1XD2A

Crystal structure of a ternary ras:sos:ras*gdp complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-Ras-1
publication title Structural analysis of autoinhibition in the ras activator son of sevenless.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xd2A00
2CNWD 3W6OA 1N5KA 4AY2A 1ZD8A 2WICA 2GEUA 1CR1A 2F43B 3ETLA 3SS8A 1BS1A 1KJZA 1TADA 2XNDA 3A37A 2AD1A 1W0JA 2PLRA 1T5IA 2QEQA 4KBGA 1SXJD 3MD0A 3W6PA 4HATA 1LB1B 2CLCX 4TLBA 1CBUA 4PXAA 2JJ1D 1AZSC 3H1TA 5JBQA 4Q02A 3QIAA 1TAGA 2WWYA 5F9HA 4QNRA 1DAGA 4OQMA 4IRUB 4E22A 4A0RA 4Q7JB 1NIJA 4DSOA 2BJVA 1E94E 3RS5A 4EDHA 4H9GA 1G291 4MQBA 1YZNA 1G41A 1N2CE 2CEAA 4FCWA 5EZ6B 2YJTD 2HUPA 5BQ5A 3P27A 3BFVA 4QRHA 4OQLA 3VQTA 1QHXA 4DT1B 4NYIR 4US0R 1S9DA 1KTVA 3DZ8A 5E3HA 4BZXA 2NGRA 1B0UA 1JR3D 4DWJA 2W2TA 2O52A 4RD3A 2VHQA 2DFTA 3BAFA 3I1FA 4BFWA 5SZHB 3QPWA 3PUZA 1YU9A 3LX8A 4KI0A 3VU9B 4E03A 1HUQA 1U8AA 3MMPA 2FSHA 3W34A 1WRBA 2WM9B 3FWYA 2O8EB 3T06B 4X8MA 4CT5A 4RFSA 3SR0A 3VKHA 4PTLA 1S3SA 4WXRA 4ACAA 1OIWA 1Z5ZA 2OZEA 2D3WA 3DKPA 2QT1A 4PO9A 5G41A 5EUMA 3W3ZB 1X86B 1UEJA 3VR6A 1CF4A 5B57C 1SXJE 4NPHA 2JDID 1KI3A 4LHYA 2J0UA 3WBKA 5JHHB 3NC0C 5BN4A 1XJ0A 1DAIA 1GIAA 1KI4A 5G53C 4C9BA 4KJZA 1NBMA 3LBHA 4IDQA 2VTKA 2W0MA 3QXHA 2HLDA 4Q1EA 2YINC 4A9AA 3X2SA 1KJYA 4B33A 3VNVA 2KSQA 5D3MA 2CBZA 3NKVA 4Z54A 2ZAMA 4DVGA 4PQRA 3GCGA 3HYTA 1Z0JA 3LW7A 3X1DA 4HB4A 2JLXA 4BFZA 3CF0A 1JR3E 5UKDA 3NEYA 3UIEA 5JCZA 1OFTA 3BD9A 3FFAA 4GI7A 1OH5A 2ORWA 2OSBA 1F5NA 2ZREA 1P2TA 5D3QA 2CL6X 1R0XA 1GDDA 2R6GA 2C99A 4IVQA 1OB2A 1XD8A 4EUNA 1OHHA 3OIYA 4PHGA 3PENA 3CF6R 3NIBA 4MA4A 3SDZA 3LBNA 4C0QC 4NYJQ 2B8TA 4D80A 2O8BA 3THWB 2JLUA 4HLUA 5JS7A 2WIBA 4LWZA 3U2QA 5BWMA 1KSJA 3PEWA 2ZYTX 2BVNA 1UKZA 4DC9A 1XFAA 3ZIAD 2VLIA 1Z29A 1GWNA 3W8NA 4PHFA 2OCPA 2ATXA 1ZUNB 4MRPA 3LFUA 5CB8A 1NG1A 3RS0A 1JAIA 1G5TA 1Q1ZA 4HAXA 1TQ4A 2XSZA 3K0SA 3OZXA 3QXSA 4G5RA 4C2UA 3ND8A 1Q1EA 1EK0A 1GAJA 1QHHA 2FEOA 4LC1A 3KUCA 4B2PA 2WSSD 2J46A 2RGBA 1KSFX 4RD2A 5CK5A 4C0AC 4JIMA 4KLNA 5EXPA 1P7CA 1YRAA 3TR5A 2GJ9A 1R5OA 4N1AA 1VPLA 4RVCA 3HDTA 2JEOA 3LA6A 5E95A 4E5UA 2A5GA 4XWKA 2ZRAA 4HZUB 1OH6A 2J7KA 4Q1AA 2Z6VA 1COWD 2GJSA 2QZ4A 1NMYA 1E0SA 3L82B 1XXHA 3L0SA 1HV8A 4TZ6A 1G8FA 4PPGA 3RS7A 4M1KA 5FTNA 1TQ2A 4EFMA 3K70D 2QAGA 1E2JA 2ZYVX 4LJ5A 4Z8YA 1Z3IX 5HR5A 3EIHA 4K81B 5C2JB 2J45A 4IOJA 2OLJA 1PUJA 2XNDD 3X1WA 1Q12A 2N1BA 1ELOA 1OXXK 1W0JD 5FOXA 1FMLA 5LB2A 2KE5A 3LY5A 1XWIA 1KAGA 3CW2A 3LWNA 1HH4A 3MWLA 3RAPR 1R0YA 1CTQA 1XCGB 3KQLA 1QRAA 2VP9A 5GVSA 2SHKA 3OESA 4AKIA 3KDSE 4QBIA 5AR1A 4D0NA 3RVBA 3OE7A 3GLHB 2R6AA 1DADA 1Z47A 2FFQA 3B78A 3EZ2A 4LDJA 4DKXA 3CRW1 4OL0A 3R9IA 1E9RA 5KDLA 3R7WB 3GLIB 5H68A 3SI7A 3ASZA 2NO1A 1G8GA 3QI2A 1CJUC 1U0JA 1JXMA 1MABB 4JT4A 2IYTA 5EXXA 4ZO4A 5J4VA 2O8FA 1SVLA 1GRRA 3EPJA 1G9XA 1LNZA 3BORA 2QQEA 4LY6A 4Q4LA 4B3DA 3DPUA 5CITA 1W46A 1F6BA 2ZUBA 3KKPA 3C5HA 3QUSA 2NO0A 4RZ2A 5DHFA 5GADl 5C4MA 4V0LA 3RRYA 1M8PA 1RRFA 3MRSA 4Q7KA 4DCTA 1WP9A 1U81A 2DB3A 3B1VA 2DWPA 1KI1A 4CW7A 1AN0A 1ZM9A 1XRJA 1QZXA 4GOKA 5BW8A 4G01B 1RJ9B 2OCAA 3Q8XB 3TSZA 1QVAA 4URUR 4XVUA 2Z4RA 4LJ9A 1FPMA 2A78A 1XNJA 3GJ4A 4FINA 4F7WA 2YOHA 1FTNA 1P2SA 2FU5C 4KFSA 4KFRA 2VSXA 5CLQA 5HCNA 1OXSC 3OIVA 4HAZA 4TLAA 4W7SA 3LXXA 1VDZA 3O8RA 5HTKA 1N0UA 1E4YA 2BOVA 4HLCA 4PC6A 3I73A 3GLFB 1M7HA 4JMPA 2ZS9A 4RJLA 2JJ2A 3IHLA 3QG5A 4YQFA 3BK7A 1NBMD 1KDRA 1HT1E 2GILA 1M74A 5E7MA 4UXJA 3GJ7A 2HLDD 3VHXA 4UKDA 4IOMA 1SKYB 3B6EA 1TX4B 5AJZA 1Z63A 3FPAA 3AEZA 4G0NA 3B1ZA 1TQDA 4XTCS 2J41A 1G3MA 2IXEA 1LS1A 2AK3A 2GEVA 3VX3A 5CDFE 5KPDA 4Q9HA 4UXIA 2BMFA 2VO1A 1NF3A 5J47A 4FIDA 1YZQA 3WP1B 2ZRMA 1G3UA 4PC7A 1A7JA 3THYB 3N5CA 4IDPA 4XIGS 4AYWA 2BV3A 3KQHA 1OHHD 1ZBDA 2A30A 4D0GA 2IYQA 4ZDJA 1G4UR 2J1LA 1Z6YA 5SZJA 3EZ7A 5C1BA 2GF0A 2QL6A 4D6PA 4B47A 4DCSA 1NVXQ 1NVUQ 3I32A 2B6HA 5B30A 1U98A 5EE5B 1E2FA 5G40A 1IY2A 1ETUA 1LF0A 1KI6A 2DWQA 2ZSBA 3QKRA 4YMVA 3GJ5A 3P32A 1GOTA 1E3MA 2P6UA 1KMHB 2GBLA 2XSZD 3O8BA 5A5GA 2WBLC 1TL7C 4GOJA 2V8OA 2VIIA 5FUYA 4LPKA 2XZPA 5TB5A 3N2IA 4ZPXA 3U4QA 4M1WA 2WJHA 3DDCA 2IWHA 3SZRA 5HCIA 1XTQA 4CIDA 2LCFA 1Z6GA 5HPYB 1SHZA 1RFLA 4GNKA 4C30A 3UPUA 5JSZA 2EQBA 3CRQA 3JZAA 2FMXA 4R7ZA 4A15A 1IONA 2ZI4A 3TH5A 5ELXA 5F2EA 5B64A 4WXPA 3FKQA 4V0ME 4KXFB 2ZJOA 1Z6AA 3T1TA 1E2DA 3EASA 3A1VA 5B58C 4P4TA 4LYFA 2GXAA 5KSYA 5DIFA 3IIKA 3IEVA 4PAMA 5EE0A 2HJGA 4CT4B 2WMOB 5EXSA 1KK3A 2FF7A 4P4UA 1OW3B 3A4LA 1OIXA 3MLEA 2XGJA 4R2HA 2MSDB 5FOUA 5G3YA 2NIPA 8OHMA 2DFLA 2R9VA 3CR8A 1I2MA 5G3ZA 3A8TA 1G7TA 1P60A 1Z07A 1Z0IA 4NP6A 4QHTA 2QORA 3EA0A 3UMSA 5FOTA 2QSZA 1MO5A 1QDEA 1IN6A 1XD2B 2R6CA 3CBQA 5CLLA 2YNMA 2JASA 3ICEA 1ZUIA 4B6FA 3EZ9A 2GK6A 4I81A 1R2QA 3GEHA 3G5UA 4C4PA 5L3QB 1J70A 3NBXX 4TQ9A 4HYYA 5H70A 4NL4H 1E2NA 4TYWA 1CULC 1SULA 3OE7D 4BFVA 5EE1A 3B13B 3EPLA 2IEZA 4ZIRB 1J99A 2QRZA 1Q22A 2ZPTX 3DHWC 4FCVA 1YZLA 4A36A 1IJFA 1N6NA 2VH5R 4NYMQ 1XTJA 3WNBA 4GL2A 4QGFA 1DBSA 1Z22A 4NE2A 5FBLB 2IXFA 4Q00A 4TMWA 5AJXA 1E2LA 1JJ7A 1O87A 4DHEA 2ZRLA 3PJRA 3EW9A 4AI6A 1IN7A 2D2FA 1UM8A 4DIDA 1XZQA 2YWGA 4HZIA 3FDIA 4LSGA 3WMFA 3C4JA 1AS2A 4LHWA 4A0GA 1FL9A 2LKDA 4OQXA 4N3NA 2BC9A 2ZU0C 3PFIA 5HE8A 5L3VA 2GETA 3LQQA 2CCKA 2N46A 1N6IA 3AF1A 4PHTA 2WJIA 1I2DA 2AKYA 2X19A 3AVVA 4WA7A 2EYQA 4O2RA 1S2MA 1VHLA 3BWDD 3EC1A 1WB9A 4EPTA 1SVSA 5EJEA 5CB6A 2L0XA 1NN3A 4LJYA 1GVNB 3W5JA 2JAQA 2JJ2D 2XITA 3TSWA 3IILA 1CRQA 4ZKDA 3ADCA 2ZM5A 1AIPA 2ZVQX 5KTYA 4TMXA 4TN1A 2CL0X 6Q21A 4BASA 2R62A 3T61A 2OE2A 1OPXA 1SVWA 1N6PA 3B82A 4YMWA 5CM9C 3D3QA 1W2GA 4HEJA 4D25A 1K5DA 5J4HA 3VR3A 4HDOB 4C0SA 1E99A 1KO8A 2GZAA 2ZRHA 3IDQA 5KU1A 1JJVA 4OK3A 4JLDA 1OYYA 1HQYE 4M9SA 3R8CA 3RC3A 3FMIA 2RGGA 3SJBA 2EFDB 3ZS8A 2WWFA 4UNPA 1FQKA 5FOVA 3GJXC 4MRNA 4Z1MA 1RC8A 1G5PA 2RHMA 2PX0A 2O8CA 4RKEA 2WWHA 1SQ5A 4QGGA 1RZ3A 2WIAA 5CYOA 3HU1A 3IHWA 1FW6A 1N6KA 4O25A 2FA9A 3A4NA 1ZC4A 4GOXA 4Q9IA 3TIFA 2ERXA 5FL7A 3K0CA 4LJ6A 4M0LA 4KSBA 2YC2C 2BIFA 3TBKA 3ICQB 4EKDA 3CNNA 1NVVR 1FOEB 3K0EA 2NPFA 3B1YA 2ZE6A 4ARZA 4DZZA 4LUCA 5DN6A 4XOIA 1OIVA 5FPKA 3VKGA 3RC8A 121PA 2PZGA 4RD0A 2XXAA 3C7KA 3EG5A 2QROA 4HB2A 3NWJA 3QY0A 3UG6A 5HKKA 5EP3A 3E2IA 4MRSA 3U7FB 1NLFA 1T3HA 2CHVA 1ZNWA 1AA9A 1KI2A 2PX3A 2J59A 3CX8A 4KU4A 5AUNB 2AR7A 1XZPA 2ZRCA 3LXRA 1J2JA 4JLKA 3IBGA 5DYIA 5TVKA 4V03A 2DFKB 3AQ4A 1E79A 5KSZA 2YKGA 1W36D 2ODNA 3GFPA 3I8XA 5TARA 4A8JB 1KI7A 4CDGA 2WZQA 4AKEA 3LLUA 4XH9B 1AM4D 2CVHA 1TF5A 3T1QA 5CYPA 1E69A 1OJLA 1X3SA 1Z28A 1P9WA 2KBEA 1MV5A 2QSYA 2WJVA 2ZU6A 3DZDA 3LX5A 4PSVA 4EPWA 3MJRA 4KHZA 4JYCA 4C7OB 1PJRA 3B2EA 4AG6A 2MMGA 1G6OA 4GZLA 1V43A 1ZJ6A 3C8UA 2P6NA 4WIAA 4XWOA 2FSIA 2IYWA 5FBRB 2J0VA 5IF9A 3SU8A 5KUTA 4B3XA 2QM8A 2VF7A 2A2ZA 3ZQ6A 4XWAA 2OFXA 3VHLB 2D4HA 2XB4A 5JJLA 4PC3A 3BXZA 3GLGA 4MGZR 4DSTA 3K1JA 2ZIAA 1E1QA 4HAWA 4DB2A 3W6NA 5FI0B 4GP6A 2QBYB 3ZDQA 3LAWA 3K53A 4BLSA 1PLJA 5KYKA 1FFHA 1P4SA 5KPJA 4IDNA 4Q47A 4EPVA 2H5EA 2XOKD 3U61B 1DG3A 2MSCB 3ZD7A 2H57A 4HSEA 2XTMA 5E7IA 1VG8A 1L4YA 3PXGA 2CHQA 4DLRA 1QHNA 1HY3A 2JA1A 1II8B 3DM9B 3QF7A 3RNLA 4URWR 3BFKA 4A2PA 4OI0A 1T8UA 5LPNA 3EIEA 3UXMA 4L16A 3CPEA 3EPKA 3U7HB 4CRWB 3D31A 2HT1A 2V55B 5DLQC 2ZSDA 1FP6A 5JECA 1Q1QA 1M7GA 4B73A 1TTTA 2KI5A 1Z83A 1D2MA 3I72A 2J5XA 1IN8A 3SC3A 1P5ZB 3B9PA 3KTAB 3NXSA 3WMGA 4RFSB 2WKRA 4IFEA 4IDOA 4LV8B 4B34A 3Q5EA 3QOFA 1OYWA 1J90A 1GL9B 1OH8A 2ZI3A 3HPQA 3B85A 2ONKA 4UJ3A 5KO2A 3KJEA 1Q0UA 3G82C 3NTUA 2AHOA 1L4UA 4OQNA 1A4RA 2QPAA 3V4FA 4WZ6A 2OG2A 4RD1A 1IAQA 1HT2E 1VYUA 1YHNA 2VPPA 2Q21A 1YR6A 4AYTA 2E9SA 2ODBA 4IJMA 3Q7PA 2OT3B 3CZPA 1J7KA 3BOSA 3A58B 1E9DA 3P26A 3V00A 3ZYCA 2ZJYA 3CX6A 3MG9A 4A82A 1IN4A 1KJWA 1WBDA 1F48A 4NYIQ 3AUXA 4IDHA 4F92B 3GFOA 1XMIA 3H86A 3LNCA 4JKIA 3LLMA 5DE3A 3T34A 4Z1MD 3PEYA 4LRWA 1IQPA 2IS6A 4YMUA 3B8HA 3ECCA 1G3RA 1CXZA 2C96A 1G1MA 2ZI6A 1NSTA 2FPLA 2XTZA 5FTMA 1AQUA 2IYXA 1Z0FA 2GJKA 1BO6A 4BGDA 3CNLA 4PAQA 4ACBA 2G0TA 3OEEA 4GPTA 4YLGA 3C16C 4MRVA 2ZJ8A 2CLDX 1RYFA 2O8BB 1J8YF 1Q1BA 1UPTA 5FL7D 1E2HA 1G20E 3HJNA 2IYUA 3LQRA 5JWHA 4ERNA 5DN6D 1VHTA 4GMDA 1YR8A 5JRZA 3NDBB 1OFIA 2IBMA 3KKNA 3HWSA 1RYHA 2IYZA 2WWWA 2GZDA 2NG1A 3S1AA 3F5FA 1NVWQ 4FMBB 2YOFA 4F38A 3T5GA 1AZTA 4M1OA 5FPTA 5HKKD 4M9QA 1Y3AA 4ZV4A 5KSOA 2J3EA 3I8SA 4TYNA 1RRGA 2GESA 2IUTA 2V4ZA 3KXIA 2V6IA 1NNEA 3HR7A 3PG5A 1XBTA 1Z06A 1GNPA 2I1VB 2IK8A 5E4FA 1SZPA 3PUWA 3I92A 2VL7A 1UKYA 3KX2A 4PQFA 4C0HA 2WJYA 3B7GA 1E79D 1TEXA 2J7PD 2QTFA 1R4AA 2YWHA 4XVQA 2WSMA 4Q4AB 2OUKA 2VHJA 3VX4A 3DO6A 2P65A 1N0WA 4RZUA 2BBSA 3KL4A 5DNYB 4DLTA 1OFHA 5FUWA 5GJCA 2OCBA 3LV8A 1VIYA 4OBEA 1R5NA 3Q7QA 3QVVA 1UBGA 3Q85A 1G3QA 1Z8FA 4JJKA 4KCGA 4X8OA 4P3YA 4ZKEA 1T5LA 1AGRA 5CIQA 3DM5A 2BMJA 1SVKA 3K0AA 1AJEA 1EWQA 2W2VA 3WYGA 4MUAA 2P5SA 4ZCIA 3ASYA 4GMXA 3CWZA 2C8VA 4Q4HA 1R7RA 2RGNC 4OK5A 5JS8A 2VHCA 5FOWA 4PO1A 4HI0E 1OXVA 1S96A 1XU4A 1ZNYA 4IXMA 1VYTA 3MWKA 5IDVA 1E1QD 3SN6A 1H8EA 4LCBA 4EFNA 4AG5A 2P5TB 3RS2A 1TNDA 4BZPA 2BMEA 5J4KA 4A0FA 1EG7A 3SOPA 1M1YE 1ZNZA 2EFGA 4I1VA 3SYKA 3PVSA 1EFCA 1Z08A 3U44B 2Q0HA 3T1VA 3QENA 2H1LA 4DDTA 3X1XA 4ASUA 2WWIA 4D82A 3J81k 4PHHA 2FOLA 3B60A 4V0NA 1NN0A 2ECKA 1ODFA 3H4MA 2RAPA 4FWIB 2C2HA 3LH5A 4NCHA 1CJVC 5DI3B 3KQNA 3KJHA 3SFVA 4LJAA 3VTKA 1DOAA 1II9A 1EXMA 1GFIA 1M6NA 2OCYC 1XEXB 2MMCA 3I4LA 1E0KA 1NN5A 2QMUA 3O47A 4PO8A 4A92A 4M1SA 2JATA 4HAVA 2CMKA 2IXGA 3QPVA 2FPKA 3AGQA 3MJHA 4B6EA 4L15A 3FFBA 1BH2A 1KKLA 1L7VC 2ATVA 2BJWA 5JWOA 3HPRA 4PANA 4P4SB 3JZMA 4EQ6A 2F43A 2ZXUA 4BFYA 1OB5A 4B3GA 2BBOA 3GLGE 3CIOA 4TQAA 4BLTA 1N5IA 2CXXA 4WZAE 4LX0A 2HYIC 1OH7A 3FB4A 1FQJA 2VP2A 3IPYA 3T5DA 4B3BA 2F9MA 4XVRA 3UMRA 2ZRFA 5KOYA 2PT7A 1CKEA 2ZSFA 3QPUA 2NMVA 2XAUA 4BLPA 1MRSA 5L8VA 2EWWA 1WXQA 4BFUA 1EWRA 2OXCA 2ZS8A 3H84A 2G9NA 1F3OA 2EFCB 3ZZTA 4D4MA 4LJ4A 4R71A 4CF7A 3HR8A 2OO7A 3DVLA 3FHCB 4YMSA 4A6XA 1F2UB 4OJQA 4DT1A 5LD2B 2VP0A 1XMJA 2ZYUX 4A8JC 1W4AA 1YZGA 2PJZA 4I1UA 3OEED 4CYMA 1JQLB 1S0UA 2HJVA 3QXJA 3C5CA 3TAUA 1Z6TA 5J40A 4JZKA 3T35A 1CR0A 2N42A 2EYUA 4LBWA 4ABYA 5IRCD 2F1RA 3KXKA 2FZ4A 1XEFA 5FOSA 1G6HA 2FV8A 3L0OA 4QNMA 1FUKA 1EFRA 3CONA 3VU9A 1G19A 4EPRA 5J4LA 5K8TA 4MYUA 2WWGA 2O8EA 1I4TD 4LHXA 1Q21A 2CDNA 1NLYA 1JXOA 1VCOA 2Z4SA 4JVSB 4W5HA 4ZI3A 1TU3A 1GL7A 2DBYA 4DRZA 3BB3A 3QG1A 3QBTA 2REXB 1Y63A 3FVQA 1AKEA 221PA 4RZ3A 3U4QB 2PBRA 3CF2A 2OBMA 5IT5A 4ZCLA 3TMKA 1ZD1A 3Q3JB 4OJKA 3TRFA 3PQCA 1ONBA 1XB2A 1EFUA 3EZFA 4LYJA 3TQFA 4G1UC 3SEAA 5FBQB 1G18A 3GJ3A 3AP2A 2F3TA 1W48A 3H0KA 4PPFA 4QHYA 5JLJA 3VKWA 4DBLC 1OSNA 5JI2E 1TMKA 1H8HA 3AF3A 4CEIB 4L4UA 1Q44A 1CP2A 2QP3A 1GNRA 2EWVA 2W6IA 2X2FA 4A6PA 1AQYA 2W2XA 4CGZA 4RD4A 5EP1A 4RZXA 1HE1C 1ZNXA 1N3BA 2FGKA 2HCBA 4JLNA 2J9RA 2Q3HA 1G8YA 2C9YA 1LW7A 1KK0A 3SBEA 1E2PA 2QMHA 4PAOA 3PEUA 3AVXA 1RIFA 1QHGA 4D4LA 1K8RA 2AFIE 2QA5A 3OIUA 4FMCB 3BBPA 4GRAA 3CWQA 4DCVA 3R8FA 3K0FA 1RVDA 2FEMA 2NZ8A 5TY0A 1MKYA 1M2OB 1NKTA 1W4BA 2ZROA 3THWA 1N6LA 3TSOA 4Z51A 1H8ED 2ANBA 2R65A 2GF9A 1JI0A 4QJ4A 2EFEB 2ZVPX 2O0KA 2BCGY 1E2MA 3Q9LA 3AKEA 3A4MA 2IX3A 4MGIR 1WQ1R 1DG1G 4MKGA 4NMMA 4DJTA 1EX6A 2GVZC 1GKYA 2GJ8A 4M2LA 2WTUA 3R20A 3LDAA 4Q4JB 4HAUA 4JLPA 4BRUA 4ZDKA 3SBDA 4JVMA 1G7RA 3MUFA 4YDSA 3RS4A 3CH4B 4MRRA 3IIJA 1E9BA 1E9AA 5EP2A 4NDZA 5JMTA 5AK0A 5KHOC 4OI2A 1GUAA 3E1SA 2Z5FA 1CR4A 2OEPA 2PMDA 2QT0A 3CRVA 3K9NA 4FMDF 3IPXA 2WVJA 2DCUA 1P9RA 4HZUA 4ESHA 4TL8A 4I1OA 2C78A 3DMDA 2P67A 3L43A 4JLVA 3LBIA 5DH9A 1F2TB 4R9UC 3O8DA 3B1XA 4JLJA 3LVQE 3NC1C 2A5YB 3F0TA 2ODEA 4S35A 3AH8A 5M04A 3SQWA 4QKQA 5HZHA 2IC5A 2GCNA 1NMXA 2HF9A 4URVR 4HLUC 4C2TA 2VQSA 2Q9BA 1DAMA 3PUXA 2PEZA 1LY1A 3DL0A 3BC1A 1W5SA 3PUYA 2B7BA 1NBME 3ZZ0A 1VCMA 4TMZA 4UQOA 2WAYA 3A1UA 4PFSA 2OBLA 4L5BA 4WZBE 2VA8A 4AKHA 4U02A 4LHZA 1P2VA 1PZNA 2C9OA 1HA3A 2WWXA 4I4LA 2ZSEA 4NBSA 1G64A 2BKUA 4KVGA 4Q18A 5DO9A 1TU4A 4Q03A 2X2EA 3TW8B 4D0LB 3E5HA 421PA 1SKQA 3IO3A 4LBYA 4QM6A 3L2OB 1KAOA 3R7WA 2OFWA 3GLIA 5BN3A 1AS3A 4MKHA 1MO6A 3W3AA 3WNDA 1MABA 5FR2A 4ZDWA 3TKLA 3KXLA 3THXB 1KK2A 5FI1B 2F55A 2WAXA 2FH5B 1BYUA 1QHYA 2IYLD 2D2EA 1R0WA 1T9HA 1YJ5A 1FTSA 3RRNA 2F1HA 1UDXA 1AS0A 3RANA 3NEJA 2YC4C 3LO5A 1A1VA 1DARA 1T4GA 2FSFA 2ODWA 3K09C 1U90A 3I5YA 1D9ZA 1EFTA 3O8CA 1BYIA 1P61B 1SXJB 1WMSA 4Q48A 1EFRD 4TSFA 4JLMA 3RYTC 2YHSA 2F7SA 2ZR9A 4ARZB 5KNCA 3AVTA 3WRYC 1RJ9A 1KDOA 1P9NA 3PUVA 1E4VA 3KKQA 3FGNA 4LHVA 5EUQB 2O8DB 4IFBA 1NL3A 1EX7A 5JJIA 1R6BX 2F1IA 1NY6A 2H92A 3EIQA 2BM1A 5KNDA 4BE7B 5FR1A 4A1FA 5FBVB 2JJ8A 5JWRA 1C9KA 4EPXA 1ZRHA 5TDHA 3SYNA 2IW3A 3QEOA 1XJQA 2ZJ2A 4Q5IA 5FUXA 5DSZA 3TVTA 1RKBA 3TUZC 3TUIC 1T3LA 1DAEA 4PQYA 1XXHE 2C04A 1QHSA 3I5XA 1KYIA 1IHUA 4TMKA 4DSUA 3HP1A 4ZDIA 4RKFA 3SHWA 4DDVA 2RCNA 5BN5A 1G7SA 1H8HD 2VP4A 1NRJB 3UATA 1CR2A 1FX0B 2W6ID 5DISB 2VF8A 1MRNA 2XB2A 4YXWA 1ZD9A 5K8IA 1TF2A 1S4QA 1ZP6A 1KI9A 1ZM7A 1TUIA 4JL8A 5BXQC 2QU8A 4EJSA 3THYA 2J0QA 2ZUDA 2BCJQ 1U0HC 4M1MA 4QG7A 4TMVA 4U7DA 2YOGA 3HU3A 2RGAA 3ZVNA 3MAAC 2NO6A 1U9IC 2O0HA 4JLAA 4TYQA 4V02A 4KFTA 4NTZA 1HTWA 1D9XA 3GLGB 4OI1A 3D8BA 3WHLA 3AVQA 4Q1DA 1P62B 3CX7A 4M1YA 2RGEA 4TMTA 4CZ2A 2PMKA 2GWHA 2IT1A 4LBZA 1TPZA 3R9WA 2Y8EA 1M34E 5FPYA 5FUVA 5L3SB 3D6TB 1XTRA 1US8B 4LV5B 1NJGA 2GXQA 4URZR 1G8HA 4BEJA 3CRMA 3WRXC 2D06A 2WOJA 2AL7A 2VHTA 1T0JB 2K5UA 2HT6A 1XX6A 5CK4A 3PEVA 3HYRA 4JBWA 2GA8A 3VR5A 4DEXA 4Q7MB 4WAUA 1CLUA 2QPOA 3MCAA 3A1WA 3SE0A 5SZIA 2CK3A 3VMFA 2C98A 2ONJA 2GVDC 2HF8A 3IO5A 4BPBA 1W7AA 3AUYA 5LD2C 4F93B 1RRPA 2QQ0A 3L8YA 5FTKA 3T15A 4CEHA 1NG9A 3IEUA 4XD7A 3FYHA 3NDPA 3ZD6A 3HU2A 5L3RA 4I1SA 2CLSA 3CPJB 1QF9A 4BLOA 1Z0KA 4TTRA 2G83A 4EPYA 2FDCA 1CEEA 3WYFA 4XJXA 1UKVY 4LJ7A 4BZQA 1JPJA 2AN9A 3NH9A 2AD5A 2A5FA 2DWOA 1XD2A 4LYHA 1IM2A 2R44A 4LC0A 2GAAA 1CJKC 1ZCAA 4MDFA 2QUZA 4C0BA 5L3QA 3FHTA 2ZYWX 4P32A 3QKTA 1ZC3A 4IOKA 4HUTA 2GZHA 2IYRA 4YDHB 4OHYA 2YYZA 3KKMA 3P4XA 1XPUA 3T1OA 4DLSA 2ZI9A 5JZVA 5JJKA 3AP3A 2CJWB 4ZIRA 2JIZA 4M9ZA 1WCV1 4K8OA 1S9HA 1QVRA 1NP6A 3IKJA 2BBTA 1JEDA 3QF4A 2V9PA 3U3OA 2H7VA 4QL3A 1KDPA 1WF3A 5EXTA 1ZVQA 3K70B 4DXAA 2GDJA 3VR4A 1MO4A 1WE2A 4GSYA 1MT0A 2F9LA 3TJZA 4Q9LA 4N0EA 4HLQB 1JR3A 3EAQA 4RD6A 1T6NA 4NCKA 1FMJA 4W9MC 2IYYA 3AKYA 2EW1A 1JECA 2DHRA 3WMEA 2IUUA 2XTNA 1E2QA 4TSFD 2QMEA 1HQCA 4JS0A 3ADKA 3W5IA 3GFTA 1U2RA 4MH0R 1TF7A 4TL7A 1ZU4A 4X8HA 2PL3A 1KGDA 3SNHA 3SJZA 4HUQA 3PCRB 3AVUA 4US1R 4AURA 1GP2A 4C0JA 1DPFA 3BB1A 1E9FA 4G5QA 1KY3A 2P3SA 4PX9A 1DAHA 2Q3MA 3DMNA 3FKSA 4WVFA 2JLVA 4L8GA 1KIMA 2H16A 3AF4A 2H8KA 3VR1A 2ZANA 2VSOA 4R98A 1BMFA 2BKEA 2QENA 1E0JA 2ZS7A 3K8YA 4O3MA 2QTVB 2HCJB 4DUGA 1QBKC 4DCUA 5CJ2A 4US2R 4ZI2A 4RCYA 4QGHA 1XTIA 2IUSA 3AGPA 1X8JA 3EC2A 3PIRA 1HE8B 3TUJC 1KZGB 3U60B 3W8RA 2WJJA 3E70C 3EARA 4V0OA 2ZAOA 2QPTA 3UKDA 3L8ZA 4YXWD 3QKSA 2ZJBA 2X77A 3ZVRA 4Q66C 3ONWA 3EXAA 4G5SA 3SHFA 1NMZA 1W2HA 3SQXA 1KNQA 4B3CA 2ZTSA 4B2IA 3A6PC 4CVNA 5TMPA 4DB4A 4IXNA 2OV2A 1K5GA 1EFHA 1Q3HA 5A4JA 1BKDR 3X1ZA 1A2KC 2J0UB 1W0KA 3U7GA 2Q9CA 1KSHA 4BWYA 2ZRPA 1MO3A 4MUBA 3UG7A 2IS2A 3OF5A 3DOEA 2KB0A 3NBZC 1GSIA 1LVGA 2JGNA 2G1KA 2Z43A 1CJMA 3RWMB 1ZM2A 4D4KA 3KQKA 3FMOB 3TE6A 5D3MB 4Q19A 2C9CA 1AK2A 3V4RA 4WBSA 3ZJYA 1HYQA 1UAAA 4U00A 2RKOA 2FX3A 4GT1A 4M22A 3GJ0A 1CS4C 4HB0A 1LTQA 1SKYE 2JCSA 2NZJA 3CNOA 2IS4A 3QXCA 1DO0A 4TLDA 3P4YA 4A2WA 4BLQA 4F91B 3GMTA 2WPDA 3NH6A 1IXRC 2CK3D 2KBFA 3B1WA 1UKEA 2I1QA 3ZQJA 4TL6A 4Q7LA 2ZE7A 2VYFA 2GJAA 1RPZA 1G8PA 1BIFA 3QXXA 4A8JA 2UZIR 4JBXA 3FE2A 1KKMA 2KJQA 2XX3A 4H1UA 4UNQA 4XD7D 3OEHA 4GBMA 2FWRA 1UBFA 2BBWA 3NBYC 4BFTA 2EVWX 4B76A 3TNFA 5IHPA 4LZZA 2DY1A 4JBYA 2GHIA 2ZETA 1XMVA 1ZUHA 3SYLA 4C7OA 1SXJC 1IXZA 1VMAA 1XF9A 3THOA 1KO4A 2IEYA 4EQ6B 3GP8A 1QHHB 2YWFA 4LGMA 1JAHA 2X1VA 5BYKA 3LW8A 3GEIA 4LYAA 3VAAA 2QGZA 4W5WA 2NPIA 3NHBA 4A4DA 1GRNA 4HDQB 1G17A 2C03A 4NKRA 3FMPB 1IBRA 4TLCA 2OHFA 1FUUA 2G6BA 2IA5A 4RCZA 1R8QA 1G16A 2JIZD 1C4OA 2FFHA 3RSOA 3W9YA 1G21E 2QBYA 2OFOA 1XXHB 4RFVA 1IXSB 1MOZA 1VCNA 1W5TA 4UNNA 1JBKA 4YMTA 1E6CA 2DFNA 1NLZA 2QAGB 2GXSA 4KVAA 2R2AA 4DIEA 1X1SA 2WOOA 2PLFA 5FBWB 4NHOA 4MKFA 3FTQA 2IF2A 1II8A 2A5DA 5CDFA 1X8KA 2JLRA 1OFUX 2IHBA 3U6BA 3U3KA 1L2TA 3U3MA 1DO2A 1OT3A 1S8FA 1VG0B 3LRPA 4F4JA 2IL1A 4D26A 1R0ZA 2E87A 1BOFA 2ORVA 1KO7A 3Q5DA 1DEKA 4KSCA 4TLEA 4QBFA 1A82A 4XSGA 5AUQA 4CEJA 3CO5A 2XJ9A 3KTAA 2AXNA 4PR0A 2ZI7A 2JLZA 3KB1A 1G3IA 4PSKA 3FKSD 5C18A 5SZKB 3A1TA 2ZE5A 4DLVA 5FTJA 5CJPA 4AC9A 1R5BA 4DLYA 2IF0A 5FL3A 4W5JA 3JVUA 3BE4A 1KSGA 4QM7A 1BMFD 2O8FB 4OI4A 4UNRA 3QEJA 1JNYA 3N2EA 5EZ5A 3EX7C 4PC1A 2MSEB 4PZYA 1UDWA 1N25A 3CKLA 1ZM3A 4EAQA 4DUGD 4PZZA 2GCOA 1DE0A 5F9FA 2PEYA 4IVRA 3RABA 3U7EB 5GVRA 4B75A 4D4JA 2OAP1 2IWRA 2QE7A 5JFGA 1GG2A 2P6RA 1ZCBA 3UK6A 2GEDA 2HV8A 1E9CA 4QGAA 4QC2A 1P6XA 2PJRA 5JRJA 2JLWA 5DGXA 2XEXA 4LI0A 2QM7A 2FG5A 4AD8A 2P2LA 1U94A 5FFMA 1YZKA 3ND9A 1IOZA 3BRWD 1KO5A 4V0MA 3MWYW 1YZTA 4YC7A 2F3RA 3BIFA 4Q1FA 1EESA 4NU0A 4LK2A 3MWJA 3TW4A 5F98A 3X1YA 4BRWA 1GL6A 1GNQA 1W49A 2G77B 4LV6A 2EFHB 2REBA 3K0FB 2G88A 2ZITA 1W0KD 4UJ5A 3GJ8A 2ZRDA 4H1VA 2WKPA 2Q6TA 3QJYA 3C15C 1CIPA 2XNSA 2JLQA 1YE8A 3NG1A 4HLDA 1XPRA 1NJFA 1Z6XA 2HXYA 1AKYA 2HXSA 1D6JA 3U6KA 1GILA 4Q9JA 3AVYA 4TL9A 5TXGA 4JLBA 5HZKA 1N0VC 2WKQA 1LFDB 2CHGA 4Q21A 2IS1A 2PCLA 4FN5A 3BGWA 2W58A 1JPNA 1IJEA 2OBNA 3R9XA 1WA5A 5AJWA 1U99A 4JSYA 4OHWA 2WPDD 2ZJAA 2OLKA 5IK2A 4JL6A 1A5TA 3TGPA 3AF0A 2OXRA 2QRNA 4O0MA 2GRJA 2H17A 4Q4AA 1GKIA 2D74A 4AYXA 3K70C 3L0IB 4JSTA 2R6DA 1ESNA 3ZGXA 1N5JA 1OE0A 2G3YA 2DR3A 4M53A 4XSHA 3OEHD 1ZIPA 3BFXA 2AK2A 4QOSA 4TYPA 3RWOA 4NYJR 2A9KA 2ZQ5A 2ANCA 2QN6A 2XZOA 3V9PA 3QKRB 1KI6B 3IQXA 2Z83A 3K09A 1JR6A 1E2EA 1W4CA 2CCGA 3M0EA 4ZCMA 3RS3A 3RLFA 4BFSA 2HEIA 3KJGA 2D62A 3AVWA 1YR7A 1Z0AA 1G5RA 1T8TA 4F4IA 1ZAKA 2ASEA 3QSYA 1Z2AA 2RB4A 2QTHA 3F3YA 3AKCA 2ORIA 3I3SR 1VIAA 3UWKA 2BEKA 5JSZB 3LVRE 1I4DD 3QKUA 1XDBA 2TMKA 4OQFA 1KHTA 1W36B 5DHAA 1DTSA 2FJUA 1K6MA 4QXAA 3D7MA 1QG4A 2J0SA 4S2EA 2ZRGA 4IHQA 4AIIA 2WJGA 4BEBA 4QJ3A 3BH0A 4FWTA 4Q1CA 3TVDA 5JEEA 5AJYA 2D7CA 4QBHA 3U44A 2YVUA 4B71A 3SJAA 2GNOA 3BB4A 4KBFA 4D81A 5AUPB 3CUEF 1D5CA 1E98A 2BWJA 1OLOA 3Q72A 4MYCA 821PA 4TZ0A 5DI3A 4QFMA 4OKSA 5EE3A 4B74A 1F60A 2RGCA 5C4GB 3CLVA 1KO1A 3BH7A 4FCTA 2C95A 3WBJA 2QGNA 3PV0A 1XEXA 2ZUCA 5DYGA 3WY9A 3DKVA 4PC2A 4GP7A 1U9IA 3AKDA 4O2LA 4LBVA 4FW9A 4Z8XA 2WMNB 2VSFA 4E09A 4OHZA 2AWOA 2GCPA 2CL7X 1YVDA 1N6RA 4XTRA 4P4SA 4ILEA 4U5XA 2I3BA 1ZW6A 2D7DA 1S3GA 4FXPA 2WV9A 5FH9A 3B9QA 4ASUD 4L9SA 1TUEA 4TYYA 3RSLA 1J8MF 1XD9A 3CPHA 5JEDA 2QE7D 4DLUA 3GEEA 3PITA 1ZYUA 3EWSA 2LWIA 1NY5A 4HB3A 2PZEA 3U3RA 4MKIA 1CJTC 4NCNA 4JL5A 5EP4A 2F6RA 4BUJA 1FZQA 4GFDA 2NTYC 2NO7A 2VP6A 2FZLA 4MGYR 3JVVA 2IHYA 3ADDA 3FOZA 3RRZA 3IQWA 1ESMA 2BM0A 2UVQA 1C1YA 4LJ8A 3G0HA 4KODA 4EJSB 4TTPA 2V3CC 2ZI5A 1F2UA 1YQTA 4BQSA 3REFA 4JVLA 4C0LA 1CRPA 2CVFA 3KFXA 4M21A 3WP0A 3MFYA 2B7CA 3QVUA 2V54A 2ZR7A 2DYKA 3A36A 1X6VA 5P21A 3W90A 3CZQA 4ESVA 2ZRNA 4TQUS 2V6JA 5LBIA 3M6AA 3LD9A 1KK1A 2V7QA 2VEDA 2A5JA 1GZSA 2UZ3A 3AVOA 3NVAA 1P72A 4Q9KA 4OHXA 3GLHA 1YKSA 1OXTA 3AB3A 4M8NE 2IYSA 1Z0DA 4KFUA 2RH5A 3AP1A 1UF9A 5FTLA 1WDTA 2NO9A 3UMFA 3EWAA 1UADA 2FPMA 5K8UA 2O8CB 1RRCA 1E2GA 2ZRIA 3FMFA 1XTSA 2J87A 1QG2A 1GRQA 4Y0VA 5K8LA 2ERYA 5JCPA 3OIWA 3I61A 4AKGA 5IK2D 1E9SA 4OK6A 4IEEA 1W44A 2QG6A 2QAGC 1A2BA 3F8TA 5ANRB 4LPSA 1SVOA 4URYR 3GD7A 3P20A 4G3XA 4CEHB 1PVOA 2X8AA 2F1JA 2JLSA 1KOFA 1W47A 5F3WB 4CEIA 1T91A 2QNRA 4RSGA 4P33A 2XXAB 1GM5A 2HDNB 4JJZA 3TR0A 2ZRBA 2YZ2A 1XEWX 3NHAA 4NONA 1OF1A 2A3RA 4B2LA 4TT3A 3FHOA 4BLRA 1CU1A 5AWFC 5KDDA 3KB2A 2GAOA 4M9XA 3SJCA 2W83A 4IEIA 2C5LA 3GLFA 2W6JA 3T12A 3DEFA 3TQCA 2ZRJA 1VYVA 2CCJA 1X8LA 4J0QA 2LKCA 5AUOB 4DLZA 3NBFA 4MYTA 1VKJA 4X8LA 5TV2A 4DDWA 2QMOA 1PLLA 5GJWC 1XEWY 3OAAA 1E1RA 3QF4B 3RHFA 2XOKA 1V5WA 1JEEA 4Q01A 5C46F 1RW4A 2QY9A 1Z2CA 2G0NA 1JALA 4Q4JA 1VCIA 3GPLA 5J5CA 2FFBA 1XJCA 3C14C 2XZLA 1DELA 1Q57A 3L0PA 5FPSA 3OFNA 5EE9A 4OHVA 3QQ5A 4EIWA 1DVRA 2V1XA 1AGPA 3UWOA 2OM2A 1NVVQ 4BFXA 2ZE8A 1T0HB 1ANKA 1W1WA 2QP9X 3CRRA 1SVMA 4KAXA 4B44A 2A7QA 4G5OA 5KDOA 5A0FA 3ADBA 1YR9A 2E1RA 4HUQB 3H2YA 4NH0A 1PV4A 2ZRKA 1F2TA 2AXPA 1XCPA 1FNNA 1P3JA 4MYHA 2VP5A 1XTKA 4DSNA 3KJIA 4BECA 521PA 2OESA 721PA 1IY0A 1E32A 3ZH9B 4LOAA 1KMHA 4B48A 3TLXA 2CE7A 1TQ6A 2H18A 4DLWA 3ZLJA 2BMDA 3DOFA 2YWEA 3CB4A 3ZZUA 1XCMA 5H1YA 1NSFA 1LS6A 2REOA 1U8ZA 4NYMR 2AFHE 1WBBA 2BDTA 3RDPA 2P0EA 4DEYA 1E2KA 4EFLA 2RHDA 4KV9A 4M4SA 2R8RA 3ZVLA 1KZ7B 1XPOA 1E0AA 1YRBA 3IBYA 1YZUA 4UNSA 1E9EA 1O3YA 1FNMA 2FNAA 1NIPA 3KUDA 3QKSB 2CE2X 5JI3E 4IKEA 1S1CA 1ZINA 2GK7A 2PT5A 1DAFA 4YONB 1KNXA 3THXA 3BJIC 2B92A 4OYHA 1OKKA 5KNBA 2ZEJA 4WOPA 1H65A 3AVPA 2QI9C 2AWNA 1M7BA 1ZM4A 2BHRA 4KITB 2CNWA 4GDFA 3EPHA 1ZMXA 2GKSA 3IIMA 4MITA 4NCJA 4GZMA 4PPNA 3AF2A 5AJVB 621PA 2XJ4A 2FE4A 2FN4A 5GJVC 3MGCA 2QP4A 3PR1A 1SXJA 2GBLC 1KMQA 4RY2A 5EQTA 2V7QD 1OXUA 1PUIA 3VR2A 4ON9A 4K46A 2JJ1A 4URXR 1GTVA 1VECA 1G7CA 4L9WA 3CH5A 3I62A 3EA5A 2O8DA 5E7JA 4AWXA 4IOLA 4TTQA 2AX4A 4DDUA 1G4AE 2FSGA 2OILA 3VFDA 1II0A 1SGWA 1U0LA 2NOAA 2VRWA 1IN5A 3IUYA 4P0TA 4P31A 4Y0AA 2JLYA 2YV5A 1LF5A 5LDDC 4FD2A 1W36C 2FFAA 1PLKA 1Q20A 2V1UA 5KSPA 2IYVA 1P75A 2RMKA 4AK9A 2GXUA 4MDEA 1VTKA 2C77A 1X1RA 1XP8A 4JT2A 4KLZA 2OAQ1 2B8WA 2R6FA 4QBGB 1FP7A 2J7PA 3KQUA 4KYUA 5BYJA 3CM0A 1DS6A 4R2IA 4N0DA 1UBEA 2RGNA 1FX0A 4B32A 3A1SA 1IY1A 2KWIA 1W4RA 1KY2A 1SHKA 3S1AB 5JHGB 2Q3FA 1MH1A 4TT3D 2QAJA 4PZLA 2ZJZA 2AKAB 1R8SA 3RRMA 2JDIA 2W6JD 1RE0A 1KI8A 2HYDA 4KO8A 3QBVA 1Q3TA 3WNCA 2O0JA 3KFVA 4NCIA 3N70A 1D2EA 4IW3B 1P73A 4IVPA 2NQ2C 3GLHE 4HAYA 1SVIA 3K9HA 5HE9A 3WYAA 5CIWA 1B23P 1NKSA 5B2ZA 4C0KA 4JKYA 1ZIOA 3GLIE 4I99A 4FMDB 4KYIB 5CM8B 3OAAD 1E1RD 2W00A 3C41J 3K9GA 2ZR0A 4DCNA 4JLOA 5GJBA 4B43A 2PH1A 4TWZA 3U3JA 5L3SA 3GQBA 3TK1A 3ZS9A 1US8A 4E07A 1N6OA 3IGFA 1ZU5A 1KDTA 3K0AB 4Q1BA 1D8TA 3U5ZB 2I4IA 3AV0B 2ZSAA 3AM1A 2FGJA 3K9LA 4FI3C 4JVNA 3OFND 5LB4A 2G1JA 4Q4HB 1JQJC 1R10A 1QHIA 3UANA 1HURA 1NN1A 1P2UA 1NI3A 2ZJ5A 4D2IA 3P1JA 1DAKA 1JB1A 1UJ2A 4M1TA 1UEIA 2Z0MA 4A0HA 1UFQA 1XMSA 4EJSC 4CEJB 1I4LD 2B21A 4QJ5A 1N5LA 4G5GA 3MSXA 1OV4A 4II7A 4PPQA 3M1IA 4DLXA 1U8YA 3CR7A 3VNUA 3QNUA 3WXMA 3ZIAA 3OHMA 3REGA 2EU8A 3ZVMA 4MGKR 3GLFE 4POAA 1LV7A 3WHKA 2BEJA 4F4CA 4FMCF 3M4YA 2PCJA 1N6HA 1E2IA 1T3SA 3QE0A 4PSAA 4QHSA 4HDCA 2WSSA 4A2QA 2GCOB 4UXHA 3B5JA 1L8QA 3BS4A 4ITRC 5FPHA 2O5VA 2UKDA 3BH6A 4V0KA 2RGDA 1MR3F 1UBCA 1D2NA 3BERA 2VHUA 2VBCA 1VG9B 2WHXA 2GTPA 2PZFA 5J4YA 2CJWA 3GJ6A 3SFZA 1GITA 1EGAA 1COWA 1VG1A 2RGXA 3KZ1E 4WW0A 5H8WA 4B35A 1HEIA 5DI9A 1S1MA 2DPXA 4C3ZA 1TEVA 4JYBA 4B3FX 3TAHA 1E96A 2W0SA 3K0CC 1GKUB 1OKKD 3KKOA 2Q9AA 3EZ6A 4NZYA
chains in the Genus database with same CATH superfamily
1ZD8A 2E85A 3LPLA 1HFEL 3GHYA 3K16A 4L0QA 4UUAA 3COJA 4RGYA 4UE6A 1KJZA 1TADA 5GONF 5T57A 4FEYA 2VHYA 2YZKA 4TYMA 3BJRA 3LUBA 3OM8A 1T5IA 2JKVA 2OORC 3IESA 1ISJA 3MD0A 3ZLBA 3W6PA 4HATA 1D7AA 5AW2A 4OJYA 1QS0A 1CBUA 1O77A 4LFCB 4HNGA 4NU8X 2Z57A 1L8XA 2X4DA 2VDJA 2ZUFA 1T0PA 4KE6A 1CDZA 1T1IA 2GD2A 5U4QA 3ZW9A 3ZHTA 4WVLA 5JXHA 3W2FA 2H0AA 3NORA 4JROA 1E59A 4UUOA 4DSOA 5KVQA 1E94E 2IU3A 4H9GA 1G8AA 3O4HA 3S27A 4QUBA 5EWJA 4E15A 1G41A 5E4TA 1JHUA 3QVTA 2JAOA 2YJTD 2HUPA 2DQKA 4QOIA 2J5KA 3GGCA 5JNVA 4US0R 2BGMA 4ND4A 1KTVA 5BVHA 3U80A 5K3OA 5ALSA 1Y1SA 5HIMA 3ZHYA 2HNAA 2WD8A 5IWAB 1T9ZA 1B15A 1YASA 3UJ8A 4DLNA 4BFWA 4KDRA 5SZHB 3PUZA 3L1UA 3PQDA 1A9XB 3DEAA 4KI0A 1GTSA 2GYYA 4M49A 4ECEA 6AT1A 1X80A 1A9YA 1OYVA 3MMPA 1GD1O 2FSHA 2XGOA 4D9JA 3DBLB 1WRBA 3FWYA 2ZBVA 2YBEA 3VOBA 4CT5A 3QKIA 4WXRA 5AXDA 2OZEA 3O0DA 1P5HA 3KETA 4DIBA 3EBLA 2O7VA 4RHXA 1P1JA 5IM5A 3N8DA 5T4FA 5I7HA 3TZLA 3COPA 2CWWA 1IHXA 1XVUA 3PWSA 1P8AA 4QJBA 1MAAA 2A67A 4MS3A 5DZSA 4DJDC 4EY3A 4LHYA 1PD1A 2J0UA 5EQJB 1YUMA 2JK1A 3DLAA 3KEGA 3NIWA 2B3TA 2CMHA 4OLHA 1XJ0A 1DAIA 1GIAA 2K7ZA 1EX9A 4P83A 3H1GA 5CFQA 4KJZA 1NBMA 4YCJA 1OZAA 3PR2B 2G72A 4OXIA 5CD9A 1DWQA 1ZEJA 4MEAA 4KQHA 4Q24A 4HGYA 1BCRA 4UUNA 1TFRA 4GVXA 2POQX 6LDHA 1HL7A 2YY6A 4X7RA 5ALDA 4C2UA 2FX2A 1KJYA 2H7CA 4MUEA 2H00A 2HSGA 2KSQA 5D3MA 4Z54A 4EJMA 1MG0A 2DC1A 3DT9A 4F9EA 5BR1A 2ZLBA 2D0IA 3LM8A 2OCKA 2XZDA 3S5JA 2PJDA 3SDSA 4NEHB 2NVBA 3DVSX 3KKZA 3RT7A 1ULBA 4Z0HO 5EIEA 4QO8A 3F5MA 3QVSA 1RQGA 3DZCA 3OPYA 4N5IX 3UIEA 1FB5A 2VTVA 3IUBA 2V7EA 2OSBA 4EGCB 5D3QA 5JY1A 1R0XA 3NVKI 4X20A 4EUNA 1CB7A 4UVEA 3RCBA 1PJZA 5CGZA 2QL5A 3RJ5A 3OIYA 5EUBA 1V6AA 5IABA 1I8TA 2C9BA 2B1QA 4MA4A 4RU1A 1P45A 2EATA 3IUPA 4NYJQ 3VV2A 4KYTA 1I7LA 3L7YA 4HWGA 5IASA 1EHYA 3Q8WA 1O97C 4XX1A 1C3OB 3HDJA 2ZYTX 3PEWA 4P3NA 1UKZA 3RFXA 1QM5A 4DA9A 1XFAA 3DZKA 4UDNA 1Z29A 3W8NA 4PHFA 1LX6A 4J16C 3OM9A 4G9GA 3AESA 3GRUA 1F9AA 2JFQA 4F2DA 2B5OA 4QPJC 3DXFA 2XBLA 4WK0B 4J90A 3LFUA 3QPDA 1MTZA 5EHGA 5CB8A 1JAIA 1Q1ZA 2DTDA 3AMVA 3EXFA 3GYGA 1V1RB 2FEOA 4NBUA 3LT1A 2LDBA 4QATA 3KUCA 5A9SB 1AHPA 4R8RA 1O0SA 2J46A 2RGBA 3B6ZA 3L4KA 5LQJA 3NT5A 4INZA 4TWIA 4X64B 4KWHA 3ZU5A 4OM8A 1VPLA 4RVCA 3HDTA 2XVXA 4ES6A 2BGNA 3IPRA 1PEKE 3L41A 3QUBA 2VSYA 3L7MA 1KMMA 2AJTA 1BWRA 1SD5A 1U9YA 1ZNQO 2HPHA 4LOIA 2J7KA 1M6EX 5AVZA 1COWD 1RYNA 3JASA 3QX8A 2AZXA 1E0SA 4CQMB 4CM4B 1B2LA 1V6SA 1ZK2A 3L0SA 4Z7OB 4TZ6A 3DULA 1G8FA 1U8FO 1A77A 4TRNA 4W6QA 5FTNA 2W6NA 3N3BC 2R8EA 4LJ5A 1TM4E 4CV1A 1SOUA 5C2JB 4A91A 2J45A 4J76A 2OLJA 3L49A 1PUJA 1XDZA 3X1WA 1WCWA 3HO1A 4YJGB 2P30A 1XXLA 3LO8A 1FMLA 2QD5A 2KE5A 3FM9A 3LY5A 1BD4A 3CW2A 3R3XA 5MN6A 1IXYA 1HH4A 5THKA 3VO9A 4S1WA 2AZTA 3RAPR 2I22A 1CTQA 1W5EA 4YX9A 3H13A 5DNCA 4KBYA 5GVSA 2C0CA 3OESA 1Q2XA 3Q3VA 4D0NA 4B79A 3UCFA 5EJ9A 3DDOA 3OE7A 3GLHB 1S2OA 2FFQA 3F98A 4JC8A 2QDXA 4UEOA 3D1JA 4UFPA 4M0CA 1XUOA 1P5RA 5KDLA 3R7WB 3GLIB 2QUBA 5AI6A 4EKEA 2IIBA 5BN3B 3ASZA 2CGEA 3QWBA 1CJUC 1CPYA 1MABB 1TMGE 1U0JA 2IYTA 4LDQA 5AKJA 4WEOA 5J4VA 4BXOB 4W82A 1BHSA 2HJWA 4CKEB 3PQ3A 2QQEA 3IAXA 3VI3B 5CITA 3BGIA 3BHMA 3IOBA 2NSHA 2J3QA 2CN1A 1W46A 1F6BA 1UBUS 2BE7A 3QUSA 4N0QA 2NO0A 4RZ2A 2NYAA 3T7AA 1F0NA 1SOWA 5ICEA 2BGIA 2AS0A 2NU6A 1FSGA 1XKLA 3ESYA 3MM4A 1PS8A 3RRYA 2QUHA 4WXHA 1WNTA 1GA6A 1QIIA 2FZEA 3IAEA 3LKZA 5DBOA 4DCTA 1ZH2A 3S29A 4B09A 2DB3A 3B1VA 3WLOA 1KE2A 3UGTA 1PZMA 3STWA 3UMCA 1XRJA 1QZXA 4H4EA 5LLTA 4G01B 4UDYX 3FCYA 2OCAA 4J43A 4ZCSA 1N0IA 2NP7A 2ATIA 1LQTA 4REQA 4AMVA 4LJ9A 5I7RA 2AV6A 2WF8A 2ACKA 4F7WA 1RC1A 2XKAA 4J9VA 3L7AA 4U7JA 1YACA 2RG7A 1CUJA 4JX8A 1D2AA 3VR6D 1OXSC 3OIVA 4HAZA 1GTL1 3L7OA 4QU9A 5KTTA 2NUPB 3O8RA 1SKBA 4AG3A 1GN9A 1CK4A 5HUQA 4BQPA 1V45E 4JMPA 2E2WA 2QLFA 5LP6B 3IHLA 2TECE 3QG5A 2JRCA 3BK7A 4BKMA 1H42A 5J2TF 1OC2A 1ZJ4A 2VXOA 3HXKA 3RU9A 1XI2A 2A5LA 1QV6A 2BY4A 2KX7A 4UXJA 4ECAA 3UHAA 1FP4B 5JYDA 2JGKA 4MINA 1Z63A 1CRZA 3SHTA 4GS5A 4DA7A 3L6CA 3AEZA 3OLQA 4IJQA 3VU0A 4DDHA 1X9IA 1ARZA 3MGBA 2ICAA 4G0NA 5BQFA 1WW8A 1RXWA 1G3MA 1D6NA 2VDOB 1LS1A 3R3YA 2HFJA 2LW7A 2AK3A 1HKHA 5EOVA 4BLRA 3IXLA 4RY0A 4FYKA 2DT8A 4UXIA 1L7MA 4LKOA 5TSDA 1T9BA 5AWFC 3GLSA 3WGZA 3RNOA 2Q2OA 1X92A 2FOIA 3CN9A 3KQPA 1WU8A 4AYWA 2VDVE 2X4LA 4MVCA 4RF4A 2E55A 2V0NA 2A30A 1Y5IA 4D0GA 3SYRA 5DYNA 1K7YA 3CFYA 1HK7A 5CVCA 5SZJA 2JBHA 2QU7A 3EXIA 3GOQA 5KCMA 2DHCA 4MI6A 4FOTA 3DQZA 3DBVO 5C1BA 2H8GA 3MTQA 5FKJA 1OR8A 1J39A 1Z73A 1LWOA 4PIPA 2FR8C 1WABA 3I32A 2B6HA 1W59A 3NPAA 4I4IA 4XPIA 4CIVA 3UXEA 4EITA 1IY2A 4BDSA 5KWSA 1OOEA 4FLEA 2ZRQA 5CEEA 1NASA 1KMHB 1ZOOA 4JXJA 4O1HA 4OQZA 3CLRC 1TUBA 3L1KA 3OA0A 3O9VA 5HILA 4ETIA 3C1OA 2QSJA 2OGSA 2VIIA 4LPKA 2CLIB 2XZPA 1I94B 4J7CA 2P1DA 1PJQA 2P2CA 2CYBA 3L07A 3N2IA 3N2KB 1IOWA 1NTRA 3HSYA 2WRZA 3SZRA 5LYYA 4QAJA 3DF7A 4KWIA 4WY5A 3WIOA 1L7RA 1YUNA 1H1DA 1RFLA 3KJXA 3LHFA 5IFLA 4RVFA 3T9EA 3QVXA 4D45A 1V7ZA 4BVKA 2E89A 4FFDA 2VQEB 2P9BA 4WA8A 1N7HA 2ZSIA 3C4VA 4L51A 5C5IA 5L40A 3L8MA 3C0KA 4LYGA 1V8OA 4KQKA 4KXFB 3T9DA 1E2DA 4P86A 3PTAA 4P4TA 4HPWA 2OHOA 1CUYA 1NT4A 5DIFA 1RE1A 5KSYA 2CDRA 3BD6A 4WJKB 2ZPUA 2GHRA 5DT9A 2JIMA 4OG2A 5EE0A 3LLCA 4F4UA 2FF7A 1EVEA 1U28C 2FZ5A 3MB8A 3Q41A 4OB6A 4QBTA 1OI3A 4R2HA 5EY5B 5G3YA 5GGXA 1QNLA 2NIPA 8OHMA 5CJJA 1SCUA 3BRQA 1IULA 1XMXA 2IU6A 1JI3A 2P79A 2VUTA 5AM0A 5BSTA 3W06A 4CM3A 1VP3A 4M1QA 5IFKA 1GEEA 5B3KA 4LFAB 1RQ2A 3K31A 2X4IA 2XQFA 5LZ2A 1U63A 1XD2B 4W5OA 1TIKA 3E7DA 2YNMA 2ERCA 3WTBA 3EZ9A 4IZOA 1CIVA 2GK6A 2ZTVA 1VBNA 4RTQA 3NBXX 4TQ9A 4O3FA 3F5DA 1VLJA 5H70A 3JWJA 4NL4H 3T8YA 3EFOA 3OM0A 3UMVA 4BFVA 3JR7A 3E1GA 3ZYZA 4CQJA 4GYYA 3EPLA 4QNNA 3FAZA 4ZIRB 1WQ4A 3AEUA 1NTOA 1YQEA 4NYMQ 3WNBA 4GL2A 3JCZA 4IJUA 2HQ1A 5FBLB 2OD2A 1WTAA 4QTYA 3HJTA 5BRAA 3EYAA 5CCDA 4EO9A 3C48A 1P7YA 3TFOA 4G41A 1ZQ1A 1Y8CA 4CLXA 5JC1A 1NV9A 2UUAB 1E1KA 4AI6A 4ZU1X 4N8DA 3SJUA 1NAHA 4QYIB 3WLAA 3U7JA 1HFJA 4G0YA 3CZMA 1RAHA 1XZQA 4C08A 2AEEA 2AEMA 4FR5A 5GONA 1R0BA 1T1JA 3D8RA 4LSGA 4FHCA 4DJ5X 5K4AA 3S2FA 2YZNA 4N3NA 2BC9A 4AICA 2GPJA 1Q6ZA 2Z2YA 4P54A 2PRYA 4OMUA 4H3HB 4XOUA 3ETNA 3K1AB 1SUSA 1EE2A 1L5QA 4FHDA 4R9NA 2Z04A 4V0QA 1G20A 2CCKA 1SBZA 1N6IA 1BCSB 2IHZA 2N46A 2YWJA 3AF1A 3MXOA 2AKYA 1GFSA 3MB5A 2X19A 4PHTA 5IDYA 1WDLA 5LJLA 4R2MA 2PU5A 5G0WA 1PBTA 3BWDD 3OPVA 5I7OA 4NSNA 1H22A 5ALFA 4WLVA 1N9GB 4B83A 4EPTA 1WB9A 3B2NA 3CX4A 5CB6A 2E7ZA 1M67A 1S7GA 4ZT6A 3RIYA 1QANA 1USKA 2JAQA 4JOBA 3W5JA 1TKCA 2JD0A 3ADCA 2ZM5A 1AIPA 2E6UX 1FFBA 2DHQA 1B93A 1GDHA 1GCIA 2PZMA 3I9FA 2CL0X 1W35A 4PRYA 3T61A 4RAOA 3C5WP 1BSVA 4DW8A 2PX6A 1I7NA 3S99A 3T3OA 1TKRA 1VZ2A 1Z4JA 3OOHA 1J49A 2HGSA 5KOIA 4D25A 3D3QA 1Z2PX 1W2GA 1ZIDA 1D7OA 1K5DA 4HEJA 4BUCA 3SIPA 2XGGA 5ALMA 2AF4C 2X5NA 5G0SA 3CEAA 2ZRHA 1EHCA 2CKDA 3IDQA 2P68A 3DHEA 3PC6A 5CVJA 1WZ2A 2DJIA 2D5IA 3EIOA 1VL6A 2B25A 4NZOA 5I51A 4U4AA 3JQFC 1HQYE 2RGGA 3D4IA 5G2OA 1DPGA 5B7QA 1N2BA 3G2MA 1XAIA 1HE2A 4RL6A 4UNPA 5FWYB 4MRNA 1CZUA 1ZEMA 1G0OA 1GZUA 1Z13A 3PKJA 4IAOA 1HNXB 1LDBA 1SEPA 1P74A 2IELA 4F56A 2H1WA 3V46A 1UMBB 2P2YA 2FA9A 5EC8A 3O4JA 3E0QA 4GOXA 4JP5A 4ZQHA 4X93A 3WMRA 3KZOA 1SCBA 2FEKA 2ILVA 5FL7A 3IVGA 4LJ6A 4M0LA 4KSBA 3DUFA 4EKDA 2WABA 3KL2A 5NLLA 2NPFA 4QREA 4C7JA 2ZE6A 4ARZA 1L9KA 4LUCA 3CLUD 4RHFA 4XOIA 5KYNA 3ESAA 3S55A 2XT9A 3PD0A 2GAFA 1Y42X 1XCJA 1X7XA 3EG5A 4MQMA 4OMFG 2Y9PB 3OWOA 3A1FA 3R3VA 2VZEA 1G4HA 1K08A 1VM6A 4H2DA 4HDRB 1PV2A 4LX8A 1EDOA 2XOEA 2SKCA 3GI1A 1JEAA 1LEHA 3U56A 3QVLA 4EG7A 3DT6A 3U7FB 5K6AA 1NLFA 4ZK2A 1T3HA 1TM2A 4FTWA 3TD2A 2VUHB 1M6YA 3D2CA 3VZRA 3CX8A 1QV7A 2WYIA 3JVIA 4KU4A 5JD5A 3F49S 3UJCA 2X7XA 3TLBA 1O95A 5ALZA 4I08A 4XWWA 1J2JA 4ZK6A 1STOA 3DFUA 1AMUA 3ND5A 5TVKA 5B6JA 4V03A 5EHZA 3OCUA 1OZFA 2C3YA 3RRBA 1X15A 5KSZA 1WS6A 1JQKA 4R6WA 4XW2A 1ATZA 1VGRA 5IXSA 1UT5A 2GYUA 1YIDA 4A8JB 5KYXB 3KTOA 3MRXA 4MV8A 2WZQA 4CDGA 1NBEA 1AM4D 2BRUA 1TF5A 2J30A 3TRKA 3F4BA 3IOYA 4GI1A 1DG9A 3WDSA 4ALLA 1Z8HA 3OX1A 2EQAA 3MJRA 1PJRA 1PT7A 1TCVA 1Y8RB 3B2EA 4R1QA 3F7NA 3I1JA 2ILTA 4GZLA 3WRWA 3TOSA 5SY4A 1F14A 2P6NA 1NRIA 3AILA 3VU3A 4XWOA 2WD7B 2FSIA 3KBBA 2FUG6 2W6CX 5ERXA 2G17A 3NETA 1P1KA 1B76A 1XE3A 4I2NA 2QM8A 4FOSA 1KAMA 4P36A 1QU3A 1X9GA 1C50A 2XB4A 3EOBI 3H1EA 5DHRA 2QVGA 4PC3A 2PIAA 3GLGA 3A2NA 4MGZR 1T8WA 1SCDA 3NDJA 5EZYB 4WZAA 1QR6A 4Q1VA 1E1QA 3N8NA 4HAWA 5KNBH 3DGEC 1VA4A 1L4KA 1E62A 3EVGA 2P77A 2KLHA 4BB9A 3I42A 2QSUA 5KYKA 5TJ9A 5I7SA 4QD3A 4EPVA 2XOKD 5J2UB 1T2DA 1DG3A 1WSAA 1XSEA 1BJTA 1QB7A 1R5JA 2HRRA 3OX2A 4JT9A 4F9TA 5BSEA 4DLRA 5E7IA 1VG8A 1QP8A 3OZDA 2CHQA 3JTMA 3PXGA 3V6MA 5LLSA 3SIWA 3ZKWA 4FX5A 5IZCA 2WMYA 2H1FA 4A2PA 1WSWA 5HP4A 1T8UA 3OUTA 3E48A 5ETJA 5LPNA 4UCXA 4JI8B 2I87A 2VJDA 4PZDA 4X00A 4CRWB 3D31A 4KR2A 2MYPA 2V55B 3WWEA 1TA9A 3VSBA 2CNOA 2ZSDA 3BFJA 1OYOA 5DLQC 1LBTA 4I5EA 1Q1QA 2DU8A 5CHYA 4FOPA 1ECJA 4QDKA 4LMAA 1TTPB 3SF8A 4B3JA 4P93A 4IINA 1PVVA 3I72A 1RYDA 2JPDA 3KP1A 3B9PA 4PS1A 2ZB2A 3KTAB 3NXSA 4R1NA 3VR4H 1MORA 2ACVA 2WKRA 4IFEA 4ZVSA 3TNDA 4LV8B 4BO7A 1JJFA 4UEWA 1JIVA 3QOFA 2QN8A 1QLJA 1OH8A 4HBGA 3ELBA 4UJ3A 3DXXA 3KJEA 2WSLA 3NTUA 5GV7A 2OM6A 1UBMS 5JSKA 4J49A 1L7BA 2YFKA 3HV0A 2AHOA 2A1UB 1I33A 2QPAA 3KYBA 3DTVA 3G1TA 3A26A 3IFSA 5IJ0A 1ODIA 2XDQB 3WIUA 1CF2O 3DE5X 1NYRA 2JG3A 2HDHA 3C7DB 1HT2E 2CF5A 1YHNA 3M5PA 4B6SA 5MGNA 2AN3A 2G5CA 1YR6A 4UTZA 4IJMA 5FNVB 4FEAA 1Y9AA 3IPCA 4Q9AA 2HXGA 4XPZA 1SC9A 2XB8A 4CQLA 2VSQA 2OFPA 1FFSA 4F3NA 1B3BA 1J7KA 1N2JA 1FRQA 4JBLA 4UCWA 2NU9B 3P26A 3EXHB 3SX0A 1AC5A 4IWYA 3V00A 3N8KA 4RV9A 3B3JA 5KC8A 3IAS6 1QWSA 1GPYA 1WBDA 1F48A 1R1DA 1X42A 2VDUE 2WTAA 3NUGA 5EPOA 4N5MA 5TR9A 4OHBA 3TTSA 4ZVQA 4JKIA 4LXHA 5DE3A 1YXMA 4Z1MD 3LLMA 3PEYA 4CF5A 4WV3A 2VNHA 3GJYA 2HA4A 4KR0A 1IQPA 2FN3A 2XCQA 3K4HA 3BWCA 4GE0A 2FMIA 1QBGA 2C96A 5A9TA 1NSTA 2APJA 4I4TB 1AQUA 2EZ9A 1PTJA 4QFDA 5TMBA 1B7GO 1MJNA 4PAQA 2G0TA 3OEEA 2FN9A 5LZ8A 4RVDA 4QDUA 2YQ4A 2DLDA 4MRVA 1UBKS 4PTYA 2CLDX 1RYFA 3Q88A 4QJIA 2OPHA 2HR1A 1Q1BA 3WVNA 1SA0A 4OKIA 1E2HA 1HNNA 2GEKA 3EG9B 4L6AA 4ZJUA 1YA8A 5JWHA 3SBXA 2AFIA 2I65A 5LP1A 5J2TA 3WWZA 2ORED 1VHTA 2BFOA 1KEEA 5DSXA 3V3KA 3SVLA 1CUDA 1GPDG 2ALJA 2D3TA 2Q5CA 3KKLA 4BVJA 1SKMA 4IDCA 1T1EA 5EEHA 1RYHA 5JAZA 2IHUA 5JW6A 4RSRA 1F8GA 3F5FA 2OD7A 2YOFA 3ZE7A 4HQFA 1A8IA 2R3SA 1J2TA 4GX2A 1UAGA 5HKKD 1Y3AA 3MN1A 5U4XA 3OZBA 1YQXA 3I8SA 2IZZA 1RRGA 2WPNA 4LY9A 3VUEA 1EAYA 3CRZA 2AB0A 2PL1A 1X87A 2C8JA 3Q12A 4HC4A 1WETA 4F5DA 4B3SB 3TD6A 1J00A 1AKUA 2IK8A 1SZPA 3PUWA 2GO1A 3M8KA 1CUBA 2WJYA 1YIAA 1GRCA 4Q3LA 3L4BA 2VXCA 4YO7A 5BOSB 3SZ3A 4BAGA 2CBXA 5DFAA 3MA0A 3VDMA 1N0WA 5DNYB 5TLSA 2OCBA 3LV8A 1VIYA 3ZQUA 4FC7A 4V1CB 4JJKA 2UZ0A 2QX7A 4P3YA 4ZKEA 4QPCA 1AGRA 2ASVA 1A88A 4EO4A 1V7PC 2BMJA 1SVKA 3K0AA 5AI4A 4HXEB 3FRHA 5TPWB 3WYGA 2ONCA 1Z39A 2P5SA 4XWYA 4BKRA 3W2IA 2J3LA 2HLNA 3SMQA 4AZWA 4D8XA 2RGNC 1N5DA 4YPVA 4Y2VA 2XE7A 4PO1A 4HNSA 5D5PA 4ALNA 4IIHA 4N7BA 3ZWCA 4O4JF 5K3FA 4EA8A 4CETA 4WEQA 5CGQB 4NK4A 2RG1A 4PLCA 2FWJA 2ZK7A 4IXMA 1L5MA 3NHKA 1H5QA 3VPFA 2AI1A 3REOA 1NXOA 1C0IA 1UL1X 1T10A 2AR0A 3FRJA 2CB9A 2UYCA 1U8XX 4MW9A 2ZT7A 2D5BA 4QO7A 5J4KA 4RENA 4N8EA 4A0FA 1EG7A 3SHQA 3SLKA 4CKWB 2FRXA 5JNWA 1I14A 2H2DA 3D4NA 3FOWA 3HY6A 1Z08A 2VNKA 2YMPA 4GRDA 1Q14A 2XW6A 4MB0A 2GPWA 4C4TA 5TGDA 4QPNA 3T1VA 5DHTA 1SCJA 5CYFA 1J07A 4ASUA 4WJZA 3VH2A 1WUYA 2FOLA 1NN0A 2ECKA 2ZFUA 4J2TA 3ED1A 1XZNA 3LT4A 1SUAA 3QEMB 1N2HA 4FWIB 3T4PA 2G71A 5DGHA 4NCHA 1RP1A 3IJPA 3AIMA 3T4EA 1CFZA 3KJHA 2V45A 3SQNA 3LIIA 1DIOB 4YBZA 1MPTA 3I4LA 4BKQA 4Z3OA 3DZIA 4CKZA 1G8KA 3O47A 3GCZA 5JCOC 4OBBA 2H4ZA 3JAWA 3P2EA 4X0EA 2AR9A 3QPVA 1IDOA 3MJHA 3F74A 5DX0A 1SQGA 4AUMA 1ZL0A 4NU5A 1I7QB 3CEPB 1L7VC 4EARA 4J03A 2RIPA 4XGKA 4YO8A 2RCYA 5AVOA 3WTCA 4P4SB 5HGXA 1M75A 1QK4A 3I05A 3CIOA 3KWJA 4QBKA 4L8VA 2IE8A 4DQXA 2HYIC 1U1FA 4LTDA 5IJ9A 3FB4A 3C3JA 4ETNA 3IPYA 4EABA 4ZC1A 3T5DA 3N8GA 3DLHA 3C3PA 3PZBA 5CFRA 5GINE 1A8SA 2QVBA 1BX3A 1JHDA 2GVNA 1BVUA 3FG9A 4GR4A 5HUHA 3UMRA 4CIBA 2IYOA 4WN9B 4DUZB 3N2ZB 1JSCA 2CXQA 1RAGA 2X1LA 2H1CA 3Q4GA 2R5NA 3G85A 2FRDA 1EWRA 1N92A 1X1CA 2OXCA 4HHEA 5DOZA 2V7UA 1IIRA 1I0IA 1P2FA 4NMXB 1URPA 4F71A 1AGXA 3EGOA 3HNOA 7REQA 2OO7A 3KT3A 2IODA 5JRDS 3T0IA 4KNYA 3P96A 5DIZA 1B0AA 2C2GA 1CVRA 1W29A 1Z5OA 2VP0A 3BDVA 3BICA 1W4AA 3F5SA 3JALB 4XLLA 3ZXSA 1DJOA 2RI0A 2IQ5A 2FEAA 1ZIXA 1U1CA 2HJVA 3BIWA 3ZWQA 3TAUA 5KB3A 2PVCA 1Z6TA 4JZKA 2N42A 3MFQA 4ABYA 4JJ7A 4EJ0A 1KPIA 2FZWA 2I2AA 1QCYA 2FZ4A 3IR6A 3W5VA 1N75A 1G6HA 3G9TA 3W5SA 2PPLA 4TMFA 2FMTA 4C4RA 3BA6A 3H11B 4QNMA 1EFRA 2HH9A 1E66A 1PL0A 1RMQA 3U4AA 4PG5A 5K8TA 1RI2A 1PR9A 4ZP1A 2O8EA 3TPCA 2IP4A 4AJJA 4CT0A 5AIBA 2NSLA 1L5SA 3H04A 1S4MA 4GX1A 4NOLA 3R7FA 5LQNA 3PK0A 5CD1A 4G9EA 1UC9A 4JUFA 4AQ7A 1JQDA 1RM0A 3CT4A 4YJ2B 3JV7A 3QBTA 1GPNA 1Y63A 1AKEA 2Q4RA 4ZAXA 4F12A 5IG2A 2PUCA 2ZTUA 1ZXBA 3KPJA 3NVDA 2PBRA 4FQ5A 5IT5A 1WMBA 3VU8A 1LXCA 2EGHA 3CJQA 4RTNA 5NULA 1TJPB 1GNSA 2YRWA 3FDZA 2WJZB 5I3ZA 3PQCA 3WFZA 3Q1LA 1NXQA 5GZ3A 2FX5A 1EFUA 4ZZ2A 3D5TA 4Y67A 2O3RA 1TCBA 3TI7A 4CL2A 3WZLA 1RS0A 3PEEA 1QPGA 3GDGA 3PE4A 3HUDA 2CLHB 2HQOA 4DBLC 2B4QA 1TMKA 1YB4A 1YDMA 2AW3A 3AF3A 4JP8A 4WFIA 3PZRA 1Q44A 5AKHA 2W6IA 2EWVA 4Y1RB 4BYGA 4A03A 5JDIC 4DG5A 4F45A 2ZIWB 5EP1A 2WVGA 5ER6A 1ZNXA 5A1TA 3FHLA 1DOHA 4O6VA 3LBFA 1GLNA 2ZIFA 2Q3HA 3DQQA 1G8YA 3FPHA 5AXBA 1IQ0A 1KK0A 3WJAA 3WWOA 1E2PA 1OASA 3FFXA 2HBYA 3R24A 3PEUA 4L5AA 4O29A 4AS3A 3GP5A 1THGA 4CMHA 4AULA 3STUA 1W73A 3OZWA 3FN4A 1D4FA 3C3KA 3P94A 4FMCB 2BGUA 4GRAA 3CWQA 1V95A 4I5IA 4NAVA 4UM5A 5C5CA 2I2CA 4IRMA 3ZXXA 3N2LA 1TU0A 1TM3E 1YS7A 1WXHA 1W4BA 1YKGA 3THWA 2WU8A 4RAQA 5ILOA 4KWTA 2Q0SA 3QBEA 3K96A 4G1BA 3TLGB 4X24A 5FWDA 4UOEA 4UPEA 1H8ED 2NSDA 2PBZA 2W6ZA 2X3UA 2YBDA 1VHWA 4GL4A 2R65A 3K7EA 1W85A 2GF9A 5IT0A 2EFEB 2HIGA 3SDBA 2AYZA 3DD5A 4QX6A 2QN3A 2W11A 2BCGY 4WXYB 3PJGA 5EFOA 3Q9LA 1NVEA 2IUFA 3A4MA 4MGIR 3CLHA 2R5FA 3P2JA 3HJRA 3F7MA 1EX6A 1Q74A 3ZH2A 1GKYA 4W5QA 1S2DA 2WTUA 1WOYA 3R20A 4QQNA 5I4KA 5KIAA 4Q4JB 2PUHA 3CMMA 4G0XA 3A6DA 4QT4A 5BPHA 4Q3DA 1JG3A 2B1IA 1XRRA 5L9AA 2GPSA 4MRRA 1SCKA 2D1RA 3UUWA 4XB2A 1E9BA 3MIZA 3ZUGA 2X5KO 1WL8A 1E9AA 4MEBA 4X44A 5JS1A 1FUYB 4WFJA 2OZKA 1RYZA 5AK0A 5KHOC 2NVUA 4BO1A 2BFCA 4LWQA 2CWDA 1A27A 1JLRA 1CR4A 2PKQP 1BX0A 3K9NA 1N34B 3QX7A 1H1LA 4UNIA 5CM2Z 1C8KA 1CY8A 2C78A 3H8VA 4MPPA 3UUEA 4E5PA 3LBIA 4ENWA 4I50A 5I7VA 3GBVA 1Q1AA 1N2SA 2D5CA 3LVQE 3FWPA 5M04A 3M82A 3BE6A 2O7RA 3AH8A 3EUEA 4GEGA 2R6HA 4AXBA 4QKQA 5HZHA 2X13A 1LPPA 2I66A 1NZDA 4QT0A 4R1MA 5P8WA 1X7HA 2Q9BA 2I54A 2VQSA 3WB1A 1DAMA 3O8NA 4N18A 4NS4A 4DNXA 1LY1A 5JNLA 3OQMA 1EFPB 3A3KA 1ODCA 3DL0A 2V7VA 4MS4A 3PUYA 5HVNA 3G9XA 4O4LB 4G0QA 1YC5A 2VPXA 4TMZA 4P98A 4UQOA 1FUEA 2Y92A 3M6UA 5EZSA 2I7DA 4TXLA 2R7KA 1WBJB 3TZHA 2VYVD 2OBLA 4L5BA 4WZBE 4DMCA 4IYJA 2VZ9A 4HH4A 3TJMA 5HRCA 5FXMA 2Y0BA 4FGUA 1QHEA 1HA3A 2C9OA 4I4LA 4MZDA 4QEDA 2J48A 1G64A 2BKUA 3QH4A 1ECGA 5EHNA 2YWBA 3E5HA 5ALYA 2VPYA 4Y18A 1KAOA 2QLJA 3E3OA 5K5EA 2I3GA 2D1SA 1SK9A 3BL8A 3C98A 3W3AA 3NHZA 3WNDA 3I30X 5CA0F 4FWBA 2G67A 3TKLA 3GRZA 4EYKA 3THXB 2AIRA 4QGBA 2VKQA 4KSYA 1KP2A 3BWMA 3GFBA 3HZHA 5EMJA 2D2EA 1R0WA 2YH2A 4E70A 3KQOA 5ALOA 2J3KA 4EUFA 1Q0PA 2QVCA 2ZZMA 1E6KA 1DARA 1QGED 4IJWA 3X44A 2IFTA 1Z2DA 1FJHA 2WYWA 4GPAA 3K09C 1WO8A 6YASA 1U90A 2HMYB 3O1HB 4BV3A 1ISSA 3Q3HA 1IAVA 3BCRA 4PTZA 2A35A 3RK4A 1VE3A 2VPWA 3HKDB 4HH1A 5KYYB 3UICA 1D4OA 2VAPA 3Q3CA 1KDOA 5AHKA 5C32A 1LJUA 3GIDA 4AP6A 1DBVO 1XPJA 3GT0A 4G0MA 4JQZA 2H4YA 4RWEA 1UC4B 3EK2A 4ZO9A 4ZT5A 2PA3A 2XBUA 1PQ4A 1V16B 1K5HA 2YZMA 4ZAGA 1L5OA 1VLZA 4M0MA 5AI8A 3UFXB 4ZVKA 5JJIA 1R6BX 3O84A 3UTDA 1JWAB 3O3OB 1T36B 2PUWA 3EIQA 4U9UA 5FP0A 1ZSNA 5FR1A 2EXXA 2JJ8A 4IXDA 1ZD4A 1M1YB 4ZO7A 3BXHA 4RQBA 1PK8A 1HLPA 2ZTLA 3M4JA 2G1UA 3G1UA 2WWVD 4Q5IA 3CE6A 5DSZA 3WHIA 4U0JA 2DETA 4G4SO 1Z16A 2XYPA 4YV1A 5IVDA 3PNOA 4KAFA 3RRFA 1SCNE 1Q16A 3I5XA 2AX3A 2INGX 1MIOB 1H85A 4ZDIA 5BN5A 4I19A 2WWRA 2PYZA 3E03A 4KUHA 1CY7A 4LRSB 4QOFA 5BSMA 1HPLA 1IPFA 3I3OA 1D2RA 2VF8A 3RJTA 4Z9XA 4GR5A 4BNVA 2XDYA 1MRNA 5E9WA 1ZD9A 4X94A 4A8PA 4J9UE 1TF2A 2GJ4A 2JGFA 5LN1A 4RVSA 2WU4A 3B9BA 3K9CA 3H3JA 4JL8A 1OTXA 3LOQA 3LY8A 3F4LA 1U0BB 1ZWLA 2Y1KA 1BXKA 2UYOA 5HJ5A 1YI1A 2FP3A 1IN1A 2B94A 3WFJA 1C3EA 3MAAC 3ZVNA 2NO6A 2ZBFA 3LP6A 3R0JA 1BFUA 1U7HA 2H11A 2QDKA 2RHOA 1NJ2A 4KQXA 4LK3A 4W4TA 4X1KA 4N54A 4WACA 1D9XA 3GFVA 1F7VA 2HDWA 2WTXA 5B7NA 3ACCA 1YQQA 3ETCA 5DHPA 3RV3A 1P62B 1A5SB 4J91A 4M1YA 4RF5A 5JQWA 2HCTA 1Z4NA 2D8AA 1W9MA 1P8JA 5CTJA 5JOQA 1M0EA 4X66B 3BULA 1EVQA 2H4JA 2O3JA 2RH4A 1CW2B 2C5AA 4RZQA 2IDJA 4HWTA 3RSCA 1GQRA 1X1DA 5FPYA 5L3SB 1Z3CA 2EW2A 3GQBB 5I7WA 4LV5B 2QR3A 1DLIA 5ALJA 2FR0A 2GXQA 3IERA 2WE8A 1R4ZA 4C4OA 2JZNA 3TRIA 3IULA 1Z4PX 3CRMA 1RQPA 1SKAA 1YHYA 2D06A 2WOJA 2AL7A 1EX1A 2R00C 3IAM6 2K5UA 4UFOA 1F2DA 2QGFA 2HT6A 1XX6A 1SZCA 3RTBA 3PEVA 3HYRA 4BS9A 4JBWA 1ZR2A 5BWCA 2GK4A 1XHFA 3N1UA 4ZA2A 5G4LA 1CLUA 2QPOA 4QYMA 4IS2A 2G9ZA 3A1WA 3QXGA 1Z82A 2XD9A 3VMFA 2C98A 4FGJA 4O4JA 2ONJA 3IO5A 3UMJA 4E5DA 1W7AA 1I2BA 3KCNA 4MB6A 4CQMD 2QQ0A 5FTKA 3NAQA 3WK4A 2BT4A 5IYZF 1PS0A 1Q0QA 3I2FA 3IEUA 3OKPA 3DCNA 3TX6A 3FYHA 3NDPA 4DA4A 3F8SA 4CKYA 5IXYA 2AZDA 4AF7A 4HN2A 1LSJA 3CPJB 3INYA 3BG5A 1M0TA 5DMXA 5H16A 1LI5A 1GUZA 2FDCA 4EPYA 4FT2A 3TOXA 1F06A 3RPEA 1OLXB 4XJXA 3L79A 3I1IA 3IXMA 3FVTA 5F1YA 4HNRA 2ACEA 1JPJA 1UJ6A 4XLTA 3COSA 4LMPA 4IGEA 4IV0A 4CKBB 5DOVA 4EB3A 2G9VA 1AUPA 3H8WA 5JTTA 4LYHA 1IM2A 5COBA 3MJ4A 1DX6A 1WOMA 3ANSA 3HS3A 3EGCA 4PLYA 2P7HA 5IJAA 5L3QA 1QOZA 3FHTA 4HVLA 2FPIB 3EVTA 1ZC3A 4RLFA 1D1PA 4TVOA 2GZHA 3UVEA 2FWMX 3SXUA 1SUIA 4DREA 3GG2A 1XPUA 1XZLA 4RHCA 1BVYF 1DBQA 4F2PA 1O96A 1XQYA 3V1MA 4FYIA 2CJWB 1N7JA 4RV4A 4DY4A 1BFDA 1GNLA 1DBWA 2P78A 1QVRA 1NP6A 2YHIB 3U3OA 2AMLA 3ZGVA 2V9PA 1HT0A 1CDDA 1HZZA 2H7VA 2ZBQA