1XDFA

Crystal structure of pathogenesis-related protein llpr-10.2a from yellow lupine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
GVFTFEDESTSTIAPARLYKALVKDADAIIPKAVEAIQSIETVEGNGGPGTIKKLTLIEGGETKYVLHKIEAVDEANLRYNYSIVGGVGLPDTIEKISFETKLVEGANGGSIGKVTIKIETKGDAQPNEEEGKAAKARGDAFFKAIENYLSAHPEYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR10.2A
publication title Structure of a yellow lupin pathogenesis-related PR-10 protein belonging to a novel subclass.
pubmed doi rcsb
source organism Lupinus luteus
molecule tags Plant protein
total genus 41
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1xdfA00
3KLXA 4REJA 3CNWA 2KCZA 3KL1A 4XRTA 2N4AA 2Z9YA 3P9VA 4BKDA 4LGAA 4REHA 4FPWA 1ZXFA 2NS9A 1E09A 5C9YA 2L8OA 3C0VA 3JRQB 4BKCA 5JO1A 2IL5A 5E4MA 4MAPA 4WVOA 2E3SA 4IGWA 3NJ1A 4C94A 2LDKA 2REZA 2PCSA 4A83A 2LGHA 4IH2A 4JHGA 1XFSA 5E4DA 4REIA 2E3QA 1XDFA 1TXCA 2I9YA 1JSSA 3TL1A 2PSOA 2LE1A 1XN6A 2FFSA 3NEFA 2LCGA 3NJ0A 1VJHA 1TW0A 4B9RA 2LIOA 5E46A 2D4RA 3OJIA 4A88A 2RERA 3OQUA 4GY9A 4PSBA 4C9IA 2E3RA 2K5GA 4Z3LA 4MNSA 2E3NA 3QN1A 1XUVA 4DSCA 3E85A 4Q0KA 4A84A 1BV1A 4JHIA 3OTLA 1LLTA 4R7KA 1QMRA 5JNNA 3KAZA 4C9CA 4A85A 2KTEA 3ZVUA 3OH8A 3NJOA 2L9PA 3QSZA 3RT2A 1UW5A 1EM2A 4A81A 4JDLA 5I9JA 1X53A 3KB0A 3KAYA 3NEGA 2RESA 4OICA 4RYVA 1KCMA 3NS2A 4A80A 2L65A 2Z9ZA 3K3KA 3P51A 1ICXA 1LN3A 2EJXA 3H3SA 4Y31A 3UIDA 1LN2A 3UJLA 2M89A 1FM4A 3W9RA 1XN5A 3IE5A 3K90A 3H3QA 4DS8A 1LN1A 2LPXA 3TVRA 3NMNA 2LUZA 3NMHA 2N4BA 2LAKA 2VNEA 1Z94A 3P0LA 3PU2A 3TVQA 4LA7A 1T27A 3KDHA 2QIMA 3R6PA 4XRWA 3ELIA 2A1LA 2VQ5A 3KB3A 3NR4A 4LGBA 4N3EA 2KEWA 5JO2A 3Q63A 2WQLA 4IH0A 2E3OA 4DSBA 2QPVA 2LF2A 4MA6A 2K7HA 4IGYA 3H3TA 2BK0A 4IHRA 3NMPA 4BK7A 3UQHA 2NN5A 3NI8A 3JRSA 2E3MA 4A8UA 2M47A 4A87A 2LEQA 4N0GC 2Q3QA 4JDAA 3NMVA 4BK6A 4LG5A 4QIPA 3Q6AA 2GKDA 3FO5A 3RD6A 5E4BA 4IGVA 3IJTA 3Q64A 3KDIA 4M9BA 2E3PA 4M9WA 4A8GA 3WG8A 3KDJA 3TFZA 3W9KA 3GGNA 3PUTA 5BRLA 3RT0C 1BTVA 1B6FA 1IFVA 1T17A 5AMWA 4BTZA 3NMTA 4IGXA 2MOUA 1FSKA 5I8FA 4JHHA 2FLHA 3F08A 3H3RA 4A86A 2R55A 1H2OA 4A8VA 2KF2A
chains in the Genus database with same CATH superfamily
3KLXA 4REJA 3CNWA 2KCZA 3KL1A 4XRTA 2N4AA 5EKQC 2Z9YA 3P9VA 4BKDA 4LGAA 4REHA 4FPWA 1ZXFA 2NS9A 1E09A 5C9YA 2L8OA 3C0VA 3JRQB 4BKCA 5JO1A 2IL5A 5E4MA 4MAPA 3GL0A 2E3SA 4WVOA 4IGWA 3NJ1A 4C94A 3HVRA 2LDKA 2REZA 2PCSA 4A83A 2LGHA 4IH2A 4JHGA 1XFSA 5E4DA 4REIA 2E3QA 1XDFA 1TXCA 2I9YA 3HK2A 4E6FA 1JSSA 3TL1A 2PSOA 2LE1A 1XN6A 2FFSA 3NEFA 4QDCA 3NJ0A 1VJHA 1TW0A 2LCGA 2LIOA 5E46A 4B9RA 2D4RA 3OJIA 4A88A 2RERA 3OQUA 4GY9A 3GTSA 4PSBA 4C9IA 2ZYLA 2E3RA 2K5GA 4QDDA 4MNSA 2E3NA 4Z3LA 3QN1A 3GL2A 1XUVA 4DSCA 3E85A 4Q0KA 4A84A 1BV1A 4JHIA 3OTLA 1LLTA 4R7KA 1QMRA 5JNNA 3KAZA 4C9CA 3HJFA 4A85A 2KTEA 3ZVUA 3OH8A 3NJOA 2L9PA 3QSZA 3RT2A 1UW5A 1EM2A 4A81A 2YH6A 4JDLA 5I9JA 1X53A 3KB0A 3KAYA 3NEGA 2RESA 4OICA 4RYVA 1KCMA 3NS2A 4A80A 2L65A 3GTEA 2Z9ZA 4NCBA 3K3KA 3P51A 1ICXA 1LN3A 2EJXA 3H3SA 4Y31A 3UIDA 1LN2A 3UJLA 2M89A 1FM4A 3W9RA 1XN5A 3IE5A 3K90A 3H3QA 4DS8A 1LN1A 2LPXA 4QCKA 3NMNA 2LUZA 3TVRA 3NMHA 2N4BA 3DLBA 2LAKA 3DLHA 2LAFA 4N76A 2VNEA 1Z94A 3P0LA 3PU2A 3TVQA 4LA7A 3HO1A 1T27A 3KDHA 2QIMA 3R6PA 4XRWA 3ELIA 2A1LA 2VQ5A 3KB3A 3NR4A 4LGBA 4NCAA 4N3EA 2KEWA 4QDFB 5JO2A 3Q63A 2WQLA 4IH0A 2E3OA 4DSBA 2QPVA 3F73A 2LF2A 4MA6A 2K7HA 4IGYA 4KPYA 3H3TA 4JHYA 2BK0A 4IHRA 3NMPA 4BK7A 3UQHA 2NN5A 4N47A 3NI8A 3JRSA 2E3MA 4A8UA 2M47A 4A87A 2LEQA 4N0GC 2Q3QA 4JDAA 3NMVA 4BK6A 4LG5A 4QIPA 3Q6AA 2GKDA 3FO5A 3RD6A 3TGOC 5E4BA 4IGVA 3IJTA 3GKEA 3Q64A 3KDIA 4M9BA 3HM9A 2E3PA 3GOBA 4M9WA 4A8GA 3WG8A 3GB4A 3KDJA 3HXMA 3TFZA 3W9KA 3GGNA 3PUTA 5BRLA 3RT0C 1BTVA 1B6FA 1IFVA 1T17A 4QDFA 5AMWA 4BTZA 3NMTA 4IGXA 2MOUA 1FSKA 3NQNA 5I8FA 4JHHA 2FLHA 3F08A 4N41A 3H3RA 4A86A 2R55A 1H2OA 4A8VA 2KF2A
chains in the Genus database with same CATH topology
3KLXA 4REJA 3CNWA 2KCZA 3KL1A 4XRTA 2N4AA 5EKQC 2Z9YA 3P9VA 4BKDA 4LGAA 4REHA 4FPWA 1ZXFA 2NS9A 1E09A 5C9YA 2L8OA 3C0VA 3JRQB 4BKCA 5JO1A 2IL5A 5E4MA 4MAPA 3GL0A 2E3SA 4WVOA 4IGWA 3NJ1A 4C94A 3HVRA 2LDKA 2REZA 2PCSA 4A83A 2LGHA 4IH2A 4JHGA 1XFSA 5E4DA 4REIA 2E3QA 1XDFA 1TXCA 2I9YA 3HK2A 4E6FA 1JSSA 3TL1A 2PSOA 2LE1A 1XN6A 2FFSA 3NEFA 4QDCA 3NJ0A 1VJHA 1TW0A 2LCGA 2LIOA 5E46A 4B9RA 2D4RA 3OJIA 4A88A 2RERA 3OQUA 4GY9A 3GTSA 4PSBA 4C9IA 2ZYLA 2E3RA 2K5GA 4QDDA 4MNSA 2E3NA 4Z3LA 3QN1A 3GL2A 1XUVA 4DSCA 3E85A 4Q0KA 4A84A 1BV1A 4JHIA 3OTLA 1LLTA 4R7KA 1QMRA 5JNNA 3KAZA 4C9CA 3HJFA 4A85A 2KTEA 3ZVUA 3OH8A 3NJOA 2L9PA 3QSZA 3RT2A 1UW5A 1EM2A 4A81A 2YH6A 4JDLA 5I9JA 1X53A 3KB0A 3KAYA 3NEGA 2RESA 4OICA 4RYVA 1KCMA 3NS2A 4A80A 2L65A 3GTEA 2Z9ZA 4NCBA 3K3KA 3P51A 1ICXA 1LN3A 2EJXA 3H3SA 4Y31A 3UIDA 1LN2A 3UJLA 2M89A 1FM4A 3W9RA 1XN5A 3IE5A 3K90A 3H3QA 4DS8A 1LN1A 2LPXA 4QCKA 3NMNA 2LUZA 3TVRA 3NMHA 2N4BA 3DLBA 2LAKA 3DLHA 2LAFA 4N76A 2VNEA 1Z94A 3P0LA 3PU2A 3TVQA 4LA7A 3HO1A 1T27A 3KDHA 2QIMA 3R6PA 4XRWA 3ELIA 2A1LA 2VQ5A 3KB3A 3NR4A 4LGBA 4NCAA 4N3EA 2KEWA 4QDFB 5JO2A 3Q63A 2WQLA 4IH0A 2E3OA 4DSBA 2QPVA 3F73A 2LF2A 4MA6A 2K7HA 4IGYA 4KPYA 3H3TA 4JHYA 2BK0A 4IHRA 3NMPA 4BK7A 3UQHA 2NN5A 4N47A 3NI8A 3JRSA 2E3MA 4A8UA 2M47A 4A87A 2LEQA 4N0GC 2Q3QA 4JDAA 3NMVA 4BK6A 4LG5A 4QIPA 3Q6AA 2GKDA 3FO5A 3RD6A 3TGOC 5E4BA 4IGVA 3IJTA 3GKEA 3Q64A 3KDIA 4M9BA 3HM9A 2E3PA 3GOBA 4M9WA 4A8GA 3WG8A 3GB4A 3KDJA 3HXMA 3TFZA 3W9KA 3GGNA 3PUTA 5BRLA 3RT0C 1BTVA 1B6FA 1IFVA 1T17A 4QDFA 5AMWA 4BTZA 3NMTA 4IGXA 2MOUA 1FSKA 3NQNA 5I8FA 4JHHA 2FLHA 3F08A 4N41A 3H3RA 4A86A 2R55A 1H2OA 4A8VA 2KF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLX A;  4REJ A;  3CNW A;  2KCZ A;  3KL1 A;  4XRT A;  2N4A A;  2Z9Y A;  3P9V A;  4BKD A;  4LGA A;  4REH A;  4FPW A;  1ZXF A;  2NS9 A;  1E09 A;  5C9Y A;  2L8O A;  3C0V A;  3JRQ B;  4BKC A;  5JO1 A;  2IL5 A;  5E4M A;  4MAP A;  4WVO A;  2E3S A;  4IGW A;  3NJ1 A;  4C94 A;  2LDK A;  2REZ A;  2PCS A;  4A83 A;  2LGH A;  4IH2 A;  4JHG A;  1XFS A;  5E4D A;  4REI A;  2E3Q A;  1XDF A;  1TXC A;  2I9Y A;  1JSS A;  3TL1 A;  2PSO A;  2LE1 A;  1XN6 A;  2FFS A;  3NEF A;  2LCG A;  3NJ0 A;  1VJH A;  1TW0 A;  4B9R A;  2LIO A;  5E46 A;  2D4R A;  3OJI A;  4A88 A;  2RER A;  3OQU A;  4GY9 A;  4PSB A;  4C9I A;  2E3R A;  2K5G A;  4Z3L A;  4MNS A;  2E3N A;  3QN1 A;  1XUV A;  4DSC A;  3E85 A;  4Q0K A;  4A84 A;  1BV1 A;  4JHI A;  3OTL A;  1LLT A;  4R7K A;  1QMR A;  5JNN A;  3KAZ A;  4C9C A;  4A85 A;  2KTE A;  3ZVU A;  3OH8 A;  3NJO A;  2L9P A;  3QSZ A;  3RT2 A;  1UW5 A;  1EM2 A;  4A81 A;  4JDL A;  5I9J A;  1X53 A;  3KB0 A;  3KAY A;  3NEG A;  2RES A;  4OIC A;  4RYV A;  1KCM A;  3NS2 A;  4A80 A;  2L65 A;  2Z9Z A;  3K3K A;  3P51 A;  1ICX A;  1LN3 A;  2EJX A;  3H3S A;  4Y31 A;  3UID A;  1LN2 A;  3UJL A;  2M89 A;  1FM4 A;  3W9R A;  1XN5 A;  3IE5 A;  3K90 A;  3H3Q A;  4DS8 A;  1LN1 A;  2LPX A;  3TVR A;  3NMN A;  2LUZ A;  3NMH A;  2N4B A;  2LAK A;  2VNE A;  1Z94 A;  3P0L A;  3PU2 A;  3TVQ A;  4LA7 A;  1T27 A;  3KDH A;  2QIM A;  3R6P A;  4XRW A;  3ELI A;  2A1L A;  2VQ5 A;  3KB3 A;  3NR4 A;  4LGB A;  4N3E A;  2KEW A;  5JO2 A;  3Q63 A;  2WQL A;  4IH0 A;  2E3O A;  4DSB A;  2QPV A;  2LF2 A;  4MA6 A;  2K7H A;  4IGY A;  3H3T A;  2BK0 A;  4IHR A;  3NMP A;  4BK7 A;  3UQH A;  2NN5 A;  3NI8 A;  3JRS A;  2E3M A;  4A8U A;  2M47 A;  4A87 A;  2LEQ A;  4N0G C;  2Q3Q A;  4JDA A;  3NMV A;  4BK6 A;  4LG5 A;  4QIP A;  3Q6A A;  2GKD A;  3FO5 A;  3RD6 A;  5E4B A;  4IGV A;  3IJT A;  3Q64 A;  3KDI A;  4M9B A;  2E3P A;  4M9W A;  4A8G A;  3WG8 A;  3KDJ A;  3TFZ A;  3W9K A;  3GGN A;  3PUT A;  5BRL A;  3RT0 C;  1BTV A;  1B6F A;  1IFV A;  1T17 A;  5AMW A;  4BTZ A;  3NMT A;  4IGX A;  2MOU A;  1FSK A;  5I8F A;  4JHH A;  2FLH A;  3F08 A;  3H3R A;  4A86 A;  2R55 A;  1H2O A;  4A8V A;  2KF2 A; 
#chains in the Genus database with same CATH topology
 3KLX A;  4REJ A;  3CNW A;  2KCZ A;  3KL1 A;  4XRT A;  2N4A A;  5EKQ C;  2Z9Y A;  3P9V A;  4BKD A;  4LGA A;  4REH A;  4FPW A;  1ZXF A;  2NS9 A;  1E09 A;  5C9Y A;  2L8O A;  3C0V A;  3JRQ B;  4BKC A;  5JO1 A;  2IL5 A;  5E4M A;  4MAP A;  3GL0 A;  2E3S A;  4WVO A;  4IGW A;  3NJ1 A;  4C94 A;  3HVR A;  2LDK A;  2REZ A;  2PCS A;  4A83 A;  2LGH A;  4IH2 A;  4JHG A;  1XFS A;  5E4D A;  4REI A;  2E3Q A;  1XDF A;  1TXC A;  2I9Y A;  3HK2 A;  4E6F A;  1JSS A;  3TL1 A;  2PSO A;  2LE1 A;  1XN6 A;  2FFS A;  3NEF A;  4QDC A;  3NJ0 A;  1VJH A;  1TW0 A;  2LCG A;  2LIO A;  5E46 A;  4B9R A;  2D4R A;  3OJI A;  4A88 A;  2RER A;  3OQU A;  4GY9 A;  3GTS A;  4PSB A;  4C9I A;  2ZYL A;  2E3R A;  2K5G A;  4QDD A;  4MNS A;  2E3N A;  4Z3L A;  3QN1 A;  3GL2 A;  1XUV A;  4DSC A;  3E85 A;  4Q0K A;  4A84 A;  1BV1 A;  4JHI A;  3OTL A;  1LLT A;  4R7K A;  1QMR A;  5JNN A;  3KAZ A;  4C9C A;  3HJF A;  4A85 A;  2KTE A;  3ZVU A;  3OH8 A;  3NJO A;  2L9P A;  3QSZ A;  3RT2 A;  1UW5 A;  1EM2 A;  4A81 A;  2YH6 A;  4JDL A;  5I9J A;  1X53 A;  3KB0 A;  3KAY A;  3NEG A;  2RES A;  4OIC A;  4RYV A;  1KCM A;  3NS2 A;  4A80 A;  2L65 A;  3GTE A;  2Z9Z A;  4NCB A;  3K3K A;  3P51 A;  1ICX A;  1LN3 A;  2EJX A;  3H3S A;  4Y31 A;  3UID A;  1LN2 A;  3UJL A;  2M89 A;  1FM4 A;  3W9R A;  1XN5 A;  3IE5 A;  3K90 A;  3H3Q A;  4DS8 A;  1LN1 A;  2LPX A;  4QCK A;  3NMN A;  2LUZ A;  3TVR A;  3NMH A;  2N4B A;  3DLB A;  2LAK A;  3DLH A;  2LAF A;  4N76 A;  2VNE A;  1Z94 A;  3P0L A;  3PU2 A;  3TVQ A;  4LA7 A;  3HO1 A;  1T27 A;  3KDH A;  2QIM A;  3R6P A;  4XRW A;  3ELI A;  2A1L A;  2VQ5 A;  3KB3 A;  3NR4 A;  4LGB A;  4NCA A;  4N3E A;  2KEW A;  4QDF B;  5JO2 A;  3Q63 A;  2WQL A;  4IH0 A;  2E3O A;  4DSB A;  2QPV A;  3F73 A;  2LF2 A;  4MA6 A;  2K7H A;  4IGY A;  4KPY A;  3H3T A;  4JHY A;  2BK0 A;  4IHR A;  3NMP A;  4BK7 A;  3UQH A;  2NN5 A;  4N47 A;  3NI8 A;  3JRS A;  2E3M A;  4A8U A;  2M47 A;  4A87 A;  2LEQ A;  4N0G C;  2Q3Q A;  4JDA A;  3NMV A;  4BK6 A;  4LG5 A;  4QIP A;  3Q6A A;  2GKD A;  3FO5 A;  3RD6 A;  3TGO C;  5E4B A;  4IGV A;  3IJT A;  3GKE A;  3Q64 A;  3KDI A;  4M9B A;  3HM9 A;  2E3P A;  3GOB A;  4M9W A;  4A8G A;  3WG8 A;  3GB4 A;  3KDJ A;  3HXM A;  3TFZ A;  3W9K A;  3GGN A;  3PUT A;  5BRL A;  3RT0 C;  1BTV A;  1B6F A;  1IFV A;  1T17 A;  4QDF A;  5AMW A;  4BTZ A;  3NMT A;  4IGX A;  2MOU A;  1FSK A;  3NQN A;  5I8F A;  4JHH A;  2FLH A;  3F08 A;  4N41 A;  3H3R A;  4A86 A;  2R55 A;  1H2O A;  4A8V A;  2KF2 A; 
#chains in the Genus database with same CATH homology
 3KLX A;  4REJ A;  3CNW A;  2KCZ A;  3KL1 A;  4XRT A;  2N4A A;  5EKQ C;  2Z9Y A;  3P9V A;  4BKD A;  4LGA A;  4REH A;  4FPW A;  1ZXF A;  2NS9 A;  1E09 A;  5C9Y A;  2L8O A;  3C0V A;  3JRQ B;  4BKC A;  5JO1 A;  2IL5 A;  5E4M A;  4MAP A;  3GL0 A;  2E3S A;  4WVO A;  4IGW A;  3NJ1 A;  4C94 A;  3HVR A;  2LDK A;  2REZ A;  2PCS A;  4A83 A;  2LGH A;  4IH2 A;  4JHG A;  1XFS A;  5E4D A;  4REI A;  2E3Q A;  1XDF A;  1TXC A;  2I9Y A;  3HK2 A;  4E6F A;  1JSS A;  3TL1 A;  2PSO A;  2LE1 A;  1XN6 A;  2FFS A;  3NEF A;  4QDC A;  3NJ0 A;  1VJH A;  1TW0 A;  2LCG A;  2LIO A;  5E46 A;  4B9R A;  2D4R A;  3OJI A;  4A88 A;  2RER A;  3OQU A;  4GY9 A;  3GTS A;  4PSB A;  4C9I A;  2ZYL A;  2E3R A;  2K5G A;  4QDD A;  4MNS A;  2E3N A;  4Z3L A;  3QN1 A;  3GL2 A;  1XUV A;  4DSC A;  3E85 A;  4Q0K A;  4A84 A;  1BV1 A;  4JHI A;  3OTL A;  1LLT A;  4R7K A;  1QMR A;  5JNN A;  3KAZ A;  4C9C A;  3HJF A;  4A85 A;  2KTE A;  3ZVU A;  3OH8 A;  3NJO A;  2L9P A;  3QSZ A;  3RT2 A;  1UW5 A;  1EM2 A;  4A81 A;  2YH6 A;  4JDL A;  5I9J A;  1X53 A;  3KB0 A;  3KAY A;  3NEG A;  2RES A;  4OIC A;  4RYV A;  1KCM A;  3NS2 A;  4A80 A;  2L65 A;  3GTE A;  2Z9Z A;  4NCB A;  3K3K A;  3P51 A;  1ICX A;  1LN3 A;  2EJX A;  3H3S A;  4Y31 A;  3UID A;  1LN2 A;  3UJL A;  2M89 A;  1FM4 A;  3W9R A;  1XN5 A;  3IE5 A;  3K90 A;  3H3Q A;  4DS8 A;  1LN1 A;  2LPX A;  4QCK A;  3NMN A;  2LUZ A;  3TVR A;  3NMH A;  2N4B A;  3DLB A;  2LAK A;  3DLH A;  2LAF A;  4N76 A;  2VNE A;  1Z94 A;  3P0L A;  3PU2 A;  3TVQ A;  4LA7 A;  3HO1 A;  1T27 A;  3KDH A;  2QIM A;  3R6P A;  4XRW A;  3ELI A;  2A1L A;  2VQ5 A;  3KB3 A;  3NR4 A;  4LGB A;  4NCA A;  4N3E A;  2KEW A;  4QDF B;  5JO2 A;  3Q63 A;  2WQL A;  4IH0 A;  2E3O A;  4DSB A;  2QPV A;  3F73 A;  2LF2 A;  4MA6 A;  2K7H A;  4IGY A;  4KPY A;  3H3T A;  4JHY A;  2BK0 A;  4IHR A;  3NMP A;  4BK7 A;  3UQH A;  2NN5 A;  4N47 A;  3NI8 A;  3JRS A;  2E3M A;  4A8U A;  2M47 A;  4A87 A;  2LEQ A;  4N0G C;  2Q3Q A;  4JDA A;  3NMV A;  4BK6 A;  4LG5 A;  4QIP A;  3Q6A A;  2GKD A;  3FO5 A;  3RD6 A;  3TGO C;  5E4B A;  4IGV A;  3IJT A;  3GKE A;  3Q64 A;  3KDI A;  4M9B A;  3HM9 A;  2E3P A;  3GOB A;  4M9W A;  4A8G A;  3WG8 A;  3GB4 A;  3KDJ A;  3HXM A;  3TFZ A;  3W9K A;  3GGN A;  3PUT A;  5BRL A;  3RT0 C;  1BTV A;  1B6F A;  1IFV A;  1T17 A;  4QDF A;  5AMW A;  4BTZ A;  3NMT A;  4IGX A;  2MOU A;  1FSK A;  3NQN A;  5I8F A;  4JHH A;  2FLH A;  3F08 A;  4N41 A;  3H3R A;  4A86 A;  2R55 A;  1H2O A;  4A8V A;  2KF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...