1XCXA

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xcxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xcxA01
2YA2A 2VQUA 4U3AA 5F7UA 3WUEA 3VGHA 4ML4A 3U57A 4WSJA 4UZSA 2XGIA 5CLTA 3CZ8A 1UKTA 2YOCA 3WDIA 3PZ9A 3LMYA 3WMSA 4AYGA 1UQYA 3SCQA 2ZX8A 2NT1A 2WYSA 5JIPA 4PN2A 5JIWA 1JZ7A 3BAIA 3VD5A 2BY2A 4HOWA 1UWTA 2J4GA 5A3HA 1UWSA 1E6QM 3D3AA 1JFHA 1V6UA 1JF5A 2EACA 4HA3A 1I75A 2ZICA 1N82A 4DO5A 3A4XA 3AOFA 3EBVA 3KEHA 4GO8A 2VVNA 5I79A 1CXIA 4QLKA 2VCAA 1CBGA 4NF7A 1J0KA 1E4LA 3BUPA 2X09A 3O9NA 3HMCA 1GUVA 3OGSA 4H8UA 3PTMA 1HP5A 3VMPA 5JBDA 3OZPA 5CJ5A 2DSUA 4WK9A 4U2ZA 2ZIDA 5D9MA 1OT2A 3G6LA 5BYWA 4TVCA 5CZKA 3N15A 2PWDA 5DF0A 3AYSA 2V3EA 1CPUA 4JL1A 3D52A 2W66A 1W9BM 2XYLA 1EHAA 1V6XA 5A6LA 3PTKA 3CBWA 3B8SA 3WL0A 3H54A 5BWFA 2G8ZA 4H7VA 1NH6A 1VEOA 8A3HA 2VURA 1KQYA 1KXTA 4AW7A 4WSKA 1EO5A 3AS1A 2WZHA 2FHCA 1KBKA 4FF5A 1TVPA 3CUJA 2WC3A 1H0GA 5I3DA 3GXNA 1MQQA 3MMDA 2XG9A 4AEEA 1I1XA 4AD1A 3ARZA 4CVWA 2Y8VA 3RPMA 1BFNA 4AD3A 5A1AA 4FNUA 1TQSA 4GKLA 2WMFA 4MTVA 3VMNA 4AD4A 3AZRA 1WAWA 3EDFA 1H1NA 4M8UA 1BGGA 3WNNA 1ISXA 2YL6A 3QOMA 1VJSA 3WUBA 1V02E 1GJUA 1OT1A 4B9YA 5BRPA 4LYPA 1UR0A 2Y4SA 1QWUA 1XSJA 2VTFA 2PB1A 3MUY1 4B15A 3RILA 2J79A 3M6DA 3A24A 4MB1A 4JFTA 2IUZA 1DWJM 5BXSA 2GJXA 2GSJA 2WZEA 5ABHA 1LG1A 4HMDA 4AZBA 5KZ6A 5A2AA 2FGLA 2CXGA 3BMVA 2OWCA 1V3IA 4JCLA 2ZUVA 1DWIM 4AZCB 1UH3A 1VAHA 1JNEA 3W4RA 1W9DM 2WCAA 3WY2A 2PWFA 5D4YA 3WIJA 3KL5A 1GONA 4PMYA 1JDCA 5A8MA 4H2CA 3BVUA 1NP2A 2F18A 2VC9A 3DYMA 3SCOA 2ZXQA 3K1DA 3WQ4A 1H5VA 1UQZA 4PTXA 3VM5A 2DDXA 1BVZA 1TQVA 3VU2A 1R7AA 4JKKA 3UETA 1BGAA 1V0KA 1H3GA 1MW1A 4HZ8A 2ZE0A 3SUTA 2VCBA 3L4ZA 3SUWA 2FHBA 1XH1A 4GO9A 1TE1A 1WNOA 1UR8A 3GXFA 2WLZA 4AY1A 5BRQA 3BVWA 3WDHA 1LLOA 2AMGA 1IT0A 3ZIZA 3BVTA 3VPLA 2XHYA 3U5UA 3T2PA 1JD7A 4FNTA 1J0JA 2E4TA 5HPCA 3MKKA 2NT0A 3LXAA 1BTCA 1MQPA 9CGTA 1Q6FA 1SFSA 1CWYA 2W91A 1DP0A 2VRKA 5HOSA 1OBAA 1TG7A 3IK2A 4TTUA 3WEMA 3TA9A 3VTRA 2GK1A 4EANA 4MNJA 3TV8A 2OWXA 2V38A 2WSPA 3EMCA 2BVDA 1OB0A 4B9ZA 1JAEA 4P8WA 4UQBA 3SIMA 2ZX5A 3MUAA 1K9FA 4YN5A 3N11A 1HKKA 4C7FA 4PSRA 3RCNA 2JF6A 3DC0A 1E6SM 1TA3A 4AIUA 1QBBA 1LJYA 1TUXA 3QGVA 3VDCA 1J0IA 4M1RA 2WZIA 1E70M 3D50A 2ZUNA 2YJQA 3T08A 1C93A 4IUGA 1C92A 3GXIA 2VO5A 1D7FA 1Q6EA 4MNMA 1HF6A 3RM4A 1F4AA 1KCLA 3PZIA 4JZ5A 2D3LA 3OLGA 4ACZB 1RP9A 2E9BA 4MJ4A 2JIWA 4FNSA 3CZGA 3IJ9A 2WMHA 4TX6A 1OGGA 3AXIA 1GPFA 2CERA 2WMIA 1FP8A 3NJ3A 8CGTA 3BLKA 1HKMA 2CITA 4Z2JA 1F4HA 4HP5A 4UFJA 3ZJ6A 3VSTA 1JZ8A 4AZGA 3KLKA 1DHKA 2F2HA 1Z32X 3SCTA 3AMLA 3OLDA 1RP8A 2WHKA 2CEQA 5A6MA 3ALFA 4URIA 1UWRA 4GQQA 1CEOA 3WY3A 1O7DC 4W5UA 5LA1A 2XIBA 4F9DA 3NCOA 1UASA 2G3JA 1QWNA 4MAVA 1XCXA 1HJXA 3D5HA 1CGTA 2WVVB 2CNCA 1E72M 4GQRA 1OWQA 1E43A 1X1NA 3UESA 4RE2A 4AXNA 1UD6A 3WF1A 4AWEA 1W2VA 4J3UA 2CBJA 3W53A 1TQTA 3N1AA 1JZ5A 3WQ6A 4W8AA 4DWSD 3VGBA 2FYVA 4HMEA 1V0LA 5FL0A 4DUWA 3OLEA 3UEQA 3VIGA 3GNOA 1XSIA 2YIHA 1KGUA 3LPPA 4AZCA 1HJSA 3S5ZA 2JALA 3CZSA 5FD0A 1CGUA 2W67A 3W27A 2ZXDA 1PZ2A 1B3VA 2DT1A 2XWDA 3SCWA 1TMQA 4BF7A 2PBGA 1VFFA 3AYRA 3BVVA 1QI2A 2E8ZA 4JFSA 3F5JA 1W3JA 4EE9A 3WD4A 1UA7A 3AHZA 4CN1A 2WVSA 2RGLA 4MNLA 5M3WA 1YQ2A 2QLYA 2VUYA 1PIGA 1W1PA 3FNDA 2UY3A 3N18A 2WWDA 3HG3A 2CHOA 3DDGA 4W86A 4Z2GA 3TOPA 4HPGA 5AYIA 2PBOA 1JD9A 1MXDA 3N9KA 3ARRA 4X9YA 5A2CA 4UFLA 2XVNA 4RE4A 1VFOA 3KLLA 3TONA 2DEPA 4D72A 4LQ1A 1V3JA 2WANA 1E6ZA 3MSGA 3OZOA 3CGTA 4MNKA 4PSPA 1E4MM 4CD6A 4JKMA 1DWHM 2FGZA 3ECQA 2F7OA 3HG4A 3T0DA 1CXEA 4OOZA 5CPTA 2GFTA 1E0XA 4D6IA 3WY1A 7CGTA 3KZSA 2YFNA 1M7XA 1R8LA 3ARXA 4DM1A 3FW6A 3CUHA 3CUIA 1J0YA 1JYVA 2WHJA 1MQRA 1WZMA 1KR0A 1SMDA 2J7EA 1NARA 1R86A 3OGVA 3WBEA 3NSXA 4XV0A 3RIKA 4R5EA 4H41A 4J27A 3BC9A 3MUIA 1GW1A 3KWXA 5IFPA 3RO8A 3BAJA 1C3FA 1JZ4A 2BY3A 4PTVA 3AMGA 1JI1A 1CLXA 3GXPA 5EMYA 3QHMA 1LWHA 4U31A 4HU8A 1UA3A 2WLYA 1P6WA 3WF3A 1EXPA 1SR0A 4ACYA 1BF2A 1GQLA 3ARUA 4U5KA 4EAMA 2E3ZA 3H53A 3BUQA 5IXEA 3BCFA 1R34A 1EDTA 4P8XA 1EH9A 4W84A 4Y7EA 2XFRA 2D73A 2X1IA 2BXZA 1FH8A 3E1F1 3VGDA 1ZBKA 3AISA 1LF1A 1LWJA 3M7SA 1UH4A 1QNPA 3VILA 1KXHA 3CMGA 1DWFM 4BQ4A 1XHGA 3BXWA 5DFAA 3WNLA 2C7FA 3GNRA 3IGUA 3PZOA 4MDPA 3A6OA 2EPKX 3WSUA 3WDJA 5ECUA 2WW5A 1ZJAA 2UY5A 3W6MA 3ZSTA 2EPLX 4A3YA 1E3XA 4CN4A 4FK9A 3BSGA 3EDEA 3CZEA 2Y5EA 2YL8A 2ZX9A 4JHOA 4P7RA 3PHAA 4AZHA 1E3ZA 4XZBA 2YBTA 4M80A 5M03A 4OIFA 4UFKA 5C8BB 2ZX7A 3PZUA 2G41A 1AMYA 1US2A 1UWQA 5A69A 2FH6A 4YHGA 3HJEA 4WF7A 3WQWA 3NIYA 1KCKA 4J3SA 1W1TA 3SCUA 4WJXA 5CQ1A 1UR1A 1W3KA 4YHEA 3CHEA 5FIPA 1CXLA 1B90A 1OINA 1J10A 1UOKA 3VGFA 2EBNA 2WVVA 4AIOA 1JXJA 1ISWA 3UG4A 4DWSB 1J12A 1B3ZA 1B30A 1HKIA 4DO6A 3WBAA 2VMFA 4ZE4A 4N42A 4PUEA 2W63A 3CHCA 3BLBA 1R47A 1PEZA 3F5KA 3EMQA 3PZQA 1HTYA 3MUZ1 4TX8A 5IHRA 1R85A 3F5LA 1V02A 3W29A 2OWWA 2FH8A 2W5FA 1FP9A 1TQUA 2ZOXA 2OYMA 2OW7A 2F7QA 4KRUA 3DYOA 2Y8KA 2VRJA 2EPMX 2TAAA 3QR3A 2WMIB 4H04A 3N04A 2VQTA 3HG5A 2ALWA 1HVXA 1J18A 1G94A 5CPSA 3T2QA 5E9AA 1KB3A 1GORA 2Y2WA 4V2XA 4ACZA 2XSBA 1QI4A 3MS8A 2PF0A 3WUGA 3KE0A 2X2YA 3CIVA 2C0HA 4HOXA 4PEEA 3DHPA 1UH2A 4D6JA 2EXOA 1JYWA 4F79A 4D1IA 3ZR6A 1QNSA 5ABEA 2CESA 1XCWA 2WVUA 1CNVA 1E4IA 2ZUUA 3M46A 1BYDA 3GM8A 1UD3A 1GNXA 4GIAA 3VX1A 1E4NA 2G3MA 1XC6A 3ARYA 5DMYA 1E40A 1MXGA 4AMWA 4AMCA 4D71A 3POHA 4PYSA 1ZS2A 1B3YA 1QX1A 1VBRA 5FOOA 1EHNA 4RL3A 3AS3A 4D1JA 1PJ9A 4QP0A 5A2BA 2J7FA 3NSMA 2GK1B 2J7DA 2J75A 2YFOA 1K9TA 4FLRA 1ODUA 2VX6A 3K8KA 2WHMA 4ATLA 5C70A 4B16A 3HN3A 3VD4A 5I24A 3PZMA 3TP4A 1H4PA 1CDGA 3DYPA 4UNIA 1GQJA 2DT3A 4W93A 1UWUA 4PMNA 4U5IA 4X0NA 3FHQA 3BCDA 2MANA 3POCA 1U2YA 2VZSA 1HT6A 1KTCA 1E6NA 1WE5A 3BGAA 3HZ3A 5D9PA 2C8NA 1MVYA 3L2LA 4TVUA 5HDRA 3AS0A 2F7RA 5BXTA 2VX5A 1JF6A 4J3VA 4OBSA 3L2MA 3GXTA 4U2YA 4M81A 1KXQA 1JL8A 2VX4A 4UQEA 2X05A 4D6DA 3UG3A 1CGYA 4AMXA 1X6NA 1JYXA 2D0GA 2CIPA 3GDBA 1XV8A 4GINA 1IZKA 1J01A 1PX3A 2W92A 4BQ3A 1V08A 1QNRA 1E15A 2D1ZA 4MADA 1K9DA 2XM2A 4E2OA 1CENA 3RJXA 2HISA 3THCA 1V3HA 3EDKA 1D3CA 4N0RA 4QCFA 2V5CA 1UKSA 2X8RA 2OSXA 2YL9A 1B0IA 3GBDA 2XVKA 1WO2A 2DPEA 1ITCA 2JEPA 4IM4A 4MB5A 3TTSA 3D4ZA 5FL1A 4AZ6A 4CD4A 1VEPA 3BAXA 3AI0A 3CUFA 5KEZA 1B3WA 1EO7A 3ZT7A 4AEFA 5I6SA 5AC5A 1HN1A 3SUVA 4CCCA 1LQ0A 3BUBA 3WELA 2W61A 1BYCA 2F8QA 3VMOA 1KR1A 5A8NA 1XRVA 4NZCA 1QHZA 2OSYA 2BHYA 3MV11 4JFVA 3GXDA 3VIIA 4LYQA 4P7NA 2XVPA 2Z1KA 2BHZA 2F1AA 2UWFA 1MW2A 3WD0A 2OW6A 2V3DA 3DDFA 3WH8A 2YL5A 1MW3A 1ZL1A 3AICA 2A3CA 1HL8A 4AISA 3L4YA 3AQUA 4GXPA 3NDZA 2A3BA 5ABFB 3MSDA 4AZIA 1JGIA 2B31A 2FE0A 1GQKA 4WIWA 2VZOA 2XWEA 1H2JA 3EYPA 4PBGA 1KBBA 1HL9A 3ZJ8A 2WCGA 6TAAA 4BZYA 1LL7A 3MMWA 3ARQA 4S3KA 4Q22A 3LRKA 3I3EA 3K4DA 4P8UA 2CYGA 1HX0A 5DT7A 1GOQA 4TTGA 1V03A 1WDRA 2J7CA 1BHGA 2OYKA 1C91A 3VM7A 1E71M 4C7DA 4L4OA 1BG9A 1AQ0A 5A95A 5E0CA 3WH5A 1TR1A 1CYGA 2J8FA 4QFUA 5BROA 3AHXA 3GH7A 2VVSA 4P7OA 5GQBA 3WFLA 5CLWA 4MB4A 4JCMA 6A3HA 2ZUSA 3WDRA 1O7AA 1TVNA 3IAPA 1E1EA 3SCRA 4FLSA 3FAWA 3SURA 3VO0A 3AJ7A 2VCCA 3VVGA 3WF0A 1QHOA 2D20A 2BVTA 5DO8A 1NOFA 1G01A 4M24A 2XPKA 2D0HA 4PUDA 1JZ6A 5LYRA 3U7BA 4UOJA 1O6IA 4P7LA 5A6BA 4TOQA 3W82A 3VDAA 1ZU8A 3LXCA 3VD3A 2E9MA 4GZIA 2FHFA 1QHPA 3THDA 3W38A 4IPLA 4GI9A 5DEZA 1U30A 4NXSA 5ABGA 3GTNA 1BYAA 1IV8A 2VJXA 5E70A 4PTMA 2ZWZA 1R75A 1V0NA 4NX0A 5AC4A 4MAZA 3HG2A 5AY7A 4UFIA 3EJUA 3VD7A 1YHTA 4BQ5A 3ARPA 3AHTA 4BCEA 5JBEA 2WWCA 1B3XA 1AQMA 3ZQ9A 3BH4A 3RDKA 3CO4A 2GVYA 4NSBA 4PMVA 3DX0A 2XN2A 4H8HA 1GOKA 5EFFA 4CN6A 3OG2A 5FKYA 2W62A 3APGA 3W81A 2ZXBA 4OGZA 1TZ7A 4CGTA 4JFWA 2E9LA 2ESCA 3DX4A 2JEQA 1E6PA 1W9XA 1WPCA 4CD8A 3H55A 1HJUA 3K8LA 4PCSA 2DIEA 4UQAA 4HPHA 1BG4A 1DWGM 1EIBA 5A8OA 1OIFA 1VIWA 4NZFA 3CZKA 3EJQA 4UZUA 1ESWA 3KL0A 3WY4A 4XUYA 3WMBA 2G4FA 1H11A 3LRMA 3WL1A 1B9ZA 1BQCA 2EPNA 3GH4A 1GJWA 2F61A 1HIZA 2O9OA 2WC7A 3CUGA 2YLAA 3VDBA 2WCSA 1V6VA 3AS2A 1A47A 1NP0A 1EOKA 1KTBA 5FCZA 3LPFA 2X0HA 3WNKA 5GNXA 4DO4A 1PIFA 3AIBA 3ZT6A 1FHDA 3W24A 2PI6A 2D2OA 2XM1A 2PWEA 1W1VA 1VJZA 5AYBA 4Q7NA 2AAAA 1CIUA 2ZUMA 2YDSA 4PMRA 2YA0A 1LL4A 4E4PA 2JIEA 2YKKA 1UR4A 1UWIA 3VDHA 4Z2LA 5E6YA 3CZLA 3UCQA 1ISYA 2VI0A 1GZJA 2WC4A 3W28A 1WP6A 1PAMA 2J7BA 1HJWA 4W5ZA 1GHRA 4ZEPA 3A4WA 3VX0A 2ZXAA 4HA1A 1NWRA 2WPGA 3FN9A 3FY1A 2WK2A 4XB3A 5CGTA 4GZJA 4AD0A 4EKJA 1LG2A 5I23A 1V3KA 1UKOA 4W85A 1HXKA 1J9YA 1D2KA 1WZKA 4QCEA 4ZENA 2CKRA 4UCFA 2O9TA 1XYZA 5CPQA 3QHOA 3ZSSA 3ZT5A 2ZWYA 1R46A 4OBRA 3NYDA 3WFZA 4UFMA 2G3NA 5A6AA 1W1YA 5A6BD 2YLLA 4JIEA 3T0BA 2EQDA 3WNPA 1UG6A 3RM8A 3N13A 3N17A 1DEDA 1W9PA 3CV5A 3VIOA 3AMCA 3S2CA 1KGXA 4R27A 4FNPA 1PBGA 2IXUA 3AIQA 5A8QA 2O92A 1BYBA 4ZXLA 2XIIA 1DTUA 1KGWA 2X2JA 4FLOA 1TFVA 3VIKA 1ISVA 4CCDA 3FHAA 2OLHA 3GH5A 1Q6CA 4JAWA 5DT5A 3VIMA 4Z2HA 3VNZA 1MFUA 2F7PA 3A47A 2DGAA 3VIPA 4HMCA 5D9NA 2O9RA 2UY4A 2DH3A 3LXBA 4LPCA 3EDDA 1FOBA 1ZBVA 4PMQA 4JKLA 3W37A 4A3HA 5CSYA 1MWOA 5IDIA 4W87A 3U7VA 1OGSA 4S3JA 2XVGA 4W7UA 3VIJA 1HKJA 5D8WA 2G3IA 2WM0A 3RMEA 3T09A 4DM2A 4DUVA 3CH9A 1TQWA 2WB5A 3MV01 1WDPA 3FXYA 1NQ6A 2JE8A 1G0CA 1XH2A 3AIRA 2Z1SA 1C8QA 4UQCA 2CBVA 1TA3B 1WDQA 3D51A 4TUFA 5A8PA 1WCGA 2A3AA 1HXJA 1QNQA 4UFHA 1ODZA 4W88A 2XSAA 3SCNA 4J3WA 1UR2A 1EOMA 3CTTA 4HZ7A 2XTKA 1ISZA 1E0WA 4WKAA 3K8MA 4KH2A 4C7GA 1UKPA 4OJYA 4OOUA 1IZJA 1VENA 3VOCA 5JBFA 1Y7VA 4EK7A 3PN8A 2XN1A 2ZX6A 2AOSA 2EABA 1L0PA 4B3LA 3BVXA 3W0KA 4KGJA 4OZOA 4W89A 5D9OA 4J3XA 1PS3A 1E6RA 4D6GA 1HVQA 4J28A 4B3KA 3L4VA 1FH9A 3MO4A 3NSNA 3ZO9A 1KWGA 3UERA 3OA5A 2WVTA 1AVAA 4Z2IA 2XUCA 2W4XA 4QAWA 1NOUA 1G9HA 4UOQA 5CGMA 3G6MA 1E5JA 2A3HA 3LX9A 1C8XA 4DUXA 3WH7A 1RH9A 3RJYA 1E0VA 3ALGA 3M07A 4CKQA 3SUUA 2BS9A 2O9PA 1OGBA 1SZNA 3AZTA 4LYRA 1PPIA 3WF2A 1G5AA 2E8YA 3ZOAA 1OD0A 1OM0A 3WQ8A 4XX6A 1QI5A 1XD0A 4AYSA 1QOXA 4M82A 3DX2A 1GOOA 3IJ7A 1EDGA 3ZJKA 3BAWA 2WKLA 4W7VA 1MW0A 1Q6DA 2XVLA 2GDUA 1V3MA 3FAXA 1AQHA 2GDVA 1HNYA 1BAGA 4W8LA 1K9EA 1QW8A 3B9AA 4HTYA 2EJ1A 4FLQA 2CBIA 4GPNA 4NRSA 1NWSA 5BXPA 3L4XA 2JF7A 1Q4NX 3SUSA 5CXPA 2IXVA 2WMKA 3BLPX 4V27A 5A94A 4H8VA 4X0VA 2BHUA 2VZUA 1OIMA 2QPUA 3DX1A 1MFVA 3PZVA 1G1YA 3BSHA 2YDQA 3WF4A 3GXMA 4IISA 4J3TA 1GQIA 1KQZA 3TTQA 4GI6A 3W25A 1H0IA 1HWWA 3EJPA 4AZ5A 5I78A 4K68A 2DSZA 2DT0A 3VUPA 2E40A 4AD2A 3WH6A 1VF8A 2BVYA 3L4UA 1WKYA 4MDOA 7TAAA 4ATWA 4CCEA 3A21A 3AZSA 2QMJA 3TTOA 3HU7A 1CGXA 4JFUA 2D24A 2CCRA 4PMDA 2CPUA 2V5DA 1FH7A 3WUFA 3A23A 5CG0A 1JZ2A 1CXFA 3VSVA 2WMJA 1QI3A 4NI3A 3CPUA 5GNYA 3OLIA 3CMJA 5GNZA 3VNYA 1MYRA 3VIFA 3WDPP 3B9EA 4LXFA 1S46A 2J25A 2WXDM 3WD2A 1W91A 3EJSA 3SCSA 4HOZA 1CGVA 1M01A 4AZ7A 1JXKA 3L4WA 2CETA 3PZGA 3JUGA 1GHSA 1HJVA 2DSVA 3A22A 2V3FA 4FNRA 4QDMA 5GPRA 4FMVA 1VFMA 3ARVA 1J0ZA 4PRWA 3B9DA 1JYNA 5D8ZA 2VZTA 2WAGA 3WD1A 4L4PA 3MU7A 2A3EA 3CZJA 1JFXA 1FHLA 2GJPA 1BPLB 2CBUA 3T2OA 3AHVA 4TVDA 1WZLA 4UTFA 3ZR5A 1EDQA 2YA1A 3O2LA 1PX8A 1EA9C 1GOMA 1QNOA 4E8CA 2VOTA 2QV4A 1V6YA 1QVBA 4UQDA 4PMOA 4M56A 2D3NA 1W2PA 5C71A 3SCVA 4CUCA 3K4AA 3MANA 4CU6A 3O6AA 3AIEA 3VKKA 1E5NA 1EGZA 3A5VA 1GCYA 1FFRA 3VINA 1JDAA 1VEMA 2DSKA 1US3A 2DT2A 1GOIA 2VL4A 2D0FA 3WH9A 1JI2A 4UOZA 2IGTA 1DWAM 4PMXA 1M04A 3BUIA 1WB0A 2J62A 3I3DA 1UR9A 4LX4A 1HP4A 5M5DA 1FFQA 5E0FA 3EDJA 5I5RA 4WLCA 1K6AA 1UD4A 1LL6A 3RM9A 1V6WA 3AMKA 3VIHA 2QHAA 1CZ1A 2J7HA 2VZVA 5BXRA 1H09A 4KGLA 3WEOA 4V28A 1CECA 2BY1A 4RE3A 4CD7A 1XH0A 2BV9A 1ZB5A 5E09A 1J0HA 3SCPA 1JNDA 4AC1X 1V0MA 3AIUA 2JFEX 3EJTA 5A6SA 3AHYA 1KFWA 5ABFA 1QBAA 2EO7A 4GI8A 1BSIA 3MMUA 3CLWA 2EAEA 3GYCA 3T0AA 4NZJA 3OBAA 1CTNA 4Z2KA 3OGRA 2XJ7A 1VBUA 3PZTA 1CGWA 4XZWA 1ZJBA 1E9LA 2X2HA 4BQ2A 2E0PA 3AXHA 4OKDA 2WKGA 2VT0A 1X6LA 3CC1A 3W26A 4JL2A 3VGEA 2RGMA 3CZNA 3ZJ7A 2BNJA 2VNCA 1E56A 4F8XA 4HZ6A 3WDQA 3VGGA 1GVYA 2XFFA 3IJ8A 1UYQA 5EFDA 2ZUWA 2EPOA 2QPSA 4W7WA 1HJQA 1JDDA 3ARWA 4HU0A 4CU8A 2F1BA 2VR4A 1ZBCA 3GNPA 1OD8A 1SMAA 1C7SA 2PWGA 1W3LA 3LPGA 5IFTA 2OYLA 1W3HA 3WNOA 3OB8A 1R33A 4ZE5A 4D6HA 3WN6A 1VB9A 3QOKA 3J7HA 1M53A 1OCQA 3UR8A 5M17A 2YBUA 2NW0A 3W6LA 1JG9A 2QF8A 4MB3A 1EQPA 3A4AA 2EEXA 3UR7A 3AROA 4ATDA 1ECEA 5E6ZA 1WDSA 4GZEA 4D6EA 4U3CA 1UD8A 4ZXOA 2Y24A 3GZAA 2ZUTA 4JHZA 4ZFMA 4MPKA 1XYFA 1W32A 1UHVA 3II1A 1W9UA 1PZ3A 5HXMA 1KXVA 3AFBA 1R87A 7A3HA 1M03A 4PMUA 2UY2A 4QLJA 1T0OA 2X2IA 1H41A 3WMCA 2D23A 3K46A 2J8GA 4LGXA 1C7TA 6CGTA 1W9VA 1B31A 2V3GA 3BAYA 1RPKA 3KL3A 1U33A 5I77A 3BUDA 3WQ5A 3NUKA 4IPNB 1UUQA 1I1WA 3F4VA 3WENA 1E1FA 4BA0A 2BXYA 3PZNA 1QW9A 4CVUA 2CKSA 4FNQA 4QLLA 4A4AA 4F66A 5A6KA 2WSKA 1CLVA 4P8VA 4CD5A 1OSEA 3AIWA 3TTYA 1E6XM 3A3HA 1XD1A 4PTWA 1L8NA 2WBGA 3L4TA 3EJRA 1GOWA 1JAKA 3PTQA 3AXXA 1B1YA 2XN0A 3WKZA 1UD2A 1QPKA 3ARTA 3I3BA 4CU7A 3DX3A 3CHDA 2XFYA 4M29A 4UR9A 2DIJA 2J77A 1BLIA 3WEZA 4F9JA 1FA2A 4AD5A 4OUEA 3NDYA 4AIEA 4HA4A 4NXKA 3QHNA 1VFUA 1XSKA 2EADA 1ITXA 3OIHA 2Q8XA 2OSWA 3UG5A 1R7OA 2J78A 2WNWA 1PX4A 3LPOA 1CXKA 2WMGA 2D22A 4KWUA 2PWHA 5I0DA 5IHSA 1VRXA 1XGZA 3PBGA 2PC8A 5E1QA 4BS0A 4U33A 5EB8A 1V3LA 2GJXB 1A3HA 5EBAA 2GJRA 1GVIA 1UZ1A 3S5YA 2XGBA 1JIBA 1H49A 2DH2A 3DHUA 4J7RA 1SYTA 1CXHA 3WQVA 2X0YA 4E8DA 2CHNA 4KRTA 1NM9A 2BFGA 1E73M 1Q6GA 4NRRA 2WHLA 5JUVA 3D4YA 2QMKA 4KMQA 3IANA 1C90A 2J74A 1JZ3A 1KWKA 2J7GA 3S6TA 1UZ4A 4MJ2A 2HVMA 5BCAA 1EQCA 3LRLA 1J11A 3CHFA 1NWUA 3BAKA 4DWSA 4DWSC 2WBKA 4WKFA 4YPJA 1RD6A 2DSWA 3ZM8A 3WD3A 2VX7A 3EMZA 4PMZA 5LA0A 2FDMA 1ZBWA 4P7QA 5CSUA 2VR5A 2NSXA 3DECA 3SEPA 3VSUA 4D6CA 1TCMA 3GBEA 4TXEA 1UKQA 4W8BA 1QI0A 4UQ9A 3BMWA 5HPOA 2GUYA 3N12A 3ZMRA 4D6FA 5I2UA 3IAQA 1UD5A 1E55A 1C8YA 3AMDA 3VD9A 5LA2A 4WKHA 3ARSA 4PCTA 1BVNP 3U5YA 3WNMA 1B2YA 1NOWA 2J47A 2DQXA 2VRQA 5TD4A 1WZAA 5HBFA 3AIVA 5A6JA 2BY0A 1NWTA 3MI6A 2YDRA 5HNNA
chains in the Genus database with same CATH superfamily
1FCCA 5AZ2H 3U30C 3QJHA 3GS0A 1KFKA 5DXYA 5DURD 1NGYB 3B37A 4QAMB 5F7UA 4G1EA 5F93C 4ODWA 5H2BB 4H7ZA 3U57A 3E38A 2VN3A 2V2HA 3PJXA 2OCZA 1UURA 3ARBA 3QC6X 2A6IB 2D4DA 2HT4D 4Y9NA 1NLBH 3R4RA 4Q4EA 4TQEL 3LGEA 3D7PA 3QEHA 4PJ6A 4QBXA 3MOAL 1CGSH 2UX7A 3WMSA 3DMMB 3P1VA 3W9EB 4BFRA 1RUMH 4FTDA 3E3HA 4JPSA 5HYFA 4G8EA 5C8JA 4IMGA 2PDUA 3SCQA 4KY2A 1OAYL 4G7RB 5ISZE 2QJNA 3V8CA 5JIPA 2O5ZH 4PN2A 3HQOA 5I06A 5FEBA 1JZ7A 3I6SA 2NX1A 4EXQA 3L4CA 4HFUL 2JKWA 3MW7A 3DFYA 3LIZA 4JHMA 2BY2A 1P6AB 1KM0A 3FDKA 1JFHA 3DX7B 4PS4L 5E5RB 4H7CA 4W9CC 4DN4H 1CD1B 1W6LA 2EACA 5DCDA 3EOAB 5D1ZD 1U2HA 3BDYH 1I75A 3NXLA 3W39A 4DK5A 1B57A 3L21A 1EUTA 1U6AH 4MAYC 3UWWA 5LGYA 1N82A 3GE7A 1RBLA 5E5CA 2VXTL 3ATAA 2O61A 4DP0X 3EBVA 5GJMA 1SLXA 1REQA 2IADB 2V8LA 3TWBA 1FX6A 3RU8L 2A6IA 1RMFH 3S36H 2VCAA 3LVEA 1E4LA 3WTUA 3TN0D 3BUPA 3LKNA 5DTFB 4U1MB 2X09A 3VFVA 1II4E 3EYVB 2MNUA 2R1YB 3PDOB 2XQBH 1F4WH 1GUVA 2C71A 4Y1AA 3VMPA 4E9RA 1OX4B 1G1CA 4H0LC 2QYGA 5F4SA 4WK9A 4U2ZA 2ZIDA 4B9PA 3G6LA 1OAZH 1J8SA 3FZUD 4WRHA 4F33B 2PWDA 1R9ZA 4R4FH 1KGYE 4WUUD 3DG7A 5FW6A 3UJTL 4JL1A 1CPUA 3BPNC 5GS0D 1QO3B 1M9HA 1S3KL 5EOTA 1V6XA 4TSAL 2BCKA 1BVOA 5A6LA 1EZVY 5GGQH 5I1AB 3M0JA 4G8TA 4LKCB 4P2QD 4XO7A 2FZMA 3R1ZA 3RLGA 3WFEL 3TIEA 4GG6A 1BF8A 5J89A 2G8ZA 4H7VA 2CCWA 2W81C 5SV3A 5LNDA 3P2TA 1YMYA 4BRJA 2L7EA 32C2A 5LB1A 2GI0A 2R82A 1KXTA 3K13A 2NRDA 2NSOA 1OE2A 1F97A 5BVJB 2Y07H 2AJZA 4AW7A 3WLLA 4YFLF 4WSKA 3P0VL 3KXFB 4EIUA 3DH7A 5EC1B 2C9QA 1MFAH 2FHCA 3HLAA 4LEOB 3TBCA 5C0NC 2FD6L 2VZ1A 1FORL 4N2KA 4OVVA 1NICA 4X8CA 2IPUK 5GHWL 1JZJA 3UBHA 3V5DB 3BSZL 4BK5C 3BLFA 1JHTB 3MRJA 1E5UI 3M7OA 5DMKA 3ZIYA 5T8GA 4V1DA 1A5AA 1H0GA 4LLYB 5DD5L 1LQ2A 3VWKA 2ZZ5A 5T1JA 5I3DA 1E9IA 3ROOB 1J8KA 5H35A 4KZEH 4XAFA 1I1XA 3BGFC 2D7MA 2JQXA 5IHZB 3MKCA 4EN3C 2ADJA 1DIOA 8TIMA 2Q6WA 3QXAB 1C5CH 4ZJ9A 4IG2A 3IKCA 2WNNA 3QUGA 3X14A 1BFNA 1IM3D 1G6RA 1OX6A 1EBHA 1X97A 1YC7A 4HWBA 4GQ0A 5A1AA 4I9MA 4KQ4L 1KJMB 4AD3A 4DIAA 3QUYA 1Y6KR 1A7PH 2X0SA 2NY0C 3EWWA 2VH5L 3UC0H 3OG4B 4LRSA 5CH9A 1SEBB 2NW2B 1ZNNA 3W0WB 2YHGA 2QDHA 3WK0A 4XE5B 5F2LA 2JFCA 2C9UA 5BZXA 3PWPE 4ESKA 4JUSA 3RLUA 2ZDSA 3LZPA 4Z5RB 5TE4L 4MDJA 1VLXA 2G37A 1QUNA 1BGGA 4JVUA 4OGXL 5IB5B 3RGVA 5JIMA 4OFKA 4O02L 5FV1L 1ME7A 4E9QA 3M5ZA 3PNUA 3VWJC 1Z41A 1P1ZA 2QEZA 4NZUH 4PL2A 4XBPB 4YLBA 5TK4A 1DIKA 1BFVH 5DZNA 5EU3A 1PZAA 1MNSA 2WWMD 2G4GA 4OH2A 1UR0A 2AKZA 2BASA 3GGWA 2ENQA 3LSOB 5E1GA 3KPMA 4RWYH 1ZIBA 5C0RH 4YTQA 3C2FA 3KG5A 1NUFA 4DGYH 3ZL1A 4ATTA 3M6DA 4HFWB 3VRJB 1P7KB 3K4WA 2GLKA 4UQ3B 1SBBA 3KYAA 1J5HA 2H8PB 1FA4A 2WZEA 4YEEA 1XYCA 5J8OA 4FR1A 3TYBA 3BUYB 5CR1A 2RDUA 2ZCKH 5FGBC 3RB7A 3F84A 4L1BA 3RU6A 5ABHA 4Q3MA 2Y9RT 1ACCA 1VP5A 4K36A 4ORIA 5KZ6A 5AG8A 1NCDL 4S1QL 2Q3OA 4RISH 4XP9L 1AQ8A 3IJEB 4ONHA 4YH6A 1TSIA 3UXIA 3GSUA 2INZA 2R0ZL 1HDMB 1QBLH 2L3BA 2OWCA 2IC2A 2GTZA 3N1QC 2BNRE 3TYEA 1AZZC 2FRGP 2DLFH 3BKJH 3MLRH 1GOGA 4WTZA 3CSYA 4QYOB 1W9DM 4US6A 1UWGL 1KFAH 3TU9A 1OTTD 3WY2A 4UTTA 2R8SL 2E5CA 4W4QA 2E6JA 1QEWA 2L8AA 5AKVA 5D4YA 3KL5A 4RDQG 4PRIA 3DRTB 2A0NA 3CFBA 2OKOA 4PMYA 4Y1AD 1OQOA 3OKLB 1BIHA 4H2CA 3FCSB 4K3EL 3SGKC 1T1WA 5BOJA 4BZ2L 5F9JB 1RUKH 4XNDA 4XNAA 3H4XA 4WGXA 4HAFA 2JXMA 2VC9A 4KFNA 3TJIA 4L0PB 3PGCA 2R29H 4XH2B 2EF9A 4E0CA 1TDQA 1XH3B 3TNMB 1IR2A 5AOLA 3UQNA 1N0XH 2VLME 3CC5A 4L8DB 4BFIB 1TR9A 2YSWA 2Q09A 4PTXA 3ZKXB 4A29A 4Y4KB 4FERA 1ZLSH 4E9WA 2VLKB 2C9PA 5C3TA 4ANKA 3IETA 3FNKA 3H12A 5CPOA 4GUFA 3IDGB 3DOHA 3V6OC 3CH8A 2DYPB 3SQOH 4F48A 3BRFA 1YTEA 1OTUD 1YEGL 2GEQA 1FCUA 2HFFA 1FFNB 4M0XA 2OMXB 2FLMA 4CQCA 2NY0D 3BPWA 4IICA 1AJ7H 1TKWB 4GRLB 2ZOTA 5CZXC 4C6BA 5GS0L 1M1XB 4LASH 3OKEA 4KX9A 3O9WD 3GXFA 5I1HH 1WNOA 3AABA 4LSUH 1TFHA 4N2IA 4ZMNA 4LSVH 2E7LC 3WDHA 4YSSA 1XIJA 2AMGA 4IBQA 1QABA 4ZMZA 4R6UA 3TBSB 2A6NA 2IXQB 1F4XH 2J44A 2ZAIA 4M7ZB 2Q2EB 3TL5A 4BK5A 1JD7A 4O15A 2CSPA 5DRWB 3TJHC 2VDPL 2VMCA 1E2VA 3LIUA 2IV9A 3DRQB 3VFMA 3UYCA 3PPEA 2OXGB 2FO1A 1L9OA 3TX9A 1QNZH 4KJWD 1ZWIB 2J24A 4FZ8H 4OU3A 4BQBA 3VE9A 3ARDB 5LZLA 5BJTB 3BW9B 2ARJQ 4S0SD 5IZ7A 1MQPA 1Q6FA 1MY5A 3NYZA 1G0YR 3QWOA 1UR3M 4PBXA 4GG6E 5HDOA 1ONXA 1SFSA 3QEUB 3QZWG 1CWYA 2Y7GA 1F86A 1OBAA 1EK3A 1IKFL 3QDMB 3HMWH 1BMZA 3UXKA 3L1GA 5I1GL 5JIDA 3CQHA 3KHOA 4QRPE 2XV0A 2WXFA 3ESOA 5SWQA 4R7DA 3WD5H 5IB3A 3HBLA 5D1ZI 4J1UB 1G5GA 2WZPA 1B6DA 3LHTA 2X30A 3ZDYB 1RUAL 2GVLA 2VFFA 1C1EL 5B1KA 4XC3H 1V7NL 2C3GA 3MYZA 3MXVH 5D1XC 2V38A 3WFBL 2YJLA 3DIFB 4LCCC 2E46A 2FSEA 1PQZB 2EIBA 4PODA 4Q4MA 4JYFA 2NXYD 5J3HD 1RZKL 4PUBL 2ZX5A 4FPSA 3SIMA 3V4LA 3MUAA 3X1BA 1F6PA 4G7YL 5CEWA 1JPTL 1F3RB 2Y7EA 2Y5TA 5DRNB 2FT7A 1OM3H 2ZSWA 3PV6A 5F6HI 1RFDL 1PDKA 1N5YL 1HKKA 3LDBB 1V7ML 4YSUA 2J13A 4ZD3H 1YLBB 4N3UA 4ODUA 4ZMVA 1OPOA 4AXWA 2J21A 2H1PL 3CNKA 4LLUB 2QJIA 4U10A 3IT8D 5ICZA 2L7UA 1U8JA 3GRWH 1QSEA 4CVZB 4D2JA 2HG5B 5DFTA 2H9AB 1SJVA 2DI8A 3CL7A 4LF3A 5K59E 1J0IA 3SE9H 1A6WH 1YAZA 4M1RA 3MP5A 4POUB 4RMUA 5CHNA 4PVBA 3K6SA 3V4PA 3TS8A 4NSKA 3VXSA 1O5RA 3KPLB 1KBWA 4KW2A 2J8UE 4KK5D 2EDJA 2OODA 3IIOA 4RX4D 4WK2B 3Q0HA 1U95A 2A77H 1QXLA 1RBAA 3URQA 3X3GH 1POJA 4YGVA 4GH7B 4N6QA 2YC1A 5KBMA 2XTLA 3PF3A 4QNWA 5KSAD 1OSYA 4KH9A 5G2WA 2I5GA 3L7FB 3S5NA 2XH4A 4UILH 5KSUA 4XKYA 3A3WA 4N2GA 1UACL 2YXGA 5FECA 3NFPA 5IB3B 4FNSA 2WMHA 1NTDA 1XL6A 2YK1L 2YZ1A 1AD9B 1XEDA 5JDJA 1GW0A 1P53A 5D7JB 2YQGA 4JFDD 4TNVF 2CERA 4NP9A 2HX9A 2WMIA 4YJ5A 2MRYA 2Q6ZA 2WBWB 3NJ3A 1N18A 2FB4L 4DKEL 1Z5HA 3FT2B 3BCJA 3AG3B 4AXKA 4XMKL 4NNAA 1EERB 1D6VL 4O16A 1OM9A 8CGTA 2OJ1A 2R9HD 2X70B 3BLKA 1AS6A 3FT1A 1QTWA 3W1UA 1F4HA 3LH9A 4HP5A 5D32A 4DYEA 5IB2A 4JPWH 4ZMTA 3ARDD 1TEFA 3ENLA 3EZ4A 4NJIA 3VSTA 1IM9A 4H13C 3AREC 1GZGA 3NZHH 3JR2A 4MUZA 2LU3A 4GY0A 3FTXA 2F2HA 3AB0C 1GW6A 4B9GA 3QAZC 2J9YA 2VHLA 1RP8A 2CK0H 4Y1SA 1JVLA 3P3YA 4A6YH 2CEQA 3H21A 4BKNA 3ULVC 1HINL 1FZKA 2PR4H 4IJTA 4URIA 3T3MB 3IF1A 3RGVB 1I9IL 1MWAB 1ZSDB 2P1YA 1I2RA 5CIPA 2VR2A 3DV6A 3SYCA 3B0PA 5EF1A 5LA1A 4MWFB 4JAMB 4C6EA 5IG7B 1HH9A 3AFLA 4M8RA 4F9DA 5EB9A 3TW9A 5I09A 2N3JA 4K3JH 3BWZA 4ETQB 1QWNA 2DQEH 3N1MC 4PRPB 1WC7A 4R0LC 5AQ0A 4MAVA 4PL1A 3THUA 5IT2H 4OECA 1HJXA 3INUH 3R8QA 3VXRA 1JTTA 4PB9H 4U1KB 1CGTA 1IAKA 3SCMA 1VESA 5CSZB 4B97A 3OKOB 4JFXA 4DZIA 3HGSA 3DN5A 1DJSA 1FG2A 4RA0C 4YPGB 4OF8A 1E43A 2LTQC 4TV3A 3C6LA 4OF5A 1FZOA 1MRCH 4WUKL 5F0LB 3TO4A 3BLLA 4RE2A 4HIJA 4M19A 3BN9C 3PL6A 4NUGH 4HKBA 3VFGL 3B0VC 3GLZA 3OKLA 3KNBB 4I3GA 1W2VA 3LOTA 1IGYB 4WNJA 3EOTH 3W53A 3NAVA 4M48H 1OADA 3ZW3A 3VI2A 1ZLUH 5B7YA 2FYVA 3SR7A 3FTSA 3NCXA 3SGKA 5FL0A 3NVQA 4LEXH 4FFVC 4Y9GA 5CN3A 3ID7A 4HSHA 4Q4PA 4WDXA 4FYSA 3UEQA 1X6UA 1YN7A 2X41A 1HIML 5J04A 1G4TA 4PY8J 2DFAA 8FABB 1QR1B 3EYQC 5CUSL 4D8OA 4AZCA 3R58A 2YSSA 2PMZA 2VD9A 3QUMB 2P8BA 2GT9B 4JMNA 5EUOE 4NAEA 2BTMA 2ZXDA 3DUUB 3QNXB 3IJEA 2Y2YA 1SM3H 2ZWKA 2XWDA 4HJUA 3U2OA 2E47A 3Q43A 2V6AA 4EZKA 3NQBA 2PBGA 1VFFA 3TX4A 3EJYC 2I1OA 5DLMH 4ADJA 2C7UB 1KV8A 4TXVB 2VFIA 5DT1L 2JQMA 3I02A 4JFSA 3P7YA 2EEBA 4KPHH 4MZ2A 1W3JA 2VLJA 1UA7A 2X4OA 3VE0B 4CN1A 1U3NA 4G1MB 2RGLA 2JCCB 1V7AA 1P69B 1JWSA 2RTTA 2G5WA 4FOKA 5IOBA 3LSOA 1OV8A 1XGUA 2V5TA 2VUYA 3U0PA 1BG1A 3ARGA 1KIRB 2QELA 2G2RB 3PWLA 3FNDA 5HHOE 4B0MM 3TCLA 3FDGA 1P1ZB 2OO6A 2WWDA 2JJUA 4M7LT 2HBVA 3LZ3A 3PFRA 5HYSB 4NDMB 3DDGA 2CHOA 2J7LA 4W86A 1MELA 4C4KT 3I6GB 4X7SL 1N68A 5J06A 4E41A 3P0YL 2DMHA 3VGBA 4NKDB 4KU1A 4YX2L 2HQAA 3ITGA 4A2SA 3V52H 2UYLA 5IV2B 5LBVA 3ES7A 1MXDA 4N2NA 3DETD 4YHMH 2VC6A 3HG1D 1OZTG 4X7FC 4RAVB 3RGVD 4ZW5A 3DBSA 4JJOA 3EO0B 2HLEB 2XNAB 2Q8AL 1RJZA 2Q3XA 1SEBA 3QO0A 1ETZB 3NPUA 4L4VD 4HJWA 2B59B 2IANA 4JRLA 3KLLA 5C6TH 3TONA 1XS2A 2DM7A 3IBEA 3LZRA 5J6HA 1V3JA 3P9WB 2FL5A 1PZ1A 2X1TA 2N56A 2IKIA 4XZLX 2AGJH 1PEWA 1Z1WA 4YJZL 4H8WL 4YFLI 2LU5A 3MNZA 3FVMA 3S96B 3KPPA 2P7TB 3FPYA 4JKPL 4JZOA 4PSPA 5AN7A 3VI3B 2DMBA 3FQXA 2ROYA 4RDWA 3V1PA 5DWUH 4MNQD 3LEVL 2X3AA 5H35B 1BLNB 4XTDA 1EJOH 1OP5K 3CFJA 3X1EA 5FUZH 1DWHM 1U83A 2OP4H 2YYUA 4PP1C 2F7OA 1JZGA 5E9XA 2HKFH 5F7FA 2E25A 3JV6A 3GSVB 4LLDA 1DXFA 3PWJA 5CBBA 4TMPA 5T3ZE 2DBLH 2Y06H 1B4JH 4LIQE 1U21A 3GMMB 1BZ8A 3Q2CA 3WMPA 1SOXA 4XXDB 2UZPA 5DJXB 7CGTA 5IROD 3NCCB 1RAMA 3QRHA 4OLZL 1K6QH 1HW6A 1R8LA 3ARXA 2CBTA 3WE6A 3TYAA 1ORQB 4TVPL 4XPGH 1J0YA 1JYVA 4Q52A 2UWEE 3WUWG 3QEQA 5HHXL 2NXZD 4XVJH 1W6TA 4NJJA 5I5MA 3LRHA 5EOTB 1NARA 3PP4H 3A4FA 4EIBA 1R86A 4GUIA 1NMAL 3O3EA 3MMEA 4PGEB 3S9DB 1C8VA 4XV0A 4P8QA 3UTTA 2C3HA 4HK5A 2B14A 4H41A 5F1SA 3HNSL 2NY2C 1EX5A 3MUIA 2KS0A 4QRQB 1XAUA 5F72S 3U0WH 1GW1A 4NJGA 1QA9A 3RO8A 3UT0A 4F7MA 4ELKA 4NJ9H 3PANA 2Y22A 3OKKB 4N8CL 4D0BA 3V36A 1MFDL 3BIBX 3AMGA 1R4XA 2IAMA 4FYRA 1A66A 1JI1A 1PZDA 1UQSB 1CLXA 4LF2A 4EOUA 4X6FA 5EMYA 1R3IH 2CO1A 1AGDB 3Q5TA 4GT7A 4H26A 4NO3B 2VEGA 1LWHA 4F58H 3M1CA 1GGCH 4OZFB 5FO7A 2O6DA 1FIGL 3ME0B 5H8DA 1TIWA 4HD5A 4RFOH 1BGXH 5GGUA 1QRNB 5DGRA 1GQLA 1NAMB 4S1SL 1WUFA 3M47A 2E3ZA 4WDIB 2VXSH 4EAMA 3H3KA 9RUBA 4PW9A 2Y7NA 3BUQA 3IDNB 4KKAC 5KYUA 3EOAA 1HAWA 1Q2RA 2YBRA 3TV3L 5IVZA 2RBLA 3H9SB 1R3LA 2NCMA 2ED6A 1GOHA 4KJQC 4EIGB 2XNAA 2XFRA 4BM7A 4YZFF 3X1FA 2BXZA 5GISH 5ETUA 1QPRA 5IV2A 4MMYA 2B20A 4UTAA 2DB8A 3ET9F 5GRZA 4O52A 1PCXA 2P24B 3AISA 2GCYB 2RALA 2ZTKA 2PTWA 3STCA 4YC2C 4E41B 3MCLH 3G6JF 2IS7A 5F8RC 4IMCA 1UH4A 3GO2A 5FHAL 1QNPA 1I4FB 4KDWA 4NDMA 1JPEA 3QJQB 1F6AA 1IC5L 4LPVA 5EYWA 5FA5A 3BGMB 3SDAD 3V5KB 4NZRL 4BQ4A 1LDPL 5GZND 1ZP3A 3DBXB 3BGFB 1TJHL 6XIAA 1A25A 4H8WC 4U3SB 3ZE2E 3IGUA 4AUUA 3PZOA 2OG9A 5BS0B 3L5HA 4G8IB 5D8JH 3VRIB 3VXUB 2OQJA 1HI6A 2JCCA 1XZ0B 1ZJAA 1KUMA 2R4RH 2ADFH 5DK2B 1MJ7L 1T2QH 5HYIA 5L4JA 3MRHB 5F4WA 1OGAD 4OAWB 3TH3T 4ZYKB 1U41A 4Y4FD 5AB1A 1R3HA 4PLKD 2GSMB 4DVOA 1E3XA 5KVFL 4WTWA 5RUBA 3TJPA 2C7UA 2VL5A 5FO2A 3RFZB 3NQGA 3T07A 2F7FA 2ATPB 2F8OA 3MX0B 1L0YA 1SO5A 4OI8A 1D9EA 4U3XA 4XKMA 5E95B 1J9TA 1MHEB 2ZX9A 1A49A 2WMPA 2DBJA 3HAEH 3SPIA 2YD2A 1ADDA 2FFCA 1Q0XL 3F58H 4AZUA 2QFRA 4XN9A 4P7RA 3EHBC 1ND0B 1A3ZA 3H9HB 4F8OA 2MOGA 4S3AA 2VDNH 4TRPH 2OJPA 4NUJB 3UJFA 2YBTA 1I0BA 5DJCB 3EOUA 3G1YA 4GVHA 4UFKA 4N5ED 1Z5YD 4ZSOB 5EN2B 3SOBH 4DPAX 3MBWA 1KJ2L 1E8XA 4GCXA 3F12B 1RZJL 2GYSA 1UWQA 3QBTB 1BWMA 4JD4A 1MJ8H 1AXTL 3NIYA 4LNRA 3O3AB 4KZ0A 5L6YH 1QWKA 3RCMA 3S37X 3F7VA 4DJFD 1GYUA 1UCWA 3VTAA 4EJ1C 3NZ1A 4Y5YC 4KVNH 3EWUA 4TNWK 3T3ME 3VFWB 3LCHA 2RUSA 4K1WA 1GSKA 1HNGA 2A74C 1UR1A 1ORSA 1RV6X 3TSDA 3P69A 3W07A 1W3KA 3TNOA 1MFEH 1TOXA 4XMLH 3CHEA 3SECA 4Q32A 3MGAA 1N70A 1UOKA 1M42A 4GW1B 4K7PX 3QEGL 3M86A 1SN2A 4U1KA 2NTFB 3ELAT 1LO0H 1A6ZB 1JTPA 4MX7A 3TU6A 1I1YA 1FTXA 3TW7A 1IQWH 1OP3H 1UADC 3PF2A 4NAMA 3MU3A 1H3UA 3SDDD 4XTRD 5IKCB 1ISWA 1PWMA 1RR2A 1DVFA 3VIJA 5FYKU 4HNVA 2DZWA 1S9VB 5D5MA 2NXIA 3QYNA 4QHNA 1Q9WA 4RWHA 2BDQA 1J05B 3NQKA 4UB0H 2F54A 5AVRB 5IOPA 1B3ZA 3P4LA 3OC8A 2I14A 2ZZ4A 3U0HA 1HH9B 4DO6A 3WBAA 2P53A 3LZFL 4UYQA 3WJSA 2ZJSL 2HT2D 1KB5A 2NPLX 4PUEA 4Q4RA 4JY6A 1MWAA 1ZSDA 4B9KC 4EPSA 3ANVA 4O18A 1SUXA 2ZKYA 1FZKB 4N2MA 1WTLA 2XA8H 4W6YB 4Z7QE 1S5VA 3N1GC 3PZQA 1B0RB 4L1TA 1BD2B 4O19A 3HR5A 3MUZ1 3ABOA 3MUCA 2X1QA 3E02A 3B9KA 1AG0A 2ZXEB 3JYCA 2WXJA 5KW9H 2W9EL 2INFA 1X44A 2FH8A 3RY5A 2XFXB 5IB2B 5DO2C 2X87A 4I1NB 1CICC 3NDYE 4F15B 1FP9A 2HRGA 1C08A 1TQUA 4KUZH 1JGEB 3SYAA 2MMXA 2BLEA 3NP4A 4J4PC 3NVTA 3VFRB 3O0RL 5ITBL 5GJNA 3AU0A 1UWAA 3MBEA 4ZQKB 3LCIA 3TZVB 1KPVB 1ZHNA 3L3OA 2VB5A 3HG5A 3J27A 1MG3C 4JQIH 3IUIA 3G0UA 1FLTX 1DVSA 4AUBA 1XPYA 3UC2A 4GWEA 3SE3C 1I7UA 2K6ZA 2XY2A 3FH5A 4HXBL 4I13B 4QHMB 1CCZA 3ECBA 4XNYH 3S35L 3ZL4L 1GORA 4LBRA 2W38A 1CDUA 2MQGA 5FECB 1TLMA 2H9GB 4P3CH 1QOKA 3ETTA 4DCQA 4GVIA 4X22A 4ACZA 3WS6C 4K2SA 2VEMA 1QI4A 1WKDA 3MS8A 1NAKL 2F15A 2WXIA 4P4KC 3OPZL 3N1PC 3UTOA 1OCWL 2Y7OA 4C83A 1GHFH 2AXHA 4M7JL 4PEEA 4YGVB 5B21A 2C0HA 2IGFH 3QNYB 4G9PA 4JTKA 3MJWA 3EH1A 2R1MA 4PVNA 3O2DL 4Y90A 4QTHB 3W56A 2QQ6A 1OAKL 3CMOL 4S3BA 2OTDA 4P46A 5D4QA 3JWDC 3VXSB 3L9EA 3W5NA 2PZNA 1IC4H 1LLWA 3I7QA 4FJ6A 4XBGA 1CZ8L 2PDHA 4W4OC 4LV9A 3VZZA 4I88A 1X4YA 2WWMC 5EC2B 4ZUSA 4UTMA 2H9AA 5HHOD 5TDNA 5K9KB 2CESA 1KKRA 3HZKA 1XCWA 1U3HB 4Q8NA 3AC0A 1IILE 1T03H 2E6DA 4U1SA 4N86A 3DX6B 4OQ1A 5IQ7L 4X6DB 3LHYA 2ADGA 1PL3A 2PW1A 3VX1A 4ES8A 4WR3A 4JN1L 3PV6B 3SE8H 1QPXA 5SWSA 1K3ZA 1EJOL 2VEIA 4XPHH 4RNJA 2WQVA 2QHRL 3R11A 5F7EH 3TYZA 3ZS4A 5ACZB 4ZK8A 1Q9LB 1X1ZA 1ZS2A 5I16B 1K02A 2ZC8A 3D0LA 1SW3A 4N9DA 2E9GA 1DQMH 1OCJA 2YW3A 1U92B 3LS4H 3S83A 3SB3A 5FOOA 4WY0A 5LAPA 3VQMA 2NY6B 4IGBB 4LLVB 3M44A 3ESNA 4ICXA 4ORGB 1K8IB 1PJ9A 5FFOA 4QP0A 1BOGB 4E9YA 1FVDB 4FXKA 2V5YA 4KI5C 4PRBB 3FONB 2J7FA 3M6YA 3P9LA 4OM0L 2RHGA 2J7DA 5TJWK 2HP4A 1E9QA 2PYED 3LY6A 2YFOA 1K9TA 2ZDRA 3GVQA 1NINA 2CZNA 1A02N 3SADA 3OAZK 4OZFH 4YHIB 4S0HA 3K8KA 2V5SA 4YUEL 4OGAD 1VYRA 5CJOL 3TCEA 2C79A 5C0FA 3IGAA 4NHCH 3SDDA 3KBFA 1CFVL 4E41E 4DXVA 1A5OC 4B16A 4WJKB 1L2UA 5JPMB 3ARDA 3HN3A 1MREL 2VC2H 4YHKH 2R24A 3LD8C 1NCWH 2FIKB 2AXGB 3KWTA 3RA7L 2DUAA 2FZDA 3NQ2A 1PLAA 3TP4A 4N8CH 1S5MA 3SUSA 1GQJA 2PRHA 3KPRD 3K80A 3RWJB 1NSJA 1QLEL 1QZ1A 3SODB 4LBEA 1FVDA 4FXKB 4XRCA 4ANWA 3W2JA 5F21B 5JQ6L 1YLVA 4TL4A 1Q6RA 4U5IA 4X0NA 3FHQA 5D2NA 5DHVB 4LEBA 1JV2A 5E8NA 4EAYA 3TR9A 3CXFA 4KDVA 4H25B 2QPFA 4Q4KA 4F0RA 4LRIA 2Y62A 2J1WA 5LNUA 5D9PA 5LGJA 3W83A 1BREA 2JJTA 1USZA 4I9TA 4G5ZL 5TDPB 5HDRA 5FYKH 3WKML 2F7RA 1OOWA 5EIIB 2Y7MA 4O2FA 3VFLA 1C9SA 2ZRWA 2VX5A 3CJPA 2EDKA 4UNLA 4OBSA 3WMLA 4G6MH 3O3UN 3R5EA 3GXTA 5DR5L 3Q94A 1KLYA 1JCLA 4XPTL 1CURA 3ULVH 1P5UB 1XAKA 4U2YA 5G5DB 2A4AA 3ABXA 2EIZB 4G8GA 4ZFFA 4JVPA 1XC4A 4K94L 4KXDA 3C87A 4UQEA 3PY2A 3C5QA 1FAKT 3DUSB 3QUMH 4X2UA 2X05A 3UAEA 4EZMA 4Z7WF 3IV8A 2AKRB 2D2JA 2QADD 4G5DA 5B80A 2TRSA 3GKWH 3NOEA 2QXWA 1ED3A 1JYXA 5JMUA 3T42A 2NNAA 3ITLA 3KR3H 2D0GA 5DD3L 5KTEL 3EFDH 3D6GA 3R1GL 1XV8A 2WYHA 4YSDA 5F9JA 1IZKA 4O5LH 3OMNB 4XP1L 1JN6A 3EBGA 2W92A 3MLVH 2E28A 2X9YA 1OF8A 4TV6A 3NL5A 5HULA 2QCDB 4XZNX 4MADA 3QR1A 1YPXA 5DUML 2ZZ7A 3QCTL 2ISDA 4V1XA 2R15A 3R06B 5E2TH 4E2OA 1CENA 3O8XD 3MJYA 3THCA 1UP2A 4DVBA 1TV8A 1PSCA 3T1GA 1D3CA 5T1KB 4QCFA 1NC4A 1T20A 3UA3A 4IGMA 3WK3A 1L6WA 1NIDA 4NQVB 3GHBL 4QIRA 3RZCA 1WT5A 5IF0B 2YL9A 1B0IA 4NP4L 3JT0A 2CR0A 2XVKA 4UM8B 3EPMA 4J9JA 3FU0A 1HZHL 4FZEL 4NILA 4I9WE 2OI9C 3IPWA 1ITCA 2JEPA 3I6LD 1Q7QA 1W1ZA 4RDYA 1KPVA 1ZHNB 3L3OB 1FWXA 4DJMA 2B8OT 1I1AD 1KTLB 2Y1AA 4OT1L 3IWUA 3QC3A 4XO4A 4ZBJA 3JWOH 4G7VH 4KCTA 3H7VA 3BAXA 3KJ6H 3NESA 4RZBA 1ZRUA 4IBYA 1PLBA 1B3WA 4M62H 3ZT7A 3MXWL 4ZS6D 3KPMB 1OFQA 1HN1A 5DD1H 4E0RA 3GSWB 4HIXL 2QS8A 4JBRA 4JR5A 4Y4HD 5F7NC 3WELA 5L0QB 1XIMA 2GSGA 1XF2B 2APVA 1XGPA 4DF2A 4EWND 2YN3A 4MJ6B 4XBSA 2IG2L 3G5VA 1QHZA 5IJVB 1W0WA 3GXDA 3JXAA 2OKMA 2O4MA 4K3ZA 3EOOA 1ZRQA 1ITQA 2GUUA 5HJ3B 4IHCA 3WK1A 5F2MA 3D2TA 3ZDXB 3S3BB 2E1WA 3AUWB 3NZRA 4JRXE 3PJNA 4MDJB 5I1LB 1MCHA 2ICWB 2UWFA 2ZSVA 3PNWA 5FUOH 3UTQA 2CG9X 2Q2LA 5ADOL 3N44B 8PAZA 3PE9A 2ZYFA 3CHVA 4DEUA 5DXXA 4Q0XH 2V3DA 3RVUD 5HWJA 5EMUA 2YL5A 1MW3A 2O26U 4J3BA 1UC5A 4NKMB 2Z2UA 4AISA 2ZQKA 1AR1B 3L4YA 4HGWB 2CUMA 4XVEA 5BVPH 4GXPA 1IKNC 4JEGB 4J8QA 4NNBA 1P5VA 2ITFA 3R10A 4KKLC 4FXKC 3OVGA 3MSDA 3S5SA 2COVD 4M5YH 2B31A 2FE0A 3JZ7A 2K6YA 1XF0A 2JBMA 4HF5L 5CR8A 4KAQL 4N7QA 1W16A 1A50A 2V9RA 5ABTA 3E3QE 1RXOB 5T5FL 5EDSA 4O9HL 5IROA 1MLCB 2BSCA 5IESH 1JE6A 1EUUA 5JW5B 3W7CA 5AB2A 1XP3A 3C5XA 4MCMA 2WCGA 2GBAA 4NRXB 5GS1B 5GZOD 4LNRB 2V17L 2EECA 3CIWA 3P02A 4M1DL 3T5WA 4HUNB 2QQNH 1BECA 4S3KA 3K5SA 3WS3B 3X3GL 3GG7A 4GH3A 3E7JA 3LRKA 2E74C 3MNDA 1EO8L 4L1GA 4CMHC 4AY8A 4ENZA 5IVXB 3BH9A 3WJMB 3N0PB 4KRPC 1BXCA 1JHLL 1WV2A 3KBEA 2OR7A 3Q6GL 2AJZB 1A4JA 4Y5XB 2H6OA 2VDOL 3P4OA 3LBCA 1QFWM 1ADQH 4FS0A 1XTMA 4WW2F 5F7LB 1AGCB 5DT7A 3U1QA 2Z8VC 5HDQH 2VRAA 3M0HA 4LUJA 1DO6A 1JRHL 2CJTA 4OI9A 4K5LA 4GRSA 3VKAA 3ZN6A 1WDRA 1VF5C 1KTRL 2F5BL 4ODTH 4OZFG 1C91A 3W87A 4UTBL 4MKMA 4L4OA 1L6SA 3QLDA 2PKDA 3JWNH 1FY6A 2QIWA 1BZ9A 1KCXA 3QMRA 1AHWA 2DYSB 3AYTA 4PGJA 4PJAA 2W5PA 3RP1A 5FO8B 5SWZB 2ASHA 2WXNA 3MA7A 2DKSA 1KRBC 4OAWA 5GQBA 3TF7C 5L4IA 6PTDA 1TEGA 4CILA 3LA4A 3WLNA 1FVCA 1LO5A 2Q5BA 5JUEL 1T89C 2OQJB 4JCMA 5LCVA 2ZUSA 5IY5B 15C8H 3DV4A 5F9WB 1TVNA 1GZHA 1Q9KA 3MFFB 3EH3B 2EIEA 3FYPA 3WFCL 2K3HA 4RV8A 4HSAC 2VMJA 4OUUA 3FAWA 4TUOA 3EG9B 4EOWH 5LWYL 3AJ7A 3FQ2A 3AG2B 1M68A 1IVLA 1M4KA 2AL1A 2NVCA 2QF7A 2VCCA 1QJWA 2JJTC 4RISL 2IADA 4FR6A 4UMCA 1E67A 4MAUH 1MFCL 5G4NA 2RAMA 3STGA 1M2OA 2OTPA 1QOPA 3DFOA 2ZPKH 4XN2A 1H7XA 4XWUA 1MWAH 2FKPA 2WQUA 2PDMA 4ASTA 1IZCA 1T89A 5DO8A 5ABAA 3HC2A 1JDFA 1JERA 2NXZB 4YQXH 3GIQA 3MRQA 3P30H 1G01A 2D0HA 2I69A 5KG9B 1QPOA 4Z7AA 1RVGA 4YFDB 4WSHA 4F1SA 4Z1CA 3QS3A 4NI6A 1OE1A 5LYRA 3FTVA 1RUQL 4PJXF 5KG9A 3E6EA 2BX7A 1T0NA 2OXHA 4P7LA 3RU8X 3W2UA 4BI5A 1N64L 3H4FA 1HK6A 1GC1C 3S46A 5T9CE 5B7ZA 4MDRA 3C3UA 2HB0A 1GGYA 3LXCA 3G7TA 3C2VA 4ZR8A 5F6IC 1G9MH 2ZCLH 1IAII 1OGAB 1YEIL 5GGUB 3THDA 4F0KA 4BY3A 3B8TA 4ACTA 1W0MA 1U30A 3G04B 4AITA 4PJDB 1NKGA 5FA3A 5J12C 1NFKA 1N19A 2BP1A 2WV8A 4PJBB 2VEKA 1U91A 2WUCL 3L13A 4TUOB 4NO2B 5E00A 5JPMC 5EEVA 1JBJA 4OBTA 4PTMA 1GTEA 5H2BA 1V0NA 4NX0A 1Q9KB 3MFFA 4RDQF 2IANE 5FB8A 2DZBA 5AY7A 2WUBL 4UFIA 5AC4A 4WNQA 1JEZA 7FABL 4PE8A 5FPIA 3QUXA 3RUBL 4NQCB 1QVOA 1IEHA 3ENEA 3LQMA 4XAGA 1YPZF 3AHTA 3QQ4A 4DI8A 4RMWA 4G7EA 4IJBA 3QORA 5E9DE 1HCZA 4BINA 4ERSH 1AQMA 1KNWA 4LCWE 4S23A 5CPNA 4NFDA 4DNMA 2XXGA 2MH4A 5DJ6B 5EUKA 3V4VH 4WUUE 4PMVA 2VSMB 2YUWA 4H5SB 2W79A 4H8HA 5ENWB 5G4EA 5T8IA 2FIQA 4UTJA 4JFOA 4F7CA 4HEMA 3QS2A 4EDWH 4GAYB 5FKYA 1WDAA 35C8H 2PO6C 3QT2A 4XTIA 3NA4A 1AGCA 1SEQH 1EGJA 1E0OB 2ZXBA 4S0TD 4Y7OC 1IKNA 3OXSA 2DOCA 4LL1A 5SWZE 5XIAA 3R8RA 2NY3B 3P4OB 5CINL 5AW3B 2A4CA 5B3NA 5I2IB 1I4NA 1C16B 2IQ0A 3OZMA 4E2VA 5KJRL 4L5ZA 2ESCA 2YRBA 2KT6A 1TF4A 1NOLA 1R3JA 2KPWA 2P3YA 1FLRL 4FG6C 3LB0A 4QG9A 1DSYA 3FUKA 2VM9A 4CD8A 3T77A 4PREA 3N0AA 3K8LA 4XCNB 2DIEA 5HYJE 3W22A 3VSQA 5GS1A 2FNBA 1W5OA 2Z7KA 1OIFA 1Z5LB 5EULV 3AVEA 4PJIF 4NZFA 2YPLA 1UCBL 3G9AB 1RIUH 3MJ7A 3CXOA 5CN1A 2IO5A 4XVUC 2IV8A 4IW4C 3FQXB 1O6SA 1A4KB 3ABLB 4APQA 4B9CA 2WTOA 1UXWA 3M41A 4Q7IA 2JIXD 2JKJA 4HWUA 2H26B 4KQ3L 5EBWA 4HJSA 3TN0A 3KL0A 4XUYA 4BQCA 4AEHH 1NEPA 3WMBA 5LNGA 2Z64C 1KFCA 2V0TA 3WL1A 1SJCA 3N2CA 3WO8A 3O6FD 1PD0A 1JPHA 4UC5A 4HPOL 4ZUUA 1PB0A 1VDGA 5CAYB 2I60L 1IIGA 3NIFF 5B1JA 4QJ3B 5ISZA 4HH9A 1KM6A 4LC8A 3R8HA 3N6YA 5KVEL 2X4RA 1T7LA 2CLIA 1EOKA 3R0DA 4FHKA 4JDYA 4LBUA 4QE5A 3IDJA 2B39A 4TVPE 4DO4A 1PIFA 5IR1A 3L1EA 4HCRL 3UH8A 1DBJH 4F2MA 4O1DA 3I6GA 1Q38A 1GH7A 2QV2A 3G08B 5CD5C 5CCKL 1FHDA 4A7GA 4LT9A 3IGHX 1V7MH 2GL5A 3QDME 1W1VA 2RJHA 2YXXA 2NDGA 3H4GA 3V0GA 1T22A 5IJVA 4Q7NA 3FBQA 2ICEB 5I6XC 4C1NB 4W9GC 1GKRA 1CIUA 3O0KA 4G59C 4TTDD 1XGPB 5GJSL 5KWYC 1XGUB 5EU7E 3NCWA 4B2DA 4P9HL 4YDZA 4WOZA 2YA0A 3OW1A 3T0EC 2FBRA 5K39A 3S5LA 4G1MA 2DI7A 1FWCC 1W5PA 3LN3A 1XCFA 2FX9H 4KX7A 1YEKL 4GMSH 4NPYB 4WFGD 5FW7A 1JUFB 1MEWA 1IAIM 5HP5A 4MSWB 5K9XA 5T3ZL 3UCQA 4FQXA 3PL6D 4JFYA 4PLOB 2PWVA 2VI0A 4IFKB 1QFOA 2OELA 4MNHB 5HJLA 5TF1L 1CF1A 1KC5H 3V4PB 2RFGA 1UWFA 4QRSA 5G2IA 3W28A 3LTYA 4A8LA 5T33H 2XWCA 3DX9B 1A6VL 1MUJB 4ZEPA 1GHRA 3LHUA 3A4WA 3NCYP 3ZDXF 1ZFJA 4JYDA 2H4EA 3QH3B 3RWIA 5M2FX 1QEXA 4Z3FA 4I9WD 1NWRA 2ZXGA 2YZ5A 4NQVA 5DVMA 3V0WL 1L6ZA 3E6HB 4DK6A 4IKLA 4XB3A 1IBFA 1LLAA 5CGTA 1X96A 4XVTH 5IVXE 5T1LD 5T3XD 3ICJA 2IDSA 4MQTB 4GZJA 1GGIL 3BO8A 1YEHH 4M4RA 5LXVA 3QNZA 1AJ0A 3TGXA 4EKJA 2DIAA 1ANUA 3KYKH 3CYJA 3AUJA 4ZAKA 1AC0A 1UKOA 4PJHB 3FQUB 3GBNH 5TPWH 2XU2A 4OB5L 2VDLB 1J9YA 1YC8A 4FQ1H 5ESQA 5ICYA 3Q8BA 3TO4B 4KKNA 2CKRA 4X80H 3G5WA 4OLUH 1BGXL 5HJDA 3BQUD 3DVGB 3LS5H 2QLVB 5LO7A 2ZWYA 3LN5B 3TQ0A 5I8KH 1CO1A 1VCFA 1WG3A 1AXSA 4TUJB 4LVBA 2JIXA 2DQDH 2GIXA 3FJ6A 3W2NA 1QNIA 2CGZA 3WFZA 4UFMA 2J88H 5DANA 1FCGA 2V2XA 3KWUA 3QRLA 3U2JA 2JQAA 1N4XL 5KVGE 4GNVA 3TO2A 4D8AA 4G1NA 4JIEA 5CSSA 1RMFL 4F8TA 5E8DL 3FUJA 4CCZA 3RM8A 5EIIA 1YADA 3N17A 2QZ5A 1IAMA 3V7AE 4JAMA 4X9BA 4ANVA 3AMCA 5D30A 3SO3B 4HUKB 1G4EA 2QCNA 2YPVL 4DQWA 4R27A 1OAZL 4G6FB 1PBGA 1QKZH 2H0PA 3EAKA 1RZ7L 2OK0H 4MA7L 2V63A 4L64A 3QLLA 1N0LA 2F1EA 4ZXLA 4MMXB 3SW6A 3NZHL 4XB7A 1DTUA 1T04B 2X2JA 3BUTA 5JR1H 1TFVA 3KWSA 4L6OA 2EVHA 3VIKA 4LPYA 3RWJA 3QO1B 1JRHH 5DK3A 2BWGA 4I9XA 3E12A 2W95A 2OLHA 1CG9B 3T4YA 3P61A 4XO3A 2NX3A 2DQTL 3QORD 3CDGB 3Q01A 1E9PB 4YXLH 1C12B 2E6PA 1D2OA 1U6AL 5CCGE 4Z2HA 5FCUL 1QFHA 1E8ZA 3P73B 2VOMA 1YEEH 2F7PA 4B90A 3NL3A 1I2NA 4HCGA 3T0CA 3FUHA 4PIRF 2UY4A 4PRPE 5HGBA 1TCDA 3LMJL 3EDDA 1QCWA 4L9ZA 1ZBVA 1E9QB 2A9DA 4X7DC 4DLMA 2H47C 4QG8A 1A7RL 1OXYA 4HAGA 4JKLA 4RBPK 4Z3HA 3W37A 2JVUA 1MWOA 4M1BA 3FONA 4YAQA 5D7HA 1Q8AA 3PG8A 5IDIA 2WNQA 3PQYD 1OAUH 4O00A 1ZDSA 5AW1B 5AEAA 3U82B 1K8IA 1M6UA 2FJHB 4X4XB 5GGVY 2OX5B 4WFEE 5IQMA 1H7OA 4TQEH 1M3UA 1W5MA 4BH8A 3B06A 3MZNA 3S5OA 1NGWB 1LP9F 2KLSA 4JHAL 5LKNA 1WS8A 2YCLA 2ADYA 3SO7A 1IBHA 3GTVA 1P4UA 5D1ZC 2LOEA 3S35X 1ZY9A 3GNMH 43C9B 1VKXB 2WJZA 1EXUB 3W9DA 3RMEA 4LCIL 3ERPA 4DUVA 4DM2A 5LNVA 1NGXA 4XBEH 3B0YA 4TSAH 1YEDB 3P30L 5C2XA 1L9SA 4NSKB 5D7KD 4XD4A 2ZXCA 1WWCA 1ZVYA 2B1AL 2WO4A 1B3JA 2OX1A 2Y6TE 3MFGB 4FCHA 3NFSL 4WI7A 2NZ1A 4HHHA 5HNUA 6ALDA 4UU9B 1FZJB 2WNKA 3FUEA 1JMZA 2HK0A 2NUYA 5T1MA 1I8LC 1C8QA 3LDVA 4YXKL 1MJJB 1PVNA 2DS4A 5HJGA 1TA3B 1U58B 1TJGH 3CXDH 3TO4C 4EUPB 2H8ZA 3TSMA 3DXAB 2A21A 3NP3A 1TPC1 1YUKB 2KPNA 5DLCA 3DSNA 4P5KA 1F74A 1VCAA 1ODZA 5K9QI 4UU9A 1WZ1H 3Q8AA 1F3XA 4OLWL 1SXCA 2ZSWB 1WBZA 2P8LA 1BFVL 2X42A 3P0YH 1UR2A 4EIZC 3CTTA 3MLXH 2ISSA 3QIWB 4TO8A 2RCSL 4IMAA 4NI8A 4NQDD 5DVOA 1FL3B 1SDAB 1SVZA 1W72H 3TASA 3ZLQC 4IIBA 3MRNA 5HHPB 1F00I 1YZZA 2I17A 1UKPA 2HTLD 3OPSA 3QKEA 3VDGA 5PTDA 1I85C 3HE7A 1CLKA 4MKTA 2MCPH 2IPTH 1GG1A 4HK0A 1U8NA 1G7QB 1J1XL 5JBFA 4AH7A 5D5MF 5C6MA 3UTTD 4EK7A 1DORA 3PN8A 4HBCL 2AOSA 4QHMA 5DUPL 3NEHA 4NJAH 5HMSA 4PMFA 2LFGA 4A38A 1KCVH 3RAJL 4WZ9A 1UFUA 4UBDD 2CKBB 4RPPA 2HRLA 3TIDA 1LM1A 1XISA 2W60A 2X4SB 4TIMA 4W89A 1JK8A 5ADPH 4J3XA 1RK7A 4M5ZL 4ERIA 4QHLA 1D5BB 3HQNA 3OV6A 4J28A 1FH9A 2HX7A 3E1ZA 3SQBA 3D09A 2GIMA 1R17A 5I6XB 3DRQA 5GZOA 5ANMA 4DY1A 3FVDA 3GSXA 3QR2A 3BE1H 3S8GB 4Z2IA 3RX9A 2AK4E 3STLA 1HILB 2AGJL 4JRXD 2VGFA 1YDOA 1MCPL 4QTIH 3IGXA 1QD0A 4Y5YA 4ZW8A 4KK9D 1O9WA 3GPEA 4BZ2A 3DGRA 3MA9H 2JEQA 4PRNA 3B7UX 3QZNA 4QXWA 5FYLD 1TKWA 4FL4C 1KN2H 4GRLA 5A7BA 5J4MA 5KN5A 5LGHL 4IMEA 3TVAA 1MCWW 3AU1B 4AI7A 3RBSA 5XIMA 4F8QA 1NDZA 3B9NA 4BJLA 1Q65A 2ABBA 1G7HB 4ODXB 5CEYB 1FZMB 4R9XA 1BX2B 3WH7A 3A9BA 3G5ZB 3SUUA 4CKQA 1ZHKA 2R0ZH 4HJGB 2W27A 3EB2A 4LU0A 2WYZA 3BZFA 3CXHJ 3OX8B 1OEPA 3SGDH 4E42A 4N9GA 5IHWA 2NLYA 2ICWJ 2RJMA 1SZNA 2OMWB 3BKML 3QZOA 4PCKA 3ZHKA 1OGBA 1WAUA 4LYRA 3W3OA 3FFSA 3OYZA 1ZS8B 4GNKB 2E8YA 3ZOAA 5HK4A 1OM0A 4WXYA 4PRHE 1QI5A 4JO4L 2TSYA 4JQAA 4MJHA 3GI8L 3B2VL 2HTMA 3IMRA 4XX5A 4MJID 1WBYB 1Q0EA 4MCYA 2P43B 4Z0BL 1K7FA 4Z95H 4CQDA 2EDMA 3F7VB 3IJ7A 3ROLA 3ATEA 1EDGA 1F3WA 4PRIB 5EIVA 1SY6A 5AB9A 1POKA 1GC1H 4HHAA 2P44B 2VJ8A 3WQDA 1Q6DA 2XVLA 2CZDA 4PU2A 3FRUA 2CLEA 1LILA 1MY7A 1UUOA 3DTUB 1H6EA 4FZ8L 4A2RA 2NW3B 5LAXB 5JNYB 1OPGL 2R4SL 2OVLA 2NUTB 4QDWA 1DDHB 1XLHA 1QW8A 1XGRB 1GVFA 3CV7A 1ND0A 4I90A 3FU3A 3VG0H 4S1DD 3GSUB 4GPNA 4QX4A 3W7EA 1VSCA 2BP5M 4HWZA 4ZT1A 1R5WB 3P74A 5F0JB 3UBXG 4OZ4A 4J5NA 4WGKA 3P8IA 3DX9A 1EFXA 1WUNT 2X4PA 3GKZA 3JV5A 3ZRFC 4CW1B 3VFNB 2YD7A 4MD5B 3BUYA 3BRGC 1A1NB 3HHSB 3D39E 3LH2L 5D8JL 2IXVA 1ROCA 3RFZA 2A1WL 2VL5B 1AJ7L 5A94A 5KSBA 4H8VA 4BWLA 1T5XA 4Z42C 4NQEA 3WKQA 3L2IA 2QPUA 3DX1A 4JIQA 4G83A 1UZGA 3W3BA 3V8OA 4A2HA 1FWAC 4LGPB 3WTSA 5CCHE 1NBYA 4BD4A 2IDCA 1CLOL 1G1YA 2BVQB 3BWSA 2E86A 3VRIA 3WEAA 2NZLA 3VC5A 4I9JA 5IW6A 1MF2H 3C3NA 4IISA 5DQJB 1KFLA 1TZ9A 4ZB0A 3MUUA 4H88H 4NN7C 2YAMA 1F6AB 3D12B 1H0IA 3TO4D 1LQSR 1FNLA 3D0CA 3EJPA 3QN3A 2OCCB 5H94B 3CIXA 2YO3A 4H3DA 3ZYOA 1UROA 3FTGB 4Z5RA 2PDYA 1C5DB 1ZDQA 1NIFA 4ALAL 2DSZA 2DT0A 2DKMA 4UDTA 1XWVA 4HH9B 2E40A 4F5CE 5BMFL 3E9TA 3UTZB 1NY1A 3ITTA 4FF7A 1SPDA 1AH0A 2H1LM 2PF6A 1WKYA 4MDOA 4KKZA 3H9SA 1ROWA 4ATWA 5FX3A 4BV1A 4FRWA 3A21A 1JOIA 3KYOA 1C1EH 3L45A 3VI4E 2FWOA 1B5TA 3O9WB 2DZVA 3AZSA 2QMJA 2XFGB 1QRNA 4UTAH 3WXWH 1E1CA 3TTOA 3HU7A 1CGXA 2GFBA 2ATKB 3HC3L 1OARL 2L4OA 3QIUD 3GIYA 1E6OL 3EBAA 2XUWA 1QSFD 2FTPA 3W23A 4AVNA 5L2JA 3B6SA 2ICWI 2DEWX 1L9RA 2CCRA 3BD5A 1H3XA 3PSWA 5AOMA 1TWSA 2DVXA 5BV7C 4PMDA 2F54E 4L2YA 4XCNA 2TSAA 5CEZD 3OSVA 3DIVA 3W1MA 2XQBL 5FYLH 5JHDB 3WUFA 1MFMA 1KPRB 1OSPL 2DD8H 2IFFL 4DI9A 3E0LA 4DOHE 4KROB 1XDMA 3VSVA 1IM9D 3PPFA 4UB0L 3QFWA 5I30H 2Z2AA 3F7QA 4OLYL 5BVJA 2WAQA 3WD5L 1HSAA 1UBSA 3IKKA 3N3EA 4AYFB 2C13A 1AXTH 3W1AA 5LKYA 2OZ8A 4I0PA 4FZEH 3QC5X 1IKFH 2MHAB 4HUUA 1H6FA 2XZCL 2XJLA 1U8HA 4FL4B 2OB3A 3PSVA 4IH3A 1ZXQA 2BSDA 4Q56A 4XOEA 3UWZA 3QZAA 4J4KA 2ZOKA 5CILL 4KO6A 3WE6B 2LR4A 5D2YA 4AF0A 5D7IA 4AYFA 4YSEA 3HI5L 4GAAA 2WXDM 2A77L 3LKSB 1AJZA 1XCQA 1UT9A 3B5TA 1VBGA 3SCSA 3HCVA 4F33A 2VXQH 4PP2A 1Z42A 5E7BA 1N6QL 5LXGH 1EEQA 2NY5H 1Z89A 4LAOA 5JO5B 2D7TH 1ACYL 2HT3C 5CP7B 2FUQA 5T1DH 2BWQA 3RUGF 1GHSA 2AQSA 4M4PA 1KM1A 2ODHA 2DSVA 3PDOA 5GPRA 1RCOB 2XT1B 3KVLA 1OHZA 2YPVA 3M8OH 1S2AA 5L2KB 4AE1A 4URTB 4GOSA 5EOQL 2XZ9A 3AQXA 3W7QA 1FN4B 4XP6L 4GYFA 1KLGA 3HZMB 4QY8B 3F62A 3WD1A 3RR1A 4PB0H 3SBRA 2A3EA 1BQHG 3NRPA 1JNNL 4YDLC 1J87A 2X6VA 5HHOA 4K3DL 5K9OA 4FG2A 3BQUC 3P77B 3PWUA 4KKBC 3CAFA 1Y5VA 3MRFB 5F70A 1GK8A 5E2WH 2ISVA 2DUZA 5TDOA 4AKPA 2YCEA 1RJZB 4HTBA 3ZR5A 5CBAB 2YA1A 2WQDA 3O2LA 2NNFA 1B4TA 1C9WA 5DS8B 2VR8A 5E2UH 3OJDB 3OR6A 3DFHA 3RKPA 5E4OA 4LUTB 1HWGB 3KRSA 4F9LA 4E5XG 3KM2A 4AOFA 2MSPA 2O7QA 4PMOA 1T8QA 4A6GA 4TNVK 5EF3A 1QTPA 3QAQA 2XIMA 3VA6A 1IXNA 3UWEA 3L3JA 2GC7C 3SCVA 2P5WE 3QEHB 3EFOA 4NNXA 1RY0A 4A7VA 3FCBA 1O94A 2ITDA 3BD3A 4OD2B 4OUUB 2E7CA 1UACH 1CD0A 3ARGB 2A1YA 3LV5A 1JPSH 4EF9A 4P5UA 1N8FA 3TLLA 3O6AA 3T9WA 3VKKA 4XNZC 4JM2B 4DAGL 1NAKH 3SN0A 1MHHB 3IRCA 1FFRA 3UTTE 4IU2A 4PB9L 1KLFA 4RX0A 3RKDD 3OTTA 2MQCA 3VWJB 1LRTA 2A3LA 3NQ7A 5HMDA 1P4IH 1VEMA 2DSKA 1IGIH 4KOCA 3SPHA 3ZK0A 4UIKL 1NGQH 4JHWH 5FIEA 4F8NA 5IMLA 3DOPA 3VFNA 2P76A 3EXJA 1S7TB 1GSMA 3FT4A 2QDGA 5EPMA 3FHEA 4G56A 1H15B 3DUUA 3ULUH 4PMXA 3MUHL 1YDPB 4R26H 3QJOA 3O2WL 2D7OA 3I3DA 2LQRA 2YSSB 2OLAA 1F4YL 1FNGA 4UXDA 2ED8A 4E36A 3WXVL 2X7LA 4FO4A 2WINB 1FFQA 2OPCA 5CF3A 1YN6B 3L08A 5E0FA 3MWCA 1Q13A 5AVVB 3U46A 2LLNA 4HSNA 3HI1A 5CEZH 5BOFA 3CASA 3INPA 2Y1YA 3WJJC 4OZIF 4DPQA 1FFTB 1KCUL 2O72A 2V8MA 2VZVA 3CK0L 3KFTA 5BXRA 4KGLA 2ZC1A 3KTSA 2NNXA 1A80A 2HROA 1F5WA 5IIEB 3TXVA 2PXYD 1DKWA 3LD5A 3SZKC 5ALBH 3N34A 3W00A 1XIFA 5SX5H 4RE3A 3AWFA 2WQWA 1U8LB 1XH0A 4AQ1C 2EXWD 5AW7B 1GVEA 3O6KL 2X4QB 5E09A 3SCPA 4XI5D 2F84A 3BPCA 2J1ZA 2OMVA 3WJJA 1TZGH 3VQ1C 4IK6A 4BS0A 4B41A 3EJTA 2EIDA 3IIXA 2DQWA 2ONEA 2J2ZB 3EKCA 2QDVA 4QRFA 2VH5H 3UC0L 3KVJA 2PXYC 4O0ZA 4HJGA 2ZD0A 4QI3A 1S9WB 3G9VA 1YY8A 2D03L