1XD2A

Crystal structure of a ternary ras:sos:ras*gdp complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of autoinhibition in the ras activator son of sevenless.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-Ras-1
total genus 60
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xd2A00
3RS2A 2CBZA 3X2SA 4O2RA 2ZE6A 5CM9C 1R8QA 1GRNA 3IBGA 3MFYA 3T61A 4R7ZA 4RD2A 2ATVA 1E0KA 2VHCA 2XNDA 5DNYB 3RYTC 1E1RD 1JPJA 1SXJC 4Q03A 4DUGD 5IF9A 1EX6A 1CJVC 1T3LA 3SNHA 5F3WB 5JRZA 3QPUA 3WHLA 2F55A 1NMYA 4LYJA 4TWZA 2B8WA 3EIQA 1DAMA 4ZCIA 2Q0HA 3DZ8A 3HU3A 4V0KA 1T6NA 2GHIA 1E2MA 4B75A 3RLFA 2QMEA 2ZJ2A 4L15A 3Q5DA 1RW4A 4RD4A 4CEHB 1NVUQ 2F3RA 3AVUA 2WJHA 2O8DA 1VMAA 2P5TB 2OSBA 2RGNC 4DUGA 1EFCA 4QBGB 1E4YA 3IO5A 2DHRA 3KKOA 2GJKA 4XVQA 2YNMA 5A0FA 3TAHA 1F3OA 3TH5A 4LDJA 2VP0A 4HAYA 1XB2A 2GZAA 3MUFA 4L9WA 1SVLA 5AJYA 1II9A 2VBCA 2ZRKA 5FBVB 3WMFA 2C8VA 3AF2A 4HLDA 2BIFA 1E2NA 2ZYTX 3PUYA 4KITB 1TQ2A 3NIBA 1W4BA 4HAVA 1YRAA 4GMXA 3QXCA 2IS1A 4Q4JB 4DSUA 4Q02A 1OE0A 4BLTA 3GLIE 3CONA 3O8RA 1KO5A 2AR7A 3NBYC 3NG1A 4US2R 3UK6A 2ORIA 2QI9C 2JLYA 4QJ5A 1YR6A 1YZGA 5HKKA 3C41J 4Q1FA 5C18A 3CPEA 4DLTA 3PEWA 1KJZA 5CK5A 3BC1A 3LY5A 2XAUA 2HCBA 4CF7A 1E9RA 4AYXA 2OAQ1 2RKOA 4UNNA 4TZ6A 2VLIA 1E1QA 4W9MC 4B32A 3K09C 4DDUA 3TE6A 3OIWA 2IA5A 3AVVA 4BRUA 2AD1A 1OB5A 3CZQA 1NG1A 3C16C 1JAIA 2WKQA 2ZR0A 5JHHB 3FWYA 1U2RA 4P4UA 2CLSA 1M7GA 2QGNA 5JHGB 1FUUA 3JZAA 5L3VA 1OXTA 3UANA 2K5UA 4LGMA 1Z0FA 1GRQA 1ZM9A 4PSKA 2CDNA 2CNWA 2CE2X 4PC3A 4BWYA 2DFKB 1ZNYA 4MGYR 2RGXA 4Q7MB 4TT3D 3UWOA 1KGDA 1E94E 4ASUA 4CRWB 5K8UA 2QU8A 1W2GA 3PEVA 3T06B 3L43A 3TAUA 2Z6VA 4R9UC 1QHIA 1T4GA 4KFUA 4RD0A 5JCZA 2WPDD 2GVDC 2AFIE 1ZCAA 2B7CA 4D81A 2O8EA 3BFXA 2BM0A 3CRW1 3P27A 1TPZA 4JSTA 2QAGB 4A0GA 3OEED 1TU3A 2IK8A 1AKYA 1HT1E 1Z06A 1OJLA 2A2ZA 3TIFA 2DPXA 2VSXA 2ZRLA 1UADA 2ATXA 4MH0R 5GVRA 3WP1B 2H16A 1WCV1 1XP8A 4HEJA 4X8MA 1GKIA 3MSXA 2W2XA 4DLXA 5ELXA 5EE5B 3CBQA 3UATA 1FP7A 3RABA 2C03A 2FSHA 1E2HA 1G1MA 4MYCA 2O5VA 5EE3A 4KYUA 4FXPA 3MMPA 2PL3A 1P2SA 1HQCA 2GTPA 3K1JA 3LLUA 5LB4A 3WXMA 1OSNA 2ZRMA 1YJ5A 4F93B 4Q1AA 2WOJA 1DARA 1XX6A 2DR3A 3QEOA 4KYIB 4YDSA 3FB4A 4WAUA 5FR2A 3DZDA 5IRCD 3OF5A 1Z0DA 1N3BA 3LBHA 2BKUA 1KOFA 2ZRPA 1P2UA 1R5BA 4NZYA 2FSGA 1GFIA 2OV2A 1I4DD 1E79A 1E79D 5L3SB 4Q7JB 3VKHA 4BPBA 5J4YA 2LKCA 3SJBA 4DBLC 1MKYA 3ZZUA 3GLGA 5IT5A 3IO3A 2XOKA 4P31A 1VCOA 3U4QB 5H70A 1XF9A 4B2PA 1TF7A 2QT0A 5JJIA 1XD9A 5AUPB 2A5GA 4ILEA 4I1UA 3DDCA 2JIZD 1KDTA 3SYNA 1NMZA 4DLUA 1LY1A 1QG2A 4R71A 1NRJB 1T0JB 3I32A 4AKEA 1ZU4A 3W5JA 1R5OA 4B44A 3U60B 3TW8B 1IN5A 1R0ZA 4AIIA 1DTSA 4PSVA 1N6NA 1IQPA 4LBWA 3JVUA 4Q9HA 1VIAA 4YONB 5B30A 1EWRA 1YU9A 2DB3A 2ZI4A 4ACAA 3TLXA 1RFLA 4C0AC 5HR5A 1ELOA 1P9NA 2WV9A 1MABA 2CEAA 3QBVA 4TTQA 3AGPA 3OEHD 4OBEA 1E9FA 3R8CA 4F92B 2J9RA 3SS8A 2JATA 1KO7A 3K70D 1C9KA 4A36A 3C5CA 4HZUA 1TF2A 2KBEA 3B1ZA 3KKMA 1GNPA 3B1YA 4DDTA 4Y0VA 4L4UA 2DWQA 2ZPTX 4JL6A 1P75A 4LUCA 2D7CA 3OHMA 3GLGE 3VR1A 2DBYA 3MRSA 2NO1A 3TVTA 3GD7A 4P32A 1S8FA 1XTKA 5CYOA 1IY2A 4LHXA 4OK5A 3ZD6A 1X8LA 4FCTA 4EAQA 1ZUIA 2V6JA 1RIFA 1XEWX 3AV0B 1IN7A 1PZNA 2RGEA 1J2JA 1L8QA 4ESVA 2ZI6A 1ZYUA 2VL7A 4AI6A 4URVR 3LBNA 4OI2A 2F1HA 2HLDD 2BJWA 1FX0A 1KDOA 5CITA 3KFXA 2F1IA 3A1UA 1A2BA 1OXSC 2VHTA 3H86A 1JJVA 3AGQA 1E32A 1XD2A 1G8YA 2VF8A 1XD2B 1Z0JA 3ND8A 4G5OA 4EPVA 2I4IA 1R4AA 4NMMA 4B3GA 4QXAA 2ZE7A 1E2KA 3GFPA 1HURA 2YJTD 1F2TA 5HE9A 2Q21A 4O25A 3P20A 3BD9A 3BH7A 1TEXA 4C3ZA 4D82A 5EE9A 1NLZA 5TY0A 3ZQJA 4TLEA 3UKDA 4NYIR 2FF7A 2FV8A 1G5PA 3F0TA 1G4UR 1WF3A 3QI2A 3WNCA 4L16A 3QF4A 4AK9A 1W2HA 4BQSA 2ZXUA 1CBUA 3V00A 2BV3A 2WWFA 1W36D 4CIDA 3EPHA 4FCVA 2BMEA 2BVNA 2WWWA 4GPTA 3ZD7A 1SXJB 4Q19A 5KSPA 2XNDD 3THYB 4PANA 1ZJ6A 4QJ4A 3SOPA 4P4TA 4Z1MD 2MMGA 3PVSA 2MMCA 3BK7A 2GCNA 3QY0A 2ECKA 2FGKA 3CX7A 3WRYC 4I99A 3KJIA 4H1UA 1UBFA 1KNXA 2X2EA 3IDQA 5D3MA 1LS1A 2P6NA 1MO5A 3P1JA 2H18A 5EXSA 2D3WA 3SN6A 2IWRA 4DLZA 2ZE8A 1A1VA 1PUJA 2QN6A 4OJKA 3QF4B 2D62A 4JMPA 4N0EA 1IBRA 3T15A 3I3SR 2WBLC 4JL8A 2D2FA 1P9RA 2F43A 3IBYA 1LFDB 4GMDA 5BXQC 2QGZA 4TMVA 2ZEJA 4PO9A 3AP3A 2ZI9A 2PZGA 2PT7A 4TMXA 2OM2A 5L3QB 2J41A 3F8TA 4A1FA 4LCBA 721PA 1SQ5A 3CNOA 3F5FA 1AJEA 3A4NA 1FMLA 1X6VA 2VP4A 3PXGA 3ZS9A 4BFTA 3D8BA 5CIWA 1XU4A 2RGNA 3GFTA 4Q4AB 1GKYA 1CRQA 2XX3A 2AXNA 1FFHA 3A8TA 3FE2A 3FFBA 5EP1A 2H5EA 5EZ5A 3RRZA 1J8YF 5FL3A 4YDHB 4F4CA 4JBYA 4OJQA 1DO0A 2GZDA 4P3YA 2B6HA 2A5FA 1W49A 3NDBB 4TL8A 1XBTA 5FTJA 1OT3A 4Z8XA 4GSYA 1SVWA 1W36C 3IHLA 2C95A 3L8YA 3K09A 3ZLJA 1KSFX 1F60A 3WY9A 5KO2A 5AK0A 3K8YA 2HXYA 3U3RA 4ZI2A 2P6UA 2G1KA 1R2QA 2VSFA 2REBA 4IHQA 3CNNA 1VG9B 1FPMA 3U7FB 1GIAA 1CXZA 4CT5A 4M1YA 1OYWA 4LOAA 1GTVA 3A1WA 2CCKA 3GJ4A 4B34A 3SHWA 4ZKDA 4ZPXA 5E95A 4ZCMA 1AZTA 2EW1A 1QRAA 4DSNA 1XEXA 5KOYA 2N46A 2DWOA 3DEFA 3HP1A 5FBQB 2ZU6A 2EQBA 4NCNA 2FSIA 3GEIA 3FKSD 4OHVA 4XWOA 2BBSA 2J3EA 2QENA 1KZGB 821PA 4HUQB 4KBFA 4ZIRA 2V6IA 2GNOA 4HAUA 2OE2A 3LAWA 2IYZA 2C9YA 4YLGA 2J46A 4YC7A 2BBWA 1GRRA 3KZ1E 4A8JB 1Q57A 4PAMA 3W8NA 1JR6A 5FOVA 4QFMA 5J4HA 1KI7A 1MO6A 2FE4A 4HUTA 5LD2B 4C0KA 1RVDA 4ACBA 1E0AA 4Q4JA 5IHPA 2ZRDA 1Z6TA 3BH0A 4F38A 1LW7A 2J87A 5FPTA 2W2TA 3WBJA 2ZI7A 2YHSA 2W6IA 3REFA 4DEYA 4G3XA 1UFQA 1E9EA 1QHYA 3EZ2A 2V3CC 1CS4C 3ADDA 1D9ZA 4YQFA 4MYHA 4QNMA 4NPHA 2WJIA 3KQNA 1G8GA 1U8ZA 2V1UA 1ZD1A 4L5BA 1Z5ZA 1W4CA 4IVRA 4XTRA 2ZM5A 2ERYA 4IXNA 1WMSA 4IDOA 2BOVA 1QG4A 1W0JD 3TUZC 3EWSA 3Q85A 1Q1BA 2REOA 4JLAA 2C5LA 4URXR 4BRWA 5TV2A 1AGRA 5GADl 1Q1QA 4FMDF 1ZW6A 4B48A 2IYVA 4JIMA 4KFTA 2G1JA 3HU1A 4IOMA 1M6NA 4N0DA 3SJAA 5A4JA 4UXJA 5FTLA 1WDTA 3EPKA 2CL0X 3AKYA 1COWA 4BLQA 4GT1A 5L8VA 621PA 1F2UB 1X3SA 2H1LA 4UNQA 2GCPA 2Q3FA 1CLUA 2W6ID 1IXSB 1VHLA 2C2HA 4IOJA 4ASUD 1N0UA 1H65A 1S0UA 4I81A 3I62A 1Z2AA 1KZ7B 2J5XA 2EFGA 3VX4A 2FNAA 4A8JC 2F9MA 4B2LA 2HT6A 2I1QA 4Q9JA 5HCNA 1FNNA 1FW6A 2PZEA 3QNUA 2CNWD 5DLQC 1UJ2A 4Q18A 4LK2A 2O8BB 4B3CA 4QM6A 3BORA 5KHOC 2ZREA 1P61B 3SYKA 1UBGA 3KKNA 4JVSB 4MKHA 4MA4A 3S1AA 1QHHB 3S1AB 4PPNA 3ZIAA 1JALA 3VR4A 2PMDA 4OQMA 2R44A 4GZMA 1UBEA 4W5JA 3ZVNA 2ZSDA 2O8BA 4XSHA 4XVUA 1M34E 3KKQA 4QM7A 3G5UA 2Q9CA 3D6TB 1P6XA 4DXAA 3B1XA 4C2TA 1E9AA 3HYRA 1NIPA 1R0XA 4IFEA 3U44B 4MKGA 2BMJA 1KI2A 4KSBA 3UMRA 2FMXA 5FBRB 2YKGA 3KKPA 3Q7QA 3ZVMA 4B47A 4FN5A 4UXIA 1DPFA 2FDCA 2Q6TA 4B43A 5DI9A 4BFWA 4UNRA 2DFNA 1V5WA 4K81B 4PHGA 4OHYA 5B2ZA 3RSOA 1N6PA 2PX3A 1XZQA 2P5SA 2VHJA 4NE2A 1G9XA 1NVVQ 3K9NA 1QHNA 3U6KA 4WXRA 4DIDA 4JLBA 3GEEA 1KTVA 3R7WA 3TJZA 4Q4AA 2JAQA 2YC2C 2RGAA 3K53A 3NC0C 4PAOA 2HF8A 2OCAA 3RC3A 3I72A 1Z83A 5CM8B 2QTHA 3RVBA 4DWJA 3I1FA 4RFSB 3MWKA 3QQ5A 4TYNA 4DCVA 1TEVA 1IXRC 1N5KA 3NEJA 3LXXA 4LYFA 4C30A 4M1TA 2JLVA 2V7QA 1IN8A 1NVXQ 1OKKA 1BMFD 1FQKA 3GPLA 2ZS8A 4HDQB 4GDFA 2W2VA 5ANRB 2WSSD 3RRNA 5AJZA 3CNLA 1DO2A 1PV4A 3O47A 3CPHA 3GQBA 2FX3A 3C8UA 1VCNA 3TUIC 4P4SA 1FL9A 5JS7A 3VR2A 1RPZA 1W0KD 1QDEA 1TUIA 1CR2A 2FGJA 2P0EA 1GNQA 3P4YA 4Q4LA 3LV8A 1PJRA 3CR8A 5J4LA 2IS4A 4H1VA 2XTNA 2EU8A 4R98A 1E0JA 2J0QA 3OIVA 4G5GA 2QTFA 3AP1A 4Y0AA 4F4JA 5LDDC 2XITA 1US8B 4TTPA 3B85A 2OCYC 4M1OA 1YQTA 2P67A 3PCRB 3BFKA 1KY2A 1DOAA 4JBXA 1T91A 1X8JA 3CKLA 1ZINA 3EZ7A 4Z8YA 4HDCA 2QEQA 5CDFE 3THOA 3NHBA 4PC7A 2WSMA 3DPUA 4LBZA 4DCSA 1RJ9B 4XJXA 1OH7A 2Z43A 4PPGA 1S9DA 2GAAA 4D6PA 2QP3A 1M8PA 1Q21A 4JJZA 4QGFA 5BWMA 3I8SA 1XCMA 4V0NA 4CDGA 2CMKA 4EKDA 2WAYA 3RWOA 4PAQA 2H8KA 1SVOA 1D2EA 3OESA 1Z22A 2JJ1D 1U9IA 2W0MA 2BBOA 1H8ED 1WQ1R 1D8TA 3I73A 4US0R 1E98A 1E2IA 1E2FA 4YMWA 4YXWA 4BGDA 4HAWA 4B3FX 4G01B 4Z51A 4HLQB 4QBIA 1W48A 2R2AA 1KI4A 2AN9A 1VTKA 2QE7A 1T3SA 4NDZA 3GLFA 4XH9B 1JECA 1NY5A 4GP6A 1SVIA 3D31A 3AM1A 1GKUB 2B21A 5TDHA 4V0MA 1HH4A 2Z83A 1KY3A 3IQXA 3EPLA 1VDZA 4M2LA 4BEBA 3THWB 1IY1A 2HYDA 3CRQA 2VYFA 2J0UA 2CCJA 3KJHA 1NVVR 4K8OA 1ZAKA 1KI8A 1SGWA 1T3HA 3EA0A 2FPMA 4TL7A 1JEDA 1NKTA 1SHKA 4Q66C 5EZ6B 4LBVA 1II8B 1N0VC 1XFAA 5FPYA 2ZSFA 1II8A 3EWAA 1FMJA 1KK2A 5IDVA 3RS3A 4A4DA 2QQEA 4MRPA 2IYTA 3WYGA 1KO4A 1CEEA 4C2UA 3TQCA 4FINA 3L0PA 1GNRA 4A2PA 1U99A 4DCTA 4QJ3A 3R7WB 3T1TA 2GXQA 2NO7A 3R9IA 3ADBA 1SKYB 4NP6A 4FWTA 2O8CB 3DM5A 4C0SA 4CEJA 4G5RA 3GLFB 2NTYC 3B5JA 3W6NA 1DAKA 4URZR 4BLOA 4DLWA 4IDNA 2V7QD 1O87A 2D06A 2GBLC 3IIJA 4C0BA 2JLQA 1Q3HA 1T0HB 3BAFA 4TN1A 5DH9A 1OIVA 3EIHA 1XMSA 3E70C 5JZVA 1N6LA 3EZ6A 1NY6A 1P72A 2WAXA 2J1LA 3B2EA 2WJGA 1CTQA 3X1WA 2V4ZA 1E69A 1K5GA 2CLDX 4KFSA 3SYLA 3SZRA 2BM1A 2IUTA 4AURA 4DCNA 4U00A 2JDIA 4YMVA 1G8PA 1NMXA 2CL6X 2C77A 3AKEA 3WMEA 4MYUA 2PT5A 5FOXA 2Q9AA 2GJSA 2IYSA 3H4MA 3V4FA 1AZSC 3U7HB 3G82C 4I1VA 4PZYA 4V0LA 2WMNB 2HXSA 3TQFA 3GEHA 2WZQA 4OK3A 4CZ2A 3GLIA 2ZANA 1RRFA 3IILA 2A5DA 5GVSA 2A9KA 1EG7A 4RVCA 4PPQA 3IIMA 2C96A 1G17A 3HR8A 2V1XA 5SZIA 2L0XA 4XVRA 1M7BA 4EJSA 2JCSA 3KDSE 4KBGA 2G77B 2DWPA 4C0QC 2OILA 4IDQA 3K70B 4TYWA 2CJWA 3RAPR 5KTYA 4D0NA 3RS4A 1EGAA 1YZTA 3DL0A 4BZXA 1AA9A 1Z8FA 3MGCA 5AJVB 4BZPA 2A5JA 2ZSAA 5JJKA 1WBDA 4B6FA 121PA 2H17A 2G88A 4JBWA 1W1WA 3T34A 3DKPA 1E9BA 3L2OB 3K9HA 3TK1A 3I61A 4D4LA 3L0SA 1KI3A 3VHLB 4HLUA 3VAAA 3NTUA 4HATA 1AQYA 3NHAA 1G5RA 3OE7D 2XEXA 4DLVA 8OHMA 4IEIA 3T5GA 1G5TA 3LFUA 3E2IA 4B35A 1ZM2A 4M0LA 1GSIA 3KXIA 5CDFA 2O8DB 4U02A 4BLPA 1W36B 2CL7X 2ZJOA 3U3MA 2WWHA 3A1SA 3KX2A 1VG8A 2ZITA 4DT1A 3E5HA 4QL3A 2A78A 3LLMA 1W4AA 1VIYA 1SXJD 2J0VA 1YE8A 2VPPA 2FFHA 2X19A 3FHCB 3QKTA 2ZROA 1Q22A 3CIOA 4DCUA 1NG9A 4RKEA 3T12A 3FVQA 1XTSA 3AF3A 1LS6A 4IXMA 4BZQA 2Z4RA 3SJCA 1ESNA 4PO1A 1NJGA 3CUEF 4QHYA 2ZI3A 5HTKA 5JECA 4TMWA 3PITA 3LD9A 4KV9A 1E3MA 2GWHA 4EPYA 3SQXA 1GZSA 2XSZD 2ZRCA 2ONJA 1J70A 4PC6A 4WBSA 4PQFA 3LX8A 1FP6A 3THYA 4BASA 4LWZA 2P6RA 2GXSA 4RCYA 4BLSA 5KUTA 2F9LA 1H8HD 4MRRA 1N5LA 1T5LA 4A9AA 4FMCF 1BO6A 1G291 5C4GB 5HE8A 3WMGA 1YZUA 2IW3A 4EPTA 1GITA 4OHWA 2AKYA 3CRVA 5IK2D 1P9WA 2B7BA 1IN6A 1E4VA 1CJTC 4XWAA 1XTQA 1YZQA 4M9SA 221PA 3NH9A 4DVGA 3W8RA 2XGJA 3I92A 2KE5A 2VSOA 3PFIA 3FHTA 1KO1A 2IYRA 1HE1C 1S1MA 2GF9A 3MWLA 5FPSA 1G18A 1XWIA 1KJYA 2VHQA 3C14C 4JT4A 2OFXA 1IY0A 1YR8A 4RZXA 1JAHA 1N25A 3VTKA 2X8AA 3QXSA 3AVWA 3C15C 1TADA 2DY1A 3LW7A 3IPYA 4LJ6A 5FH9A 3GLHE 4KI0A 2HT1A 5K8LA 1E9SA 1A7JA 2PEZA 3AB3A 2ZRGA 2ONKA 4M9XA 3N2EA 4DB2A 1VYTA 1ZU5A 3Q3JB 1GM5A 2B92A 3BJIC 3OIUA 1BOFA 2ORWA 5SZHB 3SDZA 1HEIA 3NEYA 5E7MA 1ONBA 1Z08A 2IEZA 3K0CA 4HZIA 5EQTA 4IVPA 4B3DA 3EZFA 3MD0A 5HCIA 1OXXK 1Z3IX 1J8MF 1ZBDA 3IEUA 3QENA 3PIRA 4UXHA 2BHRA 3FPAA 4MRSA 4Q9IA 1E2EA 3G0HA 3UG6A 1KKLA 3OEHA 3PR1A 1DBSA 1P7CA 1AGPA 2JJ8A 2ZIAA 4GI7A 2IYWA 5KDLA 5DN6D 3W5IA 1A82A 4F7WA 4RD3A 4GL2A 2GJ9A 4GNKA 4A92A 421PA 1YKSA 3ZGXA 4TL9A 5JI3E 1D9XA 3CR7A 4CEIA 4B3BA 2V8OA 4TLAA 2GETA 3C5HA 1J90A 2XXAB 3THXA 2KWIA 1RE0A 2NO6A 1XDBA 2EFHB 1N0WA 1BS1A 3W6PA 4H9GA 4ARZA 4D80A 2OEPA 4D26A 2F1RA 2QPOA 3SFVA 5H68A 3HR7A 1Q12A 2R9VA 3V9PA 3SFZA 3VR5A 4TMTA 2EFEB 4V0OA 1C1YA 1UDWA 4E09A 3QBTA 1YZKA 3JVVA 4Q4HB 1OXUA 2NIPA 2ZVQX 2O0JA 2WOOA 4JLKA 2CVHA 4QHTA 3EW9A 2OHFA 2IS2A 1CJMA 1COWD 1RRGA 2J7PD 2YYZA 1IAQA 2ZJZA 4NU0A 1KAOA 1XEWY 3U3KA 1RRPA 3LW8A 4UNPA 3ZDQA 5TB5A 1AIPA 4PHTA 3HPQA 3NVAA 2GRJA 2NZJA 2OXRA 1LB1B 4I1SA 4CEJB 4LHWA 5CK4A 1JPNA 2N1BA 2ZVPX 3UMFA 1VKJA 3RS5A 1MR3F 4WA7A 5BN5A 3MLEA 2JGNA 1NN1A 2KB0A 4POAA 1CP2A 1ZRHA 2F7SA 2JLRA 2ZYUX 4IEEA 1Z6XA 3B1VA 1XTJA 4MKFA 5LPNA 5D3QA 3N70A 1KK0A 1F6BA 3A1VA 5L3RA 1OPXA 2XZPA 3ZH9B 2OZEA 3UG7A 4TSFA 4LPSA 4RZUA 4UJ5A 1E2JA 1O3YA 5FUVA 1T9HA 5KNDA 4M4SA 2EFDB 1B23P 3KUCA 2ZR7A 1MOZA 5HZHA 4B33A 3DM9B 2ODWA 1XMVA 1DVRA 5CJ2A 1D6JA 5CB6A 2H57A 1QHGA 1W44A 2VF7A 3AP2A 3SC3A 2RCNA 2EWWA 3AF0A 3TUJC 2NMVA 1OV4A 3EA5A 3H2YA 2Z5FA 1W46A 2R6CA 1N6RA 3IHWA 5AUQA 1LTQA 5E7JA 2JJ2D 4II7A 3VX3A 1AS0A 1MH1A 4CW7A 1ESMA 4AYWA 3FGNA 4IW3B 4TYQA 2VA8A 1K8RA 1ZUNB 3LVRE 3Q5EA 2PX0A 2O0KA 3GJ6A 1EFRA 1NLFA 2FEOA 1LF5A 4NCIA 1NNEA 5KDDA 5KNBA 4ON9A 5DHAA 2GVZC 1IM2A 2X1VA 2ZRHA 4JLPA 4PPFA 2FFQA 4DDVA 1SZPA 2DYKA 2IL1A 1ZIPA 5DYIA 5BYKA 2NPIA 2FWRA 4IKEA 1RRCA 4RZ3A 5EP2A 2R8RA 4XSGA 1TF5A 1UPTA 2ANCA 2VP2A 3SJZA 1CKEA 4TTRA 1Y63A 3QG1A 3ZQ6A 3QXJA 2GKSA 2WVJA 1V43A 3AF4A 3QKRA 1EFRD 2FEMA 4TMKA 2JIZA 3P4XA 2FPLA 2OCBA 1F2TB 2IYUA 1QF9A 2D74A 4MRVA 3WNBA 1SVSA 2X2FA 5HZKA 1US8A 1OH6A 4W5WA 4YMSA 3RRMA 3EAQA 4QGAA 2FFAA 1P2VA 2G6BA 4EPWA 1YVDA 4WZAE 3FDIA 4JVMA 1XPRA 3A6PC 4OYHA 4EFLA 1KMHA 4NCHA 1S96A 2IS6A 2R6FA 4XD7D 2MSEB 1NIJA 2FZLA 5UKDA 2WWIA 1NJFA 2ZUDA 3PUVA 4Q48A 5B57C 3MAAC 5C1BA 4OQNA 2HUPA 5H8WA 1FX0B 4EQ6B 1GOTA 1PLJA 1TQ6A 3WYAA 4IVQA 1GL7A 1AK2A 1JR3A 1JEEA 3OAAD 4BEJA 4PFSA 1EXMA 4TQUS 4FD2A 2NQ2C 2ZTSA 2QUZA 3UIEA 1U0HC 3QKRB 5KNCA 2EYQA 3T1VA 1Z6GA 1KO8A 3RDPA 3FMFA 1HE8B 4LHYA 2GBLA 1RZ3A 4A6PA 4Q5IA 3KXLA 2AK2A 1GUAA 3U6BA 3QEJA 2HEIA 3PG5A 5FL7A 4LRWA 3BFVA 5FI1B 1SKYE 4Q1CA 4MDEA 2ZSEA 2OAP1 4I1OA 3EIEA 3QPVA 4JSYA 4WZ6A 3VR3A 1NN3A 4JLOA 2VHUA 1UKYA 4Q21A 1ZM3A 3EC2A 3MCAA 1KI6B 3UWKA 4BFXA 4FMDB 3V4RA 3REGA 4QG7A 3EC1A 1UKZA 1SXJE 1Z0KA 3LNCA 1G4AE 1UKEA 2Z4SA 4JLNA 3AQ4A 3U3JA 1LVGA 1UAAA 1HV8A 2H92A 5EXXA 4L8GA 1BKDR 3TW4A 1IXZA 3Q9LA 2OUKA 1W5SA 3LX5A 5CLQA 5EUMA 4ZI3A 2CVFA 5A5GA 4B73A 1E2QA 2BKEA 3ZZTA 2ZJ5A 5CYPA 3RRYA 4KAXA 5EXPA 5F9HA 1NL3A 3OFND 4LSGA 1IOZA 4BUJA 4N1AA 1Z2CA 2VEDA 1I4LD 1VG0B 2FSFA 2QSZA 4B2IA 3BE4A 1NLYA 3GMTA 4OHXA 3SBDA 3UPUA 3DOFA 1U0JA 3L82B 4AKHA 2O8EB 3QKSA 4OKSA 3MWYW 3CM0A 1XRJA 4XOIA 5KPDA 1CIPA 1DG3A 3WHKA 1L4UA 4PC1A 4JZKA 2GCOA 4PHHA 2CCGA 1JR3D 3NC1C 1JR3E 1DAFA 2FFBA 3LH5A 5FPHA 1TTTA 2IYYA 4V03A 5JEEA 3Q8XB 2A7QA 2QPTA 3MG9A 3KJGA 4D2IA 3GFOA 2PJZA 3AUXA 1VYVA 2XOKD 5G40A 4PO8A 4UNSA 3ZJYA 4KO8A 2JLWA 1MRSA 1NBME 1FNMA 1KDRA 1NBMD 2ZRBA 4P33A 3EG5A 4JKYA 4GRAA 5M04A 1QBKC 4C0LA 4W5HA 3VKGA 4PX9A 4XIGS 3DO6A 4AC9A 4GBMA 3PQCA 4B71A 2QROA 3DVLA 4IDHA 1JXMA 4GFDA 1QVAA 2KJQA 2EWVA 1NF3A 3KQLA 3K70C 1WE2A 1R10A 2F43B 2WWGA 2QZ4A 2J59A 4OQXA 4AD8A 3U4QA 1CU1A 1KDPA 1OF1A 3FKQA 2HYIC 2RGDA 5FOUA 4N3NA 5KPJA 1GAJA 3FHOA 1XJCA 2W83A 4RSGA 2ERXA 3PJRA 5F98A 3X1YA 1L2TA 2IX3A 3ICEA 4Q00A 2QMHA 2AL7A 4GP7A 4MUAA 2VP5A 4C9BA 1JQLB 2XNSA 4M1MA 1TX4B 4M53A 4I4LA 4JJKA 2NPFA 1XJ0A 4ZIRB 2YWGA 1P60A 4IOLA 4WW0A 1SVKA 2BBTA 4Q1BA 4MYTA 2E87A 1K5DA 1FTNA 4PZLA 1DAIA 1KYIA 1Q3TA 1JQJC 4C7OA 1G41A 1OW3B 1NSFA 2ZYWX 2BC9A 1R0YA 3U3OA 3CF0A 5J47A 2RAPA 2NGRA 5LD2C 1UF9A 2DFTA 3B8HA 1R0WA 3LQRA 1T8UA 4IJMA 2IHBA 4Z1MA 1RYFA 1E9CA 2QTVB 3FMOB 3JZMA 3KTAA 4Q47A 3AVTA 3B6EA 1XPOA 3NDPA 1W0KA 1Z07A 4NL4H 2XJ4A 4KU4A 1GL9B 3BRWD 2VRWA 1EK0A 3DOEA 1NBMA 3FFAA 3TSOA 3EZ9A 5J4VA 1NN0A 3QE0A 3CX6A 3VU9B 4ARZB 3AF1A 2WJVA 3CLVA 2ASEA 4G1UC 3IPXA 3SBEA 2QORA 4WOPA 2PCJA 2QPAA 4C0HA 3AUYA 3EX7C 1G3MA 3A36A 2LKDA 3P32A 4LJAA 2PBRA 1S2MA 1H8EA 2IBMA 4RKFA 3BERA 5DISB 5FOTA 2G3YA 1GG2A 2N42A 2HLDA 2WIBA 4E5UA 4MDFA 2ZS9A 2ZJBA 4DRZA 5JSZB 1E6CA 2ZAOA 1KKMA 3GP8A 4WVFA 4D0GA 1BH2A 1MO4A 1T8TA 4D25A 2RB4A 1XPUA 2QP4A 5JWHA 2R6DA 3CH4B 5JJLA 2OG2A 1AS2A 1FZQA 1J99A 4ZDKA 1YRBA 3CO5A 1CJUC 3U7EB 3VHXA 4TYPA 1ZNWA 2R6GA 1HA3A 1DAEA 1I2MA 2BMDA 1OH8A 1I4TD 1M7HA 2YOHA 4OL0A 4A0FA 4BLRA 2QMUA 2JLZA 5FFMA 1AS3A 3AH8A 4AY2A 4RD6A 4MUBA 2J7KA 3QVUA 2BJVA 1E9DA 1N2CE 4FW9A 5D3MB 3RC8A 1PLKA 3C7KA 2OLKA 2ZU0C 1L7VC 1HY3A 2ODNA 3B78A 5FTMA 1U98A 3H1TA 4MGIR 2IXEA 3EXAA 3QF7A 4O2LA 4QBFA 1KJWA 2QAGC 2DCUA 1M1YE 2YWHA 5KDOA 1MRNA 1TL7C 5FL7D 3QKSB 3TSWA 2E1RA 2IHYA 1VPLA 1G16A 3DKVA 2R65A 2JA1A 2G0TA 1Y3AA 2XTMA 5J4KA 5JEDA 1W7AA 2MSDB 2NZ8A 2IXGA 3SHFA 1Q1EA 1KSHA 3PUZA 5GJVC 3H84A 1Z0AA 4D4MA 2NOAA 3D3QA 3KXKA 5G3YA 2HF9A 4FMCB 5FI0B 2YOFA 5G3ZA 2CXXA 2JASA 1JBKA 2REXB 3K9LA 4KVAA 4AYTA 3TBKA 1P5ZB 2ZR9A 2GZHA 2UVQA 1U0LA 1II0A 2CJWB 4BFUA 4BFVA 4DLRA 3HJNA 3NKVA 4DKXA 1D5CA 1JXOA 2W0SA 1ODFA 2C04A 3A58B 5BW8A 2WJJA 4LHVA 1EESA 3LRPA 2GEUA 2C9CA 5EJEA 4CGZA 2QQ0A 4LJ9A 2QAJA 2KBFA 1JI0A 4EIWA 4URYR 3HPRA 4PSAA 5DI3A 1MT0A 5BYJA 2AWOA 4NH0A 4GOXA 4AKIA 5GJCA 2QL6A 4J0QA 4PTLA 4QRHA 4DT1B 2QA5A 2EVWX 1HYQA 1S3SA 3NBXX 3UXMA 3TKLA 2JEOA 1W0JA 2GJAA 2ZYVX 4MITA 1YZLA 3TR5A 4UQOA 3A37A 4TYYA 1B0UA 1OHHD 3SEAA 3SI7A 4C7OB 1RJ9A 5E4FA 5CIQA 5FTKA 4Z54A 5JCPA 2D2EA 3ECCA 2LWIA 1AM4D 3K9GA 1WRBA 1MABB 1PUIA 3B9QA 3A4LA 5DN6A 5FBLB 2Q3MA 2ZRIA 1F48A 2FN4A 1RKBA 4HB2A 1G8HA 1TU4A 3DMNA 3P26A 1OIWA 3FTQA 4JKIA 3KUDA 3BOSA 4O0MA 5DYGA 1X1SA 3AKDA 1XMIA 4CT4B 3I4LA 4JVLA 1G8FA 3MJHA 1D2MA 1YHNA 5TXGA 1KMHB 3QG5A 3BB1A 4BE7B 4PQRA 4X8HA 4EFMA 1ZM7A 3CX8A 2AFHE 4ZKEA 2QT1A 4LV8B 4BFSA 1IJFA 4EJSC 1UEIA 4QGHA 3ADKA 1D2NA 4QNRA 3B13B 2PLFA 2ORVA 2VO1A 3W90A 3KTAB 1QHSA 1DELA 1XCPA 5SZJA 3TRFA 1HTWA 1OH5A 3AVYA 5FOSA 4ABYA 2WSSA 1PLLA 4R2HA 3Q72A 2PJRA 4K46A 1WB9A 1Z6YA 2W6JA 2X77A 1HUQA 2OLJA 1EX7A 3BGWA 2A5YB 1LV7A 3AVOA 4PXAA 3O8CA 4TSFD 1KI9A 4M9ZA 5F2EA 3O8BA 4WIAA 3ASYA 1VHTA 3U5ZB 2PMKA 2RGGA 4G5QA 1UBCA 1XEFA 3GJ5A 4M22A 3WRXC 4EQ6A 3X1XA 2GESA 2XB4A 2C98A 2QY9A 2FJUA 3SR0A 2UKDA 4HSEA 4BECA 2ZUBA 2F1JA 4NHOA 5B64A 1E2PA 3LXRA 4LJ5A 4IRUB 3IEVA 1NN5A 3TMKA 3GCGA 3EARA 2VQSA 4FCWA 4Q7KA 1XXHA 1NKSA 4LV6A 1EFHA 2FH5B 1ZIOA 4Q7LA 4WXPA 3KJEA 2QSYA 3SE0A 3HU2A 4OI1A 2ZRJA 2R6AA 4HAXA 2RHMA 4ITRC 4DDWA 1F2UA 2CK3D 4MGZR 4DZZA 4AG5A 5AUNB 1Z63A 3VFDA 2C78A 5TARA 1ETUA 2IYLD 5CJPA 1KHTA 2O8FB 4TT3A 2GK7A 3W6OA 4FMBB 2QMOA 3ASZA 3RSLA 3RWMB 1P4SA 4HDOB 4OK6A 1JB1A 1G7SA 2XZOA 2W58A 3TGPA 1ZC3A 2FG5A 4MKIA 5B58C 4YMTA 1EFTA 1FQJA 4Q01A 4U7DA 3RANA 1I2DA 1VCMA 4TZ0A 2UZIR 1XMJA 2JLXA 3H0KA 2PH1A 2WM9B 1BMFA 4QC2A 5FUXA 3TNFA 1XTIA 4DB4A 2WHXA 1TNDA 3GJ3A 2GCOB 3HWSA 1E96A 2WWYA 2QAGA 4RZ2A 1QZXA 2OFOA 3OAAA 5CB8A 3PV0A 1G3IA 1U9IC 1U8AA 3FMIA 3MJRA 2GEVA 3N2IA 1IONA 3TR0A 3AVQA 1FTSA 5HKKD 3LO5A 2I3BA 1A2KC 4RD1A 1KK1A 2NO0A 1Z6AA 2RMKA 3IGFA 2XJ9A 5AJWA 5BN3A 4IDPA 3SQWA 3I8XA 4KODA 4AKGA 3W34A 2BEJA 2OT3B 3Q7PA 2EYUA 1G19A 2RGCA 5F9FA 2P2LA 4HLUC 3W3AA 4MRNA 2GILA 4C4PA 4V0ME 1T5IA 3HYTA 3K0AB 5CLLA 4KXFB 4RCZA 1OXVA 3QXXA 2P65A 3CB4A 1TAGA 4FI3C 1ZMXA 1G64A 3HDTA 1DE0A 4P4SB 2NO9A 3CF2A 1XNJA 4Q9LA 3VR6A 4C0JA 1VCIA 2J45A 3LVQE 4S2EA 4M1SA 4RJLA 5P21A 3IQWA 1CJKC 2PZFA 2JLUA 1VECA 3ADCA 1N5IA 1SVMA 2FA9A 2WKPA 4NYMR 4KLNA 4QKQA 2CHVA 3M4YA 4LX0A 2F6RA 2HDNB 2IUUA 1P73A 5AR1A 2ZUCA 3U44A 1OB2A 4B74A 2Q9BA 4HB4A 4TL6A 4ZV4A 4LBYA 4BFYA 2GXAA 4TQ9A 1G21E 2YVUA 4M1KA 1CULC 2PEYA 1E2LA 3OEEA 3NBZC 4LHZA 4OQLA 3VMFA 3LWNA 5L3SA 5KSYA 2G9NA 3B60A 2WIAA 1R7RA 2OFWA 3GLHB 3ZIAD 1TMKA 2YV5A 2HJGA 1N6KA 5AJXA 1ZUHA 2OBMA 4NONA 2RHDA 4M1WA 3WYFA 2ZSBA 1E1RA 1AN0A 3NBFA 3PEUA 1ZC4A 2IF0A 4A8JA 1IHUA 4KCGA 3CWZA 4DJTA 5LB2A 1P3JA 3QOFA 5JI2E 5J5CA 2W00A 3GJ7A 2WTUA 1KI1A 2B8TA 2P3SA 3BBPA 1XEXB 3U2QA 1W47A 2RH5A 3FKSA 1Q44A 4NYJR 4M9QA 4A15A 4JYBA 2KSQA 3KB1A 4NYIQ 1IN4A 2G0NA 2IT1A 3OIYA 4NKRA 3OE7A 4LJ7A 4M8NE 5EP4A 4CEHA 4WZBE 4A0RA 2WMOB 1QHXA 2FOLA 3BB3A 3NH6A 2YINC 1OFUX 3TSZA 1XXHB 1IJEA 1NP6A 1ZD9A 3WBKA 3FMPB 3K0CC 3K0FB 4W7SA 2WWXA 3AKCA 3AEZA 4KSCA 1XTRA 2V9PA 4KHZA 2QG6A 2OESA 2H7VA 4F4IA 2DFLA 2O52A 2QRZA 4O3MA 3D7MA 2HJVA 3K0FA 4A2QA 1WBBA 3B7GA 5DE3A 1W4RA 5DSZA 2ANBA 5FBWB 3X1ZA 1ZVQA 1NI3A 5H1YA 4DSTA 4CVNA 3LBIA 3GJ8A 1XCGB 4US1R 3K0SA 4MQBA 4GOJA 3WP0A 2GJ8A 3CRRA 3CWQA 4JLDA 1Z28A 3O8DA 4R2IA 4EUNA 3BS4A 2IXFA 3TVDA 2GA8A 1R6BX 5FUYA 1LNZA 1UEJA 1OFHA 5E7IA 3FOZA 3A1TA 2D7DA 2HCJB 5G53C 1G6HA 4HI0E 4PC2A 2IC5A 1H8HA 4XWKA 2ZI5A 3QVVA 5JSZA 1M2OB 1N6OA 3B1WA 2EFCB 1N6HA 4ZDIA 3KFVA 4MGKR 2G83A 3R9XA 1QHHA 3AVPA 2GEDA 3PUXA 4LZZA 4JLJA 1UDXA 4EJSB 3OZXA 1C4OA 1HQYE 4KFRA 1AKEA 1QVRA 2XSZA 1HT2E 4LJ4A 3EASA 1W5TA 2AWNA 3BXZA 1GWNA 5FTNA 3VNVA 1E99A 1KAGA 3W9YA 3GJ0A 2BCGY 2IYQA 1G20E 1DAHA 1SXJA 2BMFA 3IIKA 1GVNB 4KVGA 1A5TA 5FPKA 5JRJA 5DGXA 3PEYA 1S3GA 5LBIA 1E0SA 2OBLA 4QGGA 3KQUA 4FIDA 1VG1A 1PVOA 2GXUA 3T1OA 3UMSA 3M1IA 3ZYCA 2F3TA 1ZM4A 5SZKB 2GAOA 3W3ZB 3VQTA 5KSZA 3QIAA 3MWJA 2YOGA 2AD5A 1Q20A 2A3RA 3I5YA 2J0SA 1KSGA 5C2JB 3GLFE 1XXHE 2JLSA 4L9SA 1JJ7A 3BWDD 2QE7D 1XJQA 1NVWQ 4FWIB 1G7RA 3THXB 1UKVY 1S4QA 1R5NA 4B76A 2V54A 1UM8A 2CLCX 3CH5A 4CEIB 3NWJA 3X1DA 1N5JA 2QP9X 2VTKA 1YR7A 5IK2A 4EFNA 2CHGA 2VH5R 3DMDA 3QXHA 4Q9KA 1CRPA 4JS0A 4B6EA 3FYHA 4V02A 2QBYB 4PQYA 2ZJ8A 3LDAA 3RHFA 2NG1A 4NTZA 2J7PA 4DHEA 3R8FA 1WXQA 2IUSA 1L4YA 4HLCA 5FOWA 3BIFA 3A4MA 4UJ3A 1CF4A 1KSJA 3EPJA 4Q1DA 1AQUA 1U81A 3IUYA 2FPKA 4KJZA 3T1QA 3KQKA 1XD8A 2QBYA 4ZO4A 3ZVLA 4LV5B 1ZNZA 3IKJA 2ODEA 3QJYA 3T5DA 5DHFA 2PCLA 6Q21A 3U7GA 2PLRA 2ZE5A 5EE0A 1TQDA 4D4KA 4GZLA 5EXTA 2C99A 4PZZA 1LF0A 2A30A 1J7KA 3CPJB 4PR0A 5BQ5A 4JVNA 1ZNXA 4HUQA 3ND9A 2E9SA 4QOSA 5EP3A 2OO7A 4NCJA 4JL5A 4X8OA 3VKWA 4LJ8A 2YZ2A 3WNDA 1RYHA 4F91B 5L3QA 4E07A 1TQ4A 4EPRA 1Q1ZA 3BH6A 1X86B 3DHWC 1ANKA 2AHOA 2OXCA 4X8LA 2ZRAA 4DIEA 2AKAB 3M6AA 2AXPA 5DIFA 4AWXA 4P0TA 5AUOB 1K6MA 5DO9A 521PA 1ZD8A 2R62A 4LC0A 2IF2A 1Z47A 3C4JA 4Q1EA 3ZVRA 1OLOA 3AVXA 2WICA 1GILA 2YWEA 4JT2A 4A0HA 2QM7A 2BEKA 2RGBA 2BCJQ 1F5NA 2VP6A 1DADA 4LYAA 1E1QD 2AK3A 3L8ZA 3I5XA 1OFIA 2LCFA 4ERNA 5KU1A 2WJYA 2GK6A 1BYUA 2IEYA 5FR1A 1OYYA 2VP9A 4U5XA 5JMTA 4URWR 3QUSA 4E22A 1FOEB 2ZQ5A 4HZUB 4YMUA 4RFVA 1KMQA 3THWA 5KSOA 1X8KA 1R8SA 4HAZA 1P62B 3L0IB 2QRNA 3L0OA 4GOKA 4ESHA 4ZDJA 5K8TA 2CK3A 2YWFA 4DSOA 1GP2A 1Z0IA 2ZRNA 1WA5A 3U61B 3M0EA 3QSYA 5E3HA 2KI5A 2ZAMA 1EWQA 2ODBA 4LI0A 1E2GA 3PUWA 4G5SA 1CR4A 2CHQA 2ZS7A 3VU9A 5JS8A 4G0NA 4JLMA 3VNUA 3R9WA 1ZCBA 1ZP6A 2ZJAA 3KB2A 3T35A 4A82A 2XZLA 4NBSA 2IWHA 5EUQB 1SHZA 2JDID 1GDDA 1YR9A 1OFTA 1SKQA 4Q4HA 2O8FA 4QHSA 4IOKA 4DC9A 4YXWD 5GJBA 3KL4A 1S9HA 1U8YA 4RY2A 5GJWC 4AG6A 4HB0A 1JNYA 3ICQB 5JFGA 3ZS8A 4JLVA 2Y8EA 3LQQA 2QNRA 3ZZ0A 1KIMA 5BN4A 2J0UB 4M21A 2FZ4A 4LYHA 2Q3HA 2ZJYA 3GJXC 2D4HA 2GDJA 2W6JD 3CRMA 4DLSA 1BIFA 1YZNA 2ZETA 2Z0MA 1DAGA 3N5CA 5JWOA 1NSTA 5AWFC 2MSCB 1X1RA 4HYYA 2O8CA 1EFUA 1KNQA 3OFNA 1M74A 4LJYA 2O0HA 2WPDA 4EPXA 4QBHA 3QPWA 4RFSA 1XZPA 3BB4A 4OI4A 5FUWA 3RS0A 1N6IA 4UKDA 4EDHA 3SU8A 1DS6A 4A6XA 4LC1A 1FUKA 3LA6A 1KI6A 4NCKA 4LPKA 1CR0A 4IFBA 5EE1A 4JYCA 4NYMQ 2AX4A 3J81k 4OI0A 2JJ2A 4TLBA 1Z29A 5K8IA 2SHKA 4XTCS 3CZPA 2V55B 4OQFA 4TLDA 3RNLA 1P2TA 3F3YA 3KQHA 1RC8A 3GLIB 1SULA 1BYIA 3K0EA 2OCPA 1Q0UA 3PENA 5JWRA 2YC4C 4HB3A 4URUR 1OIXA 1DG1G 2VIIA 3GLGB 1E2DA 3CW2A 2QM8A 3B82A 1G6OA 1U94A 1VYUA 2BWJA 5C46F 4BFZA 1CR1A 4ZDWA 4CYMA 1OKKD 3E1SA 4TQAA 2OBNA 1KK3A 1OHHA 3R20A 3QKUA 2WKRA 2FU5C 5TVKA 5DI3B 5KYKA 2XB2A 3ONWA 2ZRFA 2TMKA 4DLYA 1S1CA 1MO3A 4ZCLA 5J40A 2JJ1A 1TUEA 4KLZA 1A4RA 3B9PA 2XXAA 2BDTA 4B3XA 3K0AA 2UZ3A 4A2WA 1G3RA 3ETLA 2CE7A 1G3UA 2I1VB 2IYXA 4XD7A 1U90A 2HV8A 3CF6R 3GLHA 4PHFA 5C4MA 5JBQA 4D0LB 1G7CA 5TMPA 4S35A 3NXSA 4NYJQ 4OHZA 2GF0A 2XTZA 1DEKA 4E03A 5JLJA 2C9OA 1WP9A 4TMZA 3RS7A 1G7TA 1MV5A 4LY6A 4TLCA 5HPYB 5G41A 4DEXA 4D4JA 1G3QA 1GL6A
chains in the Genus database with same CATH superfamily
3ZHVA 3BTSA 3EE6A 1L7AA 2DHEA 2XAAA 4NZNA 5ER9A 1USGA 2H7XA 1R8QA 1GRNA 3IBGA 2BFCA 4U9IS 5CM9C 4YQEA 3T61A 4S1VA 1M6HA 1RKUA 2HRDA 2XXJA 5DNYB 4LMPA 4EJ0A 4Q03A 4BKOA 3MWEB 1ST3A 4DUGD 3SIXA 4EATA 2I7TA 4WXMA 1ZJYA 2AYZA 1T3LA 5TE9A 3ANMA 1B0PA 4MHOA 3IAUA 1T2VA 5JRZA 3HWRA 3PB3A 2EJVA 1ZJ4A 4N49A 4XGQA 2PA3A 4WLUA 3RFFA 1DAMA 1C3XA 2A35A 2PIAA 2AG5A 3HU3A 3Q2IA 5IJZA 1EP2B 1HKHA 1T6NA 2WLTA 2VG8A 1E2MA 3FCXA 3JQDA 4MR8A 3C6YA 2ODTX 2PQ0A 4LYYA 4QOGA 3WLOA 4CQMD 5JY6A 2JGRA 3DP9A 5CGZA 4RD4A 1U65A 1DIGA 3HN2A 3B36A 3WWOA 1O6FA 3DBHB 2G63A 3UW1A 2GVNA 5ERYA 4DQ0A 2CVOA 4OVKA 3I3OA 1AURA 2GAFA 3KKOA 3Q6IA 1ZEMA 4OGLA 1UAYA 1XKQA 1NVTA 1MOSA 2QYSA 2X9LA 1ZH4A 2XNJA 3L7DA 4P4GA 1I36A 4ZZ2A 4YLYA 3CCCA 4J1TC 4TOIA 3TH5A 1E5QA 3HZRA 1HG1A 1M2GA 1X38A 4HAYA 2PO7A 2C88A 4L9WA 2FQYA 4WEQA 5FQNA 3L84A 4IFTA 1II9A 4GNRA 3UY4A 3K9FC 1VMKA 5HS6A 1R0LA 4N6OA 1J8VA 4F84A 5JD6A 1PD0A 2C8VA 2BIFA 3M2PA 3PUYA 2GX6A 3T3OA 1VA5A 4HAVA 5JSKA 1I10A 3GWZA 4Y6SA 3VDMA 4GMXA 1QYCA 3QXCA 4PS1A 2GMWA 4PSUA 5J2TF 1VHJA 3QJGA 1T35A 4XQ0A 1KO5A 2JGDA 2LZ0A 4TS1A 3FYCA 1PG0A 4L5JA 4ZJUA 1KFJB 1OZHA 1W2WB 3HCBA 1KH1A 3K5WA 3UK6A 4LDAA 2BFEA 3E03A 2QI9C 3QU2A 4RTOA 1E7SA 3H1AA 1YR6A 4JUFA 5HKKA 4Q1FA 3ZHTA 3NDJA 5DTRA 3RVJA 3C6BA 3CPEA 4NPCA 3IA2A 4ZCRA 1GLNA 1C1HA 2HCBA 2QLFA 4AZ3B 4EJ6A 1WKVA 4AYXA 3KDPA 2OAQ1 3GT7A 4K6GA 3OIFA 1QX4A 2CN1A 3SS7X 3WRYA 4EEXA 2VLIA 1MDBA 1VPTA 5BMVF 1O08A 1VE9A 4WLNA 3S2UA 1JV2B 2NQTA 3VRHA 3DL4A 5A0TA 2AQHA 3DXFA 1KZ4A 3OIWA 4G5YA 3AVVA 2FWJA 4A23A 2AZ4A 1LSOA 2AG0A 4R01A 3VPFA 4H7FA 5LNK6 1W4ZA 3CZQA 3ITNA 4AN0A 1N2CB 4C4XA 2PUCA 3DF9A 3C8ZA 4GPD1 1AMNA 1W73A 3IPRA 3LCUA 3HUFA 2DT5A 3FWYA 3GEGA 4HLNA 5ALRA 2CLOB 5K3EA 2CLSA 1Y6JA 4RS4A 4ECEA 1SY7A 2FRXA 1NVGA 2BFBA 2QGNA 3EVNA 3JZAA 4INOA 1XAHA 4O2AB 3UANA 3ZWPA 2K5UA 1ZIYA 1ZM9A 3QPAA 4FFBA 2O48X 4KYTA 4PZAA 3LS2A 2CE2X 1K63A 2OCDA 3L46A 3K72B 4MGYR 4Q7MB 4QPJC 5DZSA 1KGDA 3BJRA 1S01A 1W59A 1E94E 2EBUA 2VQ6A 5DGCA 4KFCA 4ASUA 4MNTA 4ROSA 2QU8A 3B7WA 3LUFA 5K0CA 5K8UA 3GVPA 5AKGA 2X5NA 1USUA 2DQYA 3PHBE 4YV1A 3L43A 3W1VA 3VPGA 2Z6VA 1GUDA 4BJ5A 3P97A 2ODAA 4HBGA 4RD0A 1T3ZA 4B40A 3VM6A 4DIKA 1JU3A 1TK2A 1H3EA 2CHUA 1NT2A 3E9RA 4NV3A 4DNQA 1MJ5A 3P27A 3B38A 4I1RA 1TPZA 4I55A 2LD4A 5C80A 1N5OX 4C6SA 4LJKA 1Y1LA 3TIFA 2IGTA 2ATXA 4MH0R 4OB7A 5BN4B 2H16A 1HG0A 2ZIEA 4HEJA 3WP1B 5B3KA 4X8MA 4MIYA 1OY1A 2IU0A 3KFLA 2ST1A 4DLXA 3AEXA 4FJ0A 2XIQA 3UATA 4RH1A 1FP7A 3RABA 1RNLA 2C03A 1HK7A 2XVXA 2EOAA 1QHFA 1G1MA 3OLVA 1WMDA 3MMPA 3R0ZA 4ND1A 4QU8A 3VU1A 4UOZA 4G56A 3PPXA 2GTPA 2VSQA 3Q11A 3I2IA 1H3FA 4IZOA 1RQ2A 5LLTA 1RXCA 3IE1A 1OI3A 1WETA 2PZLA 4WZZA 5I4KA 5C5IA 5DBOA 1JHAA 4MVJA 3CJRA 3KQMA 4FYVA 1DARA 1W4LA 2HGSA 3AHFA 2VF5X 5EYPA 4WAUA 4PGHA 2HK6A 3DZDA 1ORDA 5IRCD 3PGMA 4QT4A 1FUIA 3LBHA 4OQDA 4POOA 3HJFA 2ZRPA 1MB3A 1N36B 3NRJA 1SUSA 5LA6A 2LXNA 3EOAI 4Q7EA 3VKHA 1D4AA 4BPBA 1SBTA 1E18A 3IO3A 1ZH8A 2PGLA 4P31A 4RK4A 3WBFA 2I5PO 2X5KO 4YHBA 1H4VB 1LPBB 1TF7A 1TZMA 3NOVA 2V74B 5CVTA 3FPGA 4N5IX 5JO9A 4RLQA 3OTOB 3QLVA 4EECA 4UHDA 3JATB 4RHFA 5AXBA 1ISIA 1KJ8A 4MAFA 3PK0A 3LQ2A 2PSEA 3I32A 1T0JB 4XIIA 3VC7A 2E4XA 2ENWA 1AMOA 4JR1A 1KC3A 1Y7TA 3SE7A 1EVQA 4J0JA 1IN5A 1SUCA 1X0XA 1GAWA 1PL7A 1KMMA 2VYNA 4AIIA 2JK0A 2Y1WA 5I3ZA 5BR4A 3DDOA 4LBWA 4G4JA 1ACLA 3JVUA 3RFCA 3WQBA 4P82A 3B9RA 1UBNA 2OMKA 2OQVA 5B30A 3BIXA 2F4VB 4E12A 2DB3A 3IALA 1LSUA 3QKWA 3F5SA 1X13A 1M2VA 3H1EA 1E3DA 5DKFA 1D4FA 4TTQA 5BUCA 2JKVA 2YCLA 1Z8NA 2PZ8A 4FGWA 4HADA 3TN7A 2PUDA 3VZQA 1L7NA 2J9RA 3RSGA 3SS8A 1KO7A 3GA0A 1C9KA 1I0IA 4HZUA 2NP6A 2R11A 1NXPA 1TF2A 2QTTA 3QPDA 4ETMA 4LG1A 2FMTA 1SPBS 2VCEA 3FNQA 4O4HB 3ZCQA 3AONB 3RUIA 2X0RA 5KZMB 1XCBA 1L9XA 4YCBA 3OJCA 1YFKA 2DWQA 2L17A 4JL6A 2QD3A 4CQJA 3GLGE 1NDHA 3OZ7A 3NPAA 2HD4A 5HEKA 4BLVA 1BXRB 2NO1A 4HGQA 4N6NA 1M2FA 1O9GA 2ZIVB 1XTKA 3HL4A 3N7TA 4LHXA 1SOUA 1YDEA 3VH1A 2P27A 4EAQA 4UEOA 3W2FA 3CN9A 1CE8B 1IN7A 2WUEA 5AJUA 4FFVA 1XVAA 2QF7A 3FCYA 5H59A 1TMOA 2BEVA 1SBHA 1XMPA 4XIFA 3RREA 2RGEA 5LQSA 3CSUA 3A2KA 3GJYA 3KOZA 4R31A 1D4ZA 2VL7A 2WFAA 2YXDA 3QX8A 5TF0A 2VRCA 5A4KA 2HNBA 2VAWA 3D8SA 4UE3S 4EKIA 1FX0A 3F46A 3H9QA 2JG3A 3ESRA 3KFXA 2AQKA 2YW2A 4O4IB 4WFIA 5K0EA 2QN3A 1DCKA 3GIWA 2P2SA 1H2FA 1Z0JA 4FYHA 1CZLA 5LMZA 3EGCA 1VSVA 5EMKA 2VDJA 2R0QC 2D3TA 4JUAA 5AK3A 3IIEA 5H4GA 1TYDE 3U0VA 5BVGB 5HGXA 3ZHCA 1FDOA 3GFPA 4LTNA 4NCBA 3S1SA 1SCBA 4KZPA 2CNNA 1SR8A 3K9QO 4D8XA 2P9TA 1OI4A 4DEVA 1F2TA 1DFHA 1X8XA 2WWVD 4IMPA 2JJYA 2CLKB 3P20A 2NAFA 4O25A 3TZKA 4FJ2A 5DWQA 3ZTYA 4CL0A 1R27A 3VHXB 1GG9A 2ZP1A 3ZQJA 2I0FA 3ILXA 3T3GA 3IP3A 2PMFA 4B8WA 3UKDA 2FV8A 3N5KA 3F0TA 4CTKA 3RRXA 4K9QA 1WF3A 2QDKA 4AK9A 3QF4A 5ALJA 2ZXUA 3TZ6A 2A1UA 2W2NA 2X5XA 2BV3A 3BZWA 1EIWA 2IITA 1NQUA 4N5HX 5HF9A 2BVNA 3VOTA 4MWZA 3EPHA 8AT1A 2EXXA 3R41A 2QD5A 2Z04A 1RLTA 4P92A 3TRHA 4BP8A 3THYB 1WULS 5IWAB 4D56A 4ME6A 3H2KA 4B1FA 3TDNA 4Z1MD 4AJJA 5CT5A 4GQIA 1U0OC 3A4TA 1E60A 3OU7A 3CX7A 3OC6A 4BIIA 1EAYA 1OUMA 1UXHA 3KJIA 1PD1A 4E33A 1MAUA 1V1JA 4IICA 1E3SA 1KNXA 3P9YA 5BURA 2Z2JA 2VK8A 3W6ZA 5JJBA 1LS1A 1SPXA 3PJFA 1MO5A 2QD2A 1N7HA 5H5JA 4Q24A 5KTPA 2B4KA 2NXJA 3FXAA 4F11A 1N9GA 1OOEA 2FLKA 3PR2B 2JAUA 1G55A 2D3WA 4MP8A 1QKIA 2H1SA 2ZE8A 1EGMB 1CZUA 4R9RA 5AOVA 2Q07A 3IVRA 3R3JA 2D62A 1KEPA 4N0EA 4MAMA 2AZMA 4KE7A 2HU2A 3CF4A 1L5WA 1ZHHA 1PK8A 1X39A 2ID8A 2QGZA 3L7AA 2IV3A 2PAFA 4D9NA 2OOSA 5SY4A 2FMIA 4BBAA 1LLDA 2CBXA 2ZI9A 1BWRA 4EW1A 2O8VA 5EGNA 1KL7A 1Z4QA 2PT7A 5HTOA 4M89A 3ZNNA 3FY4A 3A05A 2QHXA 4BVEA 2J41A 4O5AA 4TM8A 4A1FA 4Z4HA 3PQ4A 4LCBA 3Q3IA 1Y82A 3IBCA 5K09A 1YFJA 1I24A 4MJLA 1FMLA 1X6VA 1FJ2A 4BFTA 4DNFA 4DWOA 4CU5A 1F20A 3FLEA 5EMHA 1GKYA 4BWGA 1N78A 5KWIA 1I7LA 2C4HA 4U2GA 2NV6A 2VNAA 4O29A 5JBNA 2Q5IA 3A8TA 3OQPA 2V96A 3LLCA 5AKKA 5AHRA 5FL3A 3TD2A 3INGA 1H23A 2ZIFA 3BJEA 2OZVA 3FG9A 2Q1WA 5FTJA 2W6CX 1R9JA 1YJXA 3DMTC 2XNKA 1XP5A 4NH4A 2V58A 3FTCA 3L8YA 3P7MA 5IJXA 4DLPA 4UU1A 5L4NA 5KO2A 3QPCA 2OHOA 1VKNA 4YRMA 1N8TA 1CDZA 3K8YA 5IZCC 3UOGA 1JDBC 1BEZA 2AOTB 4OXNA 2VSFA 4MARA 1QTQA 4YMGA 3FNEA 2C7GA 1VG9B 3CNNA 3M1AA 2PS3A 3EOBI 4EY4A 4AP9A 4M1YA 4DOMA 1OYWA 1J6UA 4B3HA 4DJDC 2X7HA 2N75A 4BDSA 1XZJA 1R88A 3TQRA 3AERA 4ZKDA 4QPZA 4DMKA 5E95A 1AZTA 1A50B 2C2BA 2FPXA 1XEXA 5JVDF 1VIDA 1R0BA 2YMLA 5THXA 5KWSA 2Y1DA 4CF3A 1H6CA 4X7BA 4ZJYA 1TAQA 3HV0A 3MS4A 1XZCA 4IIHA 1ZBQA 4IX1A 4YUVA 1KZGB 1VLMA 1XDDA 2D0IA 2X0KA 2X5OA 3QITA 4QUEA 3L41A 1PHRA 4HAUA 3HBJA 3SY8A 3QVJA 2P4EA 1GQRA 1Z37A 1NVEA 2BBWA 1GRRA 2F4NA 4A8JB 1GV0A 3PC3A 2DR2A 4R41A 3W8NA 1IFXA 4ZAZA 4JX9A 5FOVA 3PA8A 1ZOOA 1KI7A 1RQPA 2OK8A 1VSBA 3R5FA 1BFKA 1M2EA 3H3JA 4HUTA 3EMDA 3RRFA 2B5WA 1DKPA 1Z6TA 1QC5B 3AUUA 4RLFA 4F38A 2X1LA 3NWPA 3ZX5A 3H16A 3AIIA 3TXAA 3BIJA 2EP7A 3BREA 5LZ5A 4EG6A 3FJYA 2HDWA 2HQSA 3I2HA 1J22A 2IELA 1TO6A 1E9EA 4J9VA 1QHYA 3EZ2A 3O2QB 1UOEA 4GSLA 1CS4C 3EULA 1VP9A 4RTLA 1PI3A 4LRYA 2IY9A 4QNMA 1O0SA 2WJIA 3L7BA 3ONFA 1E64A 3T9DA 2P9ZA 1RXUA 1SOMA 3L5OA 3LT1A 3KQNA 2CVQA 5DGHA 3BVPA 3ISJA 3KOXA 1I1QB 1Y1RA 5AW5A 3IS3A 2ZM5A 2ERYA 1BVUA 1WMSA 2QW1A 3A11A 3OCJA 4CGYA 1BDHA 4LF7B 1NULA 2D1SA 4YBZA 2IOHA 4IV0A 2O6LA 2QRLA 3VV3A 4DBZA 5A4DA 1Q1BA 3TJMA 3RK1A 2B25A 1MGOA 1VJRA 2I2AA 5DRYA 4DS3A 3ETDA 4F6RA 4URXR 4BRWA 4N3CA 2R1TB 3DXZA 4DQDA 4F2HA 3WLQA 1VE7A 2BKLA 2ZK7A 3SZOA 1VBKA 2W6OA 1DAPA 1X1BA 3M5CA 3K8OE 1M6NA 3E7DA 4M87A 4GXQA 1XHLA 3SJAA 4UXJA 2A4KA 3TRDA 1T9AA 2R6JA 1KDZA 5FTLA 3HABA 1MEOA 4KYVA 3OCCA 3BFJA 4ZREA 4BLQA 1R8YA 3GJRA 1B26A 4RGVA 3NTRA 2AFRA 4H7IA 4UNQA 2V9ZA 621PA 1JAYA 2VAPA 2YY6A 4GG1A 4D4IA 1FX1A 4NU8X 1S2OA 3KT3A 3NOOA 4IOJA 4RVFA 2Q0QA 5H3HA 1N0UA 4EW2A 4DV2B 5AVOA 3KEOA 4F60A 3EQ8A 1V39A 2EFGA 4TKZA 4RWEA 5LQCA 4RANA 1IWOA 3DZGA 1LEHA 1BWSA 1QFMA 1FLNA 2I1QA 2LIPA 5TPZD 3TBFA 5ADUS 1AMUA 5MN6A 3HA2A 1L6RA 1ZD2P 4QM6A 3O2SB 4IHKA 3H1GA 2R97A 4G0MA 4KIJA 3OZRA 4MKHA 3S1AA 4HNAB 4O5OA 3SAJA 3F6CA 2YZ7A 3CTPA 3UXYA 1JALA 4MB2A 1ZK1A 3UPDA 3I4CA 4BZZA 4FYYA 1UBEA 3ENZA 4XDGA 2ZSDA 3ZVNA 3DZHA 1JJIA 2CUZA 4FSXA 4XSHA 4FIZA 3F8WA 3HZOA 1JZSA 2Y0CA 1T0IA 1P6XA 3ZJ4A 3B1XA 4FC7A 4F96A 2PXCA 3ZIUA 5IU6A 5KYXA 3TTWA 1CF2O 1LZLA 4XX0B 1R0XA 2UYHA 2I4NA 1SUBA 4QBTA 2BMJA 3BL8A 5TRTA 6GPBA 2FMXA 4EB0A 1OTXA 3KJNA 3KKPA 4WZBB 1SOVA 1QYWA 3ZJUA 2MYNA 3NO4A 4BQPA 1Z8HA 4NBTA 5KX5F 2JBAA 3P9ZA 4B87A 1I1OA 4PFQA 2I2BA 2FDCA 2Q6TA 3GDHA 4XXHA 1SC1A 3TIGA 1A7UA 3HLKA 2KLBA 3R6DA 1EVLA 2DFNA 4OHYA 1EEXB 5DGIA 1RXYA 3OZCA 1SUAA 2CLIB 1QQTA 3AW9A 4HEHA 4HS9A 3IC5A 4TVOA 1U0BB 4YCJA 4R8KA 1G9XA 2WFLB 2LCIA 3K9NA 4I46A 1D6NA 3HDYA 4XD2A 4YO7A 4CUZA 5LP1A 1M5UA 1Y0BA 1AQ6A 3G8YA 2XMDA 2QJRA 4JLBA 4LY3A 3RB8A 4OO3A 2DWUA 3GEEA 4P2GA 1ZVVA 1YE5A 2D8MA 3WWEA 4D57A 2HJRA 3FMVA 2P5UA 3KXPA 4O1IA 2HF8A 3WC4A 2HMTA 3ZK8A 4EW6A 4RENA 4V3CA 3MWKA 1SIOA 3U7RA 1RM4A 3L7CA 1XTBA 4YMLA 3U19A 2EKPA 1PFWA 1N5KA 4FNGA 5DLDA 2J3JA 2VRBA 3NWBA 4JJ8A 3GOQA 1P5RA 4UUNA 2FR8A 4WEOA 1IN8A 2X58A 3KWJA 4U0JA 2BRUA 4PX5A 5C3MA 3GPLA 2ZS8A 2W2VA 4C01A 3IA7A 4L0QA 3HKEB 2ZT8A 5A7FA 4K9PA 4ICIA 4YUYA 2ORED 3A2LA 5FADA 1PV4A 3FPFA 1LUAA 3EMKA 1W85A 2R48A 3L49A 3K15A 2K7FA 4LOIA 3TUIC 4AJPA 5ETJA 2EBHX 2QTBA 2WPNA 4JOBA 4XWTA 3VR2A 3VVBA 1W0KD 5J9FA 1TK3A 1QOQB 4MMZB 2QTWB 2DU8A 5B7QA 2P0EA 2QPLA 3LP5A 5CA0B 4PGMA 5J4LA 3H3FA 3LDFA 4H1VA 3TLMA 1NVBA 3NUGA 4WNAB 4DL9A 3FBWA 4MUJA 4JENA 4Y0AA 3AP1A 4N3AA 2FEXA 2XITA 1XELA 1IZYA 1STOA 4RQAA 2OCYC 1XTUA 4GAEA 1OBHA 1G9TA 4F9TA 5EWLB 1A9OA 3TFWA 3JATA 4LMRA 2JW5A 1K92A 3ACBA 1KXJA 1PGOA 2QEQA 3KLNA 4HQKA 4JYZA 3TQIA 2R7NA 3RVQA 4LBZA 4K05A 4KUEA 3W8DA 4BFLA 3WK7A 5FHQA 3FSJX 4DR7B 2Z43A 2E3JA 4MQMA 2GAAA 2QP3A 2I6TA 1Q21A 3A6HA 1ZI9A 1EX1A 5AOAA 4ZZ0A 3I8SA 4X6UA 3ER6A 1XCMA 2WJWA 2ZUSA 2CKMA 3GLVA 2JEYA 3QEMA 3HA7A 4LJSA 2CV2A 1ZHOA 1BCSA 4EKDA 2VT7A 1VKZA 1DV2A 1W0CA 4ENUA 4LXHA 3OESA 1Z22A 3EQ2A 1O95D 4NPAA 4ZVVA 2BBOA 3E7FA 1CWUA 1H8ED 3I73A 4US0R 1Q5PA 3A9VA 1E2FA 1K2VN 1WXHA 3K73O 2D4AA 4HAWA 4OSOA 4RHCA 1IIBA 3EIUA 4Q15A 2XDYA 2XQIA 1TIPA 2MU1A 2R2AA 4IDEA 1QAQA 1KI4A 2H1OA 4LXYA 3AU8A 1Z7WA 1HSOA 5ALGA 1JECA 3ZCUA 2UUBB 5A4IS 1SVIA 3BMCA 1POXA 4BXOA 3SMVA 3AM1A 4L5CA 1JHDA 1GKUB 1IXKA 1T2DA 4TYMA 3WLJA 3QYFA 3CVJA 3IQXA 3VPXA 3WJAA 4DV6B 2A94A 3ROXA 2IPLA 1U9JA 1Y7IA 2VYFA 3IKVA 5E1BA 2ZUVA 3HJHA 4EO7A 4DREA 1KI8A 1Q17A 3EA0A 2HY7A 3GFFA 1NKTA 2TMDA 2BGUA 1AXGA 1T8WA 4CLOB 4M0MA 3ER8A 1L4HA 4QWMA 4A6EA 1YKFA 4FVTA 1KAMA 4GLFA 4A4DA 2CXSA 3EH2A 4WNIA 4MRPA 5AM2A 2IYTA 1TYBE 2EFJA 2YN4A 1GZ5A 4M8IA 4FINA 3L0PA 7REQB 1U31A 3B3QA 3D2AA 1J9EA 1U99A 3IDAA 4QJ3A 3T1TA 4JQSA 5KTTA 3ADBA 2NO7A 5ELLA 1JVNA 1GGNA 2OP1A 1SKYB 4CEHB 4PYIA 2C31A 1R4ZA 2PV7A 1CCWA 2JANA 5CXXA 4M1ZA 2F67A 3ZI0A 4CKEB 4QFCA 5TQ2B 2XQKA 4LXQA 4EG5A 3OCUA 4BLOA 1KEUA 4JI3B 4WOJA 3VO1A 5AI9A 1MTOA 1U8FO 2PU5A 2YXPX 5B3LA 5EJ7A 5CX1B 1ISPA 3WKEA 4BN4A 1GHTA 4RPCA 1Q3HA 1T0HB 3BAFA 4HYEA 2XMCA 4TN1A 3EIHA 3ZN2A 4EY3A 2LUOA 1N6LA 1JIXA 1O94D 3EEIA 5LDGA 3HM9A 4C1NA 1KRHA 1FRNA 1XNHA 1E69A 2CLDX 2CZCA 4KFSA 4LHSA 3UFBA 4G1FA 4AQ7A 4OJTA 2ZB4A 3SYLA 3SZRA 2IUTA 1KFKB 2B3TA 3OZUA 5EEHA 4DV5B 4YJFB 2W22A 3IKMB 5FRDA 4J16A 4GXNA 4L2IA 3WMEA 3H6HA 2JFXA 4F2GA 2R8ZA 1LDBA 4G5FA 5HK9A 4FN4A 2O3UA 4I7EA 2HXSA 5ALSA 3I30X 4PEVA 3F8SA 3GLIA 2X3UA 2NTNA 3F9IA 4J0EA 3O75A 4AX4A 4UMEA 1T1IA 2FWBA 2NW6A 4R7GA 3WK4A 5GVSA 2HFJA 1EG7A 4RVCA 4PPQA 3TYXA 2C96A 3HM2A 3TZCA 3MTDA 5LR6A 2VHVA 4BX3A 4EJSA 1OR8A 3KDSE 4KBGA 4C0QC 5BOSA 4XVCA 3K4QA 5HHTA 1K98A 1C3VA 2ECPA 3L4BA 2EW8A 1UJMA 2VJAA 3RAPR 1CJBA 3IPCA 3HB0A 4WKGA 4KXYA 1JVBA 4Y1RB 4WNAA 1XZLA 1Z8FA 1T15A 2R6HA 3FPSA 4L6IA 2A5JA 4YCLA 4H7JA 1WLYA 4H08A 4EG8A 5A9SB 1FDUA 121PA 2RG1A 3GGDA 3LKDA 2XIJA 2JRLA 3DV0A 4W1RA 1OASA 4OXRA 1YIDA 2O1WA 1WU8A 2M32A 2XGSA 5AHKA 1PVDA 3PT5A 4Z5XA 3HY3A 5DVZA 2RARA 1NYRA 3VHLB 5YASA 3CZRA 4HLUA 3NTUA 1G8MA 1GEGA 3KRTA 4F2DA 5FYQA 3NHAA 4HGNA 1TCVA 2VNSA 8OHMA 3VPAA 3T5GA 1G5TA 4B35A 5DNAA 4B8ZA 4FNMA 2O8DB 2V6BA 4U02A 4JEHA 3I2FA 1W36B 1YJCA 2ZJOA 4R9NA 4IO0A 1QTIA 1OWMA 3SC2B 3U3MA 1VG8A 1U4SA 4J7CA 2ONZA 3L9XA 3LLMA 2AVNA 4RQTA 4UVHA 4Q0MA 5IBRA 3DAFA 1BEUB 1OZAA 1YE8A 2PZMA 2WHQA 3C0KA 2P1RA 3QKTA 3EXHC 1Z18A 1KBQA 4P7FA 1DB3A 2IS2A 1FTGA 1L7EA 4RKEA 2XRFA 3R5TA 3T12A 2UU9B 1SBQA 2WT8A 2AX3A 3MTGA 4Z99A 1JHYA 1XTSA 1QNLA 2Z4RA 4REQB 3RC1A 1RD4A 3LVBA 2EDCA 4QHYA 5HTKA 3PITA 4UHJA 4KV9A 4C0WA 3UV7A 2XYRA 1AQLA 1M66A 3NORA 1WZNA 2BD0A 2PWPA 1SAYA 3DPSA 4P38A 2ZCVA 1J70A 3LX8A 1J1IA 3IVAA 4H35A 1EE1A 2C3PA 2O7VA 2QTZA 3NASA 2TMGA 3OMXA 4ZI5A 4MJXA 1JEOA 1R8JA 2GA9A 2ZWAA 5KUTA 2F9LA 1H8HD 4MRRA 1N5LA 5AKEA 5JQGB 1BO6A 2B6NA 2GBIA 1PZMA 2VFAA 5F35A 3KO8A 5C4GB 5TQVA 1BWPA 3ZWNA 5JASA 3RHTA 4NBVA 3ZJ5A 1GITA 4D79A 5EIFA 4CLOA 2K6GA 2AKYA 5IK2D 4BMSA 2XCSB 1P9WA 3IFSA 1ZKDA 1B00A 2DHCA 1AUPA 2C57A 2ZKLA 1CJTC 3IXQA 3MERA 3UM9A 3W6UA 4CV2A 3QEBZ 3LY9A 1KPIA 3EFEA 1EG2A 4GI2A 5IAEA 1I7SB 3HKBA 3NH9A 5CB4B 4MCHA 4WLVA 2KE5A 2VSOA 4KNYA 2DF8A 1DMSA 2YVAA 2AV6A 1PWYE 1J09A 1KO1A 2GDZA 4JSRA 1ECBA 1QORA 2IYRA 4HEQA 2GF9A 3P2EA 5AKYA 3C1UA 3TW6A 3F1LA 1G18A 1XWIA 4RS3A 4RHUA 4PICA 2OFXA 1IY0A 1YR8A 5E9QA 4CV0A 4TTAA 5IT0A 2XMSA 1N25A 1RYBA 3K05A 1SD1A 2X8AA 3QXSA 2HSWA 4E5KA 4F4FA 3LPNA 4FSDA 3AVWA 3C15C 4LJ6A 1XZBA 4KQGA 5FH9A 1C1DA 3VU8A 2RHBA 2Z3WA 4KI0A 5GONA 4FKBA 2QKYA 1E9SA 2TS1A 5ALZA 4OGGA 1GJRA 2ONKA 5C4IA 1FSZA 1G8AA 1K97A 1UPUA 1VYTA 2Q49A 3NV9A 1MHPA 2BZ0A 2DPHA 1XRMA 2NV2B 2C20A 2A58A 3PDIB 3Q3JB 2FJPA 2Q99A 2XA2A 4MR9A 3HTXA 4DC1A 3UJHA 3SDZA 1RCFA 4YYZA 2HNAA 4Q05A 5EQTA 4IIXA 3ZUPA 2BKXA 1Z3IX 2ZSHA 3IEIA 3R6TA 4B85A 4P1ZA 4DR3B 2BHRA 2C3OA 4M0DA 2HN9A 1CRLA 1E2EA 2H48A 3UG6A 4OMDA 2XE7A 3DHNA 1X74A 3EH1A 3PR1A 1DBSA 1ZD5A 2R85A 2JJ8A 4MS1B 4U9UA 1YK0A 1YRQA 5LQDA 3KPVA 1DO8A 3AY7A 5BRJA 2R00C 1QRTA 3PXCX 3FGZA 3GBSA 4GNKA 1I4WA 4IRXA 3ZGXA 5JI3E 2QVBA 5BNTA 1U2DA 5HW0A 4CMCA 4CEIA 5LIRA 1AQNA 2O3JA 4ZVLA 3EDRA 2A57A 1T9ZA 3MJ4A 3PYXA 5I01A 4OGWA 1E5TA 2WYHA 3GOHA 1EBBA 5JNSA 3TGLA 1RE0A 2NO6A 3GCDA 4HGYA 4LSZA 2EFHB 1RXVA 1N0WA 4BO5A 3MRVA 3W6PA 5EHGA 4R7TA 3RYIB 4DM4A 1UPBA 3D2BA 3WTCA 4YS6A 2GF2A 1WV0A 4J0CA 2I55A 4OHMA 4L2IB 4TMTA 2EZTA 1NGSA 5KTNA 3HC7A 2SECE 5FUQA 5AVKA 1UDWA 2PMWB 2Y0EA 3FWZA 3QBTA 4QU5A 2HDHA 3JVVA 5LYJB 2NIPA 2B2NA 2WOOA 1I3NA 2CVHA 2NVUB 1KDVA 4BB9A 2ZJZA 1COWD 5HJ2A 3SQNA 3U3KA 1OXBB 2JI4A 1E3IA 3RARA 3T7DA 5TB5A 3ZGOA 5FEUA 1PGQA 3I6YA 3LKBA 3NVAA 1Y6ZA 1IZ9A 1LB1B 2CWWA 4CQLB 2RHOA 1M0TA 5C1OA 3FDZA 1XZNA 4I1SA 4CEJB 4D9HA 2PXHA 1JPNA 3CY6A 1MR3F 5IM5A 3WIEA 4DA7A 5JH7B 5K0LA 3KKZA 1RHJA 4JC0A 2OMEA 8MHTA 4IEEA 4REQA 3QE4A 1Z6XA 2EEZA 3FSGA 4NZMA 5JC8A 3U4DA 1F6BA 1JXAA 3OC0A 5L3RA 3D3EA 3S4YA 2G06A 2RK3A 2QLJA 2ID9A 2QRQA 4FNAA 1Q3KA 3W5AA 5ECDA 5ADVA 4IILA 3BXXA 3E7XA 4C3UA 2W2LA 1T9HA 4FKMA 4Z3KA 5C5CA 4FEAA 4LRXA 3HUUA 4M98A 1WB6A 2PQ2A 3DNPA 4ZAYA 5HDQA 3ESDA 1OWLA 2PPVA 1N1MA 1D6JA 5EUBA 1ULSA 1W44A 5CB6A 3UNXA 1YF3A 1FYDA 2FWAA 2IVZA 2N0SA 2RCNA 3K6KA 5FA8A 4YCSA 2NMVA 4TV9F 3ORSA 3QNMA 3H2YA 4DJEC 5C7OO 2Z5FA 4QX6A 2R6CA 5AUQA 3ICCA 4FDMA 4H7EA 4OHFA 5E7JA 3U9SA 2YTZA 1ICIA 1GGHA 5KVQA 1CRWG 3C43A 4K8RB 4KXUA 4UAUA 4IW3B 4WKCA 2VA8A 3LVRE 3Q5EA 4IG4A 3NHMA 4OJNA 2PX0A 4V1CI 1JIJA 4M0EA 1SQFA 2WD7B 2JCYA 3CRNA 1LF5A 4W82A 1CUUA 1U8TA 5KDDA 1DFGA 1U7DA 3B8EA 5DHAA 2GVZC 2ZJ4A 2X1VA 3RTGA 1J5XA 4GVXA 3VZRA 3H9BA 2V5AA 2BHTA 2HQ1A 3BN3A 3GP3A 1EAMA 3FNGA 1IE3A 3MWEA 2NPIA 1I6LA 5I9SA 1WLSA 4G9BA 3L6RA 3CKMA 1BS9A 4HDSA 5EP2A 3Q1KA 4UZFA 1UPTA 4K5QA 2ETVA 1GCOA 3HXTA 1Y63A 4N9QA 1PJTA 1J56A 3QG1A 5IDWA 3Q1LA 1PFYA 5FFNA 4BNUA 2Q9UA 3T7TA 3QKRA 1U5BB 3TPCA 1A69A 3IP1A 2I6GA 3QVMA 1OX4A 4PAWA 2QN1A 3G1WA 3VHRA 4AJIA 3E2PA 4CETA 5IJWA 5TPZA 1RQXA 3QVTA 3OOHA 2IXAA 1KQPA 3H11B 1JHVA 5LZ8A 1DG9A 4LWQA 1N3IA 4QGSA 2BUBA 3FNFA 1OH6A 1I0LA 1RM0A 2X86A 3WIUA 4UE6A 4KO4S 3EAQA 1M67A 2FFAA 1GPBA 1C30A 4QGAA 3TLEA 2GZSA 4IGAA 4EPWA 1YTLA 4MWBA 3MILA 1TK9A 3RU9A 4JJEA 3JALA 3CEPB 3RK4A 4OGFA 4YPFA 4F5EA 3F4KA 1SMKA 1YIAA 1XPRA 2UXCB 1AY0A 5DM1A 1X94A 4BHTA 1ADJA 5CR9A 1DQRA 2IS6A 2R6FA 4GE3A 1JLLA 1Q91A 2CNDA 2F90A 2FZLA 3PSHA 1QGZA 5UKDA 3PUVA 2DEUA 3TL6A 1NRXA 5AVXA 4KXNA 3GRAA 2FRDC 5LMNB 3IUEA 1YL7A 5DM60 3JTMA 3QW4B 1GTG1 1DBRA 1FRZA 1TZKA 3E9MA 3LPMA 4BO1A 4JI1B 1D2HA 1GPAA 4N54A 3W5VA 4D9CA 3OAAD 4QWWA 2H1CA 4RKQA 5COAA 2HO5A 2P9QA 3TTYA 5KQPA 5DSTA 1IXYA 4TRNA 1RLUA 3I8OA 1L4MA 1KU0A 1NJ8A 1Z5VA 2M1XA 3HSKA 1UWCA 2B69A 3LJKA 5AW4A 1Z6GA 1XTZA 1FW8A 1RJWA 2YJ4A 3I6QA 1E61A 1KO8A 4LHYA 5H9WA 1RZ3A 3KR9A 4IGIA 3OTGA 1E6UA 5L6LB 2NO4A 3QEJA 2WKWA 1PWHA 1E5LA 2PQMA 3EGIA 4QU0A 3QBJA 3CLUC 4LRWA 5FI1B 3IVXA 4K03A 4Q1CA 3MELA 2ZSEA 1ADGA 4MDEA 2QWXA 4JSYA 1M1ZA 1NV9A 3Q88A 2VHUA 2PG3A 3EBPA 5AKIA 1NW5A 4RE6A 5REQA 1ZVKA 5EJMA 4FMDB 4DMHA 1O0CA 3REGA 4QG7A 3EC1A 3AEUB 1AB5A 4IO1A 3NVMB 4KXXA 1BN6A 5DEOA 4JLNA 1OGYA 5K3FB 2R47A 1LVGA 3LTEA 1UAAA 1PQ4A 1TA0A 2PBZA 3EG9B 1X7YB 1YVRA 3DHYA 3Q9LA 1DKLA 2A9PA 3E8MA 3O4HA 3E0QA 1P0IA 3R40A 2VDWB 4MVWA 3WBBA 4NR0A 2BKEA 3ZZTA 1EXDA 4KAXA 4U9HS 5IAJA 1E5DA 3RVSA 4BUJA 1H05A 4GC5A 2J4FA 3IAAA 3N3BC 5G0VA 3TIVA 1VG0B 3OCWA 4RMHA 1IIRA 1KARA 1YQWA 2JKYA 3NKFA 3JD0A 3DAPA 3A26A 3GMTA 3SBDA 4BNLA 2B9EA 1Z4LA 3SJ7A 1U0JA 1B76A 2O05A 3DDSA 4NS1A 3STWA 4YRPA 1KJ9A 4P93A 2YWBA 4OKSA 1M1YB 3LGXA 3T52A 4I6EA 3QLTA 1RFGE 4Z4IA 1A0OA 2FUG1 4GICA 3WHKA 2GCOA 2I8LA 4G1CA 4PHHA 4PVDA 5EZYB 1WDLA 2BH2A 2PS0A 4FYJA 4I2NA 4UEWA 3DZIA 4BAUA 3TL3A 5BV2P 1YZVA 2IYYA 4V03A 1KAHA 5A5FA 2Y2VA 3MG9A 1DUIA 5LM3A 4YA6A 5E6SA 3GYBA 2PJZA 2QZPA 3KJQA 3AUXA 4PGGA 2RHWA 3VKVA 1VYVA 4HN9A 4MJ3A 4UNSA 2AOVA 4Y6OA 3ZJYA 4X66B 2Q5QA 4PAGA 4J4BA 4LF5B 1FNMA 3PC4A 3NIDB 3FYUB 4ZV7A 5FO0A 3EG5A 4KXMA 5JMPA 4I4TF 4GRAA 4IDDA 1CLEA 4E5MA 1P1BA 1TO2E 4MWTA 1MJGM 2JBAB 2O5EA 3HMKA 4IIVA 4PX9A 1R4MA 2ECQA