1XD2A

Crystal structure of a ternary ras:sos:ras*gdp complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-Ras-1
publication title Structural analysis of autoinhibition in the ras activator son of sevenless.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xd2A00
4KLNA 3SBEA 5CB6A 2IEYA 3QKSB 2VSFA 3SNHA 5A5GA 1IONA 2BWJA 1NVVQ 2WVJA 2OCPA 1LS6A 1UBEA 3LAWA 4DKXA 1JAIA 5C18A 2XSZD 2PH1A 3ZQJA 3PUZA 5EXPA 4URVR 2A5GA 2BMJA 2ZAOA 1W36D 2JLWA 4P4UA 4NBSA 5LD2C 2ZJAA 3ZVNA 1II0A 1XJ0A 2JLRA 4Z51A 2BMFA 2A3RA 2V7QD 4A8JC 4D4JA 2VP5A 5FPSA 4B3DA 2Q9CA 5CDFE 1IN5A 1AS3A 5FOTA 5IT5A 2KSQA 2PMKA 3GJ4A 4NTZA 3SS8A 1U99A 3AVTA 3SYNA 1MABB 4YC7A 2P65A 4RJLA 1LB1B 1U8YA 2CCGA 1GP2A 2MSCB 2FGKA 1ZJ6A 5CB8A 3DVLA 5HPYB 4IDNA 1W5TA 5JSZB 2IA5A 3REGA 1A2KC 2GF0A 2WJIA 1QHSA 4YONB 4W7SA 1Z6XA 1E2LA 4BLRA 5FPYA 3PUXA 4KHZA 5JWOA 4OQLA 4HAYA 5E7MA 5BXQC 2ODBA 1S3GA 1Y3AA 2QQ0A 3AEZA 1ZD8A 3ADDA 521PA 4B3FX 2BJVA 2XTNA 4EPWA 3AVXA 4UKDA 3WBKA 2EFCB 4JL6A 2NZJA 3VX3A 4F93B 4YLGA 1KSFX 2OCYC 5C4MA 2ZYVX 2X19A 4EQ6A 1RJ9A 3K9GA 1NVVR 3VKWA 3IO5A 3AVUA 3QQ5A 4NCIA 3B13B 5TB5A 3K0AA 1SZPA 1DOAA 1ESMA 1KKLA 1PUJA 1UF9A 4MRSA 4UNNA 2R6AA 3VR6A 4D4LA 4AKIA 3T34A 4B34A 4LBZA 3SU8A 2O8EA 2F43B 3THWA 2W6IA 2JDIA 4QBIA 1ONBA 4E5UA 4TT3A 3OESA 3UG7A 1VHLA 2QMOA 2VPPA 2YV5A 1OH5A 2GEUA 3ZD6A 3K0CC 3GLGE 1AZSC 1UDXA 2VSXA 2ZE8A 3RWMB 3F5FA 3VKGA 1G7SA 3EPKA 2YJTD 1XMVA 3WMEA 5AJZA 3CR7A 2HF8A 2HUPA 3B1ZA 3OE7A 2FSGA 2FFBA 1XWIA 3EW9A 3TJZA 3SR0A 4LC0A 1DG3A 5JHGB 2OHFA 4GBMA 4YMSA 4CEJA 1G41A 2IF0A 1R8QA 3LLMA 4HI0E 4HLUC 4OK5A 2ZXUA 2WOOA 4MH0R 3I5XA 1XJCA 3EIEA 2J5XA 3WMGA 3D8BA 4KBFA 3GCGA 3UMRA 2ZJOA 3OHMA 2C99A 2IS4A 4PZZA 3QXSA 1S2MA 3QJYA 2NPIA 3GFPA 4LV8B 4EFLA 2XXAA 3QSYA 2ZSFA 3ZD7A 1BYIA 2QL6A 1CJVC 3B82A 1GNRA 3EZ6A 1NJFA 1I4LD 4HUQA 1E9FA 5KDDA 2OCBA 4KYIB 3T61A 1Z2CA 3KX2A 2WWFA 4MKHA 4JLDA 1GUAA 4HAZA 4RFSA 1KMHA 4NYMQ 4A0GA 1GKIA 3ZVLA 1XF9A 4Q19A 4JKIA 5EP4A 4LYHA 2P67A 1VG0B 1NVXQ 3GJ8A 3KDSE 1FUKA 4NCJA 4EJSC 4BRUA 1X3SA 2YKGA 2NO7A 5M04A 5FOXA 3CR8A 1CXZA 4PZLA 5KTYA 3AP3A 2G0TA 3WRXC 5LDDC 1H8EA 1CTQA 4B3GA 4HAUA 3HPQA 1K6MA 2WWHA 2NGRA 4DDTA 2L0XA 3T1TA 1C4OA 3IQWA 1XEXB 3X2SA 2WWYA 2C9CA 3KXLA 2QRZA 1D2NA 1YZGA 4TYQA 2AFHE 1U8ZA 2PCJA 4M1KA 5JWRA 1SHKA 2EFEB 1NLYA 1UFQA 2W6JD 4F4JA 1LNZA 4KSBA 5B2ZA 5CITA 1KJWA 5CK5A 1TAGA 2OT3B 3LQQA 2EQBA 2VRWA 2QT0A 1FMJA 2WWIA 5BWMA 2W0MA 4LBWA 4IHQA 3U7EB 5FPHA 4CYMA 2O8BA 3G82C 2OXCA 4Q00A 2ZI7A 5DO9A 2IWRA 3T06B 4P3YA 1BKDR 3AKEA 1E2PA 1G5TA 5FH9A 3I5YA 4Y0VA 3N2IA 4DT1B 2G1KA 4Q7MB 5KHOC 3CWQA 3A1UA 3LBIA 4PC2A 1VKJA 5D3MA 2C95A 3MMPA 1T5LA 2BHRA 2A9KA 4GPTA 2ERYA 4HDCA 4WOPA 3GP8A 3THYB 4Q4JB 3NWJA 3PUVA 3BH0A 3GMTA 4RZ3A 3P1JA 1XXHA 1E6CA 1NLZA 2QA5A 4GOXA 4NYMR 1NNEA 1UBFA 5A0FA 4QHYA 2JAQA 2CCJA 4AI6A 2Y8EA 2BJWA 2OM2A 3RSOA 4JYCA 1RE0A 1FQKA 2H57A 2W6ID 3TSZA 4PHGA 3CUEF 4TT3D 4JVMA 1HURA 2QEQA 4BQSA 2QAGC 2CBZA 2YWEA 5TY0A 3OEHA 3GLHA 1KMQA 2ATVA 1E9DA 3PEVA 1VIYA 1OB5A 3NH6A 2YYZA 1KZ7B 4UXIA 2QGZA 2GXUA 1UEJA 3GJ0A 2R6CA 1HE8B 3MWYW 4F92B 5JI3E 1JXMA 2E1RA 2W0SA 3T1VA 2XZLA 2VEDA 1IM2A 4OQFA 1TNDA 2XAUA 5EQTA 3TR0A 3WP1B 1KAOA 2IL1A 5HKKA 3FOZA 1R0WA 1E1RA 1IY1A 3FE2A 1OF1A 1EFUA 2JA1A 5FBQB 5E7JA 4BGDA 2OLKA 4IVPA 3IHWA 1E2QA 2A5FA 3C14C 1OFTA 5AUPB 2OBNA 2ZYTX 3W6OA 3IO3A 4GL2A 2DFNA 4I1VA 4LJ4A 5EP2A 1US8A 1O87A 3AF4A 1NLFA 1KI2A 4R2HA 5G3YA 1ZC3A 4DLRA 2VQSA 1MH1A 4GP7A 4Q48A 1T0JB 2AWNA 2ZU0C 5FOWA 1JR3E 4XVUA 3EARA 4LHZA 1OIWA 1RYFA 2W2TA 2GJKA 2ZI6A 3UMSA 2HXSA 3AVPA 2DB3A 3VNVA 2BBTA 4POAA 4YMVA 3IILA 4R71A 2A2ZA 2F1IA 4W5WA 2QSYA 4GMDA 2GAAA 3HR8A 2XNDA 4IOKA 1AS2A 2R6GA 1H8ED 2CVHA 1J90A 3BC1A 3QKRA 3MJHA 4NYIQ 5F2EA 5HR5A 4DLUA 4MUBA 5EUQB 5G3ZA 1G17A 4LDJA 2X8AA 4IVQA 2IK8A 4A0FA 3OEEA 3EA0A 4WXPA 3NEYA 3NEJA 1SXJB 3E2IA 3FGNA 5AR1A 1U0HC 1G4AE 2AXNA 4WVFA 5DI9A 1FTSA 3ZS8A 4QNMA 4D2IA 5JCPA 3T1OA 3C5HA 1YJ5A 2A78A 4LJ8A 5LB4A 4GRAA 1P5ZB 4DC9A 1OH8A 2LKCA 3L2OB 2BM1A 4RD6A 5EE3A 3QBTA 1NF3A 4UXJA 2ZVPX 3RS2A 1JPJA 4XVQA 4IEIA 3BD9A 3DKVA 1IJEA 3NHBA 2AD5A 3LXXA 1D2EA 3OFND 3WYFA 1W4RA 2IS1A 2H17A 4GFDA 3KQHA 1XD8A 1DPFA 2B6HA 2GNOA 1NJGA 2KJQA 2VHQA 4CW7A 1U9IC 1Q12A 3IKJA 4EAQA 4G01B 3Q3JB 1KI1A 1XTJA 3BWDD 4LJ5A 1CR2A 5DSZA 2CJWB 4ZCLA 1GILA 3AVQA 3VR2A 2MSDB 1VG1A 3BFKA 2NO6A 1W4CA 2VL7A 3SHFA 2E87A 2IF2A 3GQBA 4HB4A 3QKSA 5F3WB 2IS6A 1IN8A 5FPKA 1VECA 3ZH9B 2NO0A 3LA6A 2B21A 4OL0A 1WRBA 5G40A 2OCAA 1Q1BA 2RGXA 4US2R 5JI2E 1XMJA 3FMPB 4EDHA 4NYIR 4JBYA 2WPDA 2VF8A 3AB3A 3VR3A 2IYXA 1ZW6A 2Z5FA 1YHNA 1S9DA 2B7BA 3OIVA 4TQUS 1J7KA 2BBOA 1OXSC 2NZ8A 2IUTA 3X1DA 2VH5R 3LH5A 3R9IA 5HKKD 4BLQA 2BCGY 4RD1A 1U0JA 4EIWA 1WBDA 5DHFA 4Q66C 4BASA 3WNBA 3QI2A 2D7DA 3NKVA 1RIFA 1ZAKA 4KI0A 5H68A 2J1LA 1XD2B 4M2LA 3IUYA 1GVNB 3GD7A 1DARA 1F2TA 2DCUA 3SYLA 1H8HD 2C96A 4JL5A 4TYNA 2HJGA 4MKGA 5A4JA 4U02A 2GJ8A 3IIMA 5SZIA 4CIDA 5EE9A 3R8FA 1TF2A 4C0LA 3OIUA 1W1WA 1CRQA 3QG1A 1TQ2A 3HYRA 4JBXA 4P0TA 4TMVA 5HCNA 3WHLA 2ZJ5A 5FOSA 4OHXA 1PLJA 4IOJA 2YWGA 3B5JA 1DG1G 4C0SA 4IOLA 2OV2A 3UANA 4A8JB 3GEIA 1NSFA 2DBYA 4KITB 4F4IA 4PSVA 1XTIA 1G9XA 2D3WA 4FINA 1GAJA 4PSAA 1XZQA 4V03A 1ZINA 5FR2A 3ZIAA 2CMKA 2ZM5A 4HEJA 2ZRPA 2G6BA 3N2EA 1NVWQ 2ONKA 4PAOA 1Q22A 4LK2A 1KNQA 2J9RA 4I1SA 3BS4A 3DO6A 1G19A 2IYQA 1PZNA 1UDWA 1N5KA 2F43A 4M1SA 3K8YA 4NKRA 2K5UA 3K0SA 3GJ6A 3QEJA 4YXWA 1OE0A 1YZKA 1DAKA 1QHGA 4ZV4A 4UJ3A 2GEVA 1SKYB 1XCMA 2EVWX 4C0BA 2OAQ1 3I92A 3SJBA 1TUIA 1Z2AA 3IEUA 1E94E 4YMTA 4Q02A 4D0GA 3TUZC 4B74A 2G77B 5SZHB 1W49A 5KSYA 2XEXA 1K5DA 1P60A 5CYPA 4P31A 3F3YA 1GOTA 4CRWB 4V0MA 2ZRIA 3QKTA 2XTZA 5FUXA 1AQUA 2CLSA 4Q9HA 3U5ZB 4WIAA 3L43A 4NHOA 3VU9B 2GKSA 1W36C 2DWOA 3PV0A 3UPUA 1N6LA 2OFWA 3EPLA 5CLLA 2REOA 2VP6A 2WAYA 3ND9A 1COWA 4B33A 3LFUA 2UZIR 2IX3A 1Q44A 4G1UC 1VDZA 2OFXA 4D4KA 3BRWD 4QOSA 3BB1A 1GNQA 4DDVA 4RZUA 5FL7A 3WMFA 4LBYA 1KSHA 2P5SA 5FOVA 1DAEA 1I4DD 5H8WA 1UKYA 4Q01A 3UWKA 1KTVA 2JLUA 1QHXA 4N0EA 4R98A 5TXGA 3VAAA 4II7A 3Q85A 4Q4LA 1KDTA 1XEXA 4E22A 3CH4B 1RW4A 2AK3A 4B48A 4M9XA 4Q47A 3W5IA 4W9MC 2CHQA 4OYHA 2F1JA 3WRYC 1VCIA 4Q1BA 3I8XA 4DBLC 1M34E 4MITA 4HLQB 1XCGB 1YVDA 3A1VA 1HUQA 3CF6R 1RC8A 2JASA 4D26A 1P3JA 5CYOA 1RKBA 1E9RA 1XDBA 3KZ1E 5ANRB 2F1RA 2GEDA 5KSPA 2ZAMA 5E95A 4EJSB 4I4LA 3RS3A 3A37A 4RVCA 2Z83A 4DT1A 1G7TA 2BBSA 1FOEB 2GCOB 2I1QA 4Q4AB 2WJHA 4MRRA 2R2AA 2ZE6A 4TZ0A 3THYA 3FMOB 4JLNA 1CR1A 4N3NA 2YC4C 3O8CA 4BFWA 4U7DA 2AD1A 2HCJB 4G3XA 4GP6A 3W90A 3GLFB 2AXPA 3OAAD 1Z28A 2ZRGA 4IDQA 1ZRHA 4ASUA 4TWZA 1VIAA 3FVQA 1R6BX 2OEPA 3GLGA 2IXGA 3CRVA 5BYKA 3ZZTA 3TAUA 2GESA 4C2UA 1OH7A 1G8PA 3LX5A 5DI3B 1V5WA 4QG7A 4XD7A 1XD9A 1EFCA 4OHYA 4B6EA 2H18A 2WV9A 3QNUA 1L7VC 4JLAA 4NPHA 5DLQC 2J0SA 1TU3A 1AN0A 3R7WB 1XJQA 5FUYA 1E4VA 1TPZA 1TU4A 1VCMA 2WWGA 3PEWA 4DSTA 2VHTA 2C8VA 2QQEA 2RB4A 2W58A 1Z6GA 4M1YA 4CVNA 1P75A 4AYXA 5CLQA 2H8KA 2FU5C 2FA9A 1BH2A 1M7BA 2ECKA 4JVLA 4KFRA 3ICEA 2BOVA 1M74A 1JAHA 2VHUA 3OZXA 3QG5A 4MYUA 4ZIRB 2XGJA 1E9EA 1TQDA 4B2LA 3CB4A 1LTQA 2PEYA 4QRHA 3BXZA 3R20A 3BAFA 3IDQA 4X8LA 1YRAA 2GZDA 4IFEA 2X1VA 4BEJA 1ETUA 1KJYA 4PHFA 2WSMA 1CJUC 4LHVA 3WHKA 2V1XA 1COWD 4IDHA 3TQCA 1G1MA 4YMUA 3K70C 2R6FA 4M1MA 4Q7JB 2F9LA 3PENA 3KXKA 2QTHA 1G3MA 1VTKA 2FWRA 3IGFA 4IRUB 4L9SA 4TMZA 4Z8XA 4AKHA 2EU8A 3W8NA 4UNRA 2HEIA 4LJAA 4QBGB 4EUNA 2J3EA 5C1BA 4OI4A 4A2WA 3EZFA 4JT2A 4XWOA 3NIBA 2OBMA 4G5SA 4PC1A 2DFKB 1KDOA 1G8YA 1OXXK 2AHOA 3PQCA 4N1AA 4TTPA 2I4IA 4Q9JA 2PZGA 3ETLA 5AUQA 4URZR 1Z06A 1OIVA 2IBMA 1T3HA 2WIAA 2FEMA 4M9SA 1RZ3A 1QDEA 1JECA 2ZSEA 3H1TA 1UKVY 4L8GA 1SGWA 4R2IA 1IQPA 3SOPA 1M8PA 1S3SA 4O3MA 1SXJA 1NMXA 1C9KA 2KBFA 4OJQA 2FN4A 4FN5A 2DWQA 2PLRA 3NC1C 3C5CA 2QPAA 5AJWA 4QBHA 4L16A 2IYTA 1IOZA 1CULC 2GILA 3LWNA 2H92A 3T1QA 3TR5A 3LBNA 2XTMA 1TUEA 2O0JA 3SBDA 1A5TA 1PJRA 1BOFA 4KFUA 3VR1A 1KI7A 1IXSB 1V43A 4QGAA 1ZNXA 3SE0A 1EESA 4NCKA 5L3QB 2VHCA 3FB4A 4LGMA 3N5CA 4NDZA 1W0JA 4AK9A 2Z0MA 1WDTA 3CLVA 2PMDA 3SFZA 1A2BA 4Q9LA 3ECCA 1MRSA 2ONJA 4F4CA 2GZAA 1R5NA 1P4SA 4ASUD 3RRZA 1G3IA 2N46A 1NBMA 2CJWA 5EE0A 2YNMA 4LC1A 1FX0B 2QT1A 3K09A 2Q21A 2G1JA 3MSXA 4XD7D 1II8B 2GXQA 1AGPA 1XPUA 3VNUA 4ARZA 2GK7A 4OK6A 4DIEA 1NSTA 4X8HA 4B44A 2Q9BA 1NN3A 4HZUB 2HJVA 3SYKA 2FPLA 3K53A 1W5SA 1E9CA 2HCBA 2O52A 2ORIA 3I3SR 2AX4A 2PT5A 4GNKA 3OF5A 4FD2A 2ZIAA 4G5OA 1Z0FA 4URYR 4B6FA 3I72A 2P6RA 3TE6A 1ZIOA 1ANKA 2ZI4A 3I73A 4DCTA 2R6DA 3HWSA 3GJ3A 4RSGA 1S1CA 5FBWB 2C03A 4MRNA 2IT1A 2UKDA 2QPOA 1N6RA 1E2GA 2CLDX 4FI3C 2D2FA 3TSOA 2ZYUX 2ZJYA 2FSHA 4BEBA 1OIXA 1XD2A 3Q9LA 4NCNA 1JR3A 4M0LA 2J0UA 2PLFA 1UKEA 2WHXA 4FW9A 2C04A 1PV4A 2V6IA 4WW0A 2QMUA 2V6JA 4RD4A 121PA 1PUIA 5BQ5A 2CL0X 3A4NA 2EFDB 5J5CA 3CPEA 5AJVB 4D0LB 1XBTA 1G4UR 3VTKA 3WY9A 3QVVA 5IRCD 4HATA 1SVWA 4AG5A 2AK2A 2WKQA 2Z6VA 2A5DA 1NP6A 1R10A 3CNNA 1QRAA 3F8TA 2Q3MA 2CK3A 3T35A 4ZCIA 1N0UA 3MRSA 4MYTA 2Z4RA 3U3JA 4JMPA 1ZYUA 4M9ZA 1FMLA 2BMDA 2OBLA 4PHHA 3W34A 1W0KD 5K8IA 3L0IB 1GRRA 2Q3FA 4HB0A 2IHYA 1C1YA 3K0EA 3NBZC 3PUYA 4DVGA 5FUWA 3BGWA 1FQJA 4QJ5A 4QJ3A 1HH4A 2GK6A 2QBYB 3CPHA 3CBQA 2FV8A 4MKFA 5FFMA 3U44B 3R9XA 5F9FA 2QN6A 3THXA 1BIFA 2GRJA 3ONWA 2EYUA 2FGJA 2V55B 1BMFA 2IYWA 4GZMA 1FPMA 2ORWA 4DLYA 2ZUDA 2GXSA 721PA 3IPYA 1IBRA 2XB2A 1JR6A 2V3CC 1NIJA 4NYJQ 3UKDA 2JATA 3QF4A 4ABYA 3H86A 5FBVB 2QE7A 3MUFA 4HUTA 4HDOB 4URWR 2QPTA 2ZQ5A 1HE1C 3KJGA 3O8DA 3NG1A 1CJKC 5D3QA 1N5IA 5J40A 3VFDA 4BZXA 4C30A 4AIIA 4A0HA 4HLDA 3RVBA 1G8GA 2VF7A 3U4QB 3SC3A 2J41A 1E98A 2OILA 3LLUA 1W0JD 2EFGA 2UZ3A 1NG9A 3PJRA 2C9OA 3AVYA 3LQRA 1IN7A 3K70D 2WSSA 2ZSAA 4Q4HB 1KO5A 3G0HA 2FZ4A 3SQXA 1G3QA 2OAP1 4HB2A 2H1LA 4CDGA 4KSCA 5L3SA 1L4UA 3WBJA 1M2OB 2XJ4A 3DOFA 1OKKA 4P4SB 1TADA 3VU9A 1MR3F 1EFTA 4OBEA 3AF3A 3PUWA 1TEXA 1G18A 1JB1A 1SKQA 3LVQE 5BN4A 4DB2A 5IK2A 2ZEJA 4QGHA 2ZRKA 1XNJA 4H1VA 4KJZA 1W4BA 5KNBA 3S1AA 5CIQA 1G21E 3NBXX 4N0DA 2CCKA 2WJYA 2Z4SA 4C9BA 3TVDA 1XZPA 2P2LA 3BFVA 3HP1A 2ASEA 3QVUA 2YVUA 3MAAC 4Q7KA 1SXJE 3UATA 5KPDA 4CGZA 3P32A 4A82A 1GRQA 1KDPA 4EFMA 2J7KA 1KO8A 1LY1A 1RFLA 3B85A 4I81A 5EE5B 5B30A 4YQFA 3D6TB 4IJMA 4MGIR 4NYJR 5JEDA 1SQ5A 3TH5A 1MOZA 5JEEA 1N6KA 4TL8A 5JS7A 3M0EA 2WKRA 1T8UA 3CZQA 1U90A 4TL6A 3KQUA 1QHHA 3BIFA 3QPVA 4GMXA 1Q57A 4XSGA 2GJ9A 3PIRA 1W36B 2NTYC 1NL3A 3GEHA 4MKIA 2WZQA 2ZJZA 2NO9A 2JDID 4S2EA 2IHBA 1NG1A 1T8TA 5P21A 3VQTA 1XTSA 1FP6A 1GNPA 1OSNA 1I2MA 1HQYE 2FZLA 4PC7A 1CBUA 3LX8A 4KLZA 4Q7LA 2XX3A 5GJBA 1NBME 2GA8A 4PR0A 3SI7A 1A7JA 1WE2A 3MWLA 4JYBA 2W00A 4PSKA 2D62A 5GJWC 3W8RA 2JJ8A 4M8NE 1OJLA 3OE7D 1E9AA 1Z0KA 3UMFA 5AUOB 1M7GA 5C46F 5J4HA 4Q4AA 2RGBA 3RDPA 3L8YA 1KKMA 1KDRA 1N6PA 1MO5A 3BE4A 3DM9B 3MJRA 1YU9A 2PZEA 3C7KA 4RD2A 4ZDJA 4JLMA 4M21A 5LPNA 5AWFC 3BOSA 2RHMA 1P9NA 1G6HA 1LVGA 1X8KA 821PA 4DEXA 1W2GA 3I32A 5FTNA 4QM7A 2GAOA 3CKLA 4ITRC 1QVRA 4C7OA 3NHAA 1SULA 2ZROA 3ZLJA 4TN1A 5FL3A 1KY3A 2PX3A 1RPZA 2V4ZA 1VMAA 2QTVB 4LHYA 1FNNA 3KTAA 1K5GA 2PJRA 1E2NA 5ELXA 2REXB 2VP0A 3CPJB 2ZRNA 3FTQA 3EPHA 4Q5IA 4ZDWA 1AA9A 4FMCF 2AKAB 3DKPA 3KUDA 3CRRA 4FXPA 3K1JA 3KKPA 1KO4A 4UQOA 3ZQ6A 4RFVA 4BECA 5TDHA 4A6PA 4ZI3A 5EXXA 1CF4A 4P32A 3NC0C 4B2PA 3TBKA 2ZRJA 1Z8FA 3IEVA 3EWAA 1AQYA 4I99A 1ZNYA 3DMDA 4BFSA 4OHWA 2FFHA 4KVGA 1MO6A 2YWFA 3DZDA 4W5JA 5L8VA 2OUKA 1ODFA 2RGCA 2EWVA 4NU0A 4LRWA 3SJZA 1A4RA 5IK2D 1LF5A 1KSJA 1P2VA 4XSHA 1QVAA 3C41J 4FWTA 4TL7A 4XWKA 3U3KA 3V4FA 3B1YA 3CM0A 2JJ1A 3BH6A 3QPWA 1TTTA 1EGAA 1PLKA 4F7WA 2WJGA 3GFOA 1AJEA 4FCTA 3IQXA 1G291 1JBKA 3RAPR 2C78A 2CL7X 2YC2C 4X8MA 3CWZA 1SKYE 3PG5A 3FKSA 1Z5ZA 4CEHB 1HT2E 1NRJB 1OHHA 1S1MA 2FF7A 3KB2A 4NH0A 1JQLB 3KQNA 1Y63A 2IXEA 2NPFA 1XX6A 2NMVA 1FZQA 1GDDA 2KBEA 3TGPA 1GKYA 3JZAA 1CRPA 5FTJA 4BPBA 4RCYA 4M22A 1NMYA 4BUJA 1FW6A 2N42A 4UNPA 2QUZA 1F60A 4BZQA 3UIEA 1GFIA 2H16A 4TSFA 2PEZA 2OE2A 3A58B 4KFTA 2RGGA 1T0HB 2HT6A 4V0KA 3U60B 5JJIA 1E2MA 5KU1A 1OLOA 3OEHD 4B76A 2ATXA 2MMCA 1NIPA 2FEOA 5C2JB 4DUGA 4BWYA 2DYKA 5TMPA 3IBYA 1KY2A 4TQ9A 2B8TA 2XB4A 3NDPA 4IOMA 5L3QA 3HU3A 1G6OA 4LCBA 4QXAA 1N2CE 1E0JA 3FWYA 1Q1EA 4Z1MA 4RD3A 1R2QA 2J59A 1E1RD 1Q20A 1Z0JA 4RCZA 3ZYCA 1G5RA 1P72A 2PX0A 3RRYA 4E03A 1MABA 3AF0A 5FI0B 3QIAA 4DEYA 3K9HA 5KPJA 2ZRCA 4TMWA 5JSZA 1N0VC 3CX8A 5GJCA 4L15A 3CH5A 1FX0A 3LXRA 4LYFA 1NMZA 1QF9A 3EIHA 2FFQA 2ZRDA 4TQAA 2IUSA 5FOUA 1KSGA 2FFAA 2G88A 2DFLA 2REBA 1RJ9B 4QNRA 2R44A 2VP2A 5DHAA 2F55A 1SVMA 3K0AB 3RS4A 4M1WA 4FMDF 2O0KA 5LD2B 4L4UA 3H0KA 3C8UA 2ZR9A 4OJKA 3K0FB 2AN9A 4NP6A 4KU4A 3THWB 2ANBA 4HSEA 4XVRA 1XB2A 2FJUA 2XNDD 2P6NA 3HU1A 4ACBA 4EPRA 1K8RA 2JIZA 4TLBA 2P0EA 4WZBE 5TARA 5EZ5A 4BFUA 2ZREA 2IUUA 4LJ9A 2FDCA 4JLKA 5FBRB 2GHIA 4KV9A 2H5EA 2OXRA 2ZRHA 3OEED 4WAUA 3KQKA 4AURA 1WMSA 3GLIB 3MGCA 1UM8A 4OHZA 3GLFE 2JLVA 1GM5A 3ASYA 1GKUB 3CNLA 1VYUA 3LVRE 1XMIA 1AZTA 4HAWA 3CO5A 5EZ6B 1OYYA 4U5XA 4O0MA 4L9WA 2ZRAA 1AK2A 1B0UA 1S0UA 1KI6B 1HT1E 5IDVA 621PA 5IF9A 2QTFA 1CJMA 4LUCA 3DM5A 5HE9A 5KSOA 3RS7A 2RGNC 1TQ6A 2ORVA 3RNLA 2GBLA 3FKSD 3V9PA 1XFAA 4BZPA 4C2TA 1P6XA 2CE7A 5TVKA 5LBIA 3TMKA 1JJVA 3L0PA 2RGDA 5HTKA 4MQBA 2E9SA 1JEDA 3U44A 4D4MA 3TQFA 3RLFA 2HXYA 4JS0A 1QHIA 4G5GA 2HLDA 1GG2A 3GJXC 1YR9A 1F48A 4IXNA 4IDOA 4TMKA 2KWIA 4NCHA 1MV5A 4WXRA 5KO2A 4PO9A 4BFZA 4GZLA 3Q7QA 4BE7B 2LWIA 4JVSB 3AVVA 1Z07A 2IYRA 2R62A 2WWWA 2GTPA 2DFTA 2WPDD 4W5HA 3AQ4A 4A0RA 4PHTA 2ODNA 1G16A 2ZE5A 4JL8A 3P4XA 3KKOA 3BB4A 3U4QA 1N3BA 4FMCB 3TVTA 4XH9B 1SVSA 5K8UA 4Z1MD 4OQMA 2QROA 5KNDA 5CM9C 2QRNA 1VG8A 4JLVA 2NO1A 4Q4HA 3CRMA 3RS0A 2WICA 1Q21A 4C0AC 1AIPA 3SZRA 2QORA 4PC3A 4LHXA 3FMIA 1WA5A 1XRJA 1DEKA 1ZC4A 1Z08A 3CRQA 2VP9A 4O2LA 4P4SA 3JVUA 1EWRA 1EWQA 3W3AA 4EPTA 4PPNA 4QFMA 4RKFA 3TUIC 3ZGXA 4ZO4A 4JZKA 4D82A 3DZ8A 1KGDA 1U98A 2I1VB 2DR3A 1OW3B 2A7QA 3ND8A 2OG2A 1XXHB 2DHRA 1MT0A 4MGZR 2F3TA 2GDJA 4QHSA 1X1RA 4DSOA 5KNCA 1QZXA 4A2PA 3E70C 3I4LA 2BV3A 4BLOA 3TKLA 3AVWA 1ZMXA 1X86B 2BEJA 2P5TB 4Q4JA 3P26A 4PO8A 3X1YA 3RC8A 3ZIAD 1G8HA 3GFTA 3AP2A 3ADBA 2NOAA 1NVUQ 3GLHB 3KB1A 5EJEA 4HLCA 1N6IA 5HZHA 2F3RA 2XSZA 2O5VA 2RKOA 2ANCA 1JPNA 3VKHA 3REFA 4BLPA 2KE5A 2ZSBA 2RGAA 1T9HA 3ZS9A 4J0QA 2J45A 3QXCA 3BBPA 2V7QA 1WXQA 1CU1A 1YZTA 2W83A 3KJHA 4YXWD 4CT4B 2Q3HA 3X1XA 1AGRA 1Q1ZA 4AG6A 2NIPA 8OHMA 4Q1AA 1UAAA 1N0WA 4G0NA 4V0NA 4NE2A 1TX4B 2F9MA 1WF3A 1DAIA 4ZI2A 2QY9A 1SHZA 2ZS7A 2IXFA 5SZJA 2D74A 2VYFA 4NONA 4OI2A 1JALA 1YQTA 1SXJC 1AKYA 1EFRA 3P4YA 1Q0UA 4M4SA 3A4MA 3ADKA 1P9RA 2JEOA 1KI8A 1HTWA 1E2DA 2ZUBA 2XOKA 3QE0A 1KI3A 3W6NA 1E0KA 2A30A 3EPJA 4KCGA 4LPSA 2CHVA 4JT4A 1D9XA 4MGYR 2GVDC 2GF9A 2EFHB 4WA7A 1ZD1A 3ZJYA 3B7GA 3KJIA 1G7CA 3NBFA 2QAGB 4OKSA 4OI0A 4ZCMA 3B2EA 4DWJA 5EE1A 1VPLA 2VA8A 3DPUA 5FL7D 2D2EA 3AKYA 2X2EA 4GOKA 1YKSA 4IDPA 4FMDB 2JLYA 4F38A 2R9VA 1II9A 3T12A 2QM8A 3K09C 1IY0A 2G83A 4LV5B 3NH9A 3LW7A 1DO2A 1KO7A 1WCV1 1T3SA 4HAVA 4PTLA 4FCWA 2Z43A 3CX7A 1YR7A 3MFYA 4QGGA 4RD0A 4TYPA 5GJVC 5KDOA 2IEZA 2CXXA 2ZI3A 3PEUA 4Z8YA 4BFYA 4DIDA 4TYYA 2QAJA 1DELA 1N6OA 3AUXA 4URXR 1OH6A 421PA 4ESHA 3DL0A 5DGXA 1A1VA 3O8BA 5CIWA 1DTSA 3KFXA 1L8QA 4LI0A 2HYIC 3B60A 1XU4A 2YOHA 3LY5A 1RRGA 1E99A 3ASZA 3MLEA 5C4GB 1YR6A 3AVOA 1ZCAA 3A1WA 4US1R 1L2TA 2ZUCA 4DJTA 1N5LA 1G7RA 4JKYA 3M4YA 3VMFA 3QENA 2GJAA 4CEHA 1R0YA 2A5YB 4PANA 3B1XA 2GVZC 5DISB 5HZKA 5KUTA 3WYAA 3J81k 4JLBA 4V0OA 1KAGA 4FWIB 4JBWA 2FH5B 3A1SA 3AUYA 4LBVA 4MDFA 3RC3A 2WM9B 3MWJA 4DCVA 1BS1A 1S4QA 2IYZA 3U3MA 3L82B 3D3QA 1PVOA 1S9HA 1TL7C 2VBCA 1YRBA 4XTCS 4WBSA 2XITA 1U94A 4GDFA 1KIMA 1R8SA 4KAXA 2KB0A 1R5BA 2B92A 5JHHB 1Z47A 4G5QA 3VX4A 2GCNA 2QU8A 1R7RA 3AF2A 3RRNA 2D06A 2DWPA 2ZE7A 3A4LA 4KODA 5AJYA 2VO1A 1GIAA 4UJ5A 1F2TB 2W6JA 1OV4A 1XTKA 2A5JA 3CZPA 3HR7A 5JJKA 1E9BA 1EFRD 3M1IA 1NY6A 4EPVA 2OO7A 2YHSA 3KL4A 3EIQA 4EPYA 1ZVQA 1KZGB 4GOJA 2XOKD 2JLSA 1VCNA 4FIDA 3IIKA 4PZYA 3CIOA 4E07A 5L3RA 1XEFA 4YDHB 4TYWA 4M9QA 4PAMA 1N6HA 4B3XA 3C16C 3NXSA 4MA4A 1FTNA 5FPTA 2CE2X 2ZS9A 2WOJA 3AV0B 2O8DB 1D8TA 2C9YA 4B73A 1FUUA 2GETA 5L3SB 2Q6TA 1VCOA 4MYCA 3Q8XB 1KK3A 5FI1B 1KK0A 3B1WA 1U2RA 4JIMA 4R7ZA 4ZKEA 1DAFA 4XIGS 1I4TD 1JI0A 4K8OA 1NKTA 3BERA 4A8JA 3FYHA 1Z29A 5E3HA 3U7FB 3K0FA 4JJZA 4B32A 2JGNA 2ZI5A 1I2DA 4A9AA 1GWNA 4B43A 4PX9A 5JS8A 4DLVA 1T5IA 5JWHA 4UXHA 2HF9A 2OLJA 1P9WA 4LJ6A 2ZJ8A 5FTKA 3KFVA 1ZM4A 3AKCA 4ESVA 2W2XA 4TLAA 2JLQA 1RVDA 4C4PA 2ODEA 4YMWA 1CP2A 1QHNA 3N70A 1HA3A 4PPGA 3FHTA 1OFIA 3LW8A 2PZFA 3LD9A 2WTUA 4C0JA 1SXJD 3GLIA 1AKEA 1FNMA 1UJ2A 5DYGA 5LB2A 1ZIPA 1Z83A 1HV8A 4A1FA 2QNRA 4DDUA 4QGFA 4B2IA 4R9UC 1A82A 4QC2A 1SVOA 3T15A 3CF0A 3IPXA 5GADl 1KI6A 3AM1A 2WJVA 1Q3HA 1ZNZA 2QP3A 1ZUIA 5EXSA 4V0LA 3TW8B 2AWOA 5UKDA 1DAMA 5CJ2A 4TLCA 4URUR 2FNAA 3JVVA 4IFBA 1XP8A 4OQNA 4G5RA 1UKZA 3TLXA 2WMNB 5KSZA 5AUNB 1IN6A 4Z54A 2VSOA 5B58C 3L0OA 1YZLA 2P6UA 3DMNA 3EG5A 2QMHA 1HY3A 2ZR7A 5SZKB 1E2EA 1OXVA 2DY1A 4MRVA 1BO6A 1GRNA 2CHGA 3IIJA 4XWAA 3EWSA 3K9NA 3WNCA 2QGNA 4FCVA 1LF0A 3QXXA 4O25A 4D81A 1NBMD 3LDAA 1Z63A 4A6XA 3GJ5A 4LZZA 3X1ZA 4FMBB 2ZJBA 4ZPXA 4D80A 1KYIA 1ZM3A 3D7MA 2V9PA 3WXMA 3TUJC 1UBGA 2ZR0A 4BRWA 4DLZA 1DE0A 2V8OA 3KJEA 5J47A 1MO3A 4Q1DA 3K0CA 4B3CA 1NKSA 5JRZA 4TMXA 5JBQA 1KJZA 3W5JA 1FP7A 3SHWA 2BIFA 1HEIA 2D7CA 4M1TA 1S8FA 5JMTA 3KXIA 1QHYA 1DBSA 3KKMA 4P33A 4HLUA 4TMTA 1Q3TA 1EG7A 1KI9A 1YZQA 2RMKA 2C2HA 5J4LA 2NQ2C 1W2HA 4H1UA 2IWHA 3HU2A 2R8RA 1JR3D 3FHCB 2IYYA 4DSNA 1WB9A 1DVRA 1Z0AA 2BM0A 3ZZUA 1F2UB 1P62B 2AFIE 2BBWA 2W2VA 1X6VA 1RRFA 4OQXA 4Q21A 1JJ7A 1ZUNB 1EX6A 1W4AA 4A4DA 4DCSA 3OFNA 3QEOA 2CK3D 2RH5A 1T3LA 2IYVA 3EZ2A 3Q72A 4C0KA 3K9LA 4EJSA 2CVFA 1F6BA 1KI4A 1LFDB 1J99A 5JECA 1E1QA 1E79A 1TF7A 2GCOA 4LWZA 3GLGB 1VHTA 3HYTA 6Q21A 5H1YA 3KKQA 1FFHA 4LOAA 3WYGA 2PJZA 3AF1A 2VP4A 4U00A 4MRPA 1E96A 4LX0A 1YZUA 3X1WA 3GLFA 1ZP6A 2P3SA 1D6JA 1DADA 2BKUA 1BMFD 2JCSA 3JZMA 5FR1A 2RGEA 1Z6YA 4PFSA 2RHDA 3Q5DA 1NN1A 2FE4A 1WBBA 4HAXA 2QE7D 2PCLA 5DI3A 3I62A 3QBVA 2GWHA 4BLTA 4CEIB 4QKQA 3W6PA 3SQWA 2HT1A 1OT3A 3L0SA 2BC9A 3LNCA 4MGKR 3R7WA 1D9ZA 3CF2A 4A92A 2MMGA 3L8ZA 3B1VA 4LPKA 3QY0A 1UBCA 2VIIA 3TW4A 1IHUA 4DHEA 1OFHA 3RSLA 4CT5A 2AR7A 3V00A 4HZIA 1W46A 4QM6A 1J70A 4TTQA 1H8HA 1CR0A 3LO5A 3KQLA 2WSSD 1E2HA 1NY5A 2G9NA 5GVSA 1R0ZA 4Q1CA 1F3OA 4JLOA 3EC1A 3FFAA 4CZ2A 4ZIRA 1OKKD 2O8FB 3MD0A 1YZNA 3BB3A 1OFUX 1XPOA 1JQJC 3KKNA 4O2RA 5FBLB 1ZM7A 1IY2A 2D4HA 3I61A 2EW1A 3QOFA 1OYWA 3MCAA 2QAGA 2ZTSA 5E4FA 4C0QC 3U2QA 2FSFA 1GL6A 1E2KA 3KUCA 5F98A 5CK4A 2CNWA 1G20E 2QI9C 3EZ7A 3GLIE 4AD8A 2KI5A 2HDNB 4DRZA 2PL3A 2LCFA 1R0XA 4PAQA 2O8CB 4XTRA 5GVRA 3A6PC 1DO0A 4CF7A 2OSBA 3CW2A 3UWOA 4EPXA 1BYUA 2CDNA 5H70A 1ZM2A 3SDZA 2F6RA 3SFVA 1KK2A 1NI3A 3PXGA 1SVIA 1J8YF 4B71A 2ZRFA 4RZ2A 2FPKA 1LS1A 4V02A 3R8CA 2MSEB 3EXAA 4BFXA 4KVAA 3D31A 3RS5A 3CX6A 1IJFA 2GXAA 4AKEA 3K70B 4OHVA 1ZUHA 3H84A 2XJ9A 2ZETA 3UK6A 4H9GA 1Q1QA 3CONA 1M1YE 2HYDA 1E1QD 1E79D 3P20A 2O0HA 2V54A 1DAHA 3E5HA 5DN6A 5K8LA 5BN3A 3B9PA 1P2TA 1HQCA 3VR5A 1M6NA 1Z0IA 1P2UA 4JSTA 2Q9AA 1G5PA 3NBYC 4ARZB 4BFTA 5DH9A 1Z22A 3U7HB 2ERXA 3UXMA 1ZCBA 4KYUA 4PQFA 4AY2A 2B7CA 221PA 2BDTA 2FOLA 2QENA 2ZRMA 4Q1EA 3GJ7A 5J4YA 4AYWA 1E0SA 3PR1A 4DDWA 2NG1A 2ZVQX 3HDTA 4PO1A 2ZRLA 4MUAA 5FTLA 5DE3A 2IS2A 1ESNA 3H2YA 1CEEA 1R4AA 3EX7C 1W7AA 1GL9B 1OPXA 1TQ4A 1VYVA 4Q1FA 1EFHA 2CLCX 4Q18A 1II8A 2GBLC 1D2MA 4RKEA 1KO1A 2F1HA 5DYIA 1SVKA 2ZITA 3THOA 4AC9A 3RHFA 4EQ6B 4PQYA 4HZUA 1CJTC 3QXJA 3SJAA 3DEFA 3DOEA 2QZ4A 3TIFA 1S96A 5E7IA 1B23P 2GJSA 1RYHA 4GSYA 3ZVMA 2C98A 2BKEA 5KDLA 4DB4A 4PC6A 4TL9A 5K8TA 1CIPA 3A1TA 3CNOA 2J0UB 2O8EB 4A2QA 2G0NA 1GZSA 4ZDIA 1XXHE 3TK1A 2EWWA 3ADCA 3A8TA 2QP4A 2J7PA 1XMSA 1H65A 1CLUA 1PLLA 1ZNWA 1XEWY 2PT7A 5JLJA 1ELOA 2ZSDA 4QL3A 2X77A 1N25A 1U9IA 1E0AA 5B64A 2YINC 3V4RA 4KXFB 5EXTA 3EZ9A 3RRMA 3TSWA 4DLSA 3OIYA 3SN6A 1D5CA 2ZRBA 4GT1A 1IXRC 1GITA 1KNXA 1KK1A 3EC2A 3W9YA 3EASA 1IAQA 3GLHE 1OXUA 4CEJB 1T91A 3T5DA 4D0NA 2O8DA 2JJ1D 2ZYWX 2FG5A 4TLEA 2C77A 2CNWD 4I1UA 4UNQA 3THXB 4Q03A 3FFBA 1E69A 3OAAA 2GZHA 2XXAB 1E2IA 3NTUA 4JVNA 5BYJA 3U61B 4DCUA 4DSUA 4HUQB 1P2SA 2OFOA 1CS4C 3WNDA 1UEIA 3QF4B 3QXHA 1OHHD 2YOFA 1RRCA 1IXZA 2QBYA 4RFSB 1KMHB 2BVNA 4XJXA 2BEKA 2AKYA 1E9SA 4LV6A 4KO8A 1T6NA 5J4KA 2EYQA 3PVSA 3ICQB 1XPRA 2IYLD 5EUMA 1M7HA 4UNSA 3RWOA 3GPLA 3E1SA 3IHLA 4OK3A 1LW7A 2OESA 1XTQA 3FHOA 4JJKA 1FL9A 3BJIC 3GEEA 4D25A 4TSFD 1NN5A 4EFNA 3Q7PA 3FDIA 2QMEA 2R65A 4KFSA 4LJ7A 1P7CA 1YR8A 3LRPA 2WBLC 5BN5A 1LV7A 2N1BA 5KYKA 3AP1A 4MYHA 1MKYA 3H4MA 4LHWA 2JJ2A 4BLSA 4DZZA 5JFGA 4LYAA 4K46A 4Y0AA 4DUGD 5FUVA 4ZDKA 2JLZA 1KHTA 2V1UA 3RABA 1KOFA 4C3ZA 2QM7A 3I1FA 3C15C 2F7SA 2ODWA 4PQRA 2XNSA 4IVRA 1G64A 5DN6D 2J0VA 1ZU4A 3PCRB 3I8SA 4M53A 4ON9A 1SVLA 2WIBA 1J2JA 3MG9A 3SEAA 4M1OA 2IYSA 2LKDA 4LJYA 3S1AB 4S35A 3RYTC 3TRFA 5JRJA 3HPRA 2O8BB 1JEEA 4Q9KA 4EKDA 2FMXA 5CDFA 3QPUA 1VG9B 4IKEA 1O3YA 1QG2A 4A15A 1GL7A 3FKQA 2PBRA 1NN0A 1N5JA 3FMFA 4QHTA 5D3MB 1TMKA 3BH7A 4X8OA 3ZDQA 1YE8A 4IXMA 2DPXA 3TAHA 1GSIA 4AKGA 1TF5A 2Q0HA 4HDQB 2QG6A 3A36A 1L4YA 5CJPA 5G41A 4B75A 3EA5A 1XTRA 1Z3IX 4DLTA 4ACAA 5BW8A 2OZEA 1N6NA 3QF7A 1QHHB 4ERNA 1EX7A 4B3BA 2VHJA 3FPAA 4K81B 2CEAA 1VYTA 3C4JA 2YZ2A 3B6EA 2J87A 1F5NA 2RGNA 1WQ1R 2FSIA 4KBGA 4NL4H 1CR4A 3NDBB 4ZKDA 1T4GA 5HCIA 1E2JA 2WWXA 2JIZD 2YOGA 3VR4A 4DCNA 2J7PD 4PXAA 4F91B 2FX3A 2IW3A 1QG4A 2IYUA 2TMKA 2J0QA 2QSZA 4RY2A 1X8LA 4DLWA 1E4YA 4JSYA 3O47A 4HYYA 1W44A 2HV8A 1P61B 1X8JA 5DIFA 1F2UA 5DNYB 3AKDA 1QBKC 3U6KA 3B78A 4XOIA 4IW3B 5AK0A 3U3OA 1OB2A 1U8AA 2BCJQ 2YWHA 3Q5EA 2AL7A 4JLPA 2VTKA 3M6AA 3QKUA 4L5BA 3ZZ0A 1U0LA 2RCNA 5FTMA 3IBGA 1US8B 2VLIA 4C7OB 1TEVA 5CM8B 1P73A 2XZOA 1GTVA 4PPQA 2J46A 1AM4D 1W48A 2RAPA 4C0HA 1G3UA 3P27A 5J4VA 4RZXA 1ZD9A 3R9WA 3BK7A 3VHXA 5B57C 1WP9A 3BORA 3KTAB 4P4TA 3SJCA 3QUSA 2G3YA 3PITA 2FPMA 5IHPA 1EXMA 1E2FA 2HLDD 2XZPA 5G53C 5JCZA 4AWXA 1IN4A 1UPTA 4AYTA 3AGPA 3F0TA 2ZANA 2WKPA 1J8MF 3EAQA 4LYJA 1OXTA 1Z0DA 3B8HA 3G5UA 4CEIA 3W3ZB 3HJNA 3LV8A 4ILEA 4Q9IA 4E09A 3QKRB 4LY6A 2JJ2D 4JLJA 2CL6X 1U81A 3BFXA 3DHWC 2QP9X 4QJ4A 4DXAA 1E3MA 1MRNA 1ZU5A 2ZS8A 3UG6A 3U6BA 2ZU6A 1DS6A 1RRPA 1E32A 1W47A 1CKEA 1G8FA 2WMOB 3CRW1 1R5OA 2ZPTX 1ZM9A 4TTRA 3VHLB 1Z6AA 4D6PA 3OIWA 5EP3A 2BMEA 3RANA 4I1OA 5EP1A 4YDSA 1MO4A 4LSGA 3NVAA 2IC5A 2B8WA 3T5GA 4MDEA 2O8FA 4NZYA 3AGQA 4IEEA 3U3RA 1JXOA 4OI1A 3WP0A 2I3BA 1G3RA 1X1SA 5JJLA 2SHKA 3PFIA 4HB3A 5HE8A 3U7GA 1JNYA 4TLDA 1UADA 1EK0A 1ZBDA 3TNFA 4GI7A 1W0KA 4A36A 1AS0A 2WAXA 3O8RA 2ZI9A 4TZ6A 5JZVA 4QBFA 2JLXA 2H7VA 2WJJA 1Z6TA 3MWKA 3LBHA 2X2FA 1HYQA 4US0R 1XEWX 4PPFA 5L3VA 1DAGA 2C5LA 2GCPA 3ZVRA 2UVQA 2ZJ2A 5AJXA 5F9HA 5TV2A 4WZAE 3DDCA 4BFVA 4NMMA 2O8CA 3B9QA 4B47A 3PEYA 4V0ME 4WZ6A 4B35A 3AH8A 1XCPA 4DLXA 5KOYA
chains in the Genus database with same CATH superfamily
5CB6A 3QKSB 4W8HA 5A4MS 5A5GA 1IONA 4AZTA 1PL6A 3FNRA 1D07A 4NOKA 1FFSA 2BGRA 5ALQA 1LS6A 3AU9A 4ALKA 2A9FA 2AFIA 2QKYA 4NDNE 5LQCA 1PYGA 1WWKA 1DAPA 1I51A 2DKNA 4B81A 3PPIA 1RZUA 3AM3A 3TD2A 4IIJA 5C18A 3PUZA 5EXPA 3EZXA 4D5GA 4HFRA 3L40A 4JJ4A 2HHLA 5EHNA 4P4UA 2GUWA 4NBSA 3UVEA 5LD2C 2PUBA 4RV5A 3UM9A 1LBEA 4MCIA 1KH3A 2A3RA 5F1KA 3UTCA 3ZEAA 4DG8A 5KTPA 3JAWA 5H7XA 2DTDA 2VSQA 5FPSA 4CCSA 3AHFA 4OA8A 5CDFE 1NOKA 1IB0A 4YMIA 2P3OA 4CQJA 3RVLA 4B4UA 2O2CA 2OCDA 1I7DA 5BQPA 4UTOA 5JMOA 1WX1A 5HA5A 3ED1A 1GYQA 2BUAA 2WHYA 1AQ6A 5FRDA 3TFOA 4JWKA 4IUYA 1JQAA 4QRIA 1DJPA 1P33A 1W19A 3K9BA 3AWIA 1ZJ6A 5CB8A 5TQ0B 2Y76A 4IDNA 3M9XA 1CK4A 1GQ2A 5HPYB 4IMIB 2IA5A 2W43A 2HEGA 3GA0A 1MLDA 3HDGA 3I42A 4QPJC 1KOLA 1QHSA 3AFIA 5ITSA 4I1YA 1BS9A 1UUFA 2X0KA 1XNRB 3ONFA 4TRNA 1E2LA 5JXHA 1U04A 4KHZA 1NU8A 2X9GA 4OQLA 5E7MA 3RIXA 3SZGA 2A8YA 3T52A 4K9LA 2AXQA 2ODBA 2PZBA 3UGKA 2QQ0A 2VPYA 3FLBA 3TG2A 4IMPA 2BJVA 3AVXA 4NOLA 4D8TA 4C4OA 3R24A 4L74A 2FW1A 4JI3B 4JQYA 2EFCB 2O1SA 3PDIB 1FRQA 1EK6A 3WLSA 4DPKA 4Z3KA 4F93B 2A0XA 1R6VA 1A8PA 5C4MA 1NNLA 2J3DA 2WFAA 3K9GA 3LCVB 5DBHX 1WSWA 3VKWA 3AVUA 2CDCA 4LFBB 2IIVA 1BA3A 4QEDA 5CYGA 5KTMA 1KYZA 1ESMA 1UF9A 5LDGA 3VR6A 5F7OA 3AF6A 4W1RA 5JAZA 4LHEA 2AQ8A 2DUJA 1FYDA 3SU8A 3VSDA 2Q7DA 3HBJA 4B34A 3UA3A 5ADWA 3THWA 1FYXA 4GW3A 1ONBA 4P53A 4YRGA 1R3DA 4R9RA 4CKEA 3H7AA 3MPUA 1E7QA 1VHLA 3UG7A 2PUDA 2GEUA 1AZSC 3RG2A 3R40A 3TX6A 1UDXA 2VSXA 3ZE9A 4BVJA 3ZU2A 2C2XA 4HGZA 4FGWA 4MWBA 2YJTD 4Z86A 1XMVA 3BTOA 4MIOA 3C3YA 1N9GB 3CR7A 3QWFA 1Q16A 2HF8A 4BGVA 3NBQA 4OPMA 3NDJA 4DE5A 5ITWA 3OQOA 3OE7A 1DUVG 1XWIA 3ZCXA 4DL9A 3DDSA 4JEMA 3A1DA 4LC0A 3SR0A 3WK8A 2ZYGA 3E5RA 1G41A 2FW7A 1PIWA 4HI0E 4JKOA 4QYMA 4D3XA 2ZXUA 3OJLA 4KDFA 2WOOA 4LXGA 3EIEA 2J5XA 1OGJA 1KAMA 1DEHA 1OUMA 1YSCA 3D8BA 3DO5A 4FIZA 4PINA 4RQBA 4YRDA 2FN9A 1GPWB 2TMYA 3GFPA 1ISFA 4UBOA 4RH1A 4EFLA 1DXQA 1FSGA 4X85A 1BYIA 4RMHA 4KN8A 2JGDA 1CJVC 2J3MA 2QL6A 3QE9Y 1GNRA 4Y9RA 1NJFA 1YVRA 1Q11A 3DWGA 3K7EA 4FYHA 2OCBA 3OQVA 1N5OX 4FM9A 3I9V1 3T61A 5L3VA 4QODA 5B7NA 4B3IA 1WZNA 1PJLA 1C7QA 5IXYA 3G13A 1Q74A 1GUAA 2JD1A 1KMHA 2ISSD 1TW2A 1FFAA 1D5WA 3PQFA 4KQ6A 1V71A 1TD1A 1YO6A 1YQGA 2DX7A 1VG0B 1NVXQ 4IHAA 4FFNA 4NCJA 1RRKA 5D5QA 1SCUB 5JS2A 1X3SA 4EJSC 3FRHA 4FFBB 1U9CA 3HB7A 5M04A 1DDOA 2D1QA 2PYZA 5KWVA 2ZW9A 2ZOSA 1LDGA 4KR9A 2G9VA 3JASB 1CXZA 3GGDA 5ELMA 3AP3A 4Q9AA 2XMBA 5EIOA 3HLKA 4MLPA 5EJAA 2O0MA 4KXLA 1KH2A 1MFPA 3HU5A 4F9EA 1FDWA 3G9QA 1PP4A 1SN7A 3RTGA 5BR4A 3HUDA 1C4OA 1VHWA 2DPMA 1VPWA 1OX6A 4R0NA 2WILA 3BX1A 3KXLA 4XD2A 4QU0A 2JHPA 1AKTA 2O2JA 1PK8A 3BFJA 4BNVA 1BE6A 1V37A 1UFQA 2EFEB 1TE2A 2W6JD 1VJDA 3FNEA 5K9ZA 5KYXA 3A3YA 5CITA 1L8OA 2HBQA 2EQBA 2VRWA 1NPTO 2QT0A 2WMYA 4ZQBA 3RBAA 3FJOA 2OYCA 1RP1A 2W0MA 4JODA 4PZUA 2GLUA 3IAM1 2FPIB 1KETA 4IHQA 5FPHA 2B5VA 3WK4A 4AO6A 2Z2XA 4CYMA 2HNAA 5KWJA 3ZUGA 2Q1XA 1P1RA 2E49A 3QFSA 5LA6A 1CS0B 5FULA 2BEWB 4ZVRA 2XOXA 4R1LA 3N2IA 2XCOA 5DV9A 4TXHA 4E32A 3PC2A 4HWPA 1JDSA 4KQMA 4QTTB 1AQNA 2C31A 3HC7A 4BKRA 1IG0A 3G85A 4GPTA 2A9KA 4WOPA 2ERYA 1F0YA 2D0PB 2WNIA 4WK4B 5GOZA 3ESAA 3IQGX 3EDRA 2P79A 4ZYWA 1IJKA 2ZDHA 3NWJA 3GMTA 3ICPA 1L5QA 3P1JA 5CPFA 4F21A 2VQFB 2NYVA 4F3NA 4NYMR 3V6MA 1XQ6A 1UBFA 1GPBA 2QQ5A 2E2WA 4N5LA 5A0FA 1LLDA 1U6KA 2HQRA 2HJSA 4AI6A 1C0PA 2LP4Y 1Q84A 1YB1A 3JR3A 4P7JA 1D0IA 4PS0A 4WH0A 1OXKB 1C3VA 2OD7A 5E1MA 1RE0A 2Z8YA 4OGGA 1FQKA 2BFBA 2JCVA 3M3HA 2H57A 5COAA 1PZXA 3FSEA 3TSZA 1WZCA 3VR4H 2XA1A 3JWJA 4JVMA 1ZR2A 1GNLA 2Q5LA 2GS9A 4TQGA 1Y1RA 5KKCA 3K0KA 3PEVA 1R00A 1VIYA 1IY9A 3WKAA 2YYZA 4UXIA 3VDXA 3HGQA 4GOND 2JZCA 3PJEA 3OPVA 3UK0A 4AY3A 5C4IA 4F92B 3MWYW 3TGLA 1B14A 3B6MA 1GGJA 5TT1A 4BATA 5IJAA 4I6JA 1SOUA 4J8PA 4ONEA 2W0SA 2DF8A 5HF9A 1OGIA 1J9EA 3S2GA 2XZLA 1JF8A 1TNDA 3VPAA 4MULA 5EQTA 3TR0A 3ULKA 2CXQA 3SC4A 4WN3A 1RYEA 2OZKA 4O29A 2XLBA 1EFUA 4IQ0A 1EFKA 3HGTA 1FSSA 4ZYTA 4J1TA 2GMWA 4GX2A 4IVPA 7ABPA 3TIIA 1EEXB 4YGXB 1GT91 2WIGA 4Z0HO 3W6OA 4DLPA 5LP6B 1JLLA 3IO3A 2DFNA 3ZBQA 2IQIA 3IAEA 4MQ5A 3U3ZA 3C3WA 2M1ZA 1NLFA 2R85A 4FPXA 1KI2A 2H7CA 2YHBA 2HM7A 3CVOA 3GV0A 1LTKA 1JX6A 4QREA 1R0RE 3UHOA 2HOQA 3NM6B 2UVPA 3L7DA 4Q48A 1FRFS 4JEUA 4ZT5A 4LYDA 1YV9A 2HA7A 3CLSC 1KKUA 2ZU0C 1B74A 3EARA 4V2IA 3TYXA 1CDDA 3Q7IA 3ZI0A 2Y99A 2GJKA 2PUWA 2ZI6A 1WHTB 4KP7A 3LUFA 2GZRA 2VYCA 1SBCA 2UAGA 2PIDA 3QNMA 1OLUA 2BBTA 2I78A 3HJRA 4CIWA 3RU3A 3HKBA 2D1RA 5DBFA 4D4IA 2V98A 2O5CA 2QSYA 2QRMA 4LK3A 2HNBA 3GEMA 4E4RA 3HR8A 1AMUA 1KARA 3EDMA 2R6GA 4OA5A 3C97A 2B1QA 1L6RA 3BC1A 3O93A 3N3BC 1UZNA 3K72B 4NARA 3WX0A 4C7JA 3IKTA 5HR5A 2Y71A 2R00C 1BXGB 5T4BA 1YCDA 3MW8A 3VU1A 4TS4A 1UOEA 4FS3A 5KTSA 4CUZA 2WEKA 3C5WP 5H16A 4WASA 2IK8A 4DM3A 4F8EA 1OFVA 2HI0A 3JQGB 3OEEA 4NENB 3BIWA 4A0FA 1VDMA 1SXJB 3F5MA 1X7HA 3EQZA 4DEVA 3BXOA 1KMNA 3CN7A 2AXNA 2PFKA 1QH0A 3D3EA 3LRXA 3ZS8A 3AFHA 4W1PA 4D2IA 3T1OA 3AIIA 1GTJ1 4LNAA 4JV5B 3M5WA 4JHXA 5BURA 3ZHYA 2XYHA 4ECEA 1JEQB 4GMHA 3U4GA 5ISMA 1P5ZB 1OH8A 2ZWIA 1A98A 1B6GA 2IW1A 3E9RA 3H97A 3L2OB 3LBYA 4P58A 2BM1A 1IZ8A 3NTXA 1RXWA 5K2MA 3QBTA 5GP1A 4PYIA 3G79A 2G4VA 2E37A 4I55A 5ICCA 4XLTA 1VC2A 1C4XA 1IJEA 1WPXA 3I3OA 3EXG2 3N5KA 1NWCA 1Y4ZA 1UOPA 4JOSA 1Q1NA 3FRIA 5FJIA 3DV9A 3PFCA 3RSZA 4DANA 2C0QA 4OP1A 2H17A 4DLNA 3KYCA 2ECFA 3SKVA 4YYEA 1DPFA 1W4LA 2B6HA 1HL7A 2VF4X 1W35A 2Y66A 3DXXA 4PU0A 5DTQA 3IKJA 1NRXA 4TRRA 2Y4NA 5JV5A 4WLFA 4JDPA 5DSZA 4ZCLA 1QXSA 2HNKA 3L7MA 3PHIA 1VG1A 4XYBA 3VR2A 1Y6JA 1Z34A 3C6YA 2NXNA 3GUYA 3K0HA 3SHFA 2IF2A 4CLXA 3GQBA 3QKSA 3TLEA 5F3WB 1MORA 1IN8A 3L6EA 3LUKA 1VECA 4BLWA 2Y9MB 1D03A 2R7AA 3LA6A 4JYPA 3MHPA 2G82A 1NPYA 2OCAA 2X9QA 5EIBD 4WA8A 2VHZA 1WUKS 1X1EA 4BZWA 3E9QA 1CIJA 3EAGA 2CVOA 4TROA 3HL0A 5KYYB 2WPDA 5B7GA 4ZI7B 2O2ZA 2BGWA 4FQ5A 4DVJA 2IH2A 2QTMA 2Z5FA 1UXKA 4R1PA 2B7BA 1IWOA 2Q49A 3MS4A 4TQUS 4Y6OA 2CLIB 1KE2A 4RTKA 2IUTA 2VH5R 4N7BA 2B1JA 5IYZB 4MO9A 2OGSA 2BCGY 1OU4A 3FUTA 4IZHA 1U0JA 3HRHA 1WBDA 4GKKB 4Q66C 5DK4A 5ITVA 1KDYA 4HQLA 4EX6A 4FYYA 2NSLA 3NKVA 3E7XA 1N2OA 2QTLA 2BMAA 2V59A 3C5VA 1XD2B 2XGGA 4WACA 4RV9A 1NW6A 4FHDA 2CSXA 1T2AA 1Z5NA 3I9LA 5TQ0A 5BW5A 3YASA 1FC0A 2AYXA 3TRJA 4BEWA 1J2YA 4Z7QB 1DCMA 2WMDA 4MKGA 1M2WA 3W77A 3PGXA 2H1FA 1GA4A 5SZIA 2V0GA 2XVAA 2OR3A 3OEWA 1A88A 2VFAA 4AIRA 4ED9A 3QYAA 3RH0A 1VFPA 1Z0SA 3LCJA 4JBXA 4P0TA 4YDRA 3PWSA 2ZJ5A 4IJQA 2G1AA 3VH3A 3PE3A 4IOJA 2YWGA 3K9QO 1DG1G 1OY1A 5DHRA 1CETA 4IOLA 1ZJYA 4LMRA 4ND6A 4A8JB 1NSFA 3KUKA 4GQAA 1P0CA 4Z2AA 2QN2A 4KGDA 1XTIA 3PHJA 1QZ3A 2PKYX 3PDIA 4R1QA 4FINA 4TV9F 4C7XA 4EITA 1CUSA 2HK7A 3A0UA 3MN1A 3E81A 4YJHA 3GHYA 3QEKA 5CDSA 4AQYB 1SPBS 2GD1O 3P2KA 4ZFNA 4KR7A 3NWEA 2YVKA 2FEKA 3A7EA 1FXWA 1NVWQ 4QUKA 1YRLA 1YC5A 1ZDMA 2VPXA 3DPSA 3KQSA 4LK2A 1GRVA 4R6XA 4I4TA 1AZWA 3UH0A 1CEYA 1VE6A 3FFWA 1OYVA 3HB0A 2V7XA 2QK4A 5ALDA 4B3HA 5K8JB 1N5KA 1JHYA 2C3MA 3MS2A 4AAYA 4N82A 3K8YA 3N05A 4G0PA 3D6HA 3GJ6A 3QEJA 2DE0X 4YRZA 5BQXA 4JI2B 1OE0A 1Z5VA 3GGOA 1YZKA 4GU5A 1JDBC 4ZV4A 3HXKA 3W5CA 3WG9A 1USVA 2P6PA 3ZNNA 1KQOA 2EVWX 4C0BA 4GGMX 4CKZA 1TUIA 1GG9A 5LL6P 3IODA 5K4GA 1OC4A 4YMTA 3AEKB 1XZNA 1E77A 4MEBA 3W05A 5JQGF 3ZWDA 1NQWA 3ZKAA 1W49A 3NM5A 4ETWA 1YFJA 4W5RA 4J1QA 1P60A 2G4LA 1NV8A 4P31A 4CTJA 5IZ4A 3I64A 2H85A 1GGEA 1O54A 4I2VA 1C1XB 1ADGA 2OQIA 2SCUA 3QKTA 3R5SA 5D7NA 1EM6A 2CLSA 1DC6A 3U80A 3OJXA 2DMRA 3EULA 2QRJA 2X4IA 1GZUA 1BCSA 3O75A 4Q9HA 3DLBA 1T6ZA 3GR6A 5ICEA 1H9BA 4NHOA 3G0OA 2B9VA 2GKSA 2PBFA 3M6WA 4PFQA 4CIXA 3PV0A 5BSWA 5IJ9B 4D0SA 3R7AA 5CP8A 3F5DA 1DQSA 2J9YB 4HGNA 4WKNA 2OFWA 4X93A 5CLLA 4FB5A 2BEUA 2EEZA 2VP6A 2WAYA 4X1KA 3T4EA 2XKJE 5L51A 4A10A 3T38A 2B1RA 3GQVA 3LFUA 2QQFA 2JI4A 4GDMA 1LTHR 1Q44A 4R40A 4WLOA 5JNWA 2R8YA 5LVAA 1J20A 4BQFA 1LX7A 2P2NA 3K2BA 3JAKB 1SCUA 4LBYA 4K86A 2P5SA 5FOVA 3IYLW 3OLWA 5T57A 4F3YA 4Q01A 1JZQA 2V4UA 3UJNA 1M72A 1G98A 3F49S 5JSKA 3T8YA 1G6KA 2BE9A 4EI2A 4ZAFA 4UU8A 4YI5A 5TXGA 4DQXA 1ESZA 5CLJA 3ACCA 1T1JA 5LMCA 1NDHA 4II7A 1Y48E 3KZVA 1PR0A 4OSPA 4U4AA 3CS3A 3KQYA 3JZFA 3F3KA 1PZEA 4UQLA 1RW4A 1U7ZA 4ENWA 4W9MC 2V3VA 4EG6A 3FF4A 1ZEMA 2G80A 5BUSA 4OUDB 1QO0A 4MUXA 3FPFA 1UBTS 2H08A 3D8TA 1C7JA 4ZZ0A 5JCJD 5ECYA 3JWPA 3EEBA 1ESDA 3A1VA 4KO1S 1QGZA 4I4IA 4BU1A 2FPIA 3R6TA 2C0PA 4KO3S 1CS0A 2X86A 3RVJA 2BEWA 3DB2A 3HZZA 4FR0A 3UJPA 1W88B 3A37A 4IGEA 5AXDA 4EF6A 3DHVA 3AXTA 2WJHA 3PTZA 3BTVA 1RAFA 2R2AA 4EG8A 1VCHA 4JP5A 1E5LA 4JLNA 2NU6B 1Z73A 3DTVA 3O8CA 3W90A 3GLFB 4J9VA 4L0DA 2CYBA 2ZRGA 4GL4A 1BGXT 1CZNA 1PK9A 3FVQA 4CMKA 1JXAA 3ENNA 1MCZA 1WTAA 2P2CA 2L69A 2CWWA 4JXJA 4XASA 2I8LA 2I62A 2QLTA 3LX5A 3ZCQA 2N3ZA 2XCLA 3WOVA 3MIZA 1UAGA 4BX8A 1NUAA 2COKA 2WV9A 3KE8A 1L7VC 4NPHA 4RMJA 1RWQA 4ZT6A 2VK2A 4ARSA 2J0SA 1TU3A 2X0DA 1AN0A 5JQWA 1REQA 1YASA 3RVPA 3I45A 4P38A 1TGYA 2G67A 1C1DA 1PV2A 2JB9A 4DSTA 1M8GA 2C8VA 3PEWA 1K08A 1GQSA 1OZFA 1Z6GA 1P75A 1XQ9A 4AYXA 5CLQA 3RVKA 4E2FA 3CA8A 1KZ4A 1X9GA 4CM8B 3WKCA 1CRWG 4F2HA 2YBDA 1KEEB 5EOVA 3EODA 1M7BA 2ECKA 4CLOA 1U9YA 5K05A 3ICEA 3WWYA 2G1UA 5AOCA 2IYOA 4BX9A 1UC5B 4JAVC 5F7ZA 2VHUA 1V4BA 2NPOA 4ZIRB 2XGJA 1RWNA 1HQDA 3R9KA 3S70A 5KEIA 3CB4A 1LTQA 3CEMA 4HX2A 1Y34E 3R20A 4TKZA 4AU1A 3CX4A 3ER9A 5TS2A 1BMQA 4DA7A 3DOIA 4ZAVA 2CXSA 4IFEA 4AF7A 4BEJA 2RFLA 1KJYA 2X13A 1RWKA 1KPHA 1ZESA 3WHKA 2PRSA 2ZK7A 1N1MA 1G9TA 1COWD 2FG7C 3N2LA 1QIHA 3TQCA 2W6OA 1G1MA 1V4NA 4LZOA 2G76A 3S68A 3V46A 3K70C 2OXFA 5EMKA 2R6FA 3CLHA 4ZYLA 3CLTD 4M0DA 1XNGA 1J25A 1ORRA 3CG4A 3NKLA 2F9LA 2ACKA 1MQAA 3KXKA 1TIPA 2QTHA 2JANA 5L4NA 4X91A 2CDAA 4O1MA 3W8NA 1QV6A 4LJAA 4QBGB 1T8RA 3FMGA 5HK9A 4EUNA 5JCOA 2XKAA 4MV7A 4ZEOA 3C6MA 3O83A 1HFKA 3CBGA 1SKUA 2CYAA 4PC1A 1KDOA 1WKCA 1OXXK 4OHFA 4RACA 3VYTB 5H3HA 1KORA 3SR4A 3A2KA 5AW5A 5G0SA 1BXGA 3FYUB 5K03A 1J33A 2P3QA 4TRMA 3OOWA 1I4WA 2H06A 4PN7A 1SK8A 3BQ9A 4M9SA 3H1TA 5CFOA 1JECA 3JQGA 1F17A 2PTHA 4G89A 1EMDA 3SOPA 2XMRA 4PRKA 5KAMA 1SXJA 2OD2A 5FUQA 1K7EB 4OJQA 1UDBA 2G25A 2GO7A 2DWQA 3ROFA 9LDBA 3C5CA 3BQMB 4U0KA 2PM8A 3DDUA 4L16A 4RSRA 1MVOA 1IOZA 2GILA 1QH1B 3GD5A 4HT3B 3LWNA 2H92A 2X15A 1M6WA 3D4BA 1Y1LA 3IV9A 2OKCA 2ECOA 3LKZA 1JEQA 1PGOA 4AY4A 1AX9A 1TKBA 1PJRA 2XODA 1BOFA 4DABA 3U56A 1S2LA 1HDXA 4FHCA 4MUNA 4QGAA 1ZNXA 4PLZA 4RUKA 5AOBA 1I32A 5KI6A 3FB4A 1VXRA 3N5CA 4LYEA 3ZWBA 5BN3B 1XDUA 3SFZA 1A2BA 3MEQA 4G0ZA 2WVHA 5ALXA 3U9TA 2BGIA 3H3FA 3EXG1 3O74A 2GZAA 4WKBA 4RFLA 1P4SA 1QX4A 4MP8A 3OY7A 3PI7A 4JA0A 4MZDA 5H81A 4BKOA 1O0SA 5EE0A 3C87A 3DVAB 2YNMA 1V8PA 4CKWB 4LC1A 1FX0B 2QT1A 5C3UA 1PZMA 4EYSA 2KLBA 2ZATA 2GDZA 3T54A 1AO0A 4XD7D 1CPYA 4G2TA 3TFQA 4DWVA 1QANA 3ETEA 1XPUA 2AUMA 3X2FA 4OMCA 3KSAC 1F8XA 3IUQA 1AHNA 3MMSA 3FM9A 3UUGA 2HJVA 4UTPA 1KQFA 4GNKA 1UPFA 4K9OA 3TJMA 5KYYA 4FD2A 3Q7EA 4G5OA 4B6FA 4YCSA 2ZUSA 1ANKA 2ZI4A 3LUHA 5AD1A 1XKXA 2GVNA 1TVEA 4DQDA 1ZHFA 4I14A 5FBWB 2P1RA 2C03A 4Y1FA 4MRNA 2IXDA 5EIFA 2DETA 3MMZA 2QN8A 3QMVA 3GAZA 4XYGA 5IYZA 1UFRA 1EX9A 2IV7A 4D44A 1HFJA 3M5PA 4LSZA 4E31A 5BNZA 4FI3C 4MV6A 2NUBA 4WLUA 2DRIA 3VDNB 3PK0A 3GWGA 1O96B 1OIXA 2V6GA 1XAJA 4OVKA 1MQ8B 1XD2A 1ZY2A 2MR5A 3KQOA 3UICA 1THZA 3DL2A 4IS3A 4NCNA 2WJZB 2NT4A 4ARAA 3HY3A 4ZICA 4JI7B 2WHXA 4COKA 4B6PA 2V6JA 3KBOA 1PUIA 1XF1A 3DMHA 4MW2A 2CL0X 4A0SA 3DYBA 3Q2OA 4DV3B 1XBTA 1G4UR 5GONB 3GT0A 4HGYA 3VTKA 3QBEA 1SVNA 4Z4QA 4YWHA 2IP4A 3DMRA 4HATA 1SVWA 3LOUA 1ISMA 3WYCA 4AG5A 5IRCD 3BA6A 4EI8A 4EKGA 3T35A 2Q3MA 4AZSA 4C0WA 3MRSA 2XV1A 3OA0A 4MYTA 4HR7A 3NAMA 1E63A 3O95A 4JJ6A 3SSNA 3U3JA 4M9ZA 2BMDA 2OVBA 3SD7A 3N2KB 3OPYB 5KHLB 4CIYA 1JUDA 1XG5A 3PPWA 3PDJA 2MYTA 4G1VA 1G5IA 1O89A 2QU7A 2FXIA 1NSYA 1Z2DA 2RH4A 1VJCA 4DVGA 2VDWB 4X84A 4KQXA 5L3ZA 2I0FA 2QBYB 4J0FA 5COBA 3CPHA 1CQZA 4DCSA 3RAEC 4F3CA 2W2MA 2WT9A 2QX7A 4IPTA 1OCEA 5BNWA 2QN6A 1C0IA 2VSNA 1BIFA 4J3NA 4D98A 4M3NA 5EWJB 2V55B 3N8HA 5EWMB 1XRPA 1BMFA 3DLPX 4UCWA 2IYWA 5BV2P 1W75A 4PIPA 5HQ3A 1P5RA 3NHUA 4HYTA 2WHPB 3DCNA 4E7PA 1LQ2A 1JMVA 1NIJA 5KQGA 2UZ1B 2V9ZA 2XB8A 2YJNA 3UFXB 4HUTA 4MS3B 2QPTA 4YAFA 1RAAA 3P2OA 2C5FA 2IYAA 3KJGA 1AKWA 4NHEA 1CJKC 2FX5A 5IAEA 5A1TA 2O6HA 3FCSB 4ADSG 2BKAA 2WB2A 1ENOA 3BGIA 5DYGA 5B1IA 3VFDA 1U1GA 4AIIA 1LD3A 3PDWA 2IRWA 3AEKA 4HLDA 2X0JA 2L42A 1SG6A 3LT0A 1I1NA 1V5EA 4N6GA 1XDGA 3LLUA 4C7VA 1IHPA 1TGVA 1MMFB 5TQVA 1O77A 4B6RA 1Z26A 3JY6A 5FA6A 3G0HA 2FZ4A 1G3QA 1IQUA 1ESCA 2H1LA 2JEZA 1YS1X 1YC2A 1H93A 2OAP1 3ASVA 3BK2A 3WBJA 3WKBA 1EGHA 1DRKA 2IY9A 4GYWA 2V6BA 3NBMA 2HIMA 4BP3A 1TM5E 5JE8A 1V1JA 4D41A 1G66A 1GG8A 4B7AA 4HHEA 4F45A 4TSRA 5JPDA 2JARA 4JOBA 4Q34A 1G18A 1SKQA 1SZJG 4G63A 3RTDA 1ZCFA 1TLLA 4OGKA 2ZRKA 4UZSA 1L7OA 3DE3X 1VJGA 3ZTYA 3GVXA 4H7IA 3C3JA 5DASA 4DSAA 1EE2A 3PEFA 5CIQA 1FFYA 1UC9A 1A7AA 1F8UA 3IR5A 2I2XB 1WXEA 2HD4A 1ZBQA 5DNVA 3CJTA 2VP3A 4FFVA 5EVCA 4AZ0B 5BWMA 5KPDA 3COPA 3JAKA 3ESYA 2CLHB 1Y4AE 4QSMA 3W5AA 5BQFA 1KO8A 3B2NA 3S8YA 3DL7A 1Z39A 3B85A 2H4YA 3EPRA 2O7SA 4X60A 2Z3VA 3S27A 4YQFA 5B30A 6AT1A 3WJ7A 5KJCA 4NYJR 5JEEA 3GB9A 5LM3A 3M0EA 3O8LA 1DTEA 1LLFA 4DNQA 1ODTC 3TR6A 1U90A 1ZVVA 3JYOA 4TL6A 3HCCA 3R3VA 5I7UA 3D8RA 4GMXA 4XSGA 1QB7A 4NMXB 4CR6A 1WR8A 2NTYC 2W4MA 3IC5A 1NZFA 2WZQA 4C4ZA 2ZJZA 2NO9A 4U9UA 2JDID 1A9QA 3PX3A 4OUDA 2IHBA 1ZK1A 4H18A 4S2EA 5BN1A 5P21A 4KOAA 5B3KA 4EHDA 5A05A 1XTSA 2J9ZB 4K6MA 5ER9A 3RV4A 3IIIA 1YFKA 5EINA 1LFAA 1CUDA 2IE0A 1FLAA 1W8DA 3M4NA 2C9ZA 5GJWC 4XA8A 3UYKA 5KNCH 4C08A 1LZKA 4TUYA 3UMFA 2XBLA 5J4HA 2LIPA 1NYLA 2WFMA 4CKBB 4RABA 4EW2A 4IS2A 2H5JA 3RDPA 2KHZA 1ISGA 3P9YA 4URHA 3UHAA 1KKMA 1PQPA 3CINA 4R1NA 2NU6A 4FYXA 3GPDG 4GI5A 3DM9B 3Q40A 3MJRA 1YU9A 3C7KA 3VU0A 1NBOA 2Q6IA 3TLGB 4CUJA 1JKJB 2HKIA 3BOSA 3WL7A 5JH7B 1ZI9A 2Z1MA 1G6HA 3OWXA 2QZJA 1Z4KA 1QCZA 4YCLA 3SYTA 5FTNA 4ITRC 1NBAA 4MTLA 5JZSA 3I9KA 4G0OA 3ZLJA 4TN1A 1PJBA 3K0BA 5DHQA 3FETA 5D86A 3DUWA 4MI6A 2Z3WA 4REQB 4BJ3A 4IIVA 1FNNA 1Z4JA 5HF6A 3VV2A 5LZ7A 3U13A 2R1UA 2CD7A 3DFIA 5I4BA 1NVBA 3NASA 2VP0A 1DIHA 1CUHA 1FS5A 1TFRA 2DBVO 2W9XA 3NLLA 3NXKA 4LNHA 5E2IA 5ERYA 4D6YA 4NBKA 2AKAB 3VBEA 1E9VA 4XLLA 5AI6A 4MRMA 4S05A 1DAOA 1XSEA 3BDAA 3TMAA 4A6PA 4CM8A 5LKAA 4CDNA 3A1NA 3H5IA 4J2TA 3RK0A 4XI9A 1KEEA 1A9SA 5EHXA 3QEBZ 1THGA 3AB8A 1Z8FA 3USZA 3WIUA 4U2EA 5J23A 3B89A 4WFQA 1ZNYA 1GPNA 1ZITA 2PVCA 3MXOA 2JW5A 4BFSA 3ESRA 4OHWA 5CFRA 3OF3A 4JUAA 3QV1A 2IPNA 3JSXA 1C2YA 3Q3VA 1G21B 1GZ6A 4JELA 4I3GA 4KSYA 4KQCA 5K8CA 3EVGA 5L8VA 2VQEB 2A33A 3K4HA 3AJ8A 3G2KA 3EIXA 4DARA 5TF0A 4O1IA 4LRWA 3ZXYA 2VNHA 2X3FA 3ZE7A 3C41J 4B2YA 3IP7A 3LUCA 4LXTA 3SZMA 3X1JA 4I66A 2PFSA 3BH6A 3BL6A 3QPWA 1TTTA 1IBLB 2AZXA 4AJOA 4F7WA 2WJGA 1AJEA 1V3UA 3G7NA 4Z5XA 3TOSA 3L8GA 4YMGA 3BZUA 1VL8A 3E7WA 1OI7A 2C78A 1YFLA 1NGSA 2ZJ4A 2ABWA 1GUZA 1NXWA 1YK1A 3A10A 1OWOA 4P86A 4EHAA 5ICFA 1Z5ZA 4FYVA 4HGOA 2YVQA 5MF6A 4CEHB 4FQ7A 4YASA 1KYVA 1S1MA 2PA0A 2J33A 1BX3A 4OY3A 4MQ6A 4WY5A 4F2DA 2ZT7A 1LUAA 3S8MA 1W0CA 2J9FB 5CNIA 2NMVA 1GKYA 1KC1A 3OICA 4ZOQI 1E3TA 3L04A 2Y77A 3PR2B 1CRPA 4RCYA 4M22A 1UBMS 1NMYA 1SHTX 2FRDA 1AOXA 3K9WA 4P9NA 4TS3A 5B1SA 5K3DA 4YAKA 4J49A 2OAEA 1G6Q1 2X8BA 3MGKA 1ZN8A 2EJUA 1GFIA 2G71A 4AN4A 4BZQA 4HWGA 4TSFA 2PEZA 3SEZA 2OE2A 3A58B 2VDMB 1A8QA 1PG2A 1UMBB 1YB4A 3LBFA 1T0HB 4QELA 3LQFA 5GTDA 1MO2A 2FOIA 5KU1A 1OLOA 1GLNA 4JFAA 4B76A 2MMCA 4FDLA 4GI1A 5D84A 2F8TA 5K4AA 1E8MA 1MJFA 4KKVA 2Z1DA 3WR5A 1EX1A 5IMSA 3O2NA 2A67A 2OBXA 2LR0A 4J7CA 1KY2A 2RI6A 2B8TA 5EEHA 6REQB 1Y5IA 4ZAGA 3G88A 4GUDA 4IZIA 3T1YB 3PUJA 1DT5A 3LP6A 1ZUD1 2FRVA 5ED0A 4LCBA 1H0KA 1N2CE 4QXAA 1E0JA 3FWYA 4Z1MA 1G38A 5G0VA 4RD3A 2JFBA 3R5JA 5TQJA 4UUOA 1E1RD 1Z0JA 4RCZA 1MU0A 1G5RA 5FPPA 3ZYCA 4DJAA 5E2BA 3GK3A 1JHAA 1T2NA 4AL4A 1MABA 5G02A 2ZLBA 1ZVMA 1RKXA 4I1RA 2IHVA 5J5VA 3T3MB 5AM5A 1L6IA 4FEYA 3V2GA 2ZRCA 1MA0A 1RKUA 4TMWA 1Q0LA 3RVRA 3FNGA 4AMUA 4CBVA 3ZGLA 1LNQA 1FRVA 1Y4DE 3C24A 4L15A 2PSEA 4NZOA 1FX0A 2V58A 5HMLA 3LXRA 1SA0B 2X76A 4HYQA 1Y1SA 3G8DA 3RVMA 1TA4A 1WZEA 1DBRA 4WK2B 1JH8A 2INGX 3PL1A 4JZYA 2IUSA 1J6UA 3FPCA 3ZCRA 4G1BA 4IWYA 4XUEA 1XZGA 4QNRA 1H9AA 1P3Y1 3DS8A 3MTGA 2C42A 1EVJA 3S44A 5DHAA 5A4IS 5K0NA 2OCGA 1VKZA 4UEKA 1W5FA 1K7YA 2ZR9A 4ARUA 3NWOA 4KGVA 3K0FB 4QJBA 4AUNA 2VK8A 5C5DA 1INLA 4HSEA 2AXEA 1RU3A 4RMGA 4ECAA 4ACBA 5HS6A 5KQMA 2V5VA 3RIEA 4W9NA 4KYTA 1PDWA 1QPGA 2NXWA 2J3LA 2Q3BA 3BCRA 1D2GA 2O05A 3AJAA 4I3HA 2P0EA 2YR0A 1UBJS 1FVHA 1O96A 3HYLA 4YMLA 3F96A 4W9RA 4JLKA 5AKLA 5LUAA 1GCAA 4KV9A 2ZRHA 1SCAA 2Q3LA 3LYLA 5IAAA 1WZIA 1EB8A 3WK7A 3DMTC 3GOHA 3MGCA 3K2QA 4I55F 1UM8A 1VMEA 4OHZA 1JIQA 4RY0A 2ZUFA 2ZYIA 3ASYA 4BEVA 4O2AB 4W99A 5GONA 2P5UA 2D3TA 2V8BA 4NSNA 1XMIA 3QVJA 1AZTA 2A3NA 4E08A 1N78A 3AYZB 2WSYB 4JBIA 5IG2A 3N58A 1OBOA 1EIWA 5A71A 3MUNA 4D8XA 1VLQA 2C7VA 2ZRAA 1PJQA 3EW7A 4FZRA 1EAYA 1S0UA 3SG0A 5TE9A 2A14A 1FJXA 3ZC3A 5DP2A 2WFLB 1CJMA 3N2KA 3OPYA 3SIRA 1XTTA 3WBFA 1I5RA 1TQ6A 2ORVA 4HNVA 1EIZA 1XFAA 2OPHA 1G5HA 1P6XA 3TMKA 1RPTA 3RBXA 3MTQA 1VSTA 2C8LA 4R2MA 5EUBA 1NXTA 3RAGA 3NUZA 2NADA 5AVZA 4D4MA 1GZ7A 2XUPA 5EWMA 1I3KA 3HSKA 1P2FA 2OZPA 3I23A 2NUTB 2ZCJA 4G5GA 1JEOA 3EGOA 2FQQA 1T6XA 2VT2A 4CUKA 3D64A 3O38A 5DTIA 4IXNA 1R37A 3AYXB 2WHPA 1ZGBA 4EEKA 4NY1A 4OJMX 2FZEA 4TMKA 1GU0A 3WGMA 3FVVA 3KKLA 1HE3A 3KXDA 1Z5PA 3PT5A 4MS3A 4PO9A 1PNTA 3WLTA 3WRVA 4BE7B 1DXOA 3G49A 2NZ2A 5MFPA 1GSAA 2IYRA 2R62A 4RHFA 3LM8A 1JDPA 2GTPA 4J3FA 5LZ8A 2LTAA 3WIOA 4LN1A 4NEGA 1JDUA 1N8TA 1SRRA 5K3AA 4L4YA 3VR3D 1LSSA 4EFDA 1KR5A 2GLXA 3QX9A 3WWDA 3P4XA 4ZP1A 3TVTA 4XPIA 4XH9B 1TT7A 1Z5UA 2P9JA 2QROA 4TTJA 1JG4A 4JLVA 2NO1A 4X62B 1IG3A 4C5AA 3RS0A 2WICA 1L7QA 4O4LF 4C0AC 2BZ0A 4RPKA 3KB6A 4L5IA 1R50A 1WA5A 1XRJA 3FMIA 2K2QB 1ZC4A 3VO1A 1Z08A 1IE3A 2MTBA 2VP9A 3CRQA 5TPZA 1FPQA 1DKUA 3JVUA 3PYXA 1UP4A 4GF5A 3UPDA 3WDKA 4DIOA 2PZMA 2XUKA 3W3AA 1M2VB 4EPTA 4A8PA 2OV1A 1T4MA 2NNWB 4QFMA 5SICE 4ZO4A 1CZRA 3I9NA 1Y9JA 1CDOA 4OQPA 2YV4A 4C43A 4CMIB 4BS9A 2ZCVA 2YWXA 2AW3A