1XD2A

Crystal structure of a ternary ras:sos:ras*gdp complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of autoinhibition in the ras activator son of sevenless.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-Ras-1
total genus 60
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xd2A00
4YLGA 4KO8A 1VIAA 3THWA 1VMAA 3K0FB 5GADl 2HT1A 1N5KA 2XOKA 3F8TA 2QP9X 2CCKA 3PQCA 2P6UA 1ESMA 1S0UA 3N70A 3QKTA 4ILEA 2FSFA 1XTJA 2KI5A 2XJ9A 3AVUA 1II8A 4RZUA 3PFIA 3QPUA 4LYAA 1H8ED 4LJ6A 5G41A 4D2IA 4DDWA 3W3ZB 3IKJA 3ZIAD 4FCVA 2GF9A 2YC4C 1AN0A 2F1JA 1RRGA 2GVDC 4BGDA 1NNEA 2R6DA 5EXTA 3OESA 1KDTA 3KDSE 3R20A 4C9BA 1M7BA 1QHSA 3DHWC 4ON9A 5JJIA 1SQ5A 2D74A 4FWIB 3RC8A 2FJUA 3LY5A 1XFAA 1ZUNB 3I72A 5KDOA 5D3QA 5CM9C 4PHGA 1UDXA 4YMVA 4EPXA 1KNQA 5DYIA 2P2LA 4UJ5A 2WMOB 4LJ7A 1UDWA 2DPXA 1NMYA 2PMDA 2JLXA 2QORA 1US8A 2YWHA 1MO6A 1TAGA 4II7A 4DZZA 2Z0MA 1NMZA 1QVAA 4GOJA 5FOWA 1ZD8A 4EIWA 1Q44A 1RYFA 4OQFA 3RS7A 3UXMA 2NG1A 1WXQA 2QGNA 4C30A 4I1OA 3ZQ6A 3KB2A 4BZPA 3BGWA 4ESVA 5GJVC 1TU3A 2AHOA 2ZU0C 4CGZA 3RS3A 4JS0A 3R8CA 1VCIA 3VQTA 4PC3A 1YZLA 2ZE7A 2V54A 3RWMB 5F2EA 2GJ9A 4RJLA 2ZE6A 3RVBA 3QKSB 3IGFA 4A0GA 3ADKA 3WNDA 4ASUD 3FMFA 3HR8A 3SR0A 2GDJA 2Q9AA 3QE0A 5AUNB 3U4QA 3X1DA 3K1JA 1WB9A 4FWTA 4A6XA 1NLFA 4JBWA 3NBFA 4R7ZA 1SVMA 4LZZA 5JWRA 4TL8A 2CVHA 3D3QA 4RD0A 5EJEA 1IJFA 2GWHA 1GNPA 4NMMA 2ZPTX 1COWD 1G8HA 2X19A 4NPHA 3EPJA 1G16A 4DLRA 3CF2A 4H1VA 3I5XA 2BEKA 1AQUA 1VIYA 3MSXA 3OFNA 3B82A 4X8MA 4NONA 3ZYCA 4MKFA 4TT3A 2NZ8A 4I1VA 1XEWY 3IUYA 1E0AA 3LDAA 2PZGA 4D81A 1P2SA 1FMJA 2J0SA 3GPLA 3PVSA 2R2AA 1NVWQ 3QF4B 2VP5A 5G3ZA 1G8GA 5IK2D 1Q1ZA 2GESA 3A58B 4QGGA 4GMXA 4O2LA 2FMXA 1VDZA 4GFDA 1XEXA 3T61A 4Z1MA 3U7FB 3K0FA 1LS1A 3MUFA 1Z3IX 4E09A 2C78A 3LQRA 1EK0A 4URWR 2REOA 2NO0A 3EC2A 2F9MA 2PCJA 4GMDA 2PCLA 4LYHA 3VX3A 2QBYA 2EYUA 2QQEA 221PA 5KO2A 4Q00A 2A5GA 2C8VA 4DCUA 4GDFA 4ZIRB 2CL0X 1Q3TA 2Z4SA 2CK3D 4HB2A 3THOA 4XOIA 4LGMA 1GUAA 1T0HB 3THXB 3CX6A 3LXXA 1Z63A 1NLZA 1UAAA 3ND8A 2B7CA 2ZANA 5JZVA 1ZINA 2GJAA 2J7PA 1FUUA 1PV4A 3HP1A 1EFRD 3OIVA 2VTKA 1IXSB 1KOFA 1G4UR 1TNDA 3FYHA 4LYFA 4QM6A 1T9HA 3K9NA 4LCBA 2ONJA 1LY1A 1RIFA 2ZSFA 4IW3B 1SHZA 4K46A 1Z6YA 1P60A 3U6KA 4XH9B 2FSHA 3BS4A 3NBZC 3B5JA 1TEVA 2PJZA 3RWOA 2VF8A 1NG9A 1GZSA 2HEIA 3VR3A 1U94A 2MSEB 5SZHB 1XD2B 4TSFA 1XPRA 2OSBA 4UXHA 1DVRA 1GL9B 3I1FA 4DB2A 3E2IA 3TSZA 2P0EA 4FIDA 1GNQA 3AKDA 5TB5A 2ZRBA 1B0UA 2XX3A 3EZ7A 2V3CC 1AIPA 3I73A 4M1OA 5DI9A 5KPDA 4HAWA 1ODFA 3GLHB 5AJWA 5AJZA 3BBPA 4F91B 5FPTA 1XJQA 2Z43A 4B3GA 2CDNA 3AQ4A 3U61B 1S96A 2BVNA 2NPIA 2WOJA 1QHXA 1L7VC 1XPOA 2YWGA 3UATA 1SULA 5J4HA 4NCNA 5F3WB 1W2HA 2KWIA 2MMCA 2CXXA 1NF3A 1UKZA 4KFTA 3QUSA 3OEHA 5A4JA 4BZQA 1SKYE 5IT5A 2UVQA 3LQQA 4G5QA 2BIFA 5FTNA 5KU1A 4DWJA 5EQTA 1IN5A 1DARA 3QJYA 2G77B 4JL5A 2RAPA 2ZE5A 3RS4A 3QI2A 1E9EA 2WZQA 1G20E 1OH6A 2JDID 3X1YA 2V1UA 4V0MA 1KKMA 2QAGA 1OKKD 3QKRB 5HKKA 1Q1BA 2G88A 4ZCMA 4WXRA 3CNOA 1O3YA 2F55A 3LW7A 5AJVB 5KHOC 1QF9A 1DAKA 2IXFA 3D7MA 3AUXA 5BXQC 2X8AA 3EWSA 5HE9A 4B3CA 2B92A 1RW4A 5C46F 1OJLA 2FGKA 4RFVA 5EE1A 4CIDA 1E1QA 4R9UC 2J1LA 1Y3AA 1E2HA 4LC0A 3X1XA 3CH5A 4JLMA 5FUWA 1NBMA 4HEJA 5JJLA 1G21E 2IYRA 2J5XA 4TYQA 4LRWA 1VCMA 4QXAA 4BFXA 1HA3A 3DZ8A 3W3AA 2GJKA 2G0TA 3BORA 2D06A 4Q1CA 1ZAKA 4KVGA 1V43A 2UZ3A 3NHAA 3U7EB 2QMUA 4IEEA 2HDNB 2ODWA 4TQAA 1KSGA 1XTKA 1DAMA 3AH8A 4PZYA 1YZQA 4NCJA 2Q21A 1S3GA 1EX6A 1NKSA 1KK0A 4Q48A 3IEVA 4TZ6A 3LVQE 5K8TA 1JAHA 1FZQA 4DXAA 3AF0A 1XXHA 4QOSA 1E2IA 1AM4D 1OF1A 1KIMA 4EPTA 5TARA 121PA 3SNHA 2XNDA 2VBCA 4URVR 1RFLA 4JKIA 2J0UA 1LVGA 4N1AA 1EFRA 1NG1A 4O25A 4PHTA 1LTQA 1QHNA 1JPNA 1QBKC 2QG6A 4Q01A 1X8LA 2QT0A 1AKYA 2VP9A 4DVGA 2IS6A 1D2MA 3FGNA 2ZJ8A 1E4YA 1G41A 1KK3A 2GAOA 1W4BA 2H1LA 1NL3A 3AF1A 2VSFA 1QHYA 1SVOA 1X1SA 3DDCA 2Q3MA 4MKHA 2BMEA 2RGNA 1K6MA 1ESNA 3GQBA 3MG9A 2EYQA 1NBMD 3W34A 5JS7A 4OYHA 2FEMA 1RPZA 3FHTA 2JGNA 3PXGA 1E6CA 2BWJA 3CRW1 4E5UA 1U81A 1NVVR 3ZVNA 1NVUQ 4MGZR 1RKBA 2HXYA 1KTVA 3WBKA 1G3IA 1FTSA 3E5HA 2YOFA 1NVXQ 4TLEA 2FNAA 3FDIA 3DOFA 1TUIA 3C16C 4LWZA 2PX3A 3SJAA 4H9GA 1IJEA 1GRQA 2ZYTX 4XWKA 1YRAA 1Z47A 4RKFA 2BKUA 2QRNA 1JECA 1TQDA 1KI4A 1U0HC 4A92A 3FMPB 3QVVA 4AKGA 1ZNXA 2YOGA 3KKNA 3KUDA 3LBHA 2AR7A 2GNOA 2FZ4A 3T1TA 3O8CA 4ESHA 4BUJA 1G7CA 1XZPA 2PZEA 3T5DA 2REBA 1KNXA 2G1JA 3EZFA 4A36A 3HU3A 2OFOA 3REGA 3AF4A 2ZRPA 2WIAA 4HUQA 1S9DA 2BV3A 1UKEA 1WCV1 5L3SA 4UNNA 2CVFA 2RB4A 1I4DD 2O8DA 3BD9A 1TTTA 3TQFA 2A7QA 2JLRA 2OBLA 421PA 1DO2A 4BLOA 3KQNA 1N6PA 1E79A 4DDTA 1N6OA 2FGJA 5DISB 5DIFA 4I1SA 1Z22A 2QA5A 5CJPA 4QRHA 2PMKA 1Z5ZA 1AQYA 3ZZ0A 1R0YA 3L82B 4C0SA 4QNRA 2WWFA 2XNDD 4IOMA 4KBFA 4W7SA 3HPQA 3ZGXA 2XXAA 4BFTA 1XMIA 1YR9A 2P5SA 3FTQA 1QRAA 4NYIQ 4M2LA 3KQUA 2J7PD 4LHYA 4PC1A 4ZDIA 5D3MB 3KX2A 3MGCA 3U6BA 1J90A 4JT2A 4RFSA 4A1FA 4L16A 4N0DA 3THXA 2OV2A 3ND9A 2V4ZA 5JWOA 4RY2A 2B6HA 4QGAA 2QSZA 4P4SA 5HCIA 4Q7JB 3TH5A 4CT5A 2QAGB 4YMTA 1ZW6A 2W0SA 3H84A 3VKGA 1R5BA 4JL8A 1GRRA 4GOKA 4RD3A 1ZM7A 3TUZC 3WMEA 1EFTA 4PO8A 3KJGA 4PXAA 2XEXA 3AVPA 1LF0A 3IDQA 1KDOA 3BXZA 5FPYA 1GKYA 1E9FA 1N5JA 4Z51A 4NZYA 1ZP6A 2VO1A 5F9HA 2PLRA 2FE4A 2GVZC 2HCBA 3RRMA 3K0SA 2WSSD 3VR6A 4G5OA 3THYA 3VNVA 2IBMA 1FQKA 4DUGD 2XZOA 3V4RA 4IFBA 3BC1A 1BOFA 5CDFA 4XTRA 2WJIA 2BBTA 3GJ0A 2OUKA 4C7OB 4G1UC 5UKDA 4F38A 1K5DA 3O8DA 4LBWA 4TMXA 5EXXA 5HTKA 2HLDA 1XTIA 2ZE8A 1GFIA 1N2CE 1ZC3A 1XU4A 4EPYA 1VG0B 2OXRA 4N3NA 4BLPA 3K0AA 1E9DA 5BN3A 2YC2C 3CPHA 4UXIA 4A2QA 2FZLA 1RVDA 5CJ2A 2V6IA 2JLSA 4KCGA 4QGHA 1KYIA 3GD7A 3U3MA 2FA9A 2YINC 3FHOA 2EU8A 3P4XA 1KMHA 5L3QB 3U3OA 2WJJA 3CH4B 3X1WA 2IYXA 5BN5A 2OILA 5JEEA 1D8TA 2J59A 3OAAD 4C4PA 1C4OA 5CK4A 3UK6A 4B34A 2A5JA 1TQ6A 2QPOA 1SVKA 1BIFA 2O8FA 2FFBA 5A5GA 2KB0A 2OZEA 4TLAA 3SU8A 3W8NA 1SVIA 1E94E 4LOAA 2IYWA 3VTKA 1VCNA 3HYRA 4WAUA 3K9LA 3L0SA 4TMKA 2J0UB 1DAEA 5CLQA 2PX0A 2G83A 3W6NA 2CLCX 3MLEA 1EWQA 1BH2A 1DG1G 2DFLA 3GMTA 3N2EA 3KL4A 1E2FA 4F92B 5KYKA 3HU1A 3DM5A 3RDPA 2FH5B 3AVVA 3NBXX 3HR7A 3TUJC 4TTPA 5DLQC 4OI4A 4QKQA 1CULC 2WM9B 3NH6A 3CRMA 3BFXA 4B3XA 4EPVA 5A0FA 2F3RA 3IIMA 2ZI5A 2ZJ2A 1R4AA 2FPMA 3UWOA 3EA0A 3BFVA 1XTQA 2IUTA 4L8GA 3WNCA 3LO5A 1NN1A 4ABYA 1OXSC 2G1KA 1VCOA 3GJ6A 2CL7X 3B8HA 3MAAC 1M7HA 4LDJA 4US2R 4PPFA 3WYAA 3L8ZA 3A1VA 4QBIA 3ZQJA 3I8SA 2B7BA 2G6BA 4LPKA 2ZXUA 2DY1A 4EFNA 4MITA 2QRZA 2CE2X 1JEDA 4D82A 1SVWA 4DIDA 1LB1B 2A5DA 4DCTA 1FQJA 1CKEA 1XPUA 1GSIA 2A78A 3L8YA 2IWRA 3SFVA 2ZRHA 4XWOA 4IJMA 3OEED 2WKPA 1S8FA 5FUXA 1K8RA 3B2EA 2XAUA 3NEJA 1N5LA 4RZXA 4F4CA 3FE2A 3TW8B 1DO0A 2O5VA 2ODBA 3QF4A 4KSCA 3RLFA 3VAAA 2QU8A 4D25A 3SS8A 2ODNA 5CIWA 1N6RA 1XEXB 1N0UA 1OXUA 4B6EA 3O47A 4LHWA 1WA5A 2C98A 4A82A 3PUVA 4G0NA 3LX8A 1G3QA 3OFND 4JL6A 3T34A 3TSWA 4DDUA 1WBBA 2IYSA 5EXSA 5HZKA 2ERXA 1ZM9A 3EPHA 4B76A 1R2QA 2E1RA 4LSGA 1E1RA 1P75A 4QBHA 4H1UA 1NSTA 3CB4A 2WBLC 3IBGA 4JKYA 2IEZA 1I2DA 1WP9A 2H7VA 2WJHA 3IBYA 3NHBA 3SJBA 3QKRA 1K5GA 1CR2A 1NN5A 2H18A 3QPWA 1SXJD 1P4SA 4YDHB 5FBQB 1E2MA 1IBRA 3MD0A 1KMHB 2GXQA 5L3QA 3UIEA 2QBYB 1G5PA 2ECKA 2V7QD 3BB3A 1TEXA 3WMGA 5FPHA 2RGXA 4JLOA 3WP1B 4EJSA 3VKWA 2ZITA 3QENA 1EFHA 1Z0FA 4WZBE 4R98A 2FFHA 4KBGA 2V55B 1DAGA 4DEYA 2JLZA 1VG1A 1DOAA 3ZVRA 1ZIOA 4DUGA 4D0LB 5K8LA 4OL0A 5HZHA 4R2IA 1H65A 1DG3A 3SE0A 2QPTA 4CEHA 4LJ5A 3O8RA 4AYTA 1YR8A 2QTHA 2O8BB 3ASYA 2FWRA 2WIBA 2ZTSA 1EESA 3W5IA 1AGPA 2FSGA 2C99A 2ZRNA 3MJRA 1OYYA 4LC1A 5G3YA 2LWIA 4B2PA 3IEUA 1KO4A 1MH1A 1SVSA 1AZSC 3UANA 4DLWA 5B30A 1A1VA 4EPRA 3GLGA 4AYXA 4BLQA 2FOLA 4B73A 3M1IA 3GFPA 1L8QA 4WIAA 1P3JA 5FPSA 2GCOB 2C95A 1XRJA 5EUMA 2ZSDA 3E1SA 3WRXC 3BWDD 1TF7A 1SKQA 1QHHA 2L0XA 3ZZUA 1T8UA 4BFWA 3L2OB 1IN4A 3C4JA 1Q20A 3ZVLA 4B48A 5ANRB 2PEYA 4JT4A 4DT1A 2AD5A 3OIWA 4JYBA 2D2EA 3WMFA 1T4GA 2H92A 1WMSA 4C3ZA 5H8WA 3MFYA 5JRJA 3IHLA 2IS2A 5C4MA 3AGPA 4PO1A 1OFHA 1ZU5A 1Z0DA 3VR2A 1RZ3A 1ZBDA 3M4YA 2VA8A 5JSZB 1DEKA 3GP8A 3K0AB 1E98A 3JZAA 5FBLB 1ZIPA 4A0HA 4QBGB 4Q19A 5J47A 1G8YA 2F6RA 4DC9A 3SHWA 3U7HB 5C4GB 3CONA 3TR0A 5F9FA 2HJVA 4DDVA 2BEJA 1N0VC 1E3MA 4N0EA 3CM0A 2VHQA 5FL3A 1XB2A 4KITB 4JLVA 2H5EA 4B2LA 1ZNZA 3I92A 2BJVA 2QUZA 3LA6A 4TL9A 3RHFA 4HUTA 4JVSB 4OHVA 5CYPA 1X6VA 1L4UA 1YZUA 5FR2A 3C5CA 4KSBA 4OK6A 4Q4HA 4OHWA 5B58C 1XP8A 3NEYA 1VHTA 2JLQA 1NIPA 3W6OA 1UPTA 4IDQA 4MUAA 1D6JA 4Q4AB 2NGRA 1XMSA 2VEDA 4NCHA 4EJSC 3ETLA 1KAGA 2W83A 1GP2A 4OBEA 1AK2A 2JIZD 1FL9A 2O8EB 4P33A 4PC2A 3G0HA 3B60A 3WXMA 2NZJA 3DPUA 2ZI7A 1F48A 4PC6A 2ZVPX 4DSNA 4TMWA 4M9ZA 1CRPA 4QHSA 2XB4A 1COWA 5E7JA 2CL6X 1NIJA 2QL6A 4UNRA 4TYWA 2XSZD 3F3YA 4PTLA 4MDFA 3A1TA 4JZKA 3TMKA 3D8BA 1Q22A 2ZRFA 4D0NA 3U4QB 3PUXA 1G6HA 3CPEA 2P5TB 2W6JA 1R0WA 1CJUC 1BMFA 1CJKC 1IHUA 5H68A 4L9SA 3K70C 3LH5A 4AURA 3GLGE 4NTZA 5J40A 3EW9A 1FW6A 4URZR 3QVUA 4C0AC 1N6KA 1GITA 1XEWX 1TUEA 4WBSA 2DFNA 4QFMA 4BWYA 5EP3A 4AY2A 3VNUA 3AV0B 2R6FA 1F2UB 1E0SA 4B74A 1KAOA 1NRJB 2ZETA 1BO6A 1XD8A 4M8NE 1HQCA 3VR5A 4S35A 5SZJA 4IOLA 3AKEA 4ZDKA 3I3SR 2DR3A 5KNBA 3NDBB 3HDTA 2A30A 4IEIA 2CNWD 4DIEA 1E9SA 3P32A 2FDCA 3IO5A 4Q1DA 4B3DA 3DM9B 5E95A 4MA4A 4E07A 4C2TA 4PZZA 5KDDA 3ICEA 4MYTA 4ZI2A 2YHSA 5CB6A 3RNLA 1CR1A 1G9XA 4X8OA 2DWOA 1ZUIA 1T3HA 3HPRA 2ZJYA 1GL7A 2QM8A 4Q9IA 2BBWA 1KI3A 2N1BA 2P3SA 3A6PC 4MRRA 2Q9CA 2VSXA 2ZIAA 1KI2A 1FUKA 4YXWA 2IHBA 1ZVQA 1X86B 1ZNWA 4GI7A 3B9QA 4KYUA 4YQFA 3LFUA 2FEOA 1IM2A 1YZNA 3CX7A 3KKMA 4CEJB 1U8ZA 4LV6A 4A8JA 3GJ5A 3REFA 1S1CA 3K70B 3PJRA 3VMFA 1LNZA 3LD9A 5GJCA 5C18A 3PIRA 2QPAA 1P9WA 3NH9A 4CVNA 4C0HA 3GEIA 1SHKA 1N6LA 5EZ6B 4B3BA 2ZJ5A 2IYLD 2GBLC 3BB4A 3OE7D 3EPKA 1AS2A 1KI6B 2HF9A 4PSKA 4Q4JB 2RGEA 3KKOA 1T0JB 4R71A 2WPDD 4CW7A 2ZM5A 2WJVA 3CR8A 2FV8A 3AF3A 4C0LA 2WWXA 3LAWA 4BFYA 3K9GA 4HATA 3P20A 3MCAA 721PA 1DTSA 1ETUA 1W0JA 4IDNA 3B85A 1CR4A 5EP2A 1N6NA 2GEVA 3AVQA 3QKUA 5AJXA 2BJWA 2BCJQ 2NO7A 4UJ3A 1H8EA 2C9OA 1VG8A 3MMPA 5LB2A 4JJKA 3I62A 4Q4AA 4HLDA 4Z1MD 2D3WA 2QAJA 5JS8A 4LI0A 4QL3A 3UMFA 1TQ2A 3H4MA 1R5NA 1S9HA 1E2EA 4K8OA 2C9CA 1D2NA 4P0TA 8OHMA 4C2UA 4RZ2A 2GK7A 2CHGA 4NYMQ 3A4LA 2GHIA 2WWHA 4TYNA 3QQ5A 3ZVMA 2Z4RA 4JLBA 4X8LA 2KSQA 3I8XA 4EJSB 5J4VA 2GF0A 2PEZA 2W2VA 3PG5A 2CHVA 5KOYA 3U60B 3OAAA 4GL2A 5EE9A 2V7QA 2YKGA 3VHLB 1S3SA 4MKIA 3EARA 1OHHD 5EE0A 5SZIA 1U8YA 4OI2A 1SXJC 3EXAA 4LJ9A 4HLQB 4AKEA 2FFAA 3CRVA 4PO9A 1M6NA 2ZYWX 5EE5B 1GVNB 2MMGA 5FTMA 2BMJA 4FXPA 3UMRA 4C0BA 4Q02A 3SYKA 1M7GA 2EFEB 4PAOA 1E96A 1F2UA 1NY5A 3NVAA 3RANA 2OHFA 3S1AA 4DLXA 2ZR0A 1TPZA 2VP0A 3ZLJA 4B75A 3DMNA 1KMQA 4G5RA 3WY9A 2VSOA 3KQLA 1KJWA 2QP4A 4GP6A 4DLUA 1JR3A 1NP6A 4U5XA 3QXXA 5BYJA 1BS1A 3B1VA 2GCOA 2WMNB 1KDPA 1U2RA 3RC3A 3CRRA 2VF7A 2YZ2A 3THYB 3AP2A 3A1WA 3BIFA 3MRSA 3GLIB 4AKHA 4KI0A 4LJ4A 2GXSA 3L43A 3N5CA 3RRYA 2GJSA 3IIKA 2QE7A 1P72A 2JJ2D 1EFCA 3BRWD 3FMIA 3RS0A 5DE3A 4DCVA 1TQ4A 3OIUA 3CWZA 4KU4A 3AGQA 2PJRA 5FOXA 3PV0A 1GAJA 2J45A 3OF5A 2IYZA 3TGPA 2WVJA 3PUYA 5IHPA 5L8VA 1A4RA 1G291 2OAQ1 3NIBA 1U0JA 1WRBA 2FU5C 2ZYVX 3TE6A 2A5YB 4I81A 4BASA 2HCJB 4HDQB 5DO9A 4BEJA 1C1YA 2VRWA 2VHCA 3DL0A 3QEJA 4LYJA 1RJ9A 1I2MA 2OLJA 2R6AA 4KLNA 3ZS8A 3CF6R 5L3RA 4BE7B 3OZXA 4M1WA 2AWNA 1KKLA 1O87A 2A9KA 4Q4HB 1N6IA 2AX4A 3GLIE 4KVAA 1TX4B 1L4YA 4Q1FA 1M34E 3Q7PA 2OFXA 3BE4A 4QC2A 4JIMA 5H70A 1UKYA 1E1QD 3EWAA 2ZR9A 4XTCS 3PEWA 5FUYA 4TL7A 1JJVA 2C2HA 2RGNC 5JFGA 1YJ5A 3UKDA 4V0LA 1H8HD 1Q21A 3IQXA 2R8RA 4PX9A 4M4SA 5DI3B 3KUCA 3LRPA 1SXJB 4ZKEA 1KI1A 3KKPA 3H0KA 4XWAA 1KK2A 3RSLA 4ZDJA 1QHHB 2QZ4A 1FTNA 4AG6A 2F7SA 4AC9A 2GILA 4OJQA 3LBIA 3SYNA 3SC3A 1OSNA 2Q3HA 3CR7A 4HLUA 4UNSA 1ZM4A 2YWEA 4A15A 1I4TD 2IXEA 3T5GA 4DCNA 4QNMA 4B71A 1ANKA 2EQBA 1JALA 1ZYUA 2W2XA 2WAYA 4PQYA 3KXKA 1YZGA 5EXPA 4BLSA 1OXXK 1Q0UA 4PSVA 5AJYA 4WZ6A 4OHXA 3KFVA 3SZRA 2DBYA 2C77A 4O2RA 3NC0C 1G19A 4FMDB 4EQ6B 2VP2A 3AVYA 1SZPA 1X8JA 1JQLB 4OK3A 3F0TA 521PA 1Z2CA 1T6NA 2BBOA 2BM0A 1E9BA 1JEEA 1DAIA 1SKYB 2WWWA 2WOOA 4NU0A 1NSFA 1WQ1R 4JSTA 4JLNA 2VYFA 1CJMA 5KSYA 3AM1A 2JATA 2GA8A 3IIJA 2ZEJA 4JVNA 5E4FA 3U3RA 3K9HA 2EFGA 3FHCB 2F43B 3PR1A 4QG7A 4A4DA 3CIOA 3OE7A 4U02A 4A8JB 4JVLA 1HV8A 2GZHA 4KODA 4U7DA 4M53A 4A0RA 2N42A 3BERA 4W5WA 4Q4LA 5KNCA 2IYVA 2XTNA 2H17A 4A0FA 3I5YA 3U3KA 2MSDB 1X8KA 2X2EA 2ZI6A 3AB3A 4TLDA 2GEDA 4IDOA 4ZKDA 4JBXA 5LD2B 5FOSA 5P21A 2WV9A 4BPBA 3K53A 3L0OA 4V0NA 4OJKA 1KI8A 3KQHA 3PITA 1S4QA 1QHGA 3UG7A 5JHGB 5JHHB 3ADCA 4FMBB 2GXUA 4PANA 5AUOB 2AKAB 5EP4A 2O8CB 4D4MA 2ORVA 4QJ5A 2JJ2A 2N46A 2W6IA 3GEHA 3KXIA 2WSMA 1FP7A 2ORWA 1XD9A 5CB8A 1FPMA 1GILA 4LJYA 2WKQA 4D26A 2AL7A 1CU1A 2WKRA 4BECA 2V1XA 2JA1A 2CNWA 5CIQA 1FP6A 4W5HA 4TQ9A 3JVUA 4TN1A 5AR1A 3GJXC 3M6AA 2DHRA 2I3BA 4MKGA 1S1MA 1CTQA 1W44A 4HLUC 5FI1B 5BYKA 5ELXA 4M1KA 2WWIA 3DZDA 1YU9A 3HYTA 3ZH9B 4W5JA 4BFUA 1CBUA 1FX0A 1G4AE 2GJ8A 1G64A 2CCGA 3UMSA 3CO5A 1ZCAA 5E7MA 1W4CA 1Z0JA 1ZM2A 4DLZA 1IAQA 4FD2A 5TY0A 2QTFA 5AK0A 4F4IA 2OCYC 3BOSA 4GNKA 3SJCA 3SBDA 1OT3A 2QP3A 2FSIA 2D7CA 1XX6A 1ZCBA 1XCMA 5DYGA 1JPJA 2C9YA 1NN0A 2ZR7A 4Q1BA 1SGWA 1II8B 1MO5A 3KFXA 1OIVA 4M1SA 2EFDB 1G17A 4RFSB 4LV5B 4KLZA 4GPTA 2AFHE 1U9IC 2DFTA 2JLVA 1VYTA 2GCPA 3CRQA 1G7TA 4G5GA 4NHOA 2Y8EA 4AG5A 3PUWA 1L2TA 2JLWA 4PSAA 3OIYA 4HZIA 4LBZA 2LKCA 2RGBA 1MO4A 1OLOA 4K81B 2H57A 4RVCA 2VHUA 2XGJA 3R9WA 1OW3B 2OE2A 3LNCA 3Q8XB 5CYOA 2ZRGA 4A8JC 1JAIA 3QBTA 4XSHA 4D0GA 2FPLA 3PEVA 2ANCA 3QBVA 4M1TA 2VH5R 5J5CA 1J7KA 1DPFA 3BH0A 2GTPA 4HUQB 4FMCF 3V00A 1T5IA 4L15A 1MT0A 1W1WA 1AGRA 2JCSA 4G01B 3R7WB 4DLVA 2GBLA 3ZD7A 2F43A 5BN4A 3LVRE 4JLKA 3P1JA 1LS6A 4OQLA 1AS3A 5HPYB 3AEZA 3SOPA 3AVWA 2E9SA 3B1ZA 1II0A 1YKSA 3RAPR 4MGKR 2VPPA 4BLTA 4GT1A 2QT1A 1KY3A 2A3RA 4Y0VA 1G5TA 5IDVA 3Q5EA 2ZI3A 2NO9A 1EX7A 1OIXA 5HE8A 3IPYA 2OAP1 3T1OA 1Q1QA 3BB1A 1MV5A 2GXAA 2HUPA 3W6PA 1GDDA 2F9LA 4DSTA 3GJ3A 4EDHA 3A1SA 3TR5A 1JXOA 2CCJA 1VPLA 5TXGA 1Z6AA 1UEIA 3QOFA 4A2WA 3K09A 4BZXA 5J4LA 1B23P 5B57C 2BKEA 4EUNA 3CBQA 4MH0R 4NYIR 3EAQA 4Q21A 2KBFA 2HYDA 5DHFA 1NN3A 3UWKA 4J0QA 4US0R 2XOKD 2YWFA 1A7JA 1UEJA 1IONA 3OHMA 2IXGA 4R2HA 4RD1A 4TZ0A 2AWOA 3QG5A 4JJZA 2B8TA 2C96A 4XJXA 5FOUA 2BC9A 3WNBA 1J8MF 5C2JB 2Q6TA 2QGZA 1OHHA 1PVOA 1UFQA 4MQBA 3R9IA 2F1IA 3CZQA 4RSGA 1SXJA 4NYMR 1X3SA 4LBYA 2NPFA 5JLJA 1QZXA 2O8DB 5EE3A 3RS2A 2ZUDA 5JCZA 4B6FA 1HT2E 3NBYC 4HYYA 2XXAB 2J9RA 2ZREA 5FOVA 2QMOA 2J7KA 3C14C 1J99A 4V0ME 2RGAA 4Q5IA 2UZIR 1J2JA 4U00A 4AWXA 2BMDA 1EWRA 4XSGA 3VFDA 4QJ4A 4AD8A 2J46A 2GZDA 3IHWA 2GCNA 4JLPA 1XJCA 3B78A 1LV7A 4FW9A 4E22A 5IRCD 3FKSD 3KXLA 1P5ZB 4TLCA 2FF7A 3PEUA 4FCTA 1H8HA 4HB3A 1HT1E 1IY2A 1KJYA 3ONWA 4I99A 2AK3A 1UKVY 4NYJR 4ASUA 3U7GA 2WSSA 2H8KA 1EGAA 1KI7A 1WBDA 2ZI9A 3TIFA 2ZRKA 2ZS8A 1YRBA 1Z0KA 3T12A 2ZU6A 4XVRA 2ZSEA 3AUYA 5JWHA 2IS1A 2ZSBA 1P73A 1HH4A 5LB4A 1Z28A 2OT3B 4WXPA 3W90A 1QG4A 2EW1A 1MRNA 1KDRA 1XTRA 5DNYB 5DH9A 4Q1AA 3JZMA 2VLIA 2NO6A 3K8YA 4ZI3A 4NCIA 3BK7A 4HZUA 4URXR 1P6XA 3A4MA 3KTAB 5TVKA 4F93B 1RC8A 3GLHA 5KSZA 4D4KA 2O0JA 3IILA 4D80A 2GRJA 3H2YA 1GG2A 4OI1A 4W9MC 3Q5DA 5DI3A 3NXSA 5CLLA 4LPSA 1AKEA 5FPKA 5KNDA 2ATVA 4HSEA 1SXJE 1UADA 1JI0A 1TF2A 2ZI4A 3H1TA 1Q3HA 3QF7A 4LX0A 1UJ2A 3FWYA 3IPXA 4OQNA 3TUIC 4C0KA 1LW7A 1P9RA 4PAMA 4Q9JA 3DMDA 1KSFX 1YVDA 2EVWX 4HDCA 1OFIA 4JYCA 1G7SA 5FI0B 2A2ZA 2DFKB 1RYHA 3DKPA 3ICQB 2F1HA 1MABB 5JEDA 2RGCA 1IY1A 1N5IA 2BHRA 3ECCA 3RSOA 1JB1A 4IVRA 2QAGC 1E2DA 3CNLA 3CF0A 3H86A 2RHMA 3FPAA 1UBCA 1VHLA 5KSPA 3B13B 1R0ZA 4IKEA 3VR1A 3ZD6A 3Q72A 3EZ2A 4BFVA 3PEYA 2Z83A 3QPVA 1UBGA 2WTUA 3L0IB 1HY3A 3KKQA 2DWPA 3AVOA 4IDPA 5IK2A 3EZ6A 4TYPA 2CHQA 2JASA 2Z5FA 1YQTA 2ZRLA 4PHFA 4GSYA 4JLJA 5FR1A 2YV5A 4EKDA 2RGGA 4GBMA 2F3TA 1IXZA 4NKRA 4PHHA 4AK9A 3K70D 2B21A 4DBLC 1R8SA 2TMKA 3NC1C 2KE5A 4UQOA 5L3VA 3R7WA 4AI6A 3BJIC 4O0MA 3KJIA 2NOAA 3GCGA 2VL7A 5JRZA 4BFZA 5LPNA 2ZJBA 1KO8A 1F60A 3PUZA 4E03A 2OBMA 5JCPA 4GZMA 5JSZA 3QNUA 4L4UA 2P65A 2ZS9A 3BH7A 4BLRA 4D4LA 2BMFA 2XSZA 2R9VA 4P4UA 2H16A 4PQFA 3TKLA 2QTVB 3QXSA 1FOEB 3QKSA 2R62A 4PPNA 1CEEA 1MKYA 2W6ID 3EX7C 1GOTA 2IX3A 5FFMA 1ZM3A 3SN6A 1DS6A 5CM8B 1YR7A 3A36A 2PL3A 4FINA 1G7RA 2R44A 4XD7D 5TMPA 3MJHA 3E70C 3NDPA 1GKUB 5EP1A 2ZJAA 4P4TA 1TU4A 4P32A 4DLYA 1G3UA 3K0CC 4YDSA 4B33A 1PLJA 3FVQA 4IHQA 3TNFA 5LD2C 821PA 5CITA 2GETA 1XXHE 2OEPA 4IDHA 4TSFD 4KFRA 5EZ5A 1W36D 4RD6A 3KJEA 3NTUA 2QE7D 4BEBA 5K8IA 1XBTA 2HF8A 3FMOB 4MYHA 4TQUS 3EZ9A 5FTJA 2ZQ5A 3QG1A 4OQXA 2I4IA 4XVQA 2WJYA 4ARZA 3TVTA 1NKTA 3U2QA 3J81k 1M8PA 1EXMA 3W8RA 4DHEA 1N25A 4G3XA 1CLUA 1Z0AA 1DAHA 5FBWB 3TAHA 3WHLA 5FTLA 2IF2A 4POAA 2KJQA 3SQWA 3MWJA 2JJ1A 3AP3A 3LV8A 4Q7LA 2ZAOA 2IYUA 1W46A 2F1RA 1W5TA 3U44A 4Q1EA 4XD7A 1Z83A 3ZIAA 4DT1B 1C9KA 4LHXA 1Q12A 2E87A 4XIGS 4DSOA 5FBVB 2YNMA 4S2EA 4DLSA 1OB2A 4BQSA 1G3RA 3VU9B 2FPKA 1W36C 1KGDA 4DRZA 1M1YE 1CJTC 1JXMA 2W6JD 1E79D 2CLDX 3NWJA 2VQSA 1Y63A 2VP6A 4URYR 4C0QC 1E2JA 3P4YA 3I32A 4M9XA 2IWHA 2P6RA 4GRAA 2WWGA 3G5UA 1MRSA 5GVSA 1D9XA 4MRSA 2XZPA 3GLGB 4AIIA 2W2TA 4CZ2A 4Q9LA 1P62B 2RKOA 1CJVC 2IHYA 2OM2A 1MO3A 3V4FA 1XMJA 3P26A 4TMVA 2BM1A 4FMCB 2EFHB 1U9IA 6Q21A 3B1YA 3WYFA 4M9SA 5JI2E 1OE0A 4JVMA 4PC7A 2Q0HA 2JIZA 3EC1A 1GRNA 4UNPA 3TAUA 2ZRIA 4BRUA 1T5LA 2D7DA 4X8HA 1RE0A 1BKDR 1P7CA 1Q57A 2JLYA 3ZDQA 4IRUB 2FG5A 2CMKA 1CRQA 2J0VA 1ELOA 3SDZA 1T91A 2R6GA 4ACBA 2X2FA 3A4NA 1W47A 4EFLA 1FNNA 4NH0A 2LCFA 4NDZA 3EPLA 2W58A 2CEAA 2NO1A 3D6TB 4LHVA 4MYCA 4CEJA 4RKEA 1T3SA 4KHZA 2ZAMA 1FFHA 2GZAA 5G53C 3QIAA 5JMTA 3EIHA 5CK5A 3SHFA 3OEEA 4CT4B 3QSYA 2EFCB 1M2OB 1E9CA 3U3JA 3WP0A 1OH7A 2PH1A 2XB2A 5B2ZA 1ZNYA 1VYUA 3AKCA 1A82A 3FOZA 3X1ZA 2Q9BA 4QGFA 1OFUX 4TL6A 3GLFA 1NJGA 1PZNA 4GOXA 5FL7D 1BYUA 2ZRJA 4NCKA 5HR5A 4P3YA 3RRNA 2OFWA 2D2FA 3K09C 2WWYA 1II9A 1KJZA 1DE0A 2HV8A 4I1UA 5E3HA 1PLLA 1OYWA 1R0XA 1E2NA 3L0PA 3C15C 2IT1A 2FFQA 1NLYA 4WA7A 4CF7A 2HT6A 4ERNA 1Z07A 4LBVA 2IYYA 3U5ZB 2MSCB 2O8EA 3HJNA 1ZD1A 1ZMXA 1XNJA 1ZD9A 3CPJB 1XXHB 3CUEF 3LX5A 1TL7C 1CR0A 3TLXA 1OPXA 2W0MA 2XNSA 1MABA 1U99A 2ASEA 5D3MA 2QY9A 5JECA 1PLKA 4CRWB 1OB5A 3VU9A 4Q9KA 3VHXA 3DO6A 4F7WA 2JAQA 1W2GA 4P31A 4TMZA 4B47A 2ODEA 1BMFD 1NY6A 1QG2A 3G82C 3QXCA 3ADDA 1E2PA 4EPWA 2QENA 5FH9A 2SHKA 1W7AA 2C03A 4IVQA 4DEXA 1GNRA 2LKDA 5FBRB 4US1R 1KSJA 1Z6GA 1DBSA 1X1RA 3C41J 3LLUA 2YYZA 4GZLA 3C8UA 3QXJA 2RGDA 1MR3F 3EIEA 4FN5A 2O0HA 1TMKA 2P6NA 2IYQA 4MGYR 3TW4A 1KY2A 3QEOA 1MOZA 3S1AB 4MYUA 4A2PA 2PZFA 3GFOA 1G1MA 3AF2A 1UBFA 2ATXA 5TV2A 2J87A 1OXVA 2ZROA 1U0LA 1R8QA 2JLUA 4PQRA 2XITA 4TTQA 3KTAA 3GLFE 2REXB 4DLTA 2XZLA 2XTMA 4IXMA 4KV9A 1GTVA 2C5LA 1R7RA 1U90A 2HLDD 3GLIA 1HTWA 2FN4A 2QM7A 2GKSA 4M21A 5AUPB 1G8FA 1E2QA 3DVLA 1XJ0A 4HAUA 4LK2A 4IOKA 4Q18A 2W00A 4OHZA 2OESA 4JLDA 4G5SA 1W0JD 4Y0AA 2AD1A 1BYIA 1E32A 2QSYA 5KSOA 3MWKA 3Q7QA 3BAFA 4HAXA 5H1YA 3U44B 3A37A 2WPDA 4ZV4A 3AKYA 3VR4A 1IY0A 1R5OA 4EQ6A 5AUQA 1A2BA 2IW3A 4FCWA 4OK5A 4V02A 1KI6A 4Q4JA 5GJWC 1ZUHA 2G0NA 1T3LA 4KJZA 5BW8A 2ZRAA 4PPGA 4PZLA 4HI0E 4B44A 4JSYA 2ZUCA 3GLFB 3P27A 5KPJA 1KSHA 2V6JA 3GLHE 3K0EA 2UKDA 4PR0A 1R6BX 2CBZA 1Z0IA 1UF9A 3FFAA 5IF9A 4OI0A 4JLAA 1G18A 4YMUA 1W48A 4QBFA 4M22A 4YMSA 5L3SB 1UM8A 2BDTA 2DWQA 2K5UA 2IK8A 1CS4C 3GJ4A 4YXWD 1E2GA 1E9AA 2NQ2C 2D4HA 3VKHA 4DB4A 5KTYA 2ZRMA 2AN9A 4IVPA 4NBSA 4DKXA 2WHXA 5J4KA 4M0LA 4OKSA 3IO3A 4A6PA 4MGIR 2YVUA 3WRYC 1D9ZA 3LW8A 1E0KA 2KBEA 2ZYUX 4WW0A 1Z08A 5DSZA 1F3OA 2OLKA 1ZJ6A 1G6OA 3DOEA 1XWIA 4Z8YA 1OH8A 1AS0A 2BOVA 1V5WA 2QMEA 1D5CA 3C7KA 4V03A 4CYMA 1JR3D 1TF5A 2DCUA 3B7GA 4FI3C 4FMDF 3BFKA 4Q7MB 2G9NA 1IN8A 3KZ1E 3B9PA 4RCYA 1E2LA 1JJ7A 3WYGA 3TBKA 1DADA 3B1XA 5FOTA 5KDLA 4HB0A 1W4RA 2GEUA 3UPUA 4Z54A 3KQKA 2OXCA 4YC7A 3SEAA 4B2IA 1D2EA 3Q9LA 1U8AA 3FKSA 4CEHB 1W0KD 2V8OA 5J4YA 2JDIA 1E0JA 3UG6A 2O8BA 3JVVA 5B64A 1SVLA 4TT3D 4TYYA 1J8YF 4KFUA 4ZCLA 2X1VA 1E99A 2RCNA 1US8B 1G8PA 1KO5A 4C7OA 4V0KA 3EIQA 3CNNA 4RD4A 3FB4A 5SZKB 3TK1A 3X2SA 5LBIA 2WICA 3ASZA 3SYLA 4DSUA 3CKLA 2Z6VA 4PPQA 4B43A 1JR3E 2PBRA 1QVRA 4RZ3A 3K0CA 4KYIB 3V9PA 4A9AA 5AWFC 5GJBA 1KZ7B 1GWNA 4BRWA 4IOJA 3DKVA 3QY0A 1OFTA 4JBYA 5DN6D 3T1VA 3IQWA 3PENA 1VECA 3EASA 1KZGB 4URUR 5CDFE 4HAYA 4C0JA 2R65A 4IFEA 1ZU4A 3TSOA 1RJ9B 4F4JA 3AP1A 3FFBA 2G3YA 3A1UA 3AVTA 2WAXA 1PUJA 2JJ1D 1N0WA 4HAZA 3ZS9A 2OBNA 3Q3JB 5DGXA 1J70A 1HE8B 2J3EA 2ORIA 2J41A 3WHKA 3LLMA 5LDDC 4Q9HA 4L9WA 2YOHA 1CIPA 4WOPA 5GVRA 4MUBA 3NKVA 1W4AA 1Z29A 1RRCA 1AZTA 4I4LA 5KUTA 2QN6A 1VG9B 3NG1A 5M04A 2ZRDA 1Z6TA 2ONKA 4YMWA 2ZVQX 5C1BA 1JQJC 4ZPXA 5HCNA 2DB3A 1F5NA 5BWMA 1AJEA 1XTSA 4M9QA 2PT7A 1E4VA 2WJGA 1EG7A 1N3BA 1RRFA 1XCPA 4LHZA 2ZS7A 3THWB 3ZJYA 4PAQA 2ERYA 5TDHA 2FX3A 4HLCA 3TRFA 4RD2A 3QXHA 5E7IA 2HYIC 1AA9A 1OIWA 1XF9A 1YZKA 2IF0A 4CEIA 2O0KA 4NYJQ 4CEIB 1OXTA 4LJ8A 4Q47A 1FNMA 2AK2A 2JEOA 2X77A 2IYTA 2VIIA 1NJFA 2BCGY 4YONB 4QM7A 5DN6A 2PLFA 1NVVQ 2R6CA 1QHIA 2QNRA 2XJ4A 3F5FA 2AXNA 2I1VB 5FTKA 4TMTA 1Q1EA 1ZRHA 2ZJOA 3HU2A 1QDEA 2V9PA 2QROA 2CK3A 2O52A 4LUCA 3C5HA 3SJZA 3Q85A 1OH5A 1DELA 3A8TA 4KXFB 1A2KC 2YJTD 1WE2A 1WDTA 3SBEA 3CLVA 1XCGB 5FUVA 1W5SA 4LJAA 1CF4A 3SFZA 2ZSAA 4P4SB 1XD2A 4PFSA 4HDOB 2OO7A 1NBME 1XEFA 1XDBA 4KAXA 1UBEA 1KO7A 1RRPA 1XMVA 2NTYC 4UNQA 1ONBA 1KO1A 4ITRC 1IN6A 1W0KA 2AXPA 2HXSA 3D31A 4DCSA 1HURA 3SI7A 4QHYA 4B35A 5JJKA 1FMLA 1GM5A 3KB1A 1HYQA 2QI9C 4ARZB 2QQ0A 1IOZA 2ZRCA 2IS4A 1FX0B 4LV8B 1YZTA 3MWYW 1CP2A 4EAQA 5F98A 3FKQA 1Z2AA 1E2KA 4TTRA 2XTZA 2ZJZA 1KI9A 3SQXA 3T35A 1KHTA 4HAVA 2A5FA 2BBSA 2AFIE 2QEQA 2PT5A 4MRNA 1WF3A 2GK6A 3BH6A 2OG2A 4LY6A 1LFDB 3GEEA 3CX8A 2O8CA 2QMHA 3AVXA 4WZAE 4ZIRA 4D4JA 1P2UA 1GKIA 1M74A 2I1QA 4M1YA 1IN7A 4MRPA 3LXRA 1I4LD 4M1MA 1P2TA 4NE2A 3CZPA 3KJHA 4CDGA 3ADBA 1IQPA 4AKIA 1E69A 1NMXA 1N6HA 1U98A 3TQCA 2ZUBA 1VKJA 2RH5A 1G5RA 1PUIA 1TADA 2IC5A 3O8BA 1GL6A 5FL7A 3HWSA 4DJTA 2VHJA 5G40A 4NL4H 3TVDA 5K8UA 2O8FB 2ANBA 1W49A 1S2MA 1GIAA 2RMKA 3WBJA 4QJ3A 3GJ8A 2AKYA 2OCBA 2IA5A 3N2IA 1Z8FA 1F2TB 1P9NA 3B1WA 1F2TA 3R8FA 2NMVA 1IXRC 2OCPA 1OV4A 3W9YA 1JR6A 3RS5A 3T06B 2C04A 2IEYA 1NI3A 4ZCIA 1Z6XA 1EFUA 3GJ7A 4IXNA 4EFMA 1HQYE 2IL1A 1PJRA 3RABA 1JNYA 2CLSA 4Z8XA 1DAFA 4Q66C 2IUUA 3DEFA 1P2VA 1HE1C 2OCAA 1HEIA 3GFTA 4D6PA 4B3FX 4TLBA 4MDEA 1A5TA 2JJ8A 3PCRB 1XZQA 3CWQA 4MRVA 3M0EA 3RRZA 4BFSA 2B8WA 3I4LA 3RYTC 5JI3E 2Q3FA 4QHTA 3EG5A 5DHAA 1G3MA 1T8TA 5EUQB 2EWVA 1KK1A 4B32A 2NIPA 3VX4A 2IUSA 1R10A 3T1QA 1E9RA 1CXZA 1HUQA 4GP7A 3B6EA 4XVUA 621PA 4OHYA 1W36B 4V0OA 1OKKA 5HKKD 3MWLA 4UXJA 2DYKA 4UKDA 3CW2A 1ZC4A 2D62A 4Q7KA 4O3MA 2HJGA 4ZO4A 2VHTA 3T15A 4L5BA 4TWZA 4JMPA 2CJWA 1YHNA 2P67A 1Z06A 4RCZA 5JBQA 2CJWB 2RHDA 3I61A 1LF5A 1P61B 1VTKA 3LWNA 3OEHD 4HZUB 4NP6A 3W5JA 4OQMA 2EWWA 4Q03A 4HB4A 4ACAA 1YR6A 3LBNA 4AYWA 3ZZTA 2CE7A 2VP4A 4ZDWA 1YE8A 2J0QA 3TJZA 4WVFA 5BQ5A 1F6BA 3EA5A 4KFSA 3R9XA 2GAAA 1JBKA 1E1RD 1VYVA
chains in the Genus database with same CATH superfamily
4EG6A 4D02A 5EKDA 1VIAA 1A7UA 3V7UA 4H77A 5CCEA 3COJA 3G5MA 4E13A 4RQUA 4MQFA 2D1QA 3EIOA 2BSXA 2Q46A 3R6WA 5AKEA 4A1OA 2WFMA 3PQCA 3QKWA 2P6UA 3R0JA 1O0CA 4LXTA 3QKTA 3ZU5A 1Q2UA 5JNSA 4ILEA 4DCJA 2GD2A 2FSFA 4FNOA 1XTJA 3KB8A 2IU3A 4F1WA 4CKBA 1XZIA 3PFIA 1ENOA 3DLAA 4FE7A 1MAUA 4DW8A 2VZEA 3HYSA 4LYAA 1H8ED 1SUAA 3PFHA 1A5ZA 2J3LA 3MJSA 3NYWA 4M83A 2B61A 2QTAA 2Z9DA 2IUEA 2R85A 2X3YA 2OOKA 1Z88A 1NXWA 2K87A 2PAAA 1VL2A 2YJ4A 2PL5A 3DFMA 4KLCA 2GVDC 1A96A 4RMNA 1CQWA 2PSHA 3W8EA 4RMHA 3ICVA 3IUSA 1QH8A 3O8QB 1V9LA 1KDTA 3KDSE 3PHHA 1QHSA 2YN0A 1DBRA 3DHWC 3EVCA 2D74A 5DNAA 3K6SA 1STOA 1ZZGA 4I1PA 3E82A 1SC4A 2ZBGA 3WLOA 1H4VB 5EWLA 3V1KA 1ZSVA 2HMTA 5IDQA 2VK2A 5KDOA 1QU2A 3FR7A 3C7AA 3G1WA 3D54D 2DPMA 1UDXA 1UZNA 4PNHA 4ZREA 5EWMB 4AX8A 1NDUA 1PR6A 3UF0A 3BWVA 3NMUF 1UDWA 3VNAA 1M3SA 2AJCA 2DFPA 1C41A 4GRDA 3VAYA 2QORA 3TF5A 3JX9A 4WKBA 2BGRA 2YWHA 4O1HA 1MO6A 2PS3A 1A9XB 1TLFA 3KHKA 4O2BF 5JSFA 1A9XA 1ULBA 4HX5A 2CSXA 1U0OC 1QAQA 5DSTA 1YS1X 4FHFA 1JZQA 1RYFA 2XQGA 3RS7A 3UXMA 3PB3A 2Q2VA 3CUVA 4P7BA 4C30A 4I1OA 4OXXA 3KB2A 4KSYA 2G9UA 1GRVA 3V55A 3MINB 3QYJA 4JA0A 3RS3A 4AVYA 2ID4A 5CB4F 1LSUA 3VQTA 4F3TA 4PC3A 1YZLA 3SM9A 2ZE7A 4HO1X 2V54A 3FUUA 3AZOA 2Q6VA 1L8XA 2FEWB 2ZE6A 4A0GA 1ULHA 1VRVA 4ZYLA 1A9RA 1O9BA 2XYGA 3FMFA 3QJ5A 5M29A 1U1CA 4C08A 4MB0A 3TLMA 5H9VA 1BAPA 2RBKA 3GW8A 5AUNB 3X1DA 5BORA 5B55A 3U4QA 1VGRA 4A6XA 4R7ZA 1PS8A 2NZ2A 1RM4A 1RPNA 2WU0A 1SUBA 4H08A 3D3QA 3TM5A 1TECE 1FJHA 2V96A 4LOHA 1GNPA 2DQKA 1GEGA 1GQSA 2ZPTX 4MZXA 1G8HA 3OM8A 2NZYA 4N39A 1K0UA 4R1QA 4X84A 3RSHA 3B9BA 2NU6A 3G0DA 3KR2A 5H4GA 3EPJA 4NBRA 3L8GA 5F73A 1EP1B 2BEKA 2OZPA 2XRFA 3WG9A 1P31A 3RJTA 1Y82A 1L3CA 4RVOA 2OA0A 2QE6A 4G85A 2NZ8A 3AESA 4I1VA 3R75A 4N6OA 4R0NA 1GNVA 2PZGA 3LDAA 2UUCB 1FMJA 3IPLA 3QEMA 3PFGA 2OPBA 3GPLA 3PVSA 1UANA 3DB1A 3HDQA 3QF4B 3KKLA 4LXGA 3S2SA 1W9HA 5IFLA 1G8GA 5CW1A 1FVXA 4LECA 5BV0A 1VXRA 2GESA 1PEYA 1YE5A 1TYCA 1VPDA 3A58B 1IRIA 1ZBQA 4GQIA 3A9CA 4GMXA 4O2LA 4MS3B 5LJIA 8AT1A 2IU0A 2AB0A 4GFDA 3M49A 3WIVA 1V37A 2AOWA 1ZUD1 2IGBA 3K0FA 3BULA 2A58A 3F9RA 2FSSA 3VNQA 4RMIA 4YJ3B 2J8ZA 3H1FA 4P81A 2JARA 2NO0A 3PR3A 1U1GA 2ZBPA 5H82A 2FR1A 2PCLA 3E81A 1YDEA 1UC9A 1NXVA 1I2AA 3IYLW 1R9JA 2C8VA 3L7JA 3H9QA 4UVEA 4DNFA 2CL0X 4FB5A 2NTVA 4ZIRB 2Z4SA 1DIBA 4YAFA 4YAUA 3BWMA 3AZQA 2FRDC 2R6HA 3L7AA 4IEFB 4MVJG 3IUBA 3GFVA 1RAAA 1T0HB 4JR2A 5LCXA 3EFHA 1TCUA 1NLZA 5AOVA 3VC1A 1UWLA 4S12A 2B7CA 3JQ8B 3K2BA 1UAAA 3A6DA 3FTCA 2J7PA 5GTDA 1U80A 4PZUA 5JS1A 2RJOA 3OIVA 5FWDA 1KOFA 1E8NA 1N2GA 1FUEA 3FYHA 4MI9A 4RK6A 4LCBA 4QNNA 1C4KA 5JAZA 2VJOA 2ZSFA 1THGA 2PUAA 3RSGA 3V5NA 1GZ7A 3BS4A 4E94A 3B5JA 1TEVA 4BFUA 2EAUA 1NG9A 1Z4PX 1VSBA 3OQ1A 3B38A 2HEIA 3W2TA 4ZJZA 3PIDA 1JWLA 5B2FA 1QNLA 1XD2B 3Q8MA 1FXWA 1K7SN 3M7IA 1V95A 4RETA 1BN7A 2IZ0A 3M6VA 3WLPA 4UE3S 4PLZA 2F3UA 3JR7A 4W5NA 1QIMA 2P0EA 3M1AA 3NHZA 3A6JA 5A0TA 4FIDA 2ZUEA 3SVZA 4RQTA 2PVPA 4W1RA 2VXCA 1B0UA 1WLYA 3EZ7A 1A88A 1ZEJA 1AIPA 2FPXA 2ZZKA 3ENQA 4HEHA 3UAWA 3P0FA 2HFKA 2J67A 2A0XA 2GKGA 3N0TA 1XQ9A 5D8DA 5KYVA 4D3DA 2X1LA 1ODFA 3GLHB 4X90A 5AJWA 5AJZA 4EG8A 1I6MA 3PDUA 4M38A 4ER6A 2ON6A 1Z74A 2QVLA 3OPQA 3TQRA 2CDNA 4V3BA 2JIBA 3AQ4A 3IDAA 2MINA 3F7OA 3UAOA 3GUHA 3I34X 1L7VC 2MINB 4MUEA 4D4IA 1XPOA 5F3WB 1SULA 3QE3A 4J4TA 4NCNA 4O6VA 1JHPA 2M1ZA 3QH4A 1EFVA 4YJFA 4HUJA 5JJ5A 5LZ4A 1C1DA 4BZQA 3QEBZ 2UVQA 3ETJA 5CGQB 2BIFA 5E9JA 1YJ8A 3N87A 5JNTA 5IYZF 4ZJUA 1WSBA 4FCCA 5EQTA 4LSMA 1NFQA 2D0DA 1IN5A 3RU2A 3CS3A 5E2BA 4WL0A 2G77B 3VV3A 1E9EA 1WTCA 3V2HA 3IAHA 2JDID 1OH6A 1AGYA 2FZCA 2NU7B 3FUXA 4V0MA 1OBHA 4L3WA 1OKKD 5HKKA 4DA6A 1RLJA 3M8KA 4MMYB 4P82A 4DIMA 1AQ6A 3M83A 2M6LA 1O3YA 4I5IA 2F55A 3LSTA 2P0AA 3LW7A 1Y7LA 3R0QA 4FTWA 3NDIA 1DQPA 2R6JA 2I4TA 5HZGA 2D5BA 5HE9A 4BGEA 1YB5A 3FF1A 4U6SA 3HUDA 2SICE 1MRZA 3U62A 1XZMA 4B6GA 4EB6A 4LRXA 4IL5A 4R9UC 2BFFA 1Y3AA 3TGWA 4CM8A 1KQ3A 2H0QA 1E2HA 1EB8A 1XDSA 1NYTA 6ABPA 3CH5A 3H2SA 4XJSA 3I9V6 1O9GA 4TYQA 3HFJA 1VBFA 2A33A 2Y9MB 4BFXA 1HA3A 4IO1A 4MW0A 4UUPA 2G80A 2CNLA 1P1JA 2VNSA 4NATA 2UYCA 2G0TA 1MJNA 1SKUA 2B9VA 1V43A 4GRIA 1UM9B 2GFHA 1LI4A 3GRPA 4NY1A 2QMUA 2BFMA 4IEEA 2RB5A 4F6LA 1S2GA 2ODWA 2JFZA 2KMLA 1XTKA 2ZIZA 3MC1A 3FMGA 2MYNA 4I08A 1KSGA 4XCXA 1S3GA 1E62A 1HETA 1F4PA 1JAHA 4F4DA 1TYDE 4QTTB 1SUIA 4UCWA 1CUEA 3DSRA 1LX6A 1GAQA 1I3LA 1Z6PA 1L9KA 1C9DB 2XKAA 2VNJA 3MTBA 4INPA 4MW1A 1YR3A 3AFNA 4R1MA 1AM4D 1MPXA 1YB1A 3FDXA 1KIMA 9ABPA 4KWEA 121PA 2WW8A 3GRUA 4S1VA 3WYBA 2XNDA 5CFRA 1BMTA 4H1WA 3NCTA 1LVGA 5IKOA 1WW8A 3LXMA 4GQAA 1W88A 4YUXA 3CU5A 1J0DA 5I5EA 3L8HA 1JPNA 1QBKC 4BO7A 2I8LA 1L7EA 2QG6A 4D42A 2VSYA 4DMLA 1X8LA 2QT0A 2VP9A 3OQNA 3ACBA 1I7LA 1P7WA 3FGNA 4DDHA 4JI0B 1ZGBA 2NV6A 3EXHA 1FYWA 2CF5A 4TT8A 4TZKA 1CETA 2F9FA 2BFEA 1SVOA 3DDCA 4GXQA 2Q3MA 1XPUA 1VJGA 4RJIA 2KPOA 1W52X 2BMEA 4IGFA 2RGNA 3VTAA 1SXPA 4IF6A 3GDGA 5HMMA 1K4YA 5TMDA 3TSAA 4OYHA 4Q1VA 4U5QA 4DA4A 1W96A 2JGNA 1E6CA 1GGKA 3CRW1 2OENG 4O1MA 3UXHA 5BSEA 4R8RA 1T1SA 3CNBA 1C9MA 1USIA 2V6FA 1A8SA 1PJCA 3QFCA 1NVUQ 3H5TA 2B4KA 3H4TA 3PBKA 2HXYA 1KTVA 4D9HA 5B4UA 1G3IA 2BEVB 1UPXA 4W8HA 2C54A 3SQNA 1I3KA 3FAZA 3GY0A 1IOVA 2YOFA 3PGMA 1MVNA 1NVXQ 1ZEMA 2W8ZA 3GNQA 4C4TA 2FNAA 4YQYA 4KE8A 1XVTA 5DHUA 4AMUA 1QQ7A 4NEGA 3U31A 5JNUA 4A03A 2WYOA 4LWZA 3ZWAA 2UYGA 3GVIA 1H4SA 1BE0A 1WPRA 3BXFA 4NMXB 3SJAA 3ET4A 2VPWA 1IJEA 2ZYTX 3GAMA 3CYFA 2VDWA 4TM7A 1BOOA 1KP9A 4L5JA 2IDZA 3A4IA 4XWKA 3IULA 3S99A 1KEUA 5U1PA 1MLDA 4FD3A 4FFBA 1JECA 1TQDA 4NIMA 4IDFA 4ID3A 3FMPB 3QVVA 1ZNXA 4HQ6A 2PT9A 4LOLA 3SZGA 3H3JA 4TV8A 2AOTB 3LBHA 2AR7A 3UHOA 2X4DA 4KX3A 1G7CA 1KEVA 2X1HA 1IWPB 2Z57A 3HKEB 1VE3A 2OFPA 1H6BA 3EZFA 1NBHA 1C5KA 5K8CA 3TZHA 1WR8A 3DO5A 4NZMA 5JD4A 3AU8A 2AUMA 3HWX1 3R3ZA 3S5UA 1UKEA 2VQEB 4BVFA 5C34B 2NUBA 4L27A 1X0XA 3AIOA 4UBKA 3S29A 1IQ0A 4BLUA 4JWTA 1I4DD 3WIOA 5I7FA 3BD9A 3OFVA 5FQNA 3TLGA 3TQFA 5A5EA 3DUWA 3FPEA 1GJRA 3NHWA 421PA 5HWSA 4XLLA 1DO2A 1LPAB 2H4FA 1ML3A 2TSYB 4FEEA 4R68A 1QE5A 2H1RA 2H4YA 2VUHB 1N6OA 3GFQA 4OHCA 5BT8A 4OMUA 3AR3A 4CM4B 1N2SA 2CDRA 5DYYA 3FRJA 2QA5A 4HWRA 1AQYA 2P4QA 4JBLA 1J9GA 1R0YA 4R8SA 5T57A 1QLJA 4C0SA 5ETJA 5TEWA 5A03A 1BXRA 1FDTA 3D4LA 4B87A 2JHGA 4W7SA 4BLQA 3HPQA 2Q3DA 5KVVA 1T24A 3T3EA 1DJNA 3LYAA 3WKEA 3ELBA 5A3QA 1X7WA 3TQIA 1YR9A 2I4OA 3AM5A 4QZVA 1YF3A 3ORSA 3PHBE 1W1UA 1P7VA 4NYIQ 2NP7A 2P9FA 4ZDIA 4JBGA 1Q2XA 5IBRA 3MGCA 2VLBA 3WIUA 1J90A 1QQ5A 3ILVA 2H2HA 4FP9A 5EMHA 1U5AA 3VRHA 3VZBA 5I7UA 3FUTA 4FHCA 4N0DA 1AMUA 3THXA 1GZUA 1L7BA 3CF4A 1KTIA 4CLDA 3DR3A 3CVYA 4P4SA 5HCIA 4CT5A 1V45E 4E15A 4YMTA 3O2JA 2W0SA 3INTA 5ITZA 3UB3A 3ENZA 4DQKA 3LPCA 3TUZC 2Y71A 2BZ0A 1QMPA 4BNDA 3KLPX 1LF0A 4IFTA 2GBFA 4NS1A 1FSZA 1B6SA 3N53A 4BTEA 1R50A 1WD7A 4Z51A 2X8JB 1ZP6A 2JD0A 4Z0PA 4LCJA 3O4JA 5F9HA 1ISGA 1BE8A 1V25A 3SXPA 1OZ0A 1UBOS 3K0SA 3K8QA 3VR6A 1YDMA 2D8MA 4G5OA 1OAKA 4JT8A 3VPXA 3X2FA 1MAVA 3RE1A 4DMUB 2XZOA 2ZXEA 3NHMA 1EQ2A 1BOFA 1AMNA 4MCIA 2ECFA 2VHXA 4E46A 2WJIA 3ZDDA 2DLCX 4CODB 4LBWA 2ZE8A 1VC2A 1GTL1 1CUBA 4X5OA 1PYOA 1VG0B 4J1SA 1CRZA 2VJMB 1E9DA 2ZPAA 1Q7TA 1BZYA 1K5HA 2FZLA 1RVDA 2ZSHA 5C8YA 5HTOA 1MXHA 2C3MA 3GROA 4QGHA 1KYIA 1NDQA 3RPEA 2O7NA 2XTAA 4A8HA 3FHOA 2O1XA 1UR5A 1KMHA 5L3QB 1E58A 1XLTA 1QIDA 2IYXA 2HI0A 2OILA 5DF1A 2NW6A 2XDWA 3OAAD 3N2KB 3VNRA 1ECCA 1RYMA 3E7DA 4D43A 3UK6A 4UD6A 2A5JA 1APBA 4ZZ0A 4LRQA 3DV0B 4HVLA 3BWBA 2QPOA 3HKEA 4H7DA 2XT9A 5FAKA 2O8FA 4HJRA 2OZEA 3HMQA 1VZ2A 4LE0A 4M0UA 4W1PA 3TRHA 1P0QA 3W8NA 5HMLA 4LOAA 3GUCA 5C1DA 2VYNA 4YJGA 3VTKA 1NXPA 1VCNA 3MTGA 3GZ4A 4KR0A 2ZIWB 1RZVA 1DAEA 1UC8A 4WNYA 4DYHA 1DV1A 2MYPA 4S0ZA 5AW9A 1ZMRA 2XV1A 1NMSA 3S1LA 3H1EA 4JC5A 5LP6B 1KEEA 2CLCX 1JH8A 2LP4Y 2QN1A 2CHFA 3DD5A 3PVCA 3DE4X 1NT2A 4OP1A 3UGQA 2BP7A 3GGDA 3TE7A 1BH2A 4PHCA 4EEZA 5AVYA 3AY7A 4RCVA 2I7DA 4O59O 3WGLA 2WJAA 3HU1A 1RC0A 1VFPA 1XQ1A 3DM5A 4P7JA 4DR5B 1C3LA 3NLLA 3FLMA 2P90A 4D1YA 1A71A 3TUJC 3UJ7A 1GA4A 5DLQC 2HSZA 2WM9B 5C8YF 2E4VA 1U0GA 1VI6A 2YHAA 4RHFA 4RXUA 1T9ZA 4OO3A 1BA2A 3TLYA 3KOZA 3TNYA 1U31A 2LIPA 1QKIA 1X80A 3GA7A 4FI3F 2V7PA 2EBFX 1T8YA 3K30A 4L4YA 2Z4TA 4P93A 4QOFA 1YA8A 1JEQB 3LFHA 4DS3A 1XTQA 1XVUA 1ZI9A 4YRLA 3LT2A 4X63A 3L7IA 5IPFA 1KMCA 1NN1A 2XA2A 3MMZA 5DULA 1BG6A 4RTOA 2AXQA 5SY6A 3AXTA 4JXZA 5IKEA 3ESDA 1MQ8B 4Z4EA 5AHWA 2R7KA 1L5KA 3GJ6A 5F64A 2CHUA 5CXSA 1FUIA 1GSOA 2XR1A 3UMBA 3U9SA 6CHYA 5ED4A 3MAAC 5D1HA 1IDN1 4TKVA 3BGSA 4PPFA 4DIFA 3GCWA 1U4OA 4EA9A 3T7EA 4QBIA 3ZQJA 5EEHA 4DPMA 3I8SA 2ZBDA 2C59A 1PX0A 3JZFA 3PLRA 4PYNA 4Z9XA 2B7BA 3OBIA 3DMFA 3UQYS 4F72A 1PTJA 4FOLA 4BO4A 1BC5A 1NZJA 4ZO7A 4YRNA 5H83A 3EQ6A 2CE2X 2EZTA 3NWPA 4MWEA 3ZWKA 3UAXA 4X91A 1J2RA 3DEIA 5DYNA 2R7NA 1M5UA 1FQJA 1CKEA 5AHXA 5FNVA 1W30A 3DZGA 3CVJA 1GSIA 2A78A 4LOIA 4MARA 4OGWA 2ZRHA 3SFVA 5KYYA 4IJMA 3SKXA 1S8FA 5KB3A 4DILA 5LN1A 3U4CA 3RIEA 3OOHA 3JW8A 4F4CA 5K6RA 1DUIA 3FE2A 3EQ2A 3KZVA 1WXDA 2ZB7A 2O5VA 2ODBA 5D1NA 1F6WA 5BO5A 4XFDA 4KSCA 1EDBA 1TI7A 4N7RA 3VAAA 3I42A 1EQUA 3ZQ4A 4OQQA 3C39A 1ZJZA 2ODNA 5TMBA 3VC3A 1Y4AE 4D25A 5TGZA 1U0RA 2R7MA 4OH1A 4H1TA 5DBOA 3VPFA 2C98A 3TQQA 5F3RA 1FUYB 2EIXA 3KKKA 1U3WA 3DGEC 3RAJA 1WBBA 4OH7A 3LCJA 5IM5A 4Y2GA 4B76A 4ND8B 4RHTA 1NSTA 5IM4A 2Y3IA 4Y8VA 1EXVA 3NUZA 4PS0A 3IBYA 3NHBA 3SJBA 3CPSA 3QKRA 1NN5A 4YDHB 1LDYA 2QIPA 1K3TA 3TW4A 3ZHVA 5CCXA 2XMRA 3D3JA 2JEZA 8ADHA 1GQOA 2HA5A 5LP6C 4Y67A 4NBNA 4QRDA 3BB3A 2FOIA 2B1GA 3WMGA 4EJSA 1U7HA 2CJPA 3VKWA 5BMVA 1W1IA 2ZITA 4YPOA 3ZCXA 1T2FA 1EFHA 3W06A 4UULA 1BW9B 1E92A 3QLTA 1N1EA 2JLZA 3LHIA 5JYCA 3QMWA 3RB8A 3BWYA 2FFJA 1P5FA 1RXYA 1SBCA 4D0LB 5K8LA 4OL0A 5HZHA 5ALHA 3IQHX 3AYXB 3SYTA 1H65A 3ZXXA 1DG3A 1L7RA 1T15A 5C8VA 2QRJA 2ONCA 2QYOA 3PSHA 1W4LA 2QX6A 1NVMB 1O95D 4J94A 3KPVA 3LQ4A 4EFDA 3HCWA 3CW8X 1YQUA 1ZNQO 3KXPA 3UMGA 1EESA 3O5AA 2FSGA 2C99A 2PIDA 2ZRNA 1WHSB 3JALB 4J49A 4LC1A 1XHFA 1BWSA 3V8MA 2Z3ZA 1P8JA 3UANA 4FLEA 3ZE1B 4DLWA 1LK7A 3SKYA 4RPCA 2GAJA 4YT5A 1CNEA 4Y6LA 2DLDA 3RU3A 1MXFA 1L8QA 1U0NA 3B2QA 2FZEA 1P3JA 3MXOA 4OF4A 5FPSA 1YAJA 3SQLA 3ZU4A 1T5TA 1NMQA 2O57A 4IXTA 1AKQA 1XRJA 3ETCA 5EUMA 4GW3A 4RACA 4F12A 5CFNA 3DFIA 3L02A 2VCHA 2VRCD 1C9YA 2II6A 4BWGA 5DNUA 1T8UA 1JG6A 1JIXA 4BFWA 1YUMA 4JHXA 1IHPA 1IN4A 1E1CB 5BVHB 3CINA 1Q20A 4HGYA 4LRUA 3ZVLA 1PS0A 1P0PA 4B48A 1U9ZA 3OIWA 1SWWA 1EUCA 1TRHA 4H7FA 1TMYA 5CYFA 4KGZA 4CM3A 1P7YA 1JSRA 2WJPA 4PO1A 3OZRA 3UMCA 1U1EA 2AUTA 1Z0DA 1X39A 5DVZA 1ZBDA 1BKSB 1UIMA 3M4YA 4OXYA 5JSZB 1DEKA 4GKKB 1K88A 3HN2A 3JZAA 2CN1A 4MW9A 1M10A 5FBLB 4YREA 4A0HA 2HN9A 3CMMA 1V1MA 4KO3S 4KQ2A 1BD3A 2BI4A 1G8YA 3AY0A 2W6NA 4QBGB 3U7HB 1RZUA 3TFOA 1CC1S 4E3WA 3LCRA 5C7YA 2XHEA 1W5EA 5ELLA 1X13A 2RK6A 3I8OA 5FIUA 2VG8A 2QLFA 4N0EA 3LHSA 3TZQA 5BOSA 4NE9A 5GIPE 2HDWA 3ZUGA 5IMBA 3UC5A 2EDCA 4JLVA 1J4AA 2V9ZA 4CM5A 4COKA 1BS2A 3R0ZA 4DBLE 2JCVA 3RUCA 4TL9A 4EB6B 1U2DA 1PP4A 5CYPA 4NENB 5C3UA 2R86A 4WADA 3H2KA 3QE2A 4QT4A 2C3YA 5ICSA 1K3UB 4Q4HA 4MKZA 3UAZA 5F7XA 1V2HE 5BVGB 4OHWA 1TKBA 1O6CA 3NEYA 4X1OA 1V6SA 2G4LA 3DE1X 3GK3A 3IP9A 4KXMA 1E6KA 4Q4AB 4NCHA 2CMFA 1IJBA 1KAGA 2QRHA 2ZAYA 3UJCA 3G2OA 2Z09A 1YONA 1PEAA 1XR3A 2VUTA 1R3DA 1C3OB 3B60A 4WK6A 5PNTA 3UT6A 1B8PA 1W35A 4DADA 1YHYA 3AJEA 3H2GA 4YCAA 1G8SA 1DBVO 3FD8A 3JYQA 4DSNA 1PNTA 5E7JA 4H0CA 4HS9A 1DQRA 3R7BA 3HY4A 4GOMD 1AUXA 2QL6A 3COZA 1AHNA 4BRSA 4UNRA 1U5BA 3FTDA 4MDFA 1S5PA 1XMOB 2R1TB 4L6CA 3MLAA 4FBGA 4ND6A 3HBJA 2ZRFA 3UICA 3PUXA 5KTOA 1TYAE 1ZH8A 5IYZA 1N2ZA 3HU5A 4REMA 1UMDB 1BMFA 3VO9A 4AURA 1UMDA 4DMCA 2XUQA 3GLGE 4U7HA 1TIKA 3OLWA 1YL7A 4U7TB 2QMZA 4KP7A 3ZEIA 5B5SA 3W5CA 4ZJPA 5EWLB 2YR0A 1GLGA 4R1SA 1NFFA 2G09A 3OCUA 1B3RA 1I33A 4PFQA 3NHPA 4WBSA 4QFMA 4P0QB 1M72A 1XL1A 4Z7OB 3AV0B 3VNUA 1E0SA 1P1CA 3S6JA 4B74A 1NRJB 4Y1FA 4ME6A 3Q1LA 1QH8B 3O8QA 3T9FA 5I9BA 3VR5A 3UMYA 4MQLA 2E5WA 2QW1A 3DAYA 3QEMB 2NSLA 3SBXA 3I3SR 4AICA 4ETNA 4ZDKA 5KNBA 3NDBB 3IAM6 4DIEA 3RUHA 3IO5A 1WPXA 4D92A 4NH4A 2PMCA 2C4NA 2Q5LA 4MA4A 1D09A 1PKXA 4PZZA 3PTAA 3ICEA 4MYTA 1WPGA 5CB6A 2YHSA 3OCVA 5HKBA 3EOBI 1AY0A 1G9XA 4X8OA 5K3FA 3UC9A 5DBGA 4Z9AA 1ZUIA 4MVWA 2GPJA 3LK6A 2G25A 2ZJYA 3UK2A 1Y98A 1AA6A 2BBWA 1KI3A 1U0SY 3VR0A 2P3SA 5K09A 3SYRA 2CZCA 2ZIAA 2E85A 2ZTUA 2D59A 2IHBA 1ZVQA 1X86B 5B1YA 1WCIA 4P1ZA 4KYUA 1GZ6A 3G7UA 2FEOA 3AFMA 3CX7A 3LFUA 3WL6A 2R11A 4OHUA 2P9GA 4LV6A 2D00A 3H87A 4YHBA 3W1EA 4A8JA 3ZDBA 4N3BA 2XOEA 3UK7A 2XMZA 2PKEA 3OZEA 5EGNA 4J0DA 5EJ6A 1FJGB 1BE1A 2YWBA 3PJRA 2BHTA 2VC2B 1LNZA 3KSRA 3QPDA 3PIRA 5DM0A 1P9WA 5LU9A 1RHQA 2BDEA 3GEIA 1KEPA 2XVAA 3TRDA 1T4MA 3T3PB 2A0YA 2DFDA 3OE7D 3DEAA 4B82A 4TTVA 1T43A 2XB9A 4XDZA 4PSKA 4BBJA 1EK6A 1OAOC 2RGEA 1LPNA 5G1OA 4JJ7A 4Q0MA 4R71A 2AW5A 1EWVA 2MSKA 3DULA 3HDYA 3KWLA 4G36A 4I14A 4IJ6A 4CW7A 3CR8A 3GGJA 2FV8A 3LBYA 3MM4A 2IGTA 4MIYA 4JQCA 3HBFA 2VYCA 5TMEA 2E18A 4PBTA 5A62A 3F71A 721PA 1LBIA 1ETUA 4IDNA 4Z9BA 1UMKA 2D0PB 2ZWIA 4HFRA 2E1PA 2QK4A 4B81A 1YDGA 4P22A 5ARDA 4YUWA 2EHDA 4E5DA 3IPCA 3LY7A 2PXCA 2CUNA 4XIIA 4FDUA 1NF8A 5KYXA 4LKRA 1RIIA 3G0IA 4RA6A 2D3WA 3L7KA 5KVQA 1P74A 2ISCA 3H8JA 3WYEA 4LI0A 1WETA 4ZAZA 2CFRA 5KNBD 4H0NA 4DPLA 2X8LA 3QFFA 2WIDA 5JYEA 4YN3A 3DMRA 1D2NA 1PR4A 4OBWA 4M3NA 4NYMQ 4OHOA 2FSVA 4RWZA 1HQDA 4E70A 2GCGA 2GHIA 4UAVA 4TYNA 1R4MB 2L2QA 1YASA 4D8WA 3A1NA 4MWZA 2ZOSA 2BZGA 1QP7A 1A9PA 1ZI6A 3E61A 4MPTA 2XYPA 4EI2A 3R0VA 2G28A 2W2VA 3PG5A 3LPAA 5KQPA 1EWKA 1V11B 3KJNA 2DUMA 3FCCA 4QX6A 1S3SA 4HN9A 4MKIA 5EHNA 4EVQA 4RTQA 1Z2PX 1OHHD 5EE0A 3SC2B 4HNVA 1ZOIA 4LWQA 3EXAA 1XAGA 1ORIA 2V5UA 4ATNA 2P9CA 1CUSA 5EHGA 2X5XA 4K9OA 1PL7A 3UMRA 1MA3A 3HA7A 1ZLYA 2EFEB 2HRZA 4G0QA 1K2VN 2NQTA 1ESEA 1XLVA 3MCUA 2EL9A 2SNIE 1SU4A 4S1OA 2C29D 3IR5A 1TPZA 3ZWQA 4L22A 4CFSA 4AZ0B 3BWEA 4RH3A 1QGUA 1NUUA 3G17A 3FA2A 4I19A 4W4TA 2DT8A 2QP4A 1LH0A 3TIXB 2OB1A 3O94A 3QXXA 2LCQA 2BF4A 2OPHA 4RLFA 2GCOA 4TRRA 4WLOA 3PC2A 1R00A 4FGSA 2VF7A 1MJFA 3A1WA 3R44A 3UUFA 1RYNA 3HKDA 3MRSA 3GLIB 3KYIB 2GYYA 3VJLA 5JSHA 5IAGA 2PFGA 4Q7QA 1UP6A 1GAXA 2ZFUA 3VPBA 1PJ4A 3RRYA 4J4BA 1FMCA 3IIKA 1PAUA 3DDWA 5KTPA 3VSEA 3UA3A 3T99A 1USKA 2YCLA 3NGMA 3FTNA 4GYJA 3RS0A 3OC6A 3IEMA 1DAPA 2CD7A 1NF9A 3OIUA 4CV3A 3ZKWA 2V03A 3CWZA 4F38A 3AGQA 3WMXA 3VDXA 5U4QA 3PV0A 3WS7A 2A5LA 1WF6A 3AEYA 2J45A 1KFEB 4LGVA 3DMYA 3EULA 4LZOA 3TGPA 3DWIA 2VSNA 4NEQA 5IHPA 1OZHA 4OLBA 2YV3A 1A4RA 4X6LA 1CDOA 1FFAA 1WRBA 2FU5C 2O2IA 3ITEA 1V26A 1DNPA 5KWSA 2Q6IA 1C1YA 2WAAA 3DBRA 1DKOA 4BEJA 3B20A 5C4IA 5IEJA 2VHCA 3LXUX 3O8OB 2W93A 5REQB 2FR8C 3RV3A 3KZOA 1RJ9A 2WU4A 2OLJA 4Z9FA 3RIHA 5LMZA 3ZS8A 3UZUA 4A5SA 5TT1A 1SN7A 2IXTA 3I39X 4JGIA 3U9LA 3ZW7A 1KYQA 2L42A 5F51A 5DDIP 4JB2A 2A9KA 1WZUA 4LWPA 4EHLA 1SA0A 4UHEA 2I4LA 4C7BA 4ZOLF 1L4YA 2Q1SA 1M34E 2ZG6A 4FYMA 3K5PA 1JZSA 5H70A 1UKYA 2P2SA 2FZGA 1P7ZA 5G4KB 5IJXA 3PEWA 5ALEA 5FUYA 1ABEA 5JFGA 1VSQA 3UKDA 4CIBA 4L2IA 5KNCH 4TV9B 1JXAA 3UTCA 2R8RA 5AKHA 2AV6A 2J5RA 3KUCA 3A25A 5HIJA 1GZ3A 5LZ7A 4EZIA 1H4QA 2NU9A 1M6EX 4ZDJA 3C43A 3G8DA 2WB2A 2Y1KA 4AN0A 1QHHB 2JH8A 3FUVA 4DMKA 4Q4DA 4P0PB 2XVZA 2XI4A 2ZTHA 3NOOA 2GILA 2NXEA 3M5DA 3OCCA 4OJQA 3QUCA 2IYFA 1TAUA 4HLUA 4UNSA 4E31A 4KXXA 3SX4A 1ZM4A 2AKEA 1C4WA 3FOWA 1G5FA 2IXEA 3T5GA 4K9QA 3CLRC 3UHFA 1V1JA 1KVTA 3HVHA 3TR6A 1X14A 3IESA 1QGOA 3P94A 2WAYA 2W2XA 4TKVB 4RBNA 2ZAGA 3I6MA 4C3OB 4IMJB 2YWXA 1GU0A 4OHXA 4YX9A 3AUJB 4MB6A 1O58A 2A4KA 3FR8A 1G19A 1FEZA 3DTVA 3W5UA 4Y6OA 2WYWA 3HKBB 3KPYA 3AMVA 3HBNA 4OSOA 4AWBA 3N07A 5BNWA 1Z2CA 2BBOA 5A4KA 1KC1A 2ES4A 2ZYSA 4E88A 1BGVA 3PD1A 4F3KA 2P62A 4JJ4A 1ESCA 1HDOA 5DXJA 1Y5RA 2AFHA 2YQ4A 4JJEA 3F67A 4EY6A 2VRBA 3HLKA 2WOOA 4IIVA 4DCPA 4ZCSA 4EGJA 1IVSA 1H2RS 2W6OA 5K4AA 1GKLA 1RYEA 2QYHA 4WT7A 5KSYA 5CNMA 2GA8A 2GN2A 3Q2IA 4XQ0A 3C3BA 1TTPB 2OV8A 4HMPA 3S7TA 1SBTA 3ZNPA 3L40A 1I5EA 1I3OA 1I51A 5AVXA 4GC5A 3EH2A 2F43B 1N34B 4AAYA 3GLUA 1E59A 4QG7A 2P9BA 4DV4B 3CIOA 5JAUA 4MVXA 3DP9A 1SOWA 4JVLA 1EVKA 4IHJF 4ALNA 4DNXA 1XZKA 4KH0A 3ER9A 4F85A 1T2NA 3E9YA 3RC9A 4A0RA 4Q4LA 3CC8A 4NU6A 2UV8A 4AJLA 1T34A 2IYVA 2XTNA 2M2IA 2P1DA 3ITNA 3RJ5A 3S4YA 2MSDB 1SCUB 1X8KA 3DE0X 4DWVA 3AB3A 5BT9A 1PEKE 3COPA 4IDOA 4LZLA 1UMCA 3GMIA 4R8KA 2H3EA 3K53A 1GO2A 1IXKA 1XZEA 4OJKA 2I62A 3KQHA 1VPWA 3ND7A 1QZUA 3KXDA 3EVNA 1TZ2A 1N7IA 4FMBB 3CN7A 2VI5A 4PANA 2NP6A 2Z98A 1NOKA 4BNMA 4O5AA 1NONA 2ZYDA 3HDHA 4ZYYA 4ZVQA 2J3HA 3H0EA 2W6IA 1LBEA 1JLLB 3KXIA 4OFZA 2WSMA 1FP7A 3CRNA 1XD9A 4HTFA 4Y18A 4TKUB 4URHA 3PHCA 3T5BA 1GILA 2AL7A 2C3OA 2QIOA 2OBYA 2GEJA 2WKRA 3PNSA 2VYQA 4UMFA 4DV1B 1W0CA 1FP6A 4PZDA 1PFQA 1DCFA 5COQA 1H1TA 3JVUA 1GCOA 4X65B 3GJXC 2DHRA 2I3BA 1P44A 1W44A 3AXSA 3EC7A 3P2KA 5BYKA 1GADO 2YW9A 3JAWB 3NXKA 4JFRA 2C5FA 2W2KA 4MEAA 1ZRNA 1U9YA 1L4BA 1UBTS 2GJ8A 3EK2A 3D2AA 4HEA1 3G2MA 1PWYE 4E3ZA 2IQIA 3H1PA 3GV0A 5DXFA 2I2DA 1TC1A 1JHMA 2XBLA 1CZUA 2ID9A 5FHRA 2OCYC 1B76A 4B7CA 3A05A 3RT1A 3K94A 4HBZA 4YT8A 2RE8A 1AKNA 4WY8A 2A1TR 2FSIA 3BMXA 4JHLA 3KO8A 4MROA 1XX6A 4Q3OA 4HP8A 4JI2B 1JPJA 1V3TA 3ZDFA 4CMIA 1J5PA 3AHJA 1CY7A 5HDBB 4M60A 4Q1BA 2W70A 1FFDA 1ZESA 1RPTA 1EI9A 3AUUA 1OIVA 1BHO1 1U0EA 4TS4A 4E2YA 3VI3B 4RE5A 2PRYA 1V3UA 1B73A 3RARA 4UUQA 4KLZA 4LF8B 3DT8A 3DXZA 2AZDA 3C3PA 1VKRA 3D6JA 2MHCA 5D7NA 4C4SA 2DFTA 2VBFA 3HVJA 1DP4A 5F5XA 5JT1A 1G7TA 5JISA 4F84A 1DXYA 1L2TA 2FDXA 3OPNA 2CDBA 3PZBA 1U8EA 2FOXA 4N40A 3OIYA 4PSAA 2D2VA 4IJWA 1KZHA 2RGBA 3QU9A 4RVCA 2XGJA 4CQLB 1X8XA 3ESYA 4BQPA 3L1HA 4CQMD 5L95A 3D8NA 3TM4A 4RGQA 1Y81A 5LUAA 4QIHA 4D0GA 1W36C 2Q3BA 1FLDA 2FPLA 3HNOA 2FFRA 3EMKA 2CSUA 1J8QA 3I9FA 3QBVA 4MCJA 3H16A 4CM9D 4ZAVA 3PD7A 3CKMA 3REQA 1ENZA 3BH0A 2NZUG 2RGYA 4HUQB 4RYDA 4Z0TA 5H80A 3WYNA 1PQWA 3LDGA 5IVDA 4ZK6A 3DOUA 3LCVB 4L3OA 4QXRA 1W1WA 1AGRA 5C37A 4KR3A 3VKVA 3ZQUA 5FV7A 2IP4A 4U9UA 4AJNA 5BN4A 1UXHA 4HQOA 1GPLA 3VO8A 1G5QA 1WDWB 3SOPA 4OB6A 1II0A 2JIRA 3W5VA 1VBKA 2XIJA