1XD2A

Crystal structure of a ternary ras:sos:ras*gdp complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-Ras-1
publication title Structural analysis of autoinhibition in the ras activator son of sevenless.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xd2A00
3B6EA 3C4JA 1JECA 1HYQA 2YVUA 5SZKB 4DLSA 2ZXUA 2JEOA 1KDOA 2IUTA 2C78A 3IKJA 3SFZA 4Q19A 1VCNA 2QNRA 2C2HA 3QI2A 2WWYA 2NZ8A 4ESVA 2AXPA 1G5PA 4HLDA 3T1VA 4KSBA 1N6RA 4TN1A 1OXXK 1ELOA 3QEOA 5LBIA 1E2NA 4CEHA 1OSNA 1P9WA 1KSFX 1KNXA 5AK0A 3RAPR 2BC9A 2F55A 1U8YA 1S1MA 2P5SA 5CB6A 2ONJA 5KNCA 2BBWA 4FCWA 2C98A 5JHHB 2O8EB 4JKYA 4U5XA 1CJKC 3HU1A 2BKEA 2DFLA 1JR3D 1C4OA 1T0JB 1Q0UA 4EDHA 1MKYA 4YLGA 3C8UA 4F4IA 2K5UA 3PEWA 4FI3C 4W7SA 2CCGA 2R2AA 2CXXA 1YRBA 4K46A 3C16C 4RCZA 3AVWA 4M1YA 3W6OA 3GLFA 1U8AA 1E9RA 3RRZA 3QKRA 3W6NA 1F3OA 2YZ2A 1OHHD 3Q85A 4A92A 2GCOA 1NKTA 4HATA 2QQEA 4PHFA 4V0OA 2BEKA 2VP4A 3FMFA 3B5JA 2AD1A 4OKSA 4Z1MD 3CNOA 5EXPA 1OH6A 3D7MA 2GK7A 4IXNA 2IT1A 1C9KA 2ERYA 2F1IA 4Q7KA 3TSOA 4CEIB 2ORWA 2ZU0C 4QHTA 2XZOA 4JYCA 1O3YA 3PVSA 1KI7A 3DO6A 4NKRA 3ADDA 2G3YA 1U2RA 3W90A 3C5CA 2RB4A 2FFHA 2WV9A 1Q21A 4OHXA 1IN6A 2AKAB 3CR8A 2IA5A 1E2DA 1EFTA 1E9BA 2BMFA 3B1WA 4PQYA 1OH8A 2ZJ2A 2QTFA 1OFUX 2C95A 4KVGA 3ZZ0A 1VTKA 4DCTA 4PC1A 1FMJA 1LF0A 4DSTA 5JCPA 3UMFA 2REOA 4DCVA 1G7TA 1OYYA 1W0JA 1X8JA 2FJUA 4LJAA 3ZJYA 4NHOA 3LVRE 2C77A 3ECCA 3U7FB 4PR0A 2NPFA 3RS0A 1JR3A 2B92A 1KMHA 1ZW6A 1VYTA 4E22A 1NN5A 2UKDA 5L3QA 4D2IA 1W47A 3EAQA 3MJHA 2IC5A 4G0NA 1KOFA 2DPXA 4LHYA 4Q02A 2W00A 3GP8A 3N2IA 3OIYA 1GVNB 1DELA 1Z6GA 1AZTA 2BM0A 1OHHA 2F9LA 3QPVA 2O8FA 5EXSA 5JRZA 5FTMA 1VYUA 4LYAA 1P2VA 2YOGA 1EWRA 2ZJ5A 3CZPA 4B75A 4RKEA 2D7DA 2WSSD 3EIQA 3KJEA 1AA9A 2ZS8A 2FFQA 2ZSDA 5TMPA 4Z1MA 3DM5A 3RS3A 2WWFA 1OJLA 4HYYA 1Y63A 5G41A 1P3JA 3AVTA 3SYLA 3EA0A 3AVQA 3B13B 5EXXA 4K81B 3GLHA 1E2EA 4MGIR 2BWJA 4DLYA 3BORA 5FOVA 2X19A 2GZAA 1XEXB 1F6BA 1GSIA 4DCUA 4V0ME 2ZR7A 4TQ9A 3T5GA 5AR1A 1JQJC 1QHHB 2GAAA 3K0AB 3K0FA 4L8GA 2ZM5A 2IS6A 1G19A 2OILA 1P9NA 3VR5A 4MYUA 1E9SA 2IYTA 2J0UB 3P1JA 4PSAA 4AK9A 1LW7A 2FWRA 2WWXA 4Z8YA 4LWZA 1EFRD 1E0JA 3OFND 1NN0A 1E2KA 3LLUA 2GXSA 2WMNB 4LCBA 1O87A 3QG1A 3EIHA 4OL0A 5JLJA 3I61A 4QNRA 1XDBA 1E94E 1GUAA 3BH6A 4CZ2A 4QJ4A 2JDIA 5L3SB 1FFHA 1ZUHA 4M1KA 1AQUA 2IXFA 3D3QA 1YZQA 1G20E 2QN6A 1XEWX 3NBZC 2WOJA 4B6EA 5BYJA 3AF4A 4XTRA 2ANBA 1PLJA 2WSSA 5DIFA 1E4YA 2R6FA 2IS2A 2GXQA 2QU8A 4DB4A 2PEYA 4A6PA 3L43A 4EPWA 1S3GA 4XWOA 4QJ3A 2AR7A 4JBXA 2ZJOA 3GD7A 5TDHA 2ZVQX 1OXTA 1UDXA 3I8SA 5GJCA 3T34A 3TUIC 3IDQA 4EPRA 4A1FA 4A0HA 5DGXA 2IUSA 4AYXA 1K5GA 2OO7A 2XTMA 4M22A 3SOPA 3VTKA 4FMDB 4M1OA 3OAAA 5P21A 3N70A 3SHWA 2W2TA 2YYZA 1GG2A 3P26A 2QEQA 1A1VA 1F48A 3VR2A 2HV8A 3OFNA 1J70A 1ZNZA 3LD9A 3GEEA 4ERNA 4LPSA 3WNDA 4RD4A 3THYB 2XOKA 4Q7MB 4HB0A 2H16A 2PJRA 1XJCA 4LZZA 4NCJA 3THOA 4LDJA 2JLRA 4YXWD 2ZSAA 5DN6A 4OJKA 3VHLB 1CTQA 3CPEA 4GI7A 4NCKA 4V02A 5BW8A 1L7VC 2FSFA 1FQJA 1GRNA 2WIAA 4A82A 1SZPA 1H65A 2VEDA 1ZCBA 4R7ZA 2WJVA 3TMKA 2ODWA 3BFVA 3EXAA 4KV9A 1KO7A 3IBGA 4GP7A 5KHOC 4Q18A 4PPFA 1W36C 3LBHA 2FFBA 1NVVR 1MR3F 1WXQA 1Z0DA 1IN5A 1R8SA 3HYTA 3JVUA 4IRUB 3TIFA 4UNRA 3AM1A 1UADA 4G5QA 5GJVC 5HR5A 2OXCA 4BFTA 4YC7A 4LHXA 1M7BA 2QI9C 1DOAA 2GJAA 3U3OA 1FUUA 4F7WA 4TMXA 4NL4H 2NO6A 2FFAA 3HR7A 4XSGA 3BB3A 1HEIA 2OEPA 4UXHA 5J4VA 2IYRA 3WRXC 3QOFA 1CEEA 2J7PA 4MRRA 4JLKA 3EPJA 4JJKA 4PO8A 4J0QA 3WNBA 1FMLA 1EK0A 2ZVPX 5FTJA 4ZPXA 5JECA 5CIQA 4YMTA 4WOPA 5JMTA 5A4JA 2WAXA 2NOAA 5JEEA 4G5GA 4TWZA 4WXRA 1XCPA 4CEJB 4WAUA 2O0KA 3UMSA 4HLUC 3NIBA 1UBGA 3CWQA 3VR1A 3X1ZA 2G0TA 4D0LB 1EG7A 2H8KA 4GOKA 3NG1A 3AUXA 1XPUA 1TU3A 5K8UA 1G9XA 4DDTA 2XNDD 4HB2A 3FWYA 4YXWA 4AKGA 3KXKA 2CL0X 1YZKA 2XEXA 3TBKA 4V0NA 2VHTA 2DBYA 3OIWA 3UK6A 4U00A 2W58A 1IN7A 1QHYA 4Q1BA 2PX3A 2IWHA 1OB2A 4Z8XA 1GNRA 5CLQA 3WY9A 4DKXA 2O8CB 3AP2A 4HB4A 1T5IA 1BS1A 2QRNA 3FPAA 3M1IA 4FD2A 1GITA 3A1VA 1NJFA 3F3YA 2EU8A 3Q7QA 4TYYA 4KSCA 5DYGA 3JVVA 3SS8A 2QM8A 3AF1A 4ZKDA 2IX3A 5KDOA 1TQ2A 1ANKA 1II0A 1AIPA 2QT0A 4WXPA 2CLCX 2YOHA 1L8QA 1P62B 4A8JB 3UMRA 5AJZA 2PMKA 2BDTA 2PZFA 3CH5A 2D7CA 3M6AA 1WF3A 2GKSA 4LRWA 1GNQA 2P5TB 1G3MA 4BRWA 4PO1A 4P32A 5AUOB 2VHCA 4TYNA 3EZ6A 3S1AA 4E07A 1MO3A 3PG5A 4G5RA 2J0QA 2BBTA 2DFNA 2XITA 3QKTA 4OI1A 3ND8A 3HWSA 2ZJZA 3KKMA 4DIEA 5HZKA 2EFHB 4G1UC 1XCMA 3QXHA 2IS1A 1F60A 3A4LA 4M8NE 1GIAA 2TMKA 2V6IA 1P75A 2CBZA 4Q1AA 4RFSA 4A15A 4HAXA 3TVTA 5FOXA 5JFGA 2IYQA 4TQUS 1FUKA 4I99A 4A8JC 1II8B 1D9ZA 4DLWA 4HUQA 1RIFA 3FKSA 3H2YA 1M7HA 4EJSB 3BS4A 2X8AA 2ZI3A 2L0XA 2VP6A 4OQNA 1N5KA 4GMDA 3THXB 4XH9B 3WP0A 1G7SA 3RANA 5KO2A 1QVAA 2IEYA 2F3RA 4PSKA 2O0JA 1DAGA 2QUZA 3IQXA 3GCGA 4IW3B 4V0MA 3B78A 3QUSA 3SU8A 5LD2B 2PZEA 4LV6A 2A2ZA 2OCYC 4QNMA 5EP3A 3MAAC 3R9IA 3REFA 3ZS9A 3GLIB 2PT5A 1TUEA 3NXSA 3REGA 2GNOA 3TH5A 821PA 1X6VA 3PITA 1G3UA 8OHMA 1W46A 2QMOA 4P3YA 4XTCS 1ZAKA 4MGYR 1YZUA 2HYDA 3RABA 3AVUA 1T5LA 5BYKA 2GXUA 4OQFA 3N5CA 2QTHA 1ZM4A 1SXJD 1VCMA 4Q03A 4OQLA 4B73A 2ZITA 4JLAA 5EZ5A 4EJSC 4MDEA 4AC9A 3CKLA 3UPUA 4JLDA 1WCV1 1VPLA 4NCIA 4BLTA 5KNDA 1LV7A 4QL3A 2WVJA 2ZETA 4RSGA 3WP1B 2QG6A 3R8CA 1UBFA 2PL3A 3QF4B 1LS1A 1Z8FA 1XTKA 1XD2B 2VTKA 4NE2A 3THWA 3VKWA 2CNWD 4D4MA 5LD2C 2BIFA 3G0HA 1XX6A 1TQ6A 4JVMA 1X8KA 2DY1A 3KUDA 1YZLA 2RKOA 4NP6A 4C7OA 4OYHA 2Z0MA 4B3GA 1IXZA 1HA3A 2CDNA 3HDTA 1OH5A 2OESA 2G77B 1XRJA 5EP1A 2JJ8A 1XMVA 2X2FA 1JBKA 2O52A 3TSZA 5B58C 1XP8A 4LJ7A 2F9MA 4P4UA 1JR3E 4TL7A 4Q9LA 3UIEA 1OF1A 2IYVA 3QVUA 1JJVA 3Q9LA 1CLUA 5B64A 3V4RA 2XJ9A 2A5FA 2ZI9A 5L3RA 5CDFA 4LBZA 2WOOA 5K8IA 1Z63A 2C5LA 3FHCB 1FQKA 3BJIC 4OHVA 5HE9A 2CJWB 1DE0A 4I1VA 5IF9A 2ZRLA 3HR8A 3X1DA 2C9YA 4GOXA 4NCHA 3CRRA 3RC3A 1RRPA 1OW3B 2PX0A 4DIDA 1FTNA 5E7MA 1TPZA 4ZIRB 4MKGA 1N6KA 1NBMD 1MRSA 1SXJA 1G7RA 4A9AA 5KYKA 2P0EA 4C0KA 3K0EA 1IJEA 4UNPA 1R5OA 1T4GA 1DAIA 1KY3A 1IOZA 2H18A 1CU1A 3DVLA 2OCPA 3T1OA 3OE7D 1Y3AA 4DUGD 1N6IA 1KJWA 4RY2A 4TYPA 2QA5A 1FNNA 3LRPA 3GLHE 1XEFA 4IOKA 1NSFA 1E2HA 3T35A 2AHOA 2ZR0A 3QENA 4E09A 4UNNA 1Z06A 3P4XA 2PJZA 3H1TA 3RVBA 2QAGA 3DKVA 4EFLA 2JIZD 3LW8A 1NP6A 2CNWA 2ASEA 2ZR9A 3K53A 1RJ9B 1UBEA 1JB1A 3KKQA 1FX0B 1KI2A 2F43B 4M4SA 3KB1A 1FPMA 1R0YA 1S8FA 1OXVA 2ATVA 2GJSA 1IONA 4BASA 1W7AA 4I1UA 4QHSA 5JRJA 3DHWC 3U61B 5FPYA 2CHGA 3GJ3A 1TF2A 3MMPA 2ZIAA 1GFIA 1P9RA 4N0DA 1CXZA 1DO0A 1XD9A 1Z0JA 2ZYWX 2ZI6A 1ZMXA 2ZRHA 1G21E 3NHAA 4LOAA 1Q3HA 1KYIA 1XMJA 4QXAA 3WMFA 1L4YA 1X3SA 2WICA 5BWMA 2JLUA 4Z51A 2XX3A 1G41A 4Q9IA 2VF8A 1AS3A 1EX6A 1FOEB 4OHWA 2ZRCA 3I92A 1G18A 4KYIB 4IOJA 2DYKA 5LB4A 4EKDA 3QXJA 4KLZA 4G3XA 4JBYA 3A1SA 1SHZA 5FPTA 5BN4A 5C46F 1Q1ZA 3EARA 4CEHB 1BYUA 3EZ7A 2ZJAA 2AK3A 3WBKA 3KDSE 4II7A 1R0XA 5JZVA 1EFUA 4PO9A 3ADBA 2XB2A 2IWRA 3U2QA 4D80A 4CT4B 1E2MA 1OFTA 2ZRJA 5EQTA 1KDRA 3DL0A 4KODA 1TF5A 1KIMA 1UKYA 3C15C 4Y0VA 3ZVLA 3A4NA 4GMXA 2J59A 2YJTD 2OHFA 2IYLD 4PX9A 4DEYA 2V3CC 4HDQB 4B44A 3SJBA 3AKEA 4ILEA 3SNHA 1MABA 5ELXA 4B6FA 3PV0A 1ZJ6A 1WRBA 2JIZA 4ZDWA 1W4BA 2ZREA 3AVOA 5IT5A 4MQBA 3Q5DA 1D2EA 4WW0A 3GLFB 4DRZA 4RD6A 3U60B 3QKRB 1XXHA 4FMDF 1FP7A 1FZQA 4CT5A 2GCOB 2CLDX 1HUQA 1SKQA 2A5DA 4LBVA 4PSVA 3V4FA 5JSZA 4LV8B 2LKDA 2KSQA 5FUWA 2V54A 1OIWA 4DZZA 2DWQA 4PAMA 3O8RA 1J7KA 3PUXA 3M4YA 3AVPA 1Z2AA 1VHTA 4B33A 1W2GA 4KJZA 1N25A 1Q57A 1NY5A 4KFSA 2AN9A 2V4ZA 1OXUA 4RKFA 5FI1B 4C0LA 3K9GA 3GFTA 2FPMA 1G8GA 3EZ2A 1YR7A 3QE0A 3AQ4A 2PEZA 3QNUA 5FR1A 1NG1A 1VMAA 3KX2A 4ZKEA 3WHLA 5EP2A 1US8A 1NN1A 3VNUA 3PJRA 3WYAA 4OI4A 3NBFA 2XZLA 1KI4A 2OE2A 2ZI4A 2RGGA 3R9XA 3R9WA 1E98A 1A82A 2CL7X 4BFXA 4CGZA 3PQCA 5GADl 1ZUIA 3NC1C 2GWHA 5UKDA 1DAMA 2R6DA 1KMHB 3CRW1 3TW8B 5D3MA 5AJXA 3RWMB 3VU9A 3QKUA 2V1UA 5CITA 1YU9A 2O8BA 3AF2A 5L3QB 1NIPA 2ZJYA 4US0R 4HI0E 2B7BA 2IL1A 1L2TA 1N5LA 3DOFA 3IPXA 4L9SA 1ZM9A 2DCUA 3CNNA 4MGKR 4DLRA 4ESHA 1M8PA 1I4LD 2O8FB 2LKCA 2OZEA 2UVQA 2QMUA 3OZXA 2QY9A 4S2EA 1DADA 3TJZA 4C2UA 5G53C 2W2VA 2Q3FA 2QGNA 4F91B 3GJXC 1OH7A 1E69A 2VLIA 5FI0B 2FOLA 1S2MA 1R5NA 3ZYCA 4R71A 2ZTSA 2OFXA 2CE7A 4LHWA 4TMZA 4XVQA 3LBNA 1Z6YA 2ZEJA 3GLHB 4LJ4A 1XJ0A 3SN6A 4CDGA 1PVOA 1XWIA 4RZXA 3GJ4A 4PC3A 1CR4A 2EQBA 1ZD8A 2IS4A 4B2IA 1CRPA 2A5YB 1S3SA 2FU5C 2IHYA 4A0FA 4PXAA 1HV8A 4MYCA 1DVRA 4PTLA 1M34E 4JL6A 2JLVA 3K0FB 1X1RA 3GPLA 2RGNA 2V8OA 2IUUA 2RGEA 3D8BA 1WE2A 3K0CA 5D3QA 5IK2A 1G7CA 1M7GA 1E2PA 1MV5A 3GQBA 4U7DA 4C9BA 3B9PA 2ZRDA 3EIEA 2JLYA 3SEAA 3QJYA 3ETLA 3RNLA 1Q3TA 4PZLA 4JS0A 5KPJA 3ASYA 4ABYA 4XD7D 1SVMA 3DPUA 4OK5A 2BOVA 1U9IA 4JLPA 4M2LA 2BKUA 3EPKA 5CJPA 4M53A 1G17A 3FHTA 4DXAA 2ZYUX 4MKFA 4O0MA 4C0QC 4OK6A 2Q9BA 5FTKA 2GETA 1IN4A 1R10A 1OPXA 3VR6A 1CJVC 5SZJA 3MLEA 3U3MA 4ZDJA 3LX8A 1N6HA 1FP6A 5DH9A 3A1TA 4D6PA 3IEVA 1KK1A 2MSCB 2ZYVX 3AF0A 4PHTA 4EUNA 1G3IA 4P33A 1PUJA 3KQLA 4DDVA 3H84A 3SR0A 3L2OB 1S9DA 2R62A 2WPDD 4URZR 3T06B 5HKKD 3PUZA 5F3WB 1SVIA 3OEED 1YZTA 4KXFB 1COWD 5DI3A 4AY2A 1U94A 4B76A 4X8OA 1E9AA 1HT2E 4ASUD 4PPNA 4FMCB 4M1TA 4DEXA 1E1QD 5AUPB 2RHDA 5EE9A 1KI6A 4B3FX 2ZRFA 2HT1A 5JI3E 1U90A 1Z28A 2VH5R 3ZVNA 4OI2A 3RSLA 2OSBA 2AX4A 4RZ3A 2ZE7A 4WZ6A 3ZQJA 3CW2A 1F2UA 2A3RA 1UBCA 4LC1A 1Z0KA 5H68A 1W44A 2VBCA 3QVVA 1N0UA 1I4TD 5JWRA 2RHMA 5CB8A 3HJNA 3X2SA 1TTTA 1P2SA 3LFUA 4M1MA 3B8HA 2WJJA 1VG1A 1CRQA 5H1YA 3DZDA 3RHFA 5C2JB 1G8FA 4IDOA 3IO3A 5FFMA 4XD7A 4I81A 3AVVA 4IVQA 4B43A 1B23P 1M6NA 3B60A 4MYHA 2AL7A 1SULA 2WWIA 1E32A 1DAKA 4Q00A 1AS2A 4QGAA 2OCAA 5JS7A 2WMOB 3KFVA 1P73A 3BFXA 2YNMA 621PA 3KL4A 2LWIA 1BOFA 4KO8A 2D74A 1ZBDA 1KDPA 3ZZUA 4O3MA 4X8MA 1N6LA 4BLSA 3R7WA 4IFEA 5SZIA 4Q4LA 2UZIR 2NO9A 3BFKA 1N0VC 3LWNA 3W34A 2ZSBA 3KJIA 3LO5A 3FVQA 3BBPA 2CCKA 3CWZA 5EZ6B 5TVKA 4BGDA 3OEEA 4HDOB 2RGXA 1ESNA 5IHPA 1LF5A 4ASUA 2GVDC 4PZYA 2GTPA 2MMGA 4WZAE 3B7GA 2C96A 4DSUA 3ZD7A 2EFEB 2FZLA 4Q4AA 2F6RA 2GBLA 4A4DA 3W3ZB 2XSZD 4Q1CA 1W5SA 3EX7C 1ZIPA 3KQNA 4EPVA 4AD8A 1Q20A 2OFWA 5JI2E 1RFLA 1MOZA 3HPQA 2ZI5A 4HB3A 3MGCA 1DARA 4NBSA 4OBEA 4P31A 4Q1EA 4QGGA 3EPHA 2QT1A 4RVCA 3C14C 4QFMA 4TL8A 5FTNA 1OB5A 2ANCA 1Q22A 5IRCD 4F4CA 3NEJA 4PFSA 4A2WA 2QMEA 5DISB 4TLEA 1JEDA 5CM8B 1CJUC 3SQWA 4DWJA 1KDTA 3PEYA 1G1MA 2QPOA 1R0WA 2J1LA 4DBLC 1H8HD 1G16A 2BJWA 4XVRA 5JWHA 1HQCA 2FSGA 5BXQC 5FUYA 5CDFE 3F5FA 2YWHA 1W36B 4QGHA 2YC2C 4TT3D 1ZM2A 2HXYA 2XTZA 3W5JA 1N0WA 3IIJA 2EWVA 1QDEA 3C5HA 4Q7LA 1EFRA 3SE0A 4ARZA 3ICQB 1E0KA 4PHHA 1SKYE 1ZP6A 3AGQA 1SXJE 1PV4A 2P65A 3KQKA 1U99A 4EQ6A 3EC1A 2R6AA 2O0HA 2X77A 4BFVA 2XXAA 3L8YA 2BCGY 2IXGA 4JL8A 1KO8A 1XMSA 2A5JA 4B34A 3QXSA 3W6PA 2AFHE 2GCNA 3CO5A 4PZZA 4D4KA 3GLGA 1HT1E 2XSZA 2G1JA 4JIMA 3AVXA 1KK0A 1OXSC 1XEXA 3LXRA 4JLJA 1RVDA 1NN3A 4NYMQ 4RCYA 1DO2A 1JQLB 1GKYA 1XZPA 2WKPA 1JPNA 3Q5EA 4IXMA 4M1WA 3SI7A 5HZHA 3SYKA 1T91A 1QHHA 3KJHA 3VX3A 4RD1A 1IY1A 1TF7A 4KAXA 3P27A 4D4LA 1N5IA 3AF3A 2ZSFA 3S1AB 3DM9B 4IEIA 4D82A 3FOZA 2IYYA 4DCNA 1XFAA 1GRRA 4JKIA 2Q6TA 1GWNA 4JSYA 5FOWA 5KSPA 1TL7C 5FR2A 4N0EA 2R6CA 3WHKA 5KDDA 3U44A 1KSHA 4HAWA 3K70D 1A4RA 2R44A 4Q4HA 1E9FA 2AK2A 4D81A 2FDCA 1NVWQ 4C0HA 3SDZA 1FTSA 1TQDA 3CPJB 4AURA 5KSOA 2ZPTX 4LYFA 3TKLA 2ECKA 3CR7A 4RFSB 4R2HA 4LYHA 1RC8A 4TT3A 2HEIA 3CRVA 4DSNA 4JVLA 5IDVA 4GPTA 4B2PA 4P4SA 4HUQB 2G83A 1TX4B 2JGNA 4UKDA 1A2KC 1KI8A 1NBME 3AV0B 2ZU6A 3FYHA 3VNVA 2J87A 1E2FA 1VDZA 1WDTA 5DSZA 3X1YA 4RZ2A 1QG2A 4NTZA 3UKDA 4ZV4A 2BMDA 3CH4B 1W4AA 2NQ2C 1R4AA 1MO4A 1L4UA 1E3MA 4MKHA 2ORIA 3K9LA 2WKRA 2PBRA 1Q1EA 1HE1C 2YKGA 1X1SA 1XTSA 2EW1A 2QBYA 1AS0A 2YHSA 1RE0A 3MJRA 3TAHA 2J0SA 2GVZC 1BO6A 5H70A 1RZ3A 3FMPB 3BAFA 1NLYA 1X86B 5J4HA 1XXHE 1KK2A 3K8YA 4C4PA 1CJTC 3QPWA 3AB3A 3DOEA 1E2GA 1U0LA 5HCNA 2R8RA 3DKPA 1NLZA 1VCIA 2I1VB 2VO1A 2ZRBA 4TLAA 5GJWC 2IYZA 1NNEA 1GL9B 2WKQA 2P2LA 2FEOA 3TAUA 5EUQB 3V9PA 3Q72A 2VF7A 4N3NA 4KITB 1LS6A 2D3WA 3CBQA 3MUFA 1P7CA 3PENA 2FSIA 4WVFA 3BB1A 4Q4JA 1TEXA 1ZC4A 5EUMA 1X8LA 3SJCA 3THYA 3THWB 2J5XA 4V0LA 3NDBB 3V00A 4ZI3A 3TE6A 2BVNA 1HE8B 4LYJA 1C1YA 2H92A 1NVXQ 2ZRGA 2IK8A 4C7OB 2WWHA 1CR2A 1G8PA 1S4QA 5AJWA 2AKYA 2PT7A 2ZI7A 1GP2A 2HXSA 4EAQA 4U02A 5AJVB 1Z2CA 4N1AA 4TLCA 4OQXA 4P4TA 2NGRA 1K6MA 2XNDA 2BM1A 3FB4A 3PR1A 4HLCA 4TLDA 4G5SA 1ETUA 4KVAA 3W9YA 3RYTC 1AZSC 3EZ9A 1LY1A 4HLQB 3GJ5A 1DAHA 1OE0A 2GEVA 2R9VA 3EG5A 3QXXA 4ZCLA 1VCOA 3TR0A 5FPHA 1JPJA 5JCZA 1A5TA 1GZSA 3FKQA 3LVQE 4FWTA 2BHRA 4GFDA 1XMIA 4Q48A 4GL2A 1P2UA 4AG5A 1YHNA 1YR8A 2QZ4A 2QSZA 3SYNA 4L15A 1M2OB 1OFHA 5KNBA 2GXAA 4CVNA 5LB2A 1SXJB 4XVUA 1JR6A 4ZDKA 4NYJQ 4NYIR 3ZLJA 2GEUA 3IEUA 2XAUA 2D2FA 3TR5A 2VPPA 3W8RA 1KKMA 2ZRPA 4C3ZA 4TMKA 4M9ZA 4DB2A 5F9FA 4BQSA 2F1HA 1DG3A 1T6NA 4HEJA 3VX4A 1U0HC 1KSJA 4GP6A 4LK2A 2ODNA 1YJ5A 3A4MA 4LJ6A 1YE8A 2I3BA 2J0VA 4QM7A 2QAGB 3BH7A 4G5OA 1QF9A 1VG9B 3T5DA 1E2IA 1BMFD 4JVSB 3G5UA 4B3XA 1HH4A 2YWFA 3B1YA 2VL7A 3AH8A 4RD3A 4D0GA 4FN5A 4RJLA 3AKCA 2JA1A 3IUYA 4JJZA 4I1OA 2IEZA 1A2BA 2P3SA 1G64A 1PJRA 2V55B 4P0TA 2Z6VA 3SFVA 4BZXA 3QKSA 1ZM3A 3RRNA 3WMEA 1Q1BA 1D8TA 1SXJC 2D2EA 3LLMA 2Z5FA 3P20A 4KFTA 4W5HA 2FA9A 3FE2A 4UXIA 4FXPA 4LHZA 5JBQA 2WZQA 3G82C 4A0GA 2ZS9A 2Q0HA 3K0SA 3RS4A 1RRGA 2FF7A 1HY3A 1XD8A 2QGZA 2GJ9A 1KAGA 1UEJA 3E2IA 1OKKD 3R8FA 4XIGS 4PANA 3U3KA 3VQTA 4I4LA 3I73A 2WTUA 3H0KA 2FMXA 2QAGC 1BIFA 2C04A 1TMKA 1W4CA 1NF3A 3R20A 3BE4A 4MGZR 1UFQA 3MWKA 2UZ3A 4OHZA 4MRNA 5EXTA 1KGDA 1Z29A 1UAAA 1W0KD 2VQSA 1H8ED 1E0AA 1WMSA 3UXMA 3BGWA 1IY0A 3F0TA 2F1RA 4US1R 2IF2A 3CZQA 3L0PA 3HU3A 1UJ2A 2Q9CA 4HZUA 3E1SA 2WAYA 3QPUA 2WJHA 2HCJB 2FG5A 5KDLA 3ZVMA 1MABB 4HAZA 4WA7A 3JZAA 4W5WA 5G3YA 3TQCA 2PCLA 2QP3A 2VP2A 1A7JA 1BMFA 1CKEA 4FCTA 4ON9A 1KAOA 3FMIA 5EE0A 5FBWB 2ZRMA 4B3DA 1AK2A 1LVGA 2QORA 2V6JA 5DI9A 3FGNA 4DCSA 1XXHB 4B35A 2JLSA 2B8WA 3A6PC 4GSYA 2CL6X 2OBLA 4OI0A 1ZNWA 4QGFA 1TADA 2XGJA 3NHBA 3ONWA 2P67A 1HTWA 5LDDC 5DE3A 1U8ZA 3GFPA 3OIUA 3PEVA 4JL5A 2B6HA 2DFTA 1E4VA 4Q7JB 3RLFA 3TRFA 4F4JA 5JSZB 2QPAA 3NEYA 1PLLA 2EFGA 4YQFA 3KZ1E 4L16A 1CULC 3AUYA 5E3HA 5CK5A 2BV3A 2CK3D 5GJBA 2G1KA 1VG8A 4MA4A 2WWGA 3RS5A 2XTNA 4Q9KA 3DDCA 1SVKA 1JAHA 5FOUA 3RSOA 4F38A 4AKEA 3MSXA 1J90A 3NBXX 4BFUA 4JT4A 3AVYA 3E5HA 1NMZA 3GLIA 5H8WA 4YMSA 3L0OA 2G88A 1W0KA 3KJGA 2FH5B 3CNLA 3CM0A 3GJ8A 2IHBA 3UG6A 3B9QA 5J47A 1KJZA 4A36A 1GKUB 1Q12A 2BBOA 4UJ5A 3PXGA 4ZCIA 2EFDB 4CRWB 1P4SA 3A1UA 5D3MB 3VU9B 3VR3A 1PZNA 2CHQA 2O8DA 2O8BB 3AGPA 5DHFA 5J5CA 4QBFA 4AYTA 5AUNB 2F1JA 3CX6A 3AP1A 4GZMA 5KU1A 1CF4A 2FPKA 4C30A 3RDPA 1NBMA 1XZQA 4M0LA 3W3AA 3EA5A 2ZJ8A 4RFVA 3QG5A 3U5ZB 3IPYA 3VFDA 4NPHA 3U3RA 3OE7A 4DUGA 2ZUCA 2H57A 4PAQA 4X8HA 2PH1A 2ZQ5A 3AP3A 2R6GA 5K8LA 3QY0A 4TSFD 3LW7A 1P5ZB 2NG1A 4BZQA 2RGBA 2CK3A 4S35A 2FPLA 5CM9C 4ZCMA 1W2HA 3CIOA 4AWXA 3Q3JB 1GNPA 1TEVA 3NVAA 2Q9AA 1E96A 3MWLA 4PQRA 1RW4A 4BEBA 1Z6AA 3E70C 4URYR 4LC0A 1G6OA 3T12A 2JCSA 2OV2A 4KFUA 4QM6A 4CIDA 1BH2A 5FUXA 4ACBA 4MH0R 5C18A 2WHXA 4X8LA 1WBBA 3TW4A 3BERA 3U6KA 3WRYC 4LJ5A 2IYWA 3TUJC 4MRVA 1U98A 3B85A 2FSHA 2DB3A 2GRJA 2HLDD 4HAYA 3SJAA 3KXIA 4QJ5A 3U4QA 2EYUA 3CLVA 2BMEA 3IHLA 1Z22A 3VR4A 4DT1A 3U7EB 4CYMA 2YWEA 4UNQA 5CYPA 1R6BX 3LA6A 2DHRA 3BB4A 4EFMA 4CW7A 4TMVA 3GLGE 2G9NA 2Z43A 1KTVA 2QSYA 3B2EA 1E9CA 3K9HA 2ATXA 2VIIA 1YVDA 2C8VA 3IILA 1OT3A 4JLMA 1D5CA 1Z3IX 3AKYA 3U7GA 3B82A 5A0FA 2WJGA 4F92B 3KTAA 1D9XA 1YKSA 4QRHA 2RGNC 4JLBA 2OLJA 2BMJA 3IHWA 3K0CC 4O2RA 3LXXA 2A5GA 1RYHA 2GAOA 3EPLA 1D6JA 1JXMA 3SHFA 2C99A 4TSFA 4FCVA 5FOTA 3ZQ6A 1FW6A 5KUTA 1EWQA 3EC2A 1Z83A 2P6NA 2GEDA 2Z83A 5DI3B 2VP0A 5HCIA 3KKPA 2SHKA 4FINA 1N6NA 1U9IC 2J9RA 2VYFA 1QHNA 5JJKA 1KI6B 3BD9A 3B1ZA 2VA8A 4DLXA 5F98A 2YV5A 1ZUNB 3CUEF 4IVPA 4A2PA 3U3JA 2GESA 1F2UB 2ZANA 4B71A 4D4JA 2QTVB 1J8MF 4W5JA 4ZDIA 2QQ0A 3CRMA 3ZVRA 2DR3A 4DLUA 4FMBB 2BEJA 1K8RA 2HLDA 3O8DA 2GK6A 4M21A 3A1WA 3K09A 1W0JD 5KPDA 3L82B 4MYTA 2MMCA 1RYFA 4LJ8A 3KB2A 1IY2A 1GL7A 6Q21A 1XBTA 2KI5A 4BFYA 1N6PA 2V7QD 1CS4C 2CCJA 1XTRA 5DHAA 3BC1A 1KZ7B 3PUYA 4JYBA 2A78A 2FGJA 4UJ3A 2A30A 4HSEA 3KQHA 3PCRB 4DLTA 1T9HA 1T0HB 2FZ4A 2NZJA 2E87A 3NDPA 1GAJA 2A7QA 4JBWA 1HQYE 1V43A 2GF0A 1I4DD 2IYSA 2IXEA 2X1VA 4GOJA 2E1RA 1QBKC 2QRZA 3EW9A 3R7WB 5A5GA 1ZD9A 5AJYA 5F9HA 2VHUA 4KYUA 4GZLA 4B47A 1AGPA 2OUKA 5FL7D 1YZGA 2W6JD 4PAOA 3BRWD 5DNYB 1F2TA 2ODBA 1Q44A 121PA 1EFHA 2IYXA 3I72A 5BQ5A 5C4GB 1S96A 1GRQA 2O5VA 1EESA 4BLPA 1QRAA 4NZYA 3EWSA 4C0AC 5JWOA 1QVRA 3RS2A 2WBLC 2GHIA 2N1BA 4GBMA 4LGMA 1ZU4A 2JASA 4Q4AB 4AIIA 3BOSA 1DAFA 5KTYA 2QMHA 4PC6A 2GILA 2YOFA 4TLBA 5HPYB 1J8YF 4LJYA 4C0JA 4MUBA 3M0EA 4Q1DA 5KSZA 2H1LA 3HYRA 2OT3B 5FBLB 2FGKA 4IVRA 5TXGA 4BWYA 3W8NA 4BFZA 1KO1A 1HURA 2OFOA 2PLFA 1G3QA 3JZMA 3C7KA 2P6UA 3NC0C 3VHXA 1G5RA 3HU2A 2VHJA 3ZDQA 3FDIA 2V7QA 2XNSA 3GJ0A 1Z07A 5C1BA 521PA 1UPTA 2FE4A 1GM5A 1ZINA 3O8BA 2NPIA 3UATA 1ZC3A 5HTKA 2GBLC 2JDID 2N42A 3CF2A 3T15A 3KXLA 4AG6A 3TGPA 3SC3A 4ARZB 2MSEB 1TU4A 5FTLA 1IBRA 3OESA 4JMPA 4ZO4A 1E9EA 3I5XA 1NG9A 2O8EA 1DTSA 1JJ7A 1UKEA 2DWPA 2FNAA 2W6JA 5FL7A 4EQ6B 1VYVA 3FFAA 4IOLA 2ZE8A 3IIMA 3UANA 2E9SA 2EFCB 5FOSA 1AGRA 2RGAA 3CB4A 1Z6TA 1ZU5A 1E9DA 2XXAB 1QHSA 5L3VA 1ONBA 4DDWA 4O2LA 2YINC 4TZ6A 1J99A 3CX8A 3GLGB 1IQPA 3QXCA 3MCAA 1WA5A 5B30A 4TTQA 3VKGA 4NMMA 1W48A 2ZROA 5J40A 2KJQA 2OBMA 3BIFA 4URUR 2AWOA 1ESMA 4NONA 2PCJA 3CPHA 3IQWA 3VKHA 2WPDA 5HKKA 2GJ8A 1XTJA 1N3BA 2C03A 2QAJA 3CRQA 1AQYA 3IO5A 3X1XA 2QP9X 1UF9A 5CJ2A 1G5TA 1KNQA 1COWA 2ZE6A 1Z5ZA 1XPOA 4POAA 1YQTA 1G8HA 3OAAD 3WMGA 4CEIA 1NIJA 1E1QA 1ZM7A 5J4KA 1EFCA 1E0SA 2ZAMA 4TYQA 4BZPA 2RCNA 1SVSA 3U44B 2QPTA 1AKYA 1E99A 2W0MA 4UQOA 3GEIA 1XB2A 4Q4HB 1VIAA 1JI0A 4BFWA 2X2EA 4E03A 5CYOA 5E7JA 3I1FA 3VMFA 5B2ZA 1NY6A 1WBDA 3RC8A 2XOKD 5E7IA 3KKOA 3A58B 4TTRA 1R0ZA 4C0SA 2CEAA 1JAIA 3SBDA 5EE1A 2AXNA 5DN6D 2WSMA 4Q9HA 2RGDA 4L9WA 4DVGA 1OYWA 5FPKA 5J4YA 4P4SB 1DS6A 3U7HB 1CP2A 4GNKA 2JLQA 3ASZA 721PA 2WJYA 3UWOA 5JJLA 5GVRA 2IBMA 4AKIA 4RD2A 3ZZTA 5TARA 3O8CA 3NKVA 1NMYA 4XSHA 3LDAA 3BH0A 2OBNA 2DFKB 1VKJA 3Q7PA 2WM9B 4KLNA 2J45A 1KO4A 4LX0A 3NBYC 3TLXA 1XJQA 2F3TA 5TY0A 4AYWA 4TYWA 4HUTA 4RD0A 4TTPA 1G291 1M74A 3L0IB 1CR0A 4BLOA 2QBYB 2J3EA 4FIDA 4CF7A 1LB1B 3PFIA 1Z08A 3D31A 2C9OA 2GZHA 3KKNA 4UXJA 4A0RA 4MDFA 5CK4A 1MO5A 2H17A 2J7PD 1GTVA 3C41J 4WBSA 4BPBA 3ICEA 4B3CA 5GVSA 4YMWA 1EGAA 1JALA 2W6ID 2FX3A 3P32A 4BEJA 3I32A 4JLOA 2ZRAA 3MFYA 2AFIE 2ZRIA 4L5BA 4Q4JB 3K70B 4IDNA 1GILA 2NO1A 2OXRA 4M9QA 2NO7A 2YC4C 4NYMR 4A2QA 3K0AA 2I1QA 2REBA 2OM2A 2ZJBA 2JJ1D 3EZFA 3IGFA 5BN5A 1W36D 4BUJA 5CIWA 3GLIE 1E79D 5FPSA 2IYUA 1NSTA 1UDWA 2J0UA 1VIYA 4ITRC 4JSTA 2HJGA 2AWNA 3GEHA 1KK3A 4B74A 1UM8A 1H8HA 2W0SA 1U0JA 2JATA 4EPXA 3LX5A 4LSGA 2GDJA 4LUCA 5EP4A 1NVVQ 1T3SA 4OHYA 3WXMA 2W2XA 1Z6XA 1TAGA 1KHTA 2ORVA 1NMXA 4DLVA 3LQQA 5L3SA 2WIBA 3A37A 4KBGA 2JLXA 3K70C 4IDQA 3NWJA 4JLNA 4XWKA 3IBYA 1CR1A 1I2DA 4Q66C 1JNYA 3W5IA 4IJMA 1R2QA 3TNFA 1NLFA 3I3SR 1MH1A 2RMKA 3EWAA 4H9GA 3FTQA 4PHGA 2NIPA 2W6IA 1ZRHA 3HP1A 1SVOA 5JS8A 4A6XA 4JVNA 1S1CA 4IHQA 4M1SA 1IJFA 4BE7B 3D6TB 1MRNA 1QG4A 4UNSA 3SJZA 5SZHB 4QC2A 4W9MC 3A8TA 4TQAA 1XPRA 4JT2A 2ZE5A 5FH9A 1RKBA 4IDPA 1KI1A 2GA8A 3UWKA 3LH5A 4LY6A 1UKVY 1Z47A 2VSFA 1DAEA 1SVLA 2Z4RA 4YDHB 3RWOA 4OK3A 2OAP1 2JJ1A 4DHEA 2R65A 1DPFA 2ODEA 4LV5B 3WNCA 1KSGA 2G0NA 4URXR 1E79A 1KKLA 1NKSA 3QIAA 4HAUA 4XJXA 2HF9A 1ZD1A 2HUPA 1JEEA 4AI6A 2RGCA 1R7RA 3K1JA 4KCGA 3QKSB 2GCPA 4BRUA 3FKSD 3PEUA 3H4MA 4LJ9A 1VECA 1E6CA 3SBEA 4PPGA 4JLVA 3GJ7A 4B32A 2Z4SA 2XB4A 4EPYA 3ADKA 4E5UA 1R5BA 4HDCA 2CVFA 1G6HA 2J7KA 3DZ8A 4URWR 5JHGB 2QROA 3HPRA 2QP4A 3PUVA 3FFBA 4KI0A 1Z0AA 2JLWA 4FWIB 2ZAOA 3RRYA 1QZXA 2PMDA 5KOYA 3I5YA 3B1XA 4WZBE 1IHUA 3I4LA 2KE5A 4M9SA 3LBIA 4AKHA 2KBEA 1IXSB 4HLUA 1BKDR 1E2QA 3CONA 4IFBA 1QHIA 5B57C 4D26A 2VP9A 4HZUB 2NO0A 2B7CA 3OEHD 4IEEA 5BN3A 2YWGA 2JLZA 2P6RA 4Q9JA 1N6OA 2HT6A 1KI9A 2Q21A 3F8TA 3B1VA 3U6BA 1G3RA 3I8XA 2HDNB 1SQ5A 3LY5A 3CF0A 1SKYB 4NU0A 5HE8A 2BCJQ 1N2CE 3FMOB 2HYIC 2RH5A 2CVHA 2GJKA 4MUAA 4YDSA 3KUCA 1FL9A 3L0SA 1T3LA 3CF6R 2V9PA 4L4UA 4NYJR 4NH0A 4IKEA 4CEJA 4US2R 4QHYA 1PLKA 3DMDA 4JZKA 3CX7A 1V5WA 3H86A 4YMUA 1KO5A 1Q1QA 3OHMA 1UKZA 1OIXA 4LBYA 2KWIA 2JJ2D 1KZGB 1N5JA 4BLRA 2F7SA 2ZS7A 4GRAA 1OV4A 1TNDA 1JXOA 1W4RA 1RPZA 4Y0AA 4GDFA 1ZNXA 1R8QA 5G3ZA 4PC2A 4NYIQ 3MD0A 3KQUA 3ZIAD 2GZDA 1P72A 3EASA 5JJIA 4R9UC 2EWWA 5DO9A 421PA 4MKIA 4IOMA 2B8TA 1OLOA 2ZUDA 3I62A 1IAQA 4OJQA 4TL9A 3GFOA 1XEWY 3LQRA 2O8CA 5G40A 5K8TA 4QKQA 2VSXA 1ZYUA 3LNCA 3GLFE 5AUQA 2ERXA 4NCNA 4QOSA 2V1XA 5FBVB 4NDZA 3ZH9B 5DLQC 1DBSA 3FHOA 4URVR 5AWFC 1K5DA 1II9A 2XZPA 2MSDB 5LPNA 2EYQA 1J2JA 5FBQB 2FN4A 4PPQA 3OEHA 1G4UR 4WIAA 4IDHA 2CMKA 3SZRA 2D06A 2Q3HA 1RRCA 1MO6A 1DG1G 3AKDA 3ZD6A 1AM4D 2O8DB 3QEJA 1GDDA 1XNJA 4A8JA 1WB9A 3GJ6A 2PZGA 4C2TA 1ZVQA 2RAPA 4KFRA 1XF9A 1ZIOA 2H7VA 2CLSA 3MRSA 2IW3A 1E1RD 4EPTA 1I2MA 4KU4A 1G4AE 1IN8A 1OIVA 2BJVA 2KBFA 4D0NA 3ZGXA 1AKEA 3ADCA 3A36A 4XOIA 1GKIA 2BBSA 3T61A 2ONKA 1WP9A 3SQXA 1OFIA 4ACAA 4FMCF 1ODFA 2Q3MA 1AN0A 3T1TA 2AD5A 4Q01A 2QL6A 1P6XA 2JJ2A 4QBGB 1S0UA 2HCBA 4ZI2A 1AJEA 2LCFA 1P60A 1RRFA 1SHKA 221PA 2W83A 3TQFA 3PUWA 1P61B 3N2EA 4GT1A 2H5EA 4R2IA 4Q47A 1U81A 3ZIAA 3BXZA 1VG0B 3J81k 1YRAA 4R98A 1KY2A 1SVWA 4HAVA 2OCBA 1KI3A 3MWJA 1EX7A 3LV8A 3QQ5A 2VSOA 1LFDB 1II8A 2QENA 4F93B 1KJYA 4EJSA 4XWAA 3QF7A 5FUVA 4G01B 2NTYC 3ZS8A 3THXA 1QHGA 2FV8A 3ND9A 2EVWX 5J4LA 2FEMA 1GL6A 4PC7A 4D25A 2PLRA 4DSOA 2N46A 2WJIA 3O47A 1MT0A 1OKKA 3Q8XB 3U4QB 4DDUA 4B48A 4DT1B 1D2MA 2Y8EA 1XTQA 4DC9A 1IM2A 5ANRB 5E95A 3MG9A 1ZNYA 5FL3A 4QBIA 5JEDA 1CIPA 1XU4A 1US8B 1TQ4A 3K9NA 1H8EA 3DEFA 4RZUA 3RRMA 1W49A 3WYGA 1E1RA 4EFNA 1F5NA 1YR6A 1T8UA 3KTAB 1NJGA 3X1WA 1G8YA 3OIVA 4MITA 4QBHA 5TV2A 1W1WA 2XJ4A 3QBTA 4B3BA 5F2EA 3MWYW 4I1SA 4DLZA 4FW9A 2IF0A 1YZNA 3IIKA 3NH6A 1TUIA 3QF4A 4TMWA 1XD2A 1LNZA 1UEIA 3AEZA 2NMVA 2ZUBA 3BK7A 3NH9A 2HJVA 3L8ZA 2QM7A 4Q5IA 4YMVA 1LTQA 2C9CA 4LPKA 1P2TA 1QHXA 1T3HA 5DYIA 4MRPA 4EIWA 2GF9A 4KBFA 5M04A 3LAWA 4LBWA 2QE7D 1Z0IA 3TSWA 2JAQA 1CBUA 5C4MA 3TK1A 4LHVA 1FNMA 3KFXA 3DMNA 4DJTA 5E4FA 3RS7A 1XCGB 4MRSA 3QSYA 4V0KA 1E2LA 1VHLA 1PUIA 3WYFA 1YR9A 2WWWA 2I4IA 1B0UA 3PIRA 4Q21A 2CE2X 1NRJB 3UG7A 1NVUQ 1CJMA 1Z0FA 2VHQA 2J46A 4PQFA 2CJWA 4HZIA 4Q1FA 2DWOA 3GMTA 2CHVA 5EJEA 1E2JA 4YONB 4Z54A 4TZ0A 1DEKA 4OQMA 4ZIRA 2J41A 2OG2A 4QG7A 4BECA 4H1UA 1WQ1R 4B2LA 2ZRKA 3QBVA 1F2TB 2OLKA 1T8TA 2ZRNA 2ZYTX 1IXRC 2VP5A 1GOTA 4TL6A 5L8VA 4H1VA 3K09C 3T1QA 1KMQA 3TUZC 2D62A 4KHZA 3NTUA 1ZCAA 4BFSA 1W5TA 1BYIA 2D4HA 5EE3A 1M1YE 1D2NA 1EXMA 2B21A 2KB0A 2VRWA 4M9XA 4V03A 3WBJA 1RJ9A 4LI0A 4BLQA 3P4YA 1FX0A 2F43A 3VAAA 1S9HA 2HF8A 2G6BA 4K8OA 2A9KA 1NI3A 3BWDD 5KSYA 1XTIA 5CLLA 2REXB 2ZSEA 2QE7A 3TVDA 3OF5A 1NL3A 4TMTA 5EE5B 2OAQ1 4O25A 4C0BA 5TB5A 5FBRB 5IK2D 1SGWA
chains in the Genus database with same CATH superfamily
4XCQA 5D51S 2GN4A 4N5DA 1OFVA 2Q3LA 2VCEA 1HDGO 5SZKB 4DLSA 1SUFA 4P7FA 4F9FA 3WNQA 2IUTA 2Q5QA 2ZXUA 5LA6F 1TI7A 3OT1B 4HAOA 3ADOA 1VCNA 5AKIA 2WWYA 3K4QA 3ROMA 4TZTA 2QMQA 4ESVA 1HFWA 2A14A 5B7NA 3BT7A 3NPAA 4HLDA 4KYVA 4L0CA 1N6RA 3LRXA 2IYOA 3NWOA 5JTTA 4CQNA 1IUKA 1P9WA 1KSFX 5AK0A 1JMVA 4Q3EA 1CUJA 2F48A 4RTKA 2C4HA 1XG5A 5CB6A 1U7DA 3C6ZA 2I9PA 3PNMA 2BMWA 1ZGHA 3L6EA 1Q0QA 5KNCA 4OFZA 4FHFA 1HE2A 2BBWA 1QG6A 3HGQA 3PWZA 4EHNA 1IZ8A 4CCYB 2HRCA 5B55A 4U5XA 1UMDB 5A62A 4TV8A 3EZGA 3FOCA 4FYYA 1VLJA 1L4BA 3ICCA 4YMIA 3VSAA 5DGDA 1ZRNA 1ISSA 3GDWA 3VV3A 1ZIDA 5TPWA 3PEWA 1M2FA 2XUIA 2CCGA 2IYNA 3ESZA 1YRBA 1DKPA 3G0CA 3C16C 3E5RA 4ANFA 4NARA 3CZRA 5IJ0A 1FQOA 3AUTA 1Q83A 4JOQA 1JU9A 3ZKWA 2WQ7A 4JJ4A 4MI3A 1M33A 1AXRA 2AYXA 3LYUA 2QIOA 3QWAA 2A59A 2GCOA 2C2ZA 3WFIA 3ZHBA 5AOCA 1A04A 4V0OA 3S8MA 4AF8A 1ZQ1A 2PZJA 4BMYA 5JNRA 3W2HA 1B74A 1F06A 1C29B 2AD1A 4WBNA 1PJTA 1UMCB 1NUAA 2B2CA 1J21A 3CNOA 3IL2A 1E3JA 2ZVDA 5I45A 2GK7A 3C4QA 2PYDA 4KGDA 1D6NA 2F1IA 4QPNA 2C7QA 4H4EA 1FFCA 1A72A 2PD3A 4I6JA 3FD8A 1IBKB 2C4UA 4BPRA 4NKRA 1QQTA 2OXEA 4EUKA 2VUIB 2UXCB 3FF1A 3W7BA 1BE0A 5DN9A 5EWJB 2WV9A 5C5DA 5LKAA 3KUUA 2FW7A 4M7PA 3CR8A 2XA1A 4L72A 4UHHA 4UM9D 1E2DA 1EFTA 1E9BA 2DBRA 1U9CA 4GPAA 3SG0A 3ENZA 4N5LA 1AGYA 1JE1A 2ZJ2A 4LXXA 2JFQA 4DYVA 3WWCA 1OFUX 3MBIA 4GR5A 3RFVA 3E1KA 4C6TA 5H5JA 3UHFA 3O4FA 2X9GA 3NHLA 3UMFA 4F0JA 4DCVA 4ROTA 1K9SA 1OYYA 5F1KA 5KYTA 2OOKA 5HM8A 3ZJYA 1TCAA 3QX7A 1OZHA 2RBEA 4NOKA 3TO5A 3ECCA 1HG0A 3HJFA 4PR0A 1RIIA 3JXEA 1AQIA 1JR3A 3FLMA 3VU3A 1N34B 4LOIA 2FWJA 2R6ZA 1I36A 1KMHA 3EH1A 4J9UE 1FSPA 4E22A 1KOGA 5F51A 5HKOA 2Q50A 4ED9A 2PKQO 2XEDA 2UKDA 5LBUA 1ZQ9A 3SC6A 4RHEA 3GRVA 3TI7A 2G70A 4ALKA 4BO0A 4MB2A 4UQPA 1ZN2A 1BHJA 1ZOPA 4GGMX 3WFZA 4ZHQA 1AURA 4OCZA 2PX6A 1M2VA 1X0XA 4BVJA 2ST1A 1J2YA 5MDHA 1L7OA 2WNHA 4NR0A 4Q02A 2IXDA 1E8MA 3SR3A 2FOXA 1Z6GA 3O5AA 3SPXA 1AZTA 3EUFA 3CRNA 2F9LA 1D04A 2HMUA 2VQDA 2PV7A 3QPVA 3VR4H 4LMBA 5EZQA 3RS9A 4LYAA 4CKBB 1PJ2A 2HDOA 2YOGA 3ZHTA 2IZ6A 4RKEA 5IAJA 2WSSD 4MS3A 2Y1GA 3KJEA 2H6EA 4N49A 4ZQHA 2FFQA 5DNCA 5LNK6 1BSVA 4YMHA 2OBFA 4C29A 1KQFA 3NYQA 5LP1A 5B1YA 1P45A 1U8UA 3TIGA 5AVRA 5IHXA 1K3UB 2YMLA 4FJ2A 3EA0A 3RQSA 3AVQA 4FFNA 3B13B 3DAOA 3H16A 4YO7A 4K81B 1E2EA 2QJWA 4RKYA 3DHNA 3M3PA 4D99A 3DHYA 1QCCA 3OTQA 2VT7A 3E5NA 4QTXA 3T7DA 5CB0A 4MV6A 1J07A 5JD6A 3KZVA 1MMFB 4DCUA 3RUEA 1AV6A 1H9CA 1JT2A 1MW8X 2DPHA 5AR1A 3CVVA 4FM9A 2GAAA 1FQWA 1RI5A 4H3HB 4FHGA 3F9CA 4M8KA 4OQZA 3RUCA 2OILA 1XYGA 3VI4B 3OZWA 4MYUA 2HBQA 4AKTA 1YFLA 5CDYA 1QPBA 2IYTA 5BW6B 4I2NA 1LI5A 3U26A 3KD2A 4UTPA 4PSAA 4CXMA 3KO8A 3GEBA 1IM5A 4D42A 1EFRD 1CC1S 3VR2D 3OFND 3CJTA 3DE3X 3I12A 2D5IA 3INNA 2GXSA 3WLNA 3V7NA 1ATIA 3U1TA 3RU2A 5KS2A 4UBKA 3NXKA 2XCUA 1UJ4A 1QCZA 2Z1DA 1MEJA 1SUWA 1HFEL 4WK6A 3RAEC 4BHTA 2QZZA 3VOTA 1INLA 1QVZA 4AQDA 1KU6A 1ZUHA 5L3SB 1T8WA 2RIRA 4V1CI 4PZPA 3H3JA 4I4TF 3FFTA 1CY0A 1LPAB 2DX7A 4TMYA 4YFVA 1Z5PA 4CUZA 1XEWX 4B6EA 3SQLA 1TKAA 1YE3A 1BXGB 3I42A 2EFYA 1K68A 2I29A 3A70A 4XTRA 3FKJA 1PLJA 2JVJA 4G1EB 5DIFA 4EA8A 1Y3HA 1VSTA 1VKRA 2GERA 2PG3A 4L2IA 3X1MA 2IS2A 5DGCA 2GXQA 2QU8A 2Y1XA 4KPUB 2PEYA 4PO3X 2HNBA 2VWPA 3P2MA 3LY7A 4EHIA 5FBHA 4EPWA 5FA5A 1OTYA 5EN4A 4EKYA 1S3GA 2I2CA 2QLJA 1RVV1 1EFLA 3E84A 2J09A 2O4UX 2TS1A 3H0CA 2HSWA 3DV0A 3I2GA 3JVEA 2I2AA 4MP3A 2DWUA 3HXMA 3LP8A 1YDWA 2VQEB 3IUNA 3I8SA 2NM0A 1GCUA 3TPCA 2XKAA 4DXHA 2F3SA 2OQRA 1NQWA 2VRBA 4I9FA 1NV9A 2RB5A 3TUIC 4H7PA 4YWHA 4A0HA 2VJYA 1U7UA 1U2TA 1A69A 3HKEA 1L5VA 1RI3A 1FVHA 1SWVA 2ICAA 2OO7A 2XTMA 1EEHA 3BMQA 3DQPA 3F8WA 1LXCA 3QW4B 4M22A 4L5IA 3SF8B 3R0QA 3N70A 4OYYA 4ZAZA 3SHWA 5EL0A 1I2BA 1K8XB 1RLIA 1F9AA 1I13A 3I2FA 3OZBA 1H42A 2EJVA 4GO1A 2Q3EA 2FI1A 2BD0A 4F97A 5IT0A 2HV8A 3OCWA 3RJTA 1EUDA 1IZ9A 1M1YA 2Q27A 1X1EA 3ABOB 3BSFA 4MV3A 5G0VA 4AY5A 5T4HA 5BPFA 4D3ZA 4RD4A 3THYB 4O3FA 1H23A 1UODA 1ZLYA 2JJYA 4HB0A 4LZZA 4NCJA 4C76A 4JIGA 1RADA 2JLRA 2R8YA 4QQKA 3O9VA 1C4XA 2OYRA 3L8HA 3GNLA 1VBKA 1YNOA 3M1YA 4WY8A 1SB8A 3A6GA 3ZTWA 2Q0QA 2XRYA 4OJKA 3VHLB 1FX1A 5TS3A 5JQWA 2JLAA 4K9NA 3IQZA 2B35A 1W96A 3BWEA 1MX9A 4U2EA 4H6WA 2QF7A 1O89A 4XD2A 2A33A 2R8EA 2ODWA 1FDOA 4YTEA 5F7JA 3TZBA 1GYQA 1KO7A 3IBGA 3V34A 4DPKA 4Q18A 4PPFA 4K0RA 4G07A 4OQQA 2IV3A 4GVLA 4DCOA 1CUIA 2FFBA 1NVVR 3IX7A 3OQMA 1R8SA 3HYTA 4IRUB 4UNRA 2QRKA 3CEPB 2LGJA 4KXUA 1WX1A 1P77A 1DOAA 3GCWA 2XPCA 1JHQA 2E0IA 2W2LD 4RMHA 5BN3B 2FPIB 2R1UA 3KYJB 3ZIDA 5HDBB 2Q2NA 5LC1A 1WXFA 3DE4X 1LVUA 3MTGA 4RHUA 4UXHA 4N5HX 2P11A 3MTEA 2ISCA 2BZ1A 3O2SB 3QOFA 4IQFA 4NE9A 4U63A 3SEQA 1TIKA 4XYLA 5BQ3A 1T9KA 2XHEA 3DXXA 4U6NA 2FQQA 4JC4A 3WNBA 2ZVPX 4OXIA 4ZCSA 1MX1A 2O57A 1ICIA 1L7EA 3T9DA 3UHPA 4KWIA 3KVYA 2OMKA 3MUNA 1DKNA 2IE8A 2HQOA 1YRQA 1T4CB 2NOAA 3FLBA 3W6UA 4G5GA 1QX3A 3S2IA 4CEJB 2P2SA 1EUQA 2N9UA 1KYTA 3A0RB 3D3WA 5EZSA 2HLPA 1P31A 2WP0A 4RF4A 1UBGA 4LNHA 5K3EA 4G5XA 3D4OA 2IHUA 3VGPA 4D0LB 1A7AA 4JI8B 4KDFA 3AUXA 1GAXA 1TU3A 4FFPA 3JYOA 4WFIA 5K0SA 2EKBA 3ZE1B 5CVCA 4BNMA 3NC4A 1YR1A 2CT8A 2EP5A 1F6DA 2WU0A 1YZKA 1AN9A 3TBKA 4CMBA 4EP1A 5JYCA 3UK6A 4EB8A 1Y5MA 4N39A 5JH7B 1IN7A 1QHYA 1T5TA 3A9SA 3LWZA 5TJHA 4DA7A 3QRWA 4Q1BA 4UBJA 3AR2A 1FBNA 1V5EA 5JCOA 5B6JA 6NULA 3AP2A 4HB4A 1T5IA 4O4LB 3NZEA 3MJTA 2QRNA 3QM1A 4WNAB 3D3KA 5KMGB 3M1IA 4DQUA 4G9EA 3H1AA 1GITA 3A1VA 3N39C 2B3DA 1QTIA 4CTOA 1A77A 2IU4A 2PL9A 3DMFA 4PLCA 1FP4B 2IYPA 3ROZA 3QFTA 1WVIA 4J7CA 4RZQA 3SS8A 3O1LA 4BVBA 4ZKDA 2Q62A 5I9LA 2A4KA 4GIBA 2AUMA 3KS9A 1TQ2A 1EM8A 3IC5A 4YRLA 2CNNA 4FGSA 3RW9A 3UXYA 1WHTA 3C3BA 4WXPA 3WBBA 3PXDA 1Y6QA 4GICA 5ALMA 1CYEA 2YOHA 2KYRA 4EKIA 4YRRA 4K2HA 2EJBA 4QAJA 4O4JB 2ECOA 3CH5A 3BWVA 4DLNA 3MM4A 1MOSA 3SBDA 3M6AA 1JSCA 1PJLA 3NHUA 1GNQA 2Z8XA 2JGDA 2B5WA 3IA2A 4NQRA 1LNQA 4PO1A 3ESYA 1MV8A 3UJNA 3K1YA 1L5YA 5AUOB 1CR6A 1PR5A 1VRVA 5DYTA 1Y5NA 4Y3UA 2AZXA 1N7HA 2FG6C 5AI6A 5KQSA 4IF4A 3S1AA 2XT9A 3ZV6A 4E07A 1CNEA 4G5RA 3EXHA 5EJMA 1JIUA 1ZOOA 5SYNA 1ILWA 2Q0XA 1FLNA 2OOSA 5KNDD 4NOMA 4OI1A 4D41A 1D2AA 2ZJZA 3HWSA 2FFRA 3A4TA 4KH1A 2BH2A 1SEPA 2MHCA 1R0KA 2EFHB 1JA1A 4QVKA 4MUJA 4R41A 2AN4A 3QXHA 2QN8A 4IJWA 4YK7A 5KJ1A 5DCUA 4M8NE 1MQAA 1NNLA 3A4LA 4L6IA 2FTKE 3P96A 3FYUC 4A15A 1I5EA 2H63A 1MPTA 4LNUA 5JS2A 1ULTA 3Q8KA 5D8DA 5FOXA 5JFGA 3PLAE 4EI8A 5IYZB 2IYQA 4TQUS 4I99A 3F5MA 3K8OE 5KX5B 3TF5A 2UU9B 1VJRA 1QXSA 4YCLA 1VE7A 3OCUA 4F04A 3PWKA 4IUBS 3H1GA 3GLQA 2BEWB 2NTVA 1XAHA 3ZE6A 3BS4A 2X4DA 5DMHA 3USES 4JUBA 2J6HA 2L42A 2ZI3A 5FI5A 1DX6A 1NOKA 2L0XA 3EVAA 5JANA 3AONB 4IS3A 1G7SA 5AK6A 3RANA 2YIJA 2QX7A 3ZNOA 3WWYA 1QVAA 4HEHA 2IEYA 2XYGA 1ULHA 2F3RA 4IW3B 4K1XA 4PSKA 2DQKA 2YDXA 3GCGA 3QELA 5LU8A 3BE6A 4FYKA 5JSFA 3ETJA 3OIFA 3W7VA 3EIWA 1E3TA 3W5SA 5ALNA 3F9RA 4EMTA 1Z5NA 2PZEA 4LV6A 4QNMA 3E9DA 3REFA 1P1FA 3MAAC 4FUTA 4KXNA 3I5MA 5I7UA 1XZCA 2PT5A 3NXSA 4X6LA 4XRRA 3O2QB 4KO2S 1NRIA 3HCDA 3WJ7A 1Q3KA 1UEXC 2NSJA 4DV3B 3PITA 1G3UA 3IMGA 8OHMA 5K7SA 3ZOKA 2QMOA 1GUYA 5FWXA 3SQDA 4TKVA 1ZAKA 1EQ2A 3AVUA 4V3CA 4JP3A 4PLTA 3K94A 2IBTA 4OQFA 2R1TA 1ZM4A 1XKXA 4Y9SA 2VQFB 3E27A 4Q03A 2WMYA 4QT4A 4MDEA 3AI7A 2IZ7A 2PMBA 3R24A 3CKLA 2QUIA 4EHAA 4WY5A 3K6KA 1VPLA 1WUHS 3GYBA 3JASA 4E08A 4RULA 4WZAA 3RSSA 1LS1A 1PSDA 1GGHA 1XTKA 2X42A 4CM8A 3KQQA 2HR1A 1GQ2A 4EM6A 1NXWA 2CNWD 4BVGA 2R7KA 1U8EA 5EKUA 1H2HA 2BIFA 2R8XA 2WKSA 1TM1E 3G0HA 3PFKA 4FBGA 1X8KA 3EDCA 3BBLA 3KUDA 3NT4A 3VHQA 3WGJA 2KX7A 5TQ2A 2DJIA 2Z0MA 4B3GA 3N0RA 4OHPA 3GOHA 4OXQA 3GCZA 4ETMA 2Z9CA 5F3RA 4MW7A 4XCXA 4JCCA 1WPGA 2XNKA 4UD2A 1QF7A 2X2FA 1EHCA 5H9WA 3WKEA 3LDHA 5EJEA 2B5VA 2GJ4A 1UBOS 3KKLA 4R2JA 4RGVA 5TR9A 5HNKA 1PR6A 2F9MA 4P4UA 4CIYA 4TL7A 1ZGAA 1ZGGA 4KRYA 4Q9LA 2B1IA 3UIEA 4RHCA 1JJVA 3I6IA 3Q9LA 1I0LA 2F1OA 2I3AA 2YXDA 3IVGA 4RZIA 3T3MB 2Z08A 3ET5A 4L5AA 2IOQA 3CNBA 3V4RA 2XJ9A 2C83A 3EQZA 3K96A 1LU9A 3NYWA 4D9IA 4EY7A 5I7VA 5K8IA 3I58A 5CAEB 1Z63A 3B6MA 3NJ8A 4L5YA 5HE9A 1DE0A 2ABWA 2OXFA 3DUFA 1U1IA 1LJ8A 3VZDA 4NFYA 2PE5A 3I5AA 3TTUA 3CRRA 1YH3A 4TXJA 3PE4A 1XHEA 1BGVA 2FW8A 3FRHA 1WXWA 1FTNA 1U8FO 3L8MA 4OD0A 4YUYA 4AS1A 1TPZA 1H0SA 4ZIRB 3VPCA 1ACJA 1MRSA 3TZLA 2D0IA 4A9AA 4CMAA 1W4ZA 5KYKA 1VLMA 4ILKA 3S2YA 4Q3AA 3K72B 1GT6A 1C8BA 1O6ZA 1MC5A 3OA2A 4XYEA 3TJMA 2H18A 3QE9Y 2GMWA 3DVLA 1OBCA 2OCPA 2PH5A 4DPLA 3DDSA 5JXWA 1N6IA 1WLYA 4GPZA 2DU8A 4QPDA 1L5RA 4TYPA 5DW3A 3GLHE 4X92A 1ZR4A 5JXGA 1E7SA 1X9HA 1E2HA 2FW9A 5T3YA 3EODA 3QENA 3PGVA 4XASA 5E38A 1Z5UA 1E4OA 3RVBA 1HYHA 4MQEB 4EFLA 4D6XA 1NP6A 2AEFA 4GPEA 1DRJA 2WD7B 2ZR9A 1J56A 3IS3A 4JNCA 1BU5A 1HOTA 2FZCA 4AN1A 3EBPA 5B3JC 1NQVA 5B7PA 1OFUA 1UBEA 4UPEA 1AY0A 1KI2A 4K9PA 4ZQEA 3HN6A 4EJ2A 5A4KA 1R0YA 2DFVA 2GJSA 4LCEA 4S1NA 3CH7A 1IONA 4UC0A 3U4AA 1FRFS 3QIVA 1G8SA 2YYYA 4Q24A 4COKA 4GKJB 1PJ8A 3PRJA 4I1UA 4B4VA 3BFJA 1CUGA 5JRJA 1W25A 1QYCA 3DHWC 1UZMA 2HPZA 3UQYS 3GJ3A 2O2YA 1SC6A 3MMPA 3UUWA 4GF5A 3COVA 1RQLA 1CXZA 1XD9A 3RUHA 1Z9BA 1UJCA 1VP9A 4WFQA 3B6IA 1ZXXA 3L02A 3NHAA 3OIDA 1YQUA 4B82A 1TC1A 1KYIA 1XMJA 2A67A 1X9GA 3WMFA 4WN3A 3II6X 1EX6A 3H5LA 1Y8RA 1Y6RA 4NBWA 4OHWA 1BJTA 2Q1TA 1SXHA 4EKDA 1P5FA 3HVUA 4YQYA 2HD4A 1NBOA 1AUXA 1JPUA 2OPBA 1BYUA 1UPBA 1L5HA 1NHWA 4DQXA 3EZ7A 2ZJAA 1XRLA 3KDSE 5DM1A 1RM5A 4YRMA 3ES9A 2WE8A 4FFLA 4NMWA 3WWOA 4EABA 1JFRA 1OFTA 1YB7A 3BGSA 3OECA 3WVNA 4FDLA 4UAVA 4OREX 1TF5A 1KIMA 1DZ3A 1RBYA 3NM4A 3L1KA 3DFMA 3KDAA 4TV8B 1AHHA 3JQCA 4WFKA 3T9FA 4DEYA 1TKRA 1E92A 2BGNA 4JEIA 2UVDA 4B44A 2V3CC 3SJBA 4Y9TA 3M2TA 3RSOA 3UM9A 5TPWB 1EFAA 1YQQA 3NHRA 3VBCA 4ZDWA 5ALTA 3AVOA 2DTXA 1YS7A 2RKBA 4QOEA 5IJ0B 1D2EA 4KN9S 3ZKWB 4EF5A 2HL6A 2JKZA 1PL8A 1TCVA 2RC6A 4EELA 3PUKA 1VHQA 3MYRA 1XXHA 1UXOA 4K9SA 3JZFA 4FFMA 1FP7A 2O1WA 2GCOB 5EGNA 5AVQA 1BCSA 2CLDX 2O7QA 5H59A 4CCSA 5K0ZA 1K6JA 1KR5A 2PWZA 3D1LA 1E60A 1ZHFA 2A5DA 3NQ41 4RPHA 1TO2E 1UWKA 3G2KA 4WBNB 2LKDA 1E8NA 3JWGA 5FUWA 4JYZA 4DM3A 2X5JO 1RI2A 3GRKA 4FSHA 4J29A 4AFNA 4D79A 4DHWA 4JJFA 3CZAA 3TLYA 4QXMA 4DNFA 4QWMA 1Z2AA 1T5HX 1VHTA 3ZX4A 2LUOA 3P9YA 4RO0A 3COYA 3PKIA 4D9JA 4GUDA 1Q57A 4PX3A 1IUNA 2HSZA 2V4ZA 1OXUA 2OO5A 2MSNA 2FPXA 3K9GA 1OREA 1ZK4A 3EZ2A 4YXFA 5HIAA 2VYQA 3AQ4A 2PEZA 5FR1A 3OQ6A 3QE3A 3PC8C 2C7RA 2JAXA 4LMAA 4ONEA 3KOMA 2JAWA 4C6TB 3G7NA 3VNUA 1GARA 2ZTVA 2WU3A 5IN5A 3IQFA 3WYAA 4OI4A 1PG2A 2GX6A 1Q0RA 3UV6A 3I9OA 3KTOA 2Q1WA 2OE2A 3LF2A 4YP0A 1XPJA 2RGGA 3ZHVA 1PZFA 3J7AC 2QL5A 2HMYB 2F90A 2CL7X 1SK8A 4CGZA 2VNKA 3HS3A 5GADl 1ZUIA 1SBTA 1UK7A 1DAMA 2RONA 2R6DA 3KOWA 1VBNA 3TRHA 1KMHB 3T4EA 2DMRA 5AJXA 2A1IA 4IWNA 2HK6A 1UOOA 3QKUA 2P9YA 4QRIA 3L0CA 3RSGA 2XVAA 3RWMB 2PX8A 2QUAA 4IIYA 1NVMB 3KQPA 4I5FA 4US0R 3GVXA 3SLGA 3QW2A 4QVIA 4ZHQB 4MV9A 1QVWA 1T43A 3JU3A 1M2VB 5CLJA 2H2HA 3PJFA 1I5OA 3CNNA 1QH8A 1ESCA 2YHIA 2AG6A 1T10A 3OD1A 3AY3A 3PPXA 4MHTA 2O8FB 2LKCA 2GQ0A 2LD4A 3GAMA 2OHVA 3RJ5A 3L4BA 5F21A 2XBMA 5DTRA 3L7KA 4JH0A 4MS3B 4LF7B 2DFDA 2W2VA 4DJEC 2X58A 2Q3FA 3IVRA 1I7QB 4D74A 3V97A 2VLIA 2X76A 4BAGA 4LQLA 4CLDA 4JR0A 4Y98A 4ZTZB 4YCBA 3UJ9A 5A4AA 2OFXA 4LHWA 2IPOA 3DXYA 3NNSA 2ZBEA 1Z6YA 5EJ6A 5I7OA 3KJZA 1ILEA 5FHQA 4RHTA 3FUUA 5G4KA 2F59A 4HN9A 1ZD8A 3N8HA 1T25A 2WU8A 3EMKA 3ZW8A 3IDZA 4RTJA 2I3DA 2FU5C 2OXTA 3DEJA 3TOXA 2PT6A 3G2PA 5LIPA 4MYCA 3RV4A 1DVRA 1GQOA 3T3EA 3KLPX 2PV0A 1X1RA 3P8ZA 3RUDA 4YH1A 1YL7A 3ZDRA 2HWUA 2OHGA 4OMFG 5D3QA 1IMOA 5J2TA 4G8BA 3ED5A 2Z58A 3T5MA 1MV5A 4URFA 5EIBD 1L7NA 4RV5A 3B9PA 1Y7HA 2BUAA 2YHUA 2ZRDA 1ZX1A 3QJYA 1H2WA 2UUPA 3BGVA 4KIJA 2XUQA 4PZLA 2OGWA 4UUMA 1HLGA 3FUCA 4JS0A 1BCRA 3VSBA 3IE1A 2C0QA 5AXAA 1IHPA 1SVMA 3DPUA 1O6FA 4IXWA 1KP9A 2BOVA 5KQLA 4U6QA 1L1FA 2O3SA 4KR9A 2ZIFA 2QK4A 3FHTA 1GCGA 3SC2A 1MIHA 4O0MA 1KBQA 1ZW1A 2M1XA 4C0QC 3SD7A 4CG3A 1OPXA 3VR6A 2OQ2A 4O4JF 4QFBA 4B4DA 4R2MA 3MLEA 2XA2A 4ZDJA 2AOWA 3ZZ1A 4PYOA 3DL2A 1FP6A 4JI7B 5DXJA 2VRNA 5KWEA 1VMDA 2ZIZA 3IEVA 2AW3A 2IEGA 2F8LA 3ZHSA 2Y0DA 2PIDA 4BQRA 3R7FA 1WV0A 1UBTS 5COQA 3HBLA 1ZZGA 2XWJI 4C1NA 4L2IB 2OCLA 3DFIA 4D8TA 4BDTA 4EF4A 2VFAA 3O91A 1RTKA 2P62A 2WPDD 4WBXC 5EPUA 4XGKA 1UZLA 1XLVA 2NUBA 1Z0UA 3IUSA 1SVIA 3G68A 4J0DA 5DXAA 1YZTA 5DI3A 5G0SA 5FPQA 2PS3A 3L8EA 3JQFC 1E9AA 3DV0B 4LZOA 4ASUD 2FEWB 3OZRA 4FMCB 4YWJA 5DMXA 4DEXA 2X0RA 2VZLA 2RHDA 3GY0A 1KI6A 2P41A 2Z2KA 1EE9A 3WLRA 4B3FX 5LN1A 4MJXA 3TTTA 1DJLA 5JW6A 3ZVNA 8GPBA 5IYZF 3CZMA 5KX5F 4D3YA 2ZE7A 3ZQJA 3GVCA 1GQSA 3O4GA 4NWIA 1UQRA 3CVJA 3FPHA 4ZC1A 2A3RA 5BORA 5IZCA 3HKEB 4QELA 4BNNA 3BMQB 3WC4A 3Q7SA 4H7JA 5DPMA 1T3GA 3X2SA 5K8CA 4P35A 1RJDA 1CRLA 1TO1E 2FSUA 2I1LA 2QWXA 4HFJA 5SV2A 2ZIVB 1RACA 3B8HA 5FORA 3S2GA 3PVCA 3HZRA 2FAXA 3K9WA 4YUXA 4DNXA 5FFMA 3E7PA 4H31A 1EUDB 4IVQA 1M1YB 5EY5B 1O4WA 4HWOA 1JTFA 4RTRA 4MYHA 1WMAA 2RJ3A 2ZBUA 1GG9A 3G85A 3JWJA 2Q5FA 1CIVA 4IV0A 3UMMA 1R18A 4G0VA 1DAKA 1SCKA 1AS2A 1PFVA 2YZKA 3L05A 4MS1A 2RH8A 4X9XA 2FOIA 1ZMTA 4NESA 4L85A 4PLZA 3BFXA 1RWXA 1QTRA 3FZGA 1CK4A 2YHAA 4O4IA 5HF8A 5JNWA 4IVNA 2PIAA 3I6MA 3L0BA 1BOFA 2XE4A 2D74A 4UOEA 2WHEA 1KDPA 4X8MA 3KPWA 1N6LA 4BLSA 1XZIA 3AFGA 3DZBA 5BR7A 5CA1A 3V8RA 4DA9A 2NO9A 3OX1A 2GPSA 3F9IA 3OWXA 2PA3A 3Q9SA 2DSNA 4MUGA 2YS6A 1ODKA 1GV1A 2XIJA 4D1YA 1PR0A 3OD5A 4CF6A 2CDAA 1K75A 10MHA 4AG6A 1RXCA 3JRNA 3NJ4A 4M0EA 3EVTA 1RLJA 1ESNA 3H19A 2C3MA 4U8GA 4ENTA 1Y34E 1I7NA 3P9ZA 1LF5A 1ZD4A 2GVDC 1X70A 2QYOA 3E7WA 2GTPA 4PZYA 4BNKA 2MMGA 1P1CA 3B7GA 4PG8A 1VQ1A 4XYBA 3AK4A 3FUTA 2EWMA 4WFJA 2ZBRA 1Z7YA 4Q1CA 1W5SA 2AN5A 3KQNA 1FFGA 3QWIA 3UPTA 2IODA 4CHTA 4DOMA 1DNPA 2AZMA 4Z6KA 1RFLA 5B12A 3T3OA 4AT1A 1U1FA 2ZI5A 3GX1A 4HB3A 4NBSA 4P31A 4QGGA 4DLAA 3EPHA 3DPSA 2BCEA 2O23A 5DW0A 1CS0A 3L18A 5CVUA 4D8VA 2IFTA 2VJAA 2YYSA 3N2GA 1R66A 4I08A 2EGGA 4WLFA 1MAWA 1ORTA 3NEJA 2QMEA 4PFSA 4UARA 4YP5A 5EHXA 5CCXA 2ZBPA 3D3WB 3HL4A 3PYLA 2D7JA 2SECE 2H2DA 5CM8B 1RXVA 2OZPA 3AINA 5KYYA 2QPOA 2J1LA 4BNWA 2CVZA 1W5BA 3KSAC 2QDKA 1U63A 3NDJA 5DTIA 5FUYA 3EQ7A 3UXEA 1UBKS 1V41E 1W36B 3RAJA 1Y8CA 1RWMA 4GC5A 1V6SA 4RXTA 3VO2A 1NM5A 2GF2A 4RDHA 2H29A 2YC2C 2VXYA 1Z2DA 3HVHA 1ZM2A 4OA5A 2XTZA 4QXPA 1RBZA 3KNZA 4TT3D 4W1PA 4XJVA 4NLLA 5DM0A 5H3HA 4BP1A 4RTLA 2EQAA 2COUA 4DS3A 1FNDA 3M4ZA 3C8HA 2XUJA 2B20A 4PHHA 1T1RA 1SKYE 2VWHA 3EWIA 2Z5LA 3O8LA 3LCJA 4B6JA 2J33A 1ZP6A 1E3WA 4X7MA 4CIVA 4EQ6A 3IULA 2WFZA 3GOQA 2REQA 3E03A 4IHKA 1HI9A 4BFVA 2E4VA 3F7OA 1V8FA 3LC0A 1NVFA 3QPDA 5IAKA 3VSEA 3OO0A 1M73E 1RXSA 2X0FA 1EM8B 3B5IA 3WGLA 4KHPB 4PLPA 1WHTB 3GYGA 1QIMA 4QDTA 4C4TA 3CVYA 3NHMA 4IG9A 1C8VB 1KK0A 1F8GA 3WGOA 2P79A 1FF9A 3AVXA 2W6QA 3HVIA 5F52A 2UYOA 4NYMQ 1X2BA 4RCYA 3AUSA 1BNCA 4M1WA 1JQLB 1GKYA 1XZPA 4IXMA 4X7BA 1WTCA 4GWKA 5B53A 4DNOA 4F5DA 3SYKA 1QHHA 2JGDB 3VX3A 2D8AA 4MPTA 4DMUB 2PUWA 4GH5A 5EUBA 2JLBA 1N5IA 2XR1A 2G80A 3NI2A 1NUQA 2ZT8A 4ZAYA 3KQSA 2ZSFA 4NECA 5AYVA 2C82A 3S1AB 3EXHB 3UGTA 1Q95A 1CQIA 3EGVA 3PKZA 1GRRA 4HGYA 4TVKA 3OCVA 5CT8A 5FOWA 4D0GA 4I3GA 4CWAA 1IHYA 3C8ZA 3U44A 1EX9A 1C0IA 2I3ZA 3BA1A 1GKKA 4K7JA 4MPRA 4TSRA 1E9FA 5SY9A 3RFUA 4EL5A 4NULA 1FTSA 2VA9A 3CPJB 3M5DA 4RTMA 4EHDA 3U1BA 2ZPTX 4LYFA 4PPYA 2ECKA 2IUYA 5EWLA 5ESXA 2ZPUA 4LNUB 4R2HA 3UMYA 3I6QA 4ZN6A 1BA3A 1V39A 3RAGA 5JC8A 1UZUA 2GCIA 3TLJA 5E9QA 3JQRA 3EMBA 4GPTA 3W78A 5E4TA 1UP7A 1AKNA 4JOBA 4MTCA 1LBHA 4DJJA 3K2QA 4TXMA 3X1JA 1A2KC 1NBME 5LJIA 1VFNA 5GIOE 1FTWA 3O9ZA 1NW4A 5DSZA 3WSVA 2GPNA 4TV8F 1JEOA 1U5BB 2G4VA 3UTCA 3CH4B 4C04A 4E88A 3NEPX 2C4MA 1L4UA 3QELB 2D1YA 4MKHA 1FY2A 4MW9A 2W90A 3U31A 5ERXA 1ONSA 4OAPA 4D56A 4MHSA 4R68A 4CUKA 5BWOA 3QEBZ 2YKGA 2VNHA 3WK4A 4XDZA 1AS0A 5AW3A 1SCUA 2QRMA 4O02B 5EERA 1V5FA 4D9GA 3NETA 3MJRA 3OPMA 2HV9A 1JSXA 3FNBA 2J0SA 2E4WA 5H70A 2GUGA 5TSDA 3FMPB 1NLYA 4ZO7A 4QJBA 5FWXB 4AMBA 4R3NA 4YP9A 5HILA 1IIBA 1E2GA 1ONPA 3RU3A 4X97A 2R8RA 3TIIA 5A5DA 5KREA 1YZYA 2R1TB 4WBNF 3W5AA 2VO1A 3ZCQA 2VRCA 4XIFA 7AT1A 4OBXA 2I22A 2JZOA 1ZL2A 1M8KA 4U0KA 5GJWC 1D2GA 1G8JA 1GL9B 1U4OA 1C4WA 1PTJC 2GUWA 2P2LA 2WKQA 1T9BA 2ALJA 3KR0A 4RIEA 5EUQB 2BTQA 1TJPB 2IITA 4QTYA 4P3PA 4UU1A 4YT2A 1LS6A 2D3WA 4QYXA 4UVHA 5I01A 1K9VF 3JASB 1SIBE 2YJNA 3ORHA 4CMEA 4FTWA 4WZAB 2W70A 1PV2A 5EUMA 5BUCA 5K6RA 1RD4A 4CM8B 4KXYA 1JHPA 2J5XA 4V0LA 3SDBA 4FGKA 2ACVA 3ZY2A 1MAHA 3PGXA 3V00A 2B7LA 1TMGE 1WSWA 3U19A 4LYJA 3H6GA 2YWDA 3PNKA 1S4QA 5TQ2B 2Q3JA 2A94A 2DKFA 1SBCA 2A1TS 3GPIA 4W8OA 2HXSA 4MA5A 3ROXA 3G7UA 2P4EA 1ZZEA 5DHQA 3OP1A 5F2KA 1F0NA 3VZPA 4C7MA 1Z2CA 4P7KA 3RREA 4KNWA 1D09A 4AJPA 4KQ2A 5BQOA 1K6MA 2C3OA 2RK6A 1KE1A 5AVSA 2BM1A 1X38A 2D3TA 5ITSA 6REQA 4LC9A 1TLLA 3DH0A 3EZ9A 1Q74A 2ZCVA 3IUPA 3EGWA 5CM2Z 3STXA 2HTFA 4DDMA 5AW2A 4ND6A 1E7RA 1AHNA 4J1SA 4IINA 4HQOA 4X6UA 1NE7A 2LCIA 2XE6A 4ZCLA 1MJ5A 1V8OA 2VDUE 3G17A 2GLUA 1JPJA 5CEEA 1GZSA 5AH0A 3ORFA 2ECFA 4DR2B 2IIPA 4Q48A 3NOOA 3DUFB 1YHNA 3LX4A 1DBRA 4BQOA 3SYNA 5JPDA 2FWIA 3ORQA 1T1EA 2GZ3A 1DC5A 3HFJA 2ZWAA 3K35A 3TKAA 5LB2A 4YYZA 5DCYA 1K27A 3EZLA 4MO2A 4NYIR 1RQXA 2GEUA 3ZLJA 3T7KA 3TR5A 2VPPA 3LDGA 1KKMA 1Z0ZA 3SQNA 1V26A 2A0FA 1F4VA 3TTYA 1O6GA 4BQSA 4DB2A 2F1HA 5F9FA 5ES4B 1OWNA 4GLFA 1U0HC 3RYCA 1V11A 2ODNA 4MHOA 4EX7A 4F2GA 4XM1A 3BH7A 5K51A 4G9BA 5HGJA 4JXXA 3SHVA 3BJMA 1BMFD 3T0GA 1WJGA 4ZZ0A 2AKEA 5LZ7A 4X1IA 4PM4A 4JHLA 5C4IA 2W6CX 4XIIA 4WY2A 3AKCA 2JA1A 2OCGA 4PSCA 3WICA 4ZI5A 3HG7A 2EIXA 1YVRA 2IEZA 3OKCA 1OLXA 4I1OA 2P3SA 3RHZA 3VJRA 4P0TA 5NULA 1VA4A 4XM0A 2Z6VA 4KUEA 3SFVA 3C97A 1ZM3A 5HCUA 3RRNA 1SXJC 4H60A 5CT6A 1DC4A 4UCWA 4UXIA 3W2IA 2A0YA 1XYVA 1Z62A 3BXGA 4FXPA 4LHZA 2V7EA 2ZS9A 4KR0A 4ZV9A 4BFCA 5JBQA 5CNIA 1ISGA 2O6LA 1LTHR 2FF7A 4QJIA 3SAJA 4E1VA 2ASVA 3E2IA 3PFGA 1KAGA 1Y9EA 2BFCA 3SMQA 1D3AA 3R8FA 2IPLA 4H7FA 1WZ2A 1V8PA 4BAUA 5D7BA 1HLDA 4B85A 3K71B 2B94A 3PGJA 5DLEA 4I4LA 1Y8AA 4PLYA 1J2TA 3UFBA 2FMXA 5A4DA 1NVKA 1TMKA 2CUTA 4C6HA 2BGJA 3CLRC 3R20A 4KYTA 1DKQA 3MIZA 1ZXBA 4UFOA 3LKVA 4JN6B 1Y37A 1ADBA 2B61A 4L7QA 3CV3A 4H1TA 1EKXA 1KGDA 1L5HB 2HRBA 5EXTA