4HHAA 5LGHL 2AABH 3CJJA 2H2SC 1LDPL 5E08L 2DM2A 4UB0L 4KI5C 1CE1H 1OTUC 3EO1B 3VMPA 3R06A 1Z6JT 5I74C 5TDPA 2EIBA 2BSSA 4OGYL 4JO3H 3BKYL 5SV3A 4FQJL 4YUEH 5F93C 4ZFFA 2QTEA 5E0QA 3U1SL 3K8MA 1SYVA 2F19H 4XCFH 1FJ1B 4HG4J 2AJ3A 5ICZB 15C8L 5F9OL 1WQVT 4GFTB 4P5TA 5GGVH 2YC1B 1H15B 3SEPA 3HUJF 2QSCL 4QRQB 5E5MA 2NY4D 1CL7L 5C3LD 4O2CA 4KAQL 1EXUA 3CDCA 5EBMA 1U8KA 3OJ2C 4O5LH 2NX5A 2C4FT 3EDFA 1NFIA 1OW0C 4XBGA 2GYSA 5DJAA 4AEEA 3MREA 1NL0H 3SJVE 4R97C 4WFGE 3SKNB 2GAZA 1IGIH 1YN6B 1PG7X 5FEBA 3ABZA 3DTXB 4MQTB 4OUUA 4G8EB 3R4DA 5IW1A 4GMTL 3FONB 4Q6IA 5C3TA 5I1LB 3U2SB 5I8EA 3BN3B 1FBIH 4OZ4A 5F1NA 3O8XD 1SEQH 5D7IB 5JUEH 3O2DL 4YFEA 4P57A 1HHIB 1UB5B 2I9LB 5ETUB 1WFTA 1JMXA 5I76B 3FO0L 3BH8A 4F80A 4I3GA 3D85B 4LEOB 3ULUC 4Z76B 3HE7B 3BWAB 3DRQB 2NY0C 3M17A 5DTFA 2WUCL 1A6ZA 5CAYB 1KB5L 3CH8A 2DM4A 2HMID 3SDAC 3MA9H 4P2RE 5IEKA 2AAVA 2DQJH 4KQ3H 1AD9A 1YJDL 4YHPB 1J12A 4N9GA 2EH8L 1MI5E 2A0LD 2HFGL 1FSKC 1C08B 3ARDB 5JW4M 2EIZB 4KK5C 4NZTH 5BMFH 1ACYH 1PZ5B 3VH8B 3MPCA 3FFCE 1FIGL 4EOWL 1RJYA 3EJYD 1M7IA 2ENSA 2XQYG 5F96L 4CRPA 3HE7C 3HNSH 3HZKB 2D03L 4HD9A 4M5ZL 4K2UL 3V4VL 2CK0L 2IBZY 3ZDYF 3MLUL 4P59H 4F57L 3N9GH 3EZ8A 5FYKL 5F6HI 3UC0L 4RFEB 1TETH 3OGOE 4I9WE 3V95A 3ARBC 2AP2A 5IMMB 5DJCB 1N0XL 1CYGA 1YNKH 4OIIL 1CS6A 2HKHL 1ZTXH 2XZCH 3KG5A 3F62A 3QQ3A 2XN9E 4RMTA 3EOYG 2H41A 4YHKH 2HWZL 5KVFH 3B83A 4XVTH 5E7BA 3K8KA 1T7YA 4G80B 3FB7A 3VFUB 3K81A 5B3JF 4HGWA 4ZXBB 1MNUL 1ZLSL 3KPSD 1FNSH 3VFWB 4ODUA 3BPNB 2F53D 3HZKA 1S7SA 3QUML 1CGYA 4YAQB 3DX7A 1MCIA 1W0YT 2DAVA 3DVGA 3QT2A 2DKMA 3WS6A 1IEAB 3BIKA 3L5WA 3VRJA 3VH8A 5D1ZB 5GS0L 3QI9A 3M8OH 2C4FU 2ZUUA 3QEHA 4PJ5E 5I1HH 5DC4B 3PDDA 4P2RA 1EIBA 4LPWA 2A83A 2ZJSH 5M94B 4LLVA 1KB9K 3GKZA 3O3DB 1RUAL 4OKVA 1VENA 5DTFB 1NAMH 1T4KB 3PGCA 3ZDZF 3DRQA 3T4AA 3D69A 3CU1A 5CILH 2XZZA 4MXWL 4Z77A 3U6RA 3GMRB 2LAGB 4L4TA 2X7LA 4IRJA 4WHTB 2FJFA 3T4AB 3WSQL 1XGYH 3N1FC 5K9KB 3DV4A 4OKVB 3SDAB 1W0WB 2FJGB 3WFEL 1QSVA 2ICEB 4HIIB 4X7CC 3FOMA 2VL4A 3BDXA 3RP1A 4N0FA 1GC1H 1V5JA 4C58B 4HBQA 1YA5A 3G6AA 4KFZC 4KROD 1KBGH 1MVUB 1NJ9A 4AH2A 4JFED 2X4SA 3SE4A 4ZUVA 2YA1A 3DMMA 2N7AA 3DTXA 1AKJB 1YEFL 2DQDL 2XA3A 3L5WB 3MREB 5JW3H 3MRLA 4NRZA 1DBJH 2VR5A 4YHNA 2D2OA 4FFZL 2YD5A 5CJOH 2PTVA 5D6DC 2GKIA 3AUVA 5MI0C 2NY4B 4XNQB 4LCCC 1QQDB 1ZE3C 2PO6B 4ZOAA 4JKPL 5FO7A 4I9WD 4MNHB 3QJHA 1KC5H 4YC2C 3VE0A 2AW2A 1AGBB 4HC1L 1AXIB 4A6YH 5L88H 1IILE 1A6VL 4NRXA 1I1YA 4QOKD 3WS3A 2X44D 2MQ3A 3EYOA 3WLBA 1VFOA 4S11A 3MUY1 1HYSC 5E6YA 1T7ZA 4UUJA 2DWDB 3QG7L 5L6YH 5J57B 4MAYA 4ENED 5FK9B 4YDKH 5E2JA 3S88H 5JW4Q 1QPPA 4RAVA 3QIBC 4S1QH 4U6HA 3VXRD 1B0GA 3V6ZA 1OT1A 1I1AB 4JFQA 2N4IA 1U8LB 6FABL 4KUZL 5H35B 3CVHB 4ZTOL 3OTTA 3PDGA 1OP9A 1TXKA 5FYKD 1C5CH 2KKQA 1SY6L 3MV7E 3MXVL 1J8HB 4AEFA 5JZ7C 1B2WL 1HHHB 1EGJA 4FXLA 1QFUH 5F9WC 3VXNA 4N9GB 3BFOA 3RHWK 3Q48A 3G9AB 1Q94B 1A6TA 4W81A 2NXZC 3TBVA 2EE9A 35C8L 2QQNL 2EZ0D 3MFFB 4OFKA 4F8QA 5IHZB 3SDXE 3D6GA 3W9DA 2VDQH 4KJQD 4MQXD 1BJMA 2OTWA 4DWHA 3VDBA 5DVKA 1SJXA 4N9OB 3RI5F 4DN3L 1ZGLB 1JPST 3BYTA 1IAOA 4DN3H 1AH1A 1U8QB 1MHPL 1K4CB 4E42A 5EO1B 1KLUA 2VLKA 3DLQR 1HHIA 4MA1B 4JZJA 4X7SL 1TZIB 3QZWB 4ONHB 4GAJL 2VWEC 4Y5XA 3ZHDA 2R1XB 3QIBA 3TIEA 3PHQB 3ZE2F 1BZQK 4LVHB 2A6KB 5DEGA 3ZDXE 4N0YH 1IC5H 1Z5LA 3MJ6A 4OCYL 4UV7H 1KCUL 2YPLE 3WL9A 4YBQD 4K3DL 4YEEA 1AR1D 3UX9B 4KK9D 3BAEH 1FZMB 4X6EB 4RMVA 4GS7C 4U1NA 4XBGB 4LK4A 4ENEC 3MOBL 5FUZL 3UBXA 4NQSA 1HH9B 3KPLB 3RVTC 5C0AD 3VG9C 1YPZA 3S88L 3ESVF 5I1CL 3IXTA 1TCMA 3WIHA 1B0WA 3CIQA 4JFOB 4LCCA 3FB5B 5CP3A 4RMWA 5F89B 4WRLA 5AEAA 5DRNB 5CBAB 3S97C 1F3RB 4PRIB 5FF6A 1Q72L 5C0EA 4U1LA 4XB7A 1V3JA 5FYJD 3OKNA 1HHHA 1UM4H 1VFBA 3VFNA 1FVEB 4A6YL 3CMOH 5MERB 1T2QL 5KAQG 2IQAB 1K6QH 1YYLL 4JE4B 4U0RB 2PTTA 4G6ML 1HWHB 5D9SB 4GXUN 5ESAB 5GXBB 3CVHH 2GEEA 1DLHB 1HILA 1OAZH 4W6XB 4MJ5B 3U46B 1BAFH 2DWDA 5SWSB 4NQEA 4GKZA 3FHQA 3U4BL 4YHLL 3WJJA 3GUTB 3FO1B 2EEAA 3DIFB 5I8KH 4XT1C 2UZYB 3D48R 3L1OL 4YHIB 5T1LD 1XCQA 1KIRB 3IDYC 1FGNH 3DGGA 1LDSA 5JDSA 4MNHA 5AZEL 2NLJA 1K9TA 5CEYB 1RVFL 2PO6A 3QNZA 1QUNA 3VXOA 1E6OH 2V9RA 4XNQA 4JZOB 2MFNA 4IIQC 4WUKH 4ZS7L 4KJYB 3WMSA 2EEBA 1MRCH 3BQUA 3LN5B 2IGFL 4Y2OA 4Q9BA 1S7WA 3WIIH 5CHNA 4NRZB 5H94B 2CLZA 2QSQA 4R6UA 1HKLH 3KYKH 3O8XA 4C55A 1I4FB 2VABA 3U0TA 4FQQB 1WIPA 43CAB 3PV7A 3JXAA 5LQBL 5JHDB 1G0YR 4YO0A 5GS1A 5CEZD 4BH8A 2MNUA 4RGNE 4RIRA 1HYRC 3LPWA 3MRNA 3HRZA 4IIQB 4NNPL 4WFHD 3DO7A 1R0AH 1BGXL 1K2DB 5C0CA 5JHLH 4TVPD 5GRZA 1M1SA 1NCDH 2BCKB 2BVPA 1ONQA 4Z7UF 3O9WC 1YYMH 4OLZH 5DSCA 5FKPA 4Q2ZA 3JBG7 4LHUG 2QQQA 4P46B 5K9OA 3O41B 4MXQC 1MRDL 3A0OA 4U1JB 3OF6D 5K9QI 5HDBF 1OTSD 3LV3B 2DBLL 3UTZB 4X99A 2X1PA 1X3DA 4TUOB 3EFDH 1RZ8A 3A6CL 3QXDA 5KVFL 2IAMD 3I6LD 4IMKA 1FGVL 3T09A 2HVKB 3BIKB 1RUQH 1FZKB 1G7JB 4IRSB 4BFEA 3DVGB 2XRAL 4Z7OF 1FLTX 5JPNA 4XNYL 4BQ9A 4U1HA 1JPGA 3ZYIA 2ZCLH 5DJZA 3OKMB 2YBRB 4K7FA 2ZUVA 4K2UH 1I9RL 2X4RB 1QKZL 2X4NB 3VWKD 1MIEH 4P5TC 2GIYA 4TULL 3WIFA 3S5LA 4Q9QL 4WEBH 3S34L 4QRPD 4HIXL 1NC4B 1CE6A 3ZMRA 3E3QE 4NZTL 1G7LA 1PG7L 1A9BB 4WTZG 2EH8H 5AG9A 3G5VB 3HA0A 3BEWB 3RI5K 1F4HA 1S7UB 3TBTA 1KIQB 1A22B 2DDQL 3QAZC 2XZAL 5ECJE 4NQDD 3T3MF 2W9EL 2D9CA 1XGUA 3TP4A 4J3XA 3JWDH 4KKCD 2IPKB 2CR3A 1OTSC 2Q8BH 4XWOD 4HQQL 4XXCC 4AK1A 1JZ3A 4GRLC 4PJIA 3MNWB 1BX2A 2XTLA 1JF1A 3WSQH 4UT6L 5ITBL 3HE6A 4RMUA 4C54A 4Y4KD 5C9KA 3F8UB 3L3DB 3WFZA 1DR9A 4GMTH 1J05A 4FP8L 2Z4QA 3OKOA 1NGWB 4HIJB 1RJCA 5KVMC 5C08D 5ELIA 1BD2D 5IQ9B 3MROA 1DCLA 1NEZG 4KI5F 1UJTA 3OJVC 1D5XB 4D0DA 3MGOA 3SKOB 2G5BB 3OKEA 4CDGC 2MCG1 4P23B 3W9EB 3D3VA 4JDZB 3EOTH 1F11A 4HLZG 3VD7A 4QHNB 2IANB 4H5SA 5EZLB 3KWWA 4QGYA 4M1CD 1T1ZA 5ETUA 5FYJH 4Q58C 3BJLA 1BVLA 3QXUA 1XF2B 4KMTL 1KJMA 3VFMA 1I85C 2HYMA 2HN7A 3FOLB 2DBLH 4ZUTA 1QLFA 4TUJB 3MGOB 2ARWA 1H5BC 1EEYB 1YEDB 2F8XC 3GHEH 4Q6IC 1QLRA 4DW2L 3GHEL 5JHDE 4Y19A 3O8XC 4XVTL 3SKNA 5DJYA 4WGWB 5FXCH 3T77A 9CGTA 1AGCB 4POUB 1QPXA 4NN7B 1WVZA 5D1QA 8CGTA 2CUIA 2OMBA 1T0PB 3STZB 4AM0B 5C70A 4JY4B 1OD9A 2IANE 3BGFC 1EXUB 1WBZA 2NX5D 2IPKA 3PABA 3NCJH 2JB5L 1OSZB 3U9PL 2P7TB 4X8XA 2BFVH 3PHSA 1AGFA 3QCUH 1LO4L 3WKNA 2EKSA 1SYVB 1AXTH 3N1QC 5FV2A 4YDVA 5IR1A 1FIGH 2FB4L 1X6NA 3R06B 5BMFL 4H20H 3CPLA 4ELMA 1S3KL 2BHYA 2R4RL 5MI0B 4UINH 3I2CH 2NY4C 4PR5A 1DN0A 2V2WA 3REWA 3OB0K 4Q9RL 4PRNA 1UJ3A 3DBXB 3R1GL 5FB8A 4HHAB 3DX9A 4DK3A 5DFWH 3KLDA 4I1NB 4TSBH 5CP7A 2EDKA 3QUYC 4MA7H 3IVKA 5ALBH 4XRCA 5IROA 3FQRA 2BSED 2AXFB 4Z7WB 4FZ8L 1YEIH 2R1YA 2EDWA 4S1SL 2VLJB 1NCBL 1KN4L 4K9EC 1V7NH 5INDA 4F7EA 5EU3A 1G1CA 4Y16B 3ULUL 2CLRB 4AEHL 5FKPB 1K8IB 4HDIB 1A7RL 5IGXH 3GSRA 1CDYA 4LASL 1F3DJ 4M6OL 2P1YA 1JGEB 2PW1B 1LK3L 3ZT7A 1DL7H 5TDOA 4Z0BH 2AKRA 4OLVL 2ATPB 1I3GH 3WNMA 2AJXH 1E28B 4G5ZH 4HBCL 3MLXH 2PW1A 1I4FA 4O02L 3FB8B 3QJFB 4EKXA 3G08A 5HXMA 3NOIA 1OTTD 5H94A 5J1SC 2FGZA 3HNVH 4G6KL 4V1DA 1DANU 3MBEC 1NFDA 2J88L 1G7HA 4M7LT 3MC0A 5GZNC 4YDJA 5JXAH 2D31A 3DETD 4OZGA 3G5YB 1CGXA 3VXOB 3U7WL 3HMWL 1RZFL 5A2JH 4U31A 1HSAA 4GAJH 2NLJB 5CEYA 4FQLL 5EOQH 4X7SH 4FQXA 2Q6WA 1SEBB 3QPXL 2ED8A 5BOPA 3IU3B 4OB5H 3IVKB 4JG0L 3VGBA 1MHCB 5I8OH 3GSNL 2VSCA 1AGEB 2EC9T 1VGKA 2HRLA 2AJVL 4X8JB 2NTFB 3DBXA 2YD6A 2GK0A 2P5EE 3WHXA 3QQ4B 4ZS7H 4HJGA 1OTUD 3REWB 4CNIA 4L9DA 3B3IB 5E99L 5F3BB 5GIRA 2KDGA 3UMTA 5HD8D 3AVEA 4JDVA 4LHJB 4KUCF 4YDVB 2UZXB 3NZ8A 2BNUB 1SY6H 3N50A 4KK9C 3U4EA 1EEUA 1MUJA 1TJIL 4TVPL 4U1LB 3SDCB 5IESL 5JIIA 5FYLL 2Q6WB 4NYLB 3OJMB 2XNAB 3T0VA 4DK6A 3KNBA 3O11A 1NMCB 1TVHB 1U8MA 3KHQA 5HHMD 1HH6B 2XWJA 4QRTB 4UQ3A 3B2UD 1AO7B 1D5IH 3FT4A 4LGPB 3WNKA 4I2XB 4WI2A 5DJYB 1AP2B 4OZGE 4HIEA 1RU9H 1RZFH 4GBXC 1FZJA 1AJ7L 4Y5VA 2O61B 1UGNA 3MRPB 3AS3A 1T6WA 3MA7B 4LPUA 5JLZA 2OLDA 4YPJA 2VC2H 1NQBA 1QFWI 2DD8H 1EEZA 3GSWB 2APVA 1CWVA 1RPQA 4PRPB 1QLFB 4TUJA 2G5RA 3VFMB 1BMGA 1FV1B 2BP3A 2VLKB 4JM4H 4MAYD 5I1CH 3I3BA 1PQZA 5T3ZE 4JREC 3OR7B 1RK0A 2IMNA 3CFEB 1SQ2N 2DQGH 4JPKH 1T1YB 3TVMA 3BUYA 2C3WA 2CLRA 3AS2A 4DGIL 1QA9B 2RIKA 1MWAA 5HI4D 1D5XA 1UT9A 4J6RH 4MWFB 4D0DB 4X5XA 2EC8A 3BXNB 2VXTL 3OAUH 4NKOB 3N06B 3QUXD 1RHHB 3MUZ1 2VLJA 4YGAB 5J6GB 4NQDB 1GGTA 2CIIA 5GGQL 2Z8SA 2JJWA 3CXHK 5EOCH 1T5WA 3V6OA 5DA4A 4X4ME 2FGWL 4WO4C 3LKOA 4L3EA 1G9EA 5ESVB 4L3ED 4ZUWA 4YFDB 4Z8FL 2XXMB 4RQQA 1MRFH 3IKCB 2ORBL 1OP5H 5ADPH 3GHBL 4JFQB 3EFFA 4M7KL 3H3BC 3GMOB 4HH8A 4BFBD 3DX6B 4U6HB 3VG0L 1TLKA 3PGFL 4B53A 1JYWA 5HTSA 5FK9A 2BHUA 1ORQB 3KLSA 4WFFE 3MOQA 2YD1A 5JIKA 2K1MA 4D2NA 4NO0B 4KVNL 5D4QA 1EHAA 3R1GH 4GUPA 2VZ3A 2OL3A 5C0BD 2DJSA 4P46D 3S37L 3IDNA 1PFCA 1CQKA 1IQWH 2V17H 3HAEA 2GUOB 2VIRB 4G9DA 1A3LL 1R5VB 4TNVK 3RWCB 4FQXC 1H3PL 3MRJB 2EZ0C 1PW3A 6FABH 3EYQD 4RA3A 2CR6A 4J3VA 2X70A 5GJSL 3P4MB 4JRYA 1BOYA 3QO0B 3VWJC 4X9BA 2DTSA 5FHBH 3RWDB 1T6VN 3DHMA 5KG9A 5D1QB 2WINB 3RZCB 4N1CA 3VXSE 4GO6B 3C09C 5CJ5A 2XN9A 4QTHA 1J0YA 4OI9A 5L8KB 5JNYB 2D4FA 2PETA 3UC0H 3LMJL 4M6OH 2XA8L 1MHEA 4TUOA 2LVCA 1MVUA 1QSFE 1I7TA 4U6VH 5D96C 2DMKA 2VLJE 3E2HC 2J12B 3KPPB 3KYAA 4WHDA 1PY9A 1PJ9A 1U8OB 4M5ZH 3V8OA 3RTQD 3VA2C 5TDNA 2RAMA 4KKLD 5BZDA 1MCPH 3J8F7 3O6FD 4GXVL 5I19H 1NANH 3CSPA 3GMRA 4KK8D 1IT9L 3F12A 1XAUA 5JW3L 1F11B 2CPCA 2GJ6B 4QXUH 4JVWA 4F7CA 1HHJA 1DE4B 4ZUUB 4XCNA 3SHSA 3KLHD 2DLGA 5HPMB 4OCSH 5HDBE 4HFUH 1Q8MA 5F3HA 3GSVA 2VITB 5D6DA 3MJGX 2XQBH 1G6RA 5CJQH 5C0AB 5KSVA 1KCSL 4PB9H 5IFAH 4GW4A 1TCRB 5JUEL 5IV2A 3MCLH 1N26A 2DQTL 4OM0H 2YMXH 3W0WB 3BQUB 2ARJA 4PG9B 5GRYA 4M1GH 1XCTA 2IH1A 4YE4H 4LLWA 4P23D 3KLAB 3VW3L 2DQEL 1KJVB 4OM0L 3MZTA 3SY0A 2G75A 3AM8A 1I85A 1P1ZB 4L29B 3H9SE 3L9RA 3O4LA 4G6FB 5DK2A 2DB8A 1XIWC 1KG0B 3CMGA 3LKPA 5CEZE 1MREL 2ZJSL 2DJ4A 4PUBL 3GMQB 4Z6AT 3VXMD 4MA3B 1CTOA 3F7VB 4FG6C 1G7MA 4OZFB 3MV01 3VXSB 1YNLL 4OCSL 4RWYL 1ACZA 2K7PA 4NKDB 4M02A 4MJ5A 4CU7A 2OCFD 3QHFH 4X80L 3L7FB 5DJXA 1ULVA 4JB9H 2FSEB 3D2UD 3QUMH 5EIVA 2NZ9C 3V6BR 2F53B 1KEGH 2ZWLT 3OKMA 3LS5H 3ESUF 1MCDA 4KKAC 3P2TA 2AEWA 2HT2C 5EU5B 4U1HB 3U30C 4MB3A 3SGJA 1OAXH 2ED7A 4Y2DD 2WNGA 1PLGH 4XBEH 1WEJL 3VGEA 4LQFH 1QBMH 4NZUH 3S96B 4ZAKB 1G9NL 3Q1SL 1U3HB 4M03A 3DMMC 1CZ8L 4HWEL 3VGDA 3ZKNC 2DQUH 2E5EA 4HCRA 2XA8H 1BHGA 1MCEA 2ITCA 1MELA 3EGSA 3KS0J 4ODHH 1UZ6E 2OP4H 5E4EC 2CMRL 3HS0A 5DJ0A 4OFDA 2UWEF 4FXKA 4P59L 3OQ3B 1ONQB 1KFAL 3KPMA 4JO1H 5IK3B 2BCKA 4LDOB 1JZ4A 2LFGA 4G8FB 2B4CH 2W60A 1K2DA 4LQFL 5C0CB 4LCWD 5D2NE 5BRZD 4QRRE 1ES0A 2R0LH 1BQUA 1FIEA 3BZFA 4WFED 3GBLA 3STLA 1Q0YH 3MA9L 5D2NC 5GS1B 3GI9L 4MDIA 2VXSH 1ADQH 4NM4L 2O5XL 4O00A 4J3UA 5DD6B 5M95B 1NGQH 3SDXA 5SWZD 4LPXA 5EO1A 2WSKA 1DQTA 3L3JB 4KV5F 1XGRB 3O8XB 4YXHH 1B6DA 1SJVA 5MP6L 1JPFA 3WIHL 1GJIA 4H26A 4DKFL 5AD0A 1PX3A 1NGYB 1ZGLA 2EO1A 2P8PA 2YN5A 5DJ6B 3SDCC 2YD2A 1JWMB 2FEDC 2FZ3B 2VLKE 4FNLH 5IHZA 3FQNA 2NY2D 1KXVC 4HH9B 3ELAT 5ADPL 1JGVH 1NMCC 3QUXA 1L9MA 3PHOB 4ODSH 5IMKA 2BK8A 2JE8A 2GQHA 1DEEA 4IRZL 5HGAA 3V8CA 4KZEL 4JHBA 2YPLA 1T66D 3FQXA 5DMGC 4U4BA 1AO7D 4YEFA 1HK6A 4XMLL 1E0OB 3H0TA 3RNQA 5L7XH 4PB9L 4MJID 1HILB 1YPZE 4OCLC 3NBNA 3LN4B 3C8KB 3TGXA 4QRPB 1FGNL 3HPJB 5DR5H 5CGYC 2YWZA 3AC0A 1RJZA 3JV4A 3X3FL 5GRXG 5D9SA 3FT2A 4JFXB 3EOBA 1QLEL 1T89C 4JPKL 1KPRA 2P5WB 1TDQA 5I15H 5MERA 1INEH 1RUKL 1AHWC 4BZ2H 3RBSA 2PW2A 5IB5B 3RY6C 4NRXB 1WICA 3V6OC 4PGJA 2H8PB 3TBSB 5BS0D 4WDIA 4OQTA 2Z93B 4WO4D 3HNTL 4IMKC 3VE0B 3TZVD 5DRNA 3O45B 4XNMB 3MLTB 5C07B 4NWUL 4XVJL 3SGKC 2X4OA 2VC2L 4JM2B 4M48H 4HMCA 1DUZA 4GMSL 1R5IA 5BV7B 3IJHB 3RPIB 2B0SH 5FUCE 5INCA 4LHUD 5DJ2B 5D5MB 4S2SB 1EGJH 1LO2L 3WUWB 1YMME 5LQBH 4W6WB 1D5IL 4TNWF 5E94B 1IKNA 4YWGH 1Z5LB 1NMAH 4LLYA 3VXPB 5IESH 5IEHA 5BQ7A 3VXQB 4KHTL 2R0WH 2ICEA 2AQ2A 4HIIA 4LSVH 5H2BB 4WUKL 4BQ8A 2N7BA 1H3XA 3MLRL 5EU4A 4AL8H 1LHZA 1Y6KR 3LKQB 5DJDA 1JZ7A 4R3SB 1CGUA 4FQ2H 5MEPA 4KJQC 2HFTA 4MDJB 4QGTA 3HC0A 5AZEH 3M1BA 3MLVL 3NZHH 4PJDF 4Y8AA 4FZEH 1C5DB 5DUBB 3W81A 4OGXL 4UILL 4PRHD 4BZ1H 1DQJA 1J8HD 2CLVA 1U3YA 4PJCE 3V2AR 3D87B 5DVOA 4U6TA 5ERWA 2AJYH 3RVVD 4Y1AD 1UENA 5J56B 1SVCP 4E5XA 1BAFL 2ICES 4NJ9L 3PNWB 3ARFC 1NBYA 3MV7A 2DWEB 3OMZA 4GG8B 4Y88A 4RGMC 1A6UH 1P69B 4NKMA 1HYSD 3BPCA 1OAUH 4UDTA 3EYUH 5EZIH 1S7XB 5BZWB 3BVNB 2PCPA 3KXFE 1S7SB 4QHUB 5AYUL 3KYOB 3ARGC 2KQNA 4UV4L 1YQVH 1SJEB 2CO7B 4HGMA 3U7WH 1U8LA 1CFQA 1IC7L 2GT9A 1ZHKB 3PV6B 4APQD 2IALB 4XI5D 4HUXA 2QKIB 4NZDA 3WDHA 4MAYB 5C09B 3ARUA 5LGJA 4HUWA 2L7JA 4PJ9D 1B88A 4GKSA 1F3JA 2PXYC 3LD8C 2QV2A 4OF6A 4I0PA 3EYOB 3WLBB 4HUUB 2FYYA 2R0ZL 1HEZB 4HS3B 5H37G 4PJAE 2C3VB 3JV0A 1J86A 1IBGL 3BH9A 3S8WA 5C09A 4EN3D 4YIQB 2NW3A 3X3FH 4UIMB 1HNFA 1F97A 2O5ZL 3ARPA 5JOEA 3EBAA 3FN0L 2IH1B 2NXYB 3PJSB 3N1MC 4UTAH 1WBYA 3WO4C 1DVFD 3FRPA 5DI8B 5IKCA 1TCRA 5IV2B 1VADA 2XICA 4OZFG 1GH7A 4LF3A 3VI4E 4XPAL 1NGXA 4NKMB 5FO9B 5B22A 4HXAH 3ARDA 1MLBA 4AH2B 4L9LC 2OJZL 4YHPA 4XB8A 3G6AB 1CDHA 2CRIA 1CVSC 3CCHA 3TESA 3JTTA 3SDAA 1C12B 5C8JB 1HHJB 3FQUA 1UXWA 1YEIL 3QDGE 4NC2B 4HFWB 4UBDC 2FJFB 3D85A 1ZHNA 4HT1L 5J1TC 3I85A 3WD5H 4IMLA 4Z77B 2WP3T 3MV9A 3SCMC 4IRJD 2WMPA 4L1HA 5DEFB 3MV8E 4XCYA 2YK1H 4X0KA 4XP6H 4MJIE 5CEZH 1Q0YL 1U8JA 5BRZA 5C07E 4EN3C 2IAMB 25C8H 4B7IA 5I1LA 5JPMA 3KPRB 4NKIL 2HVJA 3MRIA 4FQ2L 4N8VB 5C0CE 4H20L 1B6UA 2R0WL 2BNRD 1XR8B 1T3FB 4JKLA 1IGMH 4Z5RB 1OM3H 4ERSH 3OV6A 1BQLL 1P4IL 1UQSB 3QI9D 1SJHB 3JTSB 3LIZH 3GSNH 2J8UE 4XPHL 4ZODA 2HJLA 4ODUB 3IJHA 3RPIA 4GRLA 4TSAL 3AREC 4JM2A 5DO2D 2X4OB 4XMKH 4HAFA 1AC0A 4GRWF 2YC1A 4LVEA 1YEEH 1Q9KB 5KSUB 1M6OA 1KACB 5F1IA 3BSZH 1I7ZB 3U7AA 4Y19E 2PUQT 1S7TB 4XHJC 1B0RB 5DJCA 3MRGA 2JJTC 3KYMB 3WEXB 3EOBB 1ZVYA 1Z9LA 3WCYA 4PGEB 4ISVB 4KJWD 4R4ND 2Y07L 1YMHB 5FYJL 2NY2C 3QP3A 4PJFE 4KMTH 3UPRA 3DNKA 5E4EB 2YZ8A 1E27A 5DGQA 1LO5B 2R2BA 3OG6B 3MFGB 3GMLA 4E0RA 3FAWA 1FCCA 4JRXB 2FR4B 5CEXA 1BZ9A 1IL1A 1FYTE 1MFBL 2ITDB 3NIFF 4KXZH 2J1KA 1G84A 3IXAA 1OD7A 4BJLA 4GW5B 5FV1L 4AT6A 5KVEL 3RUGA 5C0NC 3FO2B 4OZIA 3VWJA 4F7MB 4OKDA 4XMLH 4KPHL 1S7QB 1XGTA 4KZEH 4YFLF 1KXQE 3MACL 3E2HB 1GGBL 1QA9A 3M17B 2JJUA 2DQTH 1V7NL 3HFML 1NC4D 1E4XI 4U7MA 5GS2D 2YD3A 5IF0B 1WC7B 2P43B 4FOMA 4ETQA 2Q8BL 2CSPA 4UT6H 1G7IA 5FKAB 5JORA 1KCKA 1TTFA 1FV1A 4MA7L 4XHJD 2BERA 4TYUA 4GOSA 4TSBL 3LKRB 5E8NA 3SGDI 5F1NB 4F33B 4PJHA 5I8EB 4L8BA 4OGZA 4U6XA 4G7YL 4Q6IB 5K93A 1U3ZA 4Y1AE 4LCYB 3WJLA 3MRPA 2D0FA 4Y5VB 4G43A 1Z0MA 2FHFA 3DYPA 4KRNA 4FTVA 4P99A 4G8FA 5C6PB 2IBGA 5FYJU 1IT9H 3HE6C 2HTKD 4KQ4H 4R7NA 3O6FC 1RK1A 3QDJB 4KH2A 5I1GL 2NX5B 1JMZA 3TO4C 4P48A 1KUMA 4UQ3B 2R69L 1U3HC 4JQXC 1U8KB 5CBEA 4DGYH 2I27N 5DHYA 4LVOC 3QXWA 2JELL 2ZG2A 5TPWH 2VN7A 5T1DH 1LO4H 5DD3H 3SDCD 4XXDA 5IWLA 5ILTL 2H6PA 4W4NA 5HGDB 1ITCA 1NUDA 4H8WL 4PJIE 1BD2B 1QEWA 3MRDA 5DYOA 2BVEA 1RUQL 1DLFH 3MRBB 1EPFA 2XRAH 2HKFL 1A7QH 5EZOL 1B4JL 2BNUA 4JGMA 4PJ7E 5SWSE 3BE1H 3AS0A 3KPQA 2BSSB 1OOAA 4G9FD 5T5NF 3TCLB 3TF7C 3ARYA 4I77L 2PXYA 1WITA 3KVQA 4JHZA 3EO1A 2DYPB 3TYFA 4NOBA 1IEHA 1EERB 3IU4L 1BVZA 1JGDA 4K7PL 3MRCA 3BOVA 3VWKB 4X6CB 4NHCL 3IDJA 3GIVA 1V7ML 1REIA 5EOTA 1NBQA 1KG0A 4PUBH 2EXYD 3LHPL 1GOGA 3O4LB 3TLRA 1UWXH 1MREH 3QFDA 2GY5A 5HHOD 1YNLH 3SY0B 1U3HD 2BRRH 5TE7L 2VR4A 4MCYA 1MHHA 4LAQL 3BKML 3U7YH 4XPHH 5HGHA 1HKLL 3KYKL 4N0CC 3SJVB 1FFNA 1LE9B 4OD1L 4NQCB 3EJYC 1GPOL 5CS7A 4LHQB 4J1UB 1Y0LB 1IEBA 2HT2D 4N0RA 1PKOA 4LSQH 3X14A 1M71A 2F58L 5HYJD 3VGGA 2FBOJ 3WIIL 5EC1A 3VFTA 3RL2B 3P9LB 1WGOA 5DK0B 1IAIL 3H9SD 3HZYA 4OLEA 3EOAA 1QO3B 5D7IF 2F9BT 4MA1C 2NNAA 4P5KA 3NPSC 4YHZL 1JHLH 4MD4B 3MV8D 2LVEA 4X9GA 5JA8B 1NCWL 4J23A 1T0MB 5B3JE 3I02A 2FL5A 3GO1L 3OKDA 2ZKHL 4L4VE 4LGSB 2E8YA 1A6PA 2O5YH 4JEGB 4XCEA 4FS0A 1P7QA 3QEQD 3OXRA 1BM3H 3F12B 4PJ7A 5J1AA 5A43C 4PJ9B 1MCOL 2HFEA 3CLFH 5AZ2L 3ZTJG 4U3XA 1I7UB 1IAII 4ELME 2HLFC 2WUBH 4OF7A 4FMFA 2Y1VA 3ZTNH 4KKCC 3ILPB 3QPQC 1I3UA 3NFPA 2AK4D 1ZXQA 3DECA 4HF5L 3MLYH 5JOPE 1JBJA 3BSZL 4I5BB 4PJ8A 3UJTL 1KT2B 3HI6L 3TVMC 3K1KC 1QTYT 2XPGB 4XCCL 2VQTA 4P3DB 5ACLA 3SCMA 1JNHA 2JK5A 3HRPA 3G5ZA 4P9ML 4PFEA 3G6DH 3OGCB 1IZJA 4X6CF 4ODWA 3D39A 4OLWH 4ZNCD 2XG5A 3N1GC 2BVUA 4H1LG 3BPOC 3PQYD 1HI6A 5IFHH 4LVHC 4MA8L 1MH5A 1UKSA 3KPSE 1BLNB 4O9HH 3CPLB 1O5DT 4U2YA 5HYEA 1DQQB 4GLRH 3UJIL 3VCLA 5LBSL 5IR1B 2R23B 3WFDL