1XE1A

Hypothetical protein from pyrococcus furiosus pfu-880080-001
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
IEILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PF0907
publication title Hypothetical Protein From Pyrococcus Furiosus Pfu-880080-001
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1xe1A00
3VO1A 4YAFA 2FX3A 2BGIA 2XNCA 4M2LA 4P6VF 4B4DA 1BX0A 2C78A 3QE2A 1Q81D 2OK8A 3ES9A 1VQ4B 3ZBTA 5JBQA 1QGZA 1VQ5B 4TMWA 1VQ7B 1KTVA 2DY1A 1EFCA 4PGOA 5DSZA 1A8PA 2EFGA 4Y7CA 1K73D 4TMTA 2PIAA 4PC1A 2YWEA 1Q7YD 1VQLB 2E1RA 1R5NA 3JQPA 4RD6A 5TV2A 3CPWB 2BVNA 3B82A 4C0SA 3AVUA 2D74A 1QGAA 2BGJA 5GV8A 1JA1A 4HE6A 3W2GA 1VQ8B 1IB0A 1JNYA 4TMZA 1QFJA 1EWYA 2BN4A 1VQKB 1F60A 1JJ2B 3AVTA 4AF6A 1IJFA 1EFTA 4LBZA 1VQPB 4TMVA 1QX4A 1TUIA 4H9GA 2BPOA 1U2RA 1CNEA 3CMAB 3CCUB 4Y9RA 2GPJA 1DDGA 2CRVA 1YHQB 3VNUA 4ACBA 1M90D 1OB2A 1BJKA 4R71A 1W35A 1KQSB 1YJNB 1OGJA 3CMEB 4ZV4A 5EMNA 1KK2A 4YAOA 3CW2A 1YJ9B 4FN5A 4PC6A 1VQNB 4RCYA 4NBSA 5AN9A 4IW3B 1KK3A 3CCVB 4ZGQB 1QUEA 1QH0A 2YWGA 4UAJA 3E20A 3MHPA 3AVWA 1QUFA 4RD1A 4PC7A 1YITB 1JB9A 1CQXA 1FNBA 1GJRA 4ZCIA 1QG0A 1JA0A 1DARA 1AMOA 1I7PA 1G7SA 4G1BA 1GAQA 3MCAA 1QVGB 3OZVA 5THXA 2XEXA 1ZM2A 1D1NA 1FNCA 3CD6B 3WXMA 1CNFA 4TMXA 1ELOA 1G7TA 1W87A 2QEXB 3QSYA 3JQQA 1QFZA 3CCLB 1EFUA 4ZGNB 4N3GA 3QFRA 3OZUA 2VNHA 1KRHA 2R6HA 1ZM3A 1N0UA 1GR1A 4B43A 1QGYA 1QVFB 2BM1A 2BMWA 4QHYA 3J81k 4TN1A 4YAUA 1YIJB 2EIXA 1YJWB 1GO2A 1VQ9B 3W2EA 2YWFA 2OTLB 3AGQA 3CCJB 5FA6A 1HA3A 1FDRA 1EXMA 4U9UA 4G1VA 4PC2A 1S0UA 1VQ6B 3WNCA 2RC5A 3CB4A 1K8AD 5TR9A 5HXBA 3P27A 4MYTA 3MMPA 3CCEB 3W2IA 1FRQA 2DERA 4M1KA 3VO2A 1H42A 2VNJA 3JQRA 3CC7B 1F20A 4F7DA 1NDHA 3QFTA 3LO8A 1B23P 2B7CA 3VNVA 3ZZ0A 4ZCLA 2NPFA 2QMUA 2VZLA 1Q82D 3U6BA 1M1KD 3ZZUA 3OJWA 3I1FA 4YHBA 3ZBUA 1KC8D 4DQLA 2HCJB 2BSAA 1ZM9A 3W5HA 2BM0A 2YWHA 2B7BA 2RC6A 3PENA 1KK0A 1H85A 1EP1B 4NCNA 3I55B 1IJEA 1D2EA 2QN6A 3CCSB 3W5UA 4ZCMA 4B48A 5H5JA 1G7RA 3CCMB 4YAWA 1E64A 3CC2B 1B2RA 3CCRB 1R5BA 3LVBA 4FK8A 1E62A 1R5OA 4PC3A 4BPRA 3W5VA 5TY0A 3WBJA 3WBKA 3CXCB 2J7KA 4WQMA 4DQKA 3CCQB 4RD2A 1FNMA 3P26A 3AVXA 1SKQA 4YALA 5KSWB 2PLFA 2QTZA 1NJID 4P3YA 4LBVA 1EP2B 1TTTA 3WY9A 2QA4B 1Q86D 4G5GA 3G6EB 4J0QA 2OTJB 2VNIA 1DG1G 4LBYA 2HMAA 2DEUA 1TLLA 4RD3A 2B5OA 1W34A 3E1YE 1QFYA 2VYQA 3B8HA 2PMDA 3W2FA 3W2HA 1KJZA 4N3NA 2X3UA 1G7CA 2QDXA 4ACAA 3I56B 1XB2A 2DCUA 4B44A 3G71B 3FPKA 1ZM4A 1OGIA 2ZITA 1KD1D 1EP3B 4B47A 1FNDA 4RD4A 4MYUA 4Q7JB 1FRNA 3G4SB 1BX1A 3AVYA 3CC4B 1KK1A 2GQFA 4AF7A 1K9MD 3U2QA 2BF4A 1XE1A 4C43A 4M53A 1J9ZA 3OW2B 5GV7A 4AC9A 1TVCA 1AIPA 1YI2B 1BQEA 4LC0A 1UMKA 3AGPA 4K1XA 3VMFA 4LBWA 1GVHA 4M4SA 3WNBA 1ZUNB 1WDTA 1W2BB 3V76A 4QFMA 1N8RD 3OJXA 1N0VC 3ZZTA 4HE5A 1S72B 3WNDA 1VQOB 3WYAA 4FWTA 3B78A 3OZWA 3FJOA 5H59A 1GAWA 2VNKA 3AVVA 2BV3A 1VQMB 2XNJA 1SM4A 2HDNB 4RD0A 4B3XA 1E63A 1OB5A 2C77A 2QTLA 3SJZA 2AHOA 3ZC3A 3U6KA 4RJLA 2DETA 2OK7A 4RCZA 3CRZA 4Y9UA 4M0LA 1D8TA 3QFSA 1DDIA 3QFCA 4EH1A 2CNDA
chains in the Genus database with same CATH superfamily
3VO1A 3ZPNA 4YAFA 2F43A 1I18A 4XM3A 1E1QA 2FX3A 1T6XA 2BGIA 2XNCA 2ZZEA 4M2LA 4P6VF 4B4DA 3FKSA 1BX0A 2C78A 3QE2A 1Q81D 2Z6BD 4G7XA 3H9NA 4L8JA 2OK8A 3OE7A 1UD8A 2WZPP 2DYIA 2C5HA 3ASPA 2DOGA 1N05A 2QGGA 3ES9A 1NRKA 1VQ4B 3ZBTA 5JBQA 1QGZA 1VQ5B 4TMWA 1VQ7B 3OFNA 4RDKA 1KTVA 2DY1A 1EFCA 4PGOA 5DSZA 5F4MA 1A8PA 2EFGA 4Y7CA 1K73D 2XZLA 4TMTA 2PIAA 1WTHD 4PC1A 2YWEA 1Q7YD 1VQLB 2E1RA 1R5NA 3JQPA 4RD6A 5TV2A 1MABA 3CPWB 2BVNA 3B82A 3PA2A 4Z4UA 3OKXA 5F4JA 3Q38A 3R6KA 4C0SA 3AVUA 5F4OA 2D74A 1QGAA 2JN9A 4GQNA 2BGJA 5GV8A 1JA1A 3T56B 4XLAA 3VR6A 4HE6A 4ASUA 5B6IA 4XLEA 1N08A 5IYNA 3W2GA 5FNZA 1VQ8B 1IB0A 2ZL7A 1JNYA 4TMZA 3ONUA 4XLFA 1QFJA 1EWYA 2BN4A 1WORA 2Q6KA 2X6WA 1VQKB 3V7AA 1F60A 1JJ2B 5L46A 5BSXA 3AVTA 4AF6A 1IJFA 1EFTA 4LBZA 2OBRA 3D26A 1VQPB 1E43A 4TMVA 1P4MA 1FX0A 3WQZA 1QX4A 1TUIA 4UZFA 4H9GA 1T6YA 2BPOA 1U2RA 1BLIA 2V7VA 1CNEA 1WOOA 3CMAB 4B3GA 3CCUB 3A35A 4Y9RA 1RQRA 1DDGA 2CRVA 2GPJA 1YHQB 2ZZQA 3VNUA 5KNLA 4XOTA 5HKKA 2WYRA 2XOKA 3KEWA 4ACBA 1M90D 4QUZA 1OB2A 4UZEA 2LZJA 2V7TA 1WOSA 1BJKA 3OP1A 4R71A 1W35A 1KQSB 1YJNB 1OGJA 1OHHA 4ZV4A 3CMEB 4JMQA 5EMNA 2CBXA 1H8EA 1KK2A 2HLDA 1HZEA 4YAOA 2OYNA 2X53S 3CW2A 1YJ9B 4FN5A 3FPPA 4PC6A 1VQNB 2WPDA 4DNRB 3A8JA 2WR8A 4RCYA 3CESA 2VBTA 2ZBUA 4NBSA 5AN9A 3PA1A 4IW3B 1KK3A 3CCVB 1COWA 4Z4TA 4Z4SA 1QUEA 1QH0A 2YWGA 4ZGQB 4UAJA 3E20A 2GK6A 3A3GA 2D3NA 4P12A 3MHPA 3GVKA 4ROXA 4X8IA 1HVXA 3AVWA 1QUFA 4RD1A 4PC7A 5CDFA 1YITB 3GVJA 1JB9A 4XLCA 1CQXA 1FNBA 1GJRA 3BNWA 4ZCIA 1QG0A 1JA0A 1DARA 2V4DA 3SEJA 1AMOA 1I7PA 4YEJA 1T5EA 1G7SA 4G6IA 4G1BA 1GAQA 4WZLA 3MCAA 1W0KA 1QVGB 3OZVA 5THXA 4XN3A 2XEXA 1ZM2A 2QE7A 2W6JA 1D1NA 1FNCA 1E3XA 4P2NA 1UD3A 1CNFA 4TMXA 1ELOA 2X6XA 4FXUA 4TT3A 3WXMA 1G7TA 1W87A 2QEXB 3QSYA 3JQQA 2Q6LA 1QFZA 3CCLB 3CMMA 1UD4A 1UD6A 4DK0A 1EFUA 1V0FA 4ZGNB 4N3GA 4RPBA 3QFRA 3ZIAA 1VHEA 3OZUA 1E1RA 2VNHA 4UZUA 1V0EA 4WZKA 1KRHA 2R6HA 1ZM3A 4KKSA 4XKVA 5J3OA 3CP2A 5LMZA 1N0UA 4YELA 2Q6IA 4X7CA 4HIZA 1GR1A 5IK2A 4B3FX 4B43A 1QGYA 1QVFB 2BM1A 2BMWA 4QHYA 3J81k 2CK3A 4TN1A 4P26A 4YAUA 1WSVA 1IHMA 2WSSA 1YIJB 2EIXA 3OPOA 5FL7A 4RPDA 1YJWB 1GO2A 2OBSA 2E1BA 4II2A 4TSFA 1VQ9B 1I8DA 1VHOA 4X7EA 2V7UA 3OOCA 2YWFA 3W2EA 1K28D 3LQEA 4Z4WA 4G7WA 2OTLB 2WZNA 3AGQA 2ZTGA 1RQPA 4QV2A 5DS0A 2F4NA 2KVOA 3CCJB 2WJVA 5FA6A 1HA3A 4KKTA 1N07A 4X06A 4XL9A 5KW9A 1FDRA 1EXMA 4PABA 3ASTA 2C5BA 3CP8A 3T53B 2GREA 3LQ6A 4G1VA 4U9UA 2VJIA 4RDJA 4PC2A 1S0UA 3ONYA 3WNCA 2RC5A 1VQ6B 1WSRA 4XNFA 3CB4A 1VLOA 2CW5A 1K8AD 2JIZA 5TR9A 5A88A 5FO1A 5HXBA 2WJYA 2R9VA 3P27A 2GJPA 4XORA 3SLDA 4MYTA 3MMPA 3CCEB 1FRQA 1Y0YA 3W2IA 1UD5A 2DERA 4M1KA 5DN6A 3VO2A 1PJ7A 1H42A 2VNJA 3JQRA 3CC7B 4P1VA 1F20A 4F7DA 1NDHA 3QFTA 3LO8A 4DNTB 1B23P 1WOPA 3CPXA 2JJ2A 2B7CA 3VNVA 2GK7A 3ZZ0A 2GJKA 2V7QA 4ZCLA 2PE3A 2W6IA 3H94A 4X05A 2NPFA 2QMUA 2VZLA 1Q82D 4OOXA 1S4MA 2F1MA 1VLYA 2V7XA 2XZPA 4WWVA 3U6BA 4Z4VA 1M1KD 1PJ6A 3ZZUA 3OJWA 3I1FA 1WU8A 4QVJA 4YHBA 4XONA 3ZBUA 1KC8D 3HAGA 4DQLA 2HCJB 2BSAA 4OOVA 1ZM9A 3KL9A 3W5HA 2BM0A 3BY2A 2YWHA 2B7BA 2X8KA 3Q3AA 1NB9A 2RC6A 1WP6A 3LNNA 3PENA 2ZXHA 1KK0A 1H85A 1EP1B 4E0FA 4NCNA 3SJPA 3I55B 2VBVA 1IJEA 5IYPA 1D2EA 2JDIA 2QN6A 3CD6B 3CCSB 2C4TA 2VBUA 1WPCA 1XFOA 3W5UA 4ZCMA 3BCDA 4XMYA 4B48A 2X0KA 5H5JA 1G7RA 2F1LA 4YAWA 3CCMB 2ZBVA 1Q9SA 1E64A 3CC2B 3R6JA 4XN0A 1B2RA 4P25A 2XGJA 3CCRB 2ZL6A 4RM0A 4XD7A 4TKOB 1R5BA 3LVBA 4FK8A 1E62A 1R5OA 1YLOA 4PC3A 4BPRA 3W5VA 5TY0A 3WBJA 2I1LA 3WBKA 4PAAA 2ZTNA 2ZZFA 3CXCB 2J7KA 4Z4ZA 5A8AA 4WQMA 4DQKA 3CCQB 3ISXA 5FIUA 3BCFA 4XLHA 3OEEA 4RD2A 4WZEA 1FNMA 5FO0A 3P26A 3GQBA 3AVXA 3A3BA 2V7WA 1SKQA 4YALA 3PUMA 4OPSA 2PLFA 2QTZA 5KSWB 5BSYA 1NJID 4P3YA 4LBVA 1EP2B 1TTTA 4X07A 3WY9A 2QA4B 4XR6A 1Q86D 4G5GA 3G6EB 4J0QA 3CTAA 2OTJB 3A1PA 2VNIA 2X6YA 3OEHA 1DG1G 4LBYA 3A8IA 4AVZA 2CC2A 1NB0A 2HMAA 2DEUA 3GSIA 1SKYB 2V31A 1TLLA 4RD3A 2B5OA 1W34A 3E1YE 1QFYA 2VYQA 3B8HA 5A89A 3NE5B 2PMDA 4Z4YA 3W2FA 3BQJA 3GIRA 3OW7A 3W2HA 1MRZA 1KJZA 1H8HA 1Y0RA 2ZZGA 5IYWA 1E79A 4P22A 1V5VA 2ZL5A 4CQJA 4N3NA 1W0JA 1G7CA 2QDXA 2X3UA 4ACAA 3ASRA 3I56B 1XB2A 1PKVA 3ASSA 2DCUA 1KMHA 2DIEA 4B44A 3G71B 3FPKA 2C4UA 1VF7A 1ZM4A 4XOPA 1OGIA 2ZITA 1VJSA 4NNJA 1KD1D 1EP3B 3BH4A 4OOSA 2XNDA 4B47A 1FNDA 4RD4A 4MYUA 4P6YA 4Q7JB 1FRNA 1EFRA 3G4SB 1BX1A 3AVYA 3CC4B 1KK1A 1KZLA 2GQFA 4AF7A 3Q6QA 1K9MD 3U2QA 2JJ1A 3ASQA 4DK1A 4RDLA 1UD2A 2BF4A 1XE1A 4C43A 2GJRA 4X7DA 2D3LA 4M53A 3RY8A 1OB0A 1J9ZA 1BMFA 3OW2B 5GV7A 4AC9A 1TVCA 1AIPA 1YI2B 5HZAA 4OPVA 1BQEA 4LC0A 1UMKA 3AGPA 4K1XA 5E6TA 4XKWA 4RLZA 3JU4A 1BPLA 3ZUGA 4KKUA 3VMFA 2Q6OA 5IYQA 5TRDA 3GVLA 1YX2A 4LBWA 1GVHA 3Q6RA 3SLNA 2XZOA 4M4SA 1ZUNB 3WNBA 1WDTA 1W2BB 2VJJA 1W9XA 3V76A 1T6ZA 4QFMA 1N8RD 1XQBA 3OJXA 1N0VC 2X85A 3T51B 4OP7A 3G05A 2NV4A 2ZXIA 3ZZTA 4HE5A 1S72B 4WZTA 3WNDA 2CF4A 2OBTA 3WYAA 1VQOB 4YXWA 4FWTA 1NBMA 4X7FA 3B78A 3OZWA 3FJOA 4QVAA 1N06A 3BY1A 4P3IA 1GAWA 5H59A 4X0CA 2VNKA 3AVVA 4Z4RA 5J35A 2C2WA 3OAAA 2BV3A 2FVGA 1VQMB 2XNJA 1SM4A 1E3ZA 2HDNB 4RD0A 4B3XA 2VBSA 1E63A 3PVDA 1OB5A 2C77A 2QTLA 3BC9A 2AHOA 3SJZA 3ZC3A 4RJLA 5HZBA 3U6KA 2DETA 2OK7A 4RCZA 4P9SA 3Q39A 3CRZA 4Z1MA 1PJ5A 2D9RA 4OPOA 3SKBA 3DDYA 4Y9UA 4M0LA 5IYRA 2P3MA 1D8TA 3QFSA 3A8KA 1DDIA 3QFCA 4II3A 4XQFA 3PUNA 4EH1A 2M5SA 2CNDA
chains in the Genus database with same CATH topology
3VO1A 4YAFA 2FX3A 2BGIA 2XNCA 4M2LA 4P6VF 4B4DA 1BX0A 2C78A 3QE2A 1Q81D 2OK8A 3ES9A 1VQ4B 3ZBTA 5JBQA 1QGZA 1VQ5B 4TMWA 1VQ7B 1KTVA 2DY1A 1EFCA 4PGOA 5DSZA 1A8PA 2EFGA 4Y7CA 1K73D 4TMTA 2PIAA 4PC1A 2YWEA 1Q7YD 1VQLB 2E1RA 1R5NA 3JQPA 4RD6A 5TV2A 3CPWB 2BVNA 3B82A 4C0SA 3AVUA 2D74A 1QGAA 2BGJA 5GV8A 1JA1A 4HE6A 3W2GA 1VQ8B 1IB0A 1JNYA 4TMZA 1QFJA 1EWYA 2BN4A 1VQKB 1F60A 1JJ2B 3AVTA 4AF6A 1IJFA 1EFTA 4LBZA 1VQPB 4TMVA 1QX4A 1TUIA 4H9GA 2BPOA 1U2RA 1CNEA 3CMAB 3CCUB 4Y9RA 2GPJA 1DDGA 2CRVA 1YHQB 3VNUA 4ACBA 1M90D 1OB2A 1BJKA 4R71A 1W35A 1KQSB 1YJNB 1OGJA 3CMEB 4ZV4A 5EMNA 1KK2A 4YAOA 3CW2A 1YJ9B 4FN5A 4PC6A 1VQNB 4RCYA 4NBSA 5AN9A 4IW3B 1KK3A 3CCVB 4ZGQB 1QUEA 1QH0A 2YWGA 4UAJA 3E20A 3MHPA 3AVWA 1QUFA 4RD1A 4PC7A 1YITB 1JB9A 1CQXA 1FNBA 1GJRA 4ZCIA 1QG0A 1JA0A 1DARA 1AMOA 1I7PA 1G7SA 4G1BA 1GAQA 3MCAA 1QVGB 3OZVA 5THXA 2XEXA 1ZM2A 1D1NA 1FNCA 3CD6B 3WXMA 1CNFA 4TMXA 1ELOA 1G7TA 1W87A 2QEXB 3QSYA 3JQQA 1QFZA 3CCLB 1EFUA 4ZGNB 4N3GA 3QFRA 3OZUA 2VNHA 1KRHA 2R6HA 1ZM3A 1N0UA 1GR1A 4B43A 1QGYA 1QVFB 2BM1A 2BMWA 4QHYA 3J81k 4TN1A 4YAUA 1YIJB 2EIXA 1YJWB 1GO2A 1VQ9B 3W2EA 2YWFA 2OTLB 3AGQA 3CCJB 5FA6A 1HA3A 1FDRA 1EXMA 4U9UA 4G1VA 4PC2A 1S0UA 1VQ6B 3WNCA 2RC5A 3CB4A 1K8AD 5TR9A 5HXBA 3P27A 4MYTA 3MMPA 3CCEB 3W2IA 1FRQA 2DERA 4M1KA 3VO2A 1H42A 2VNJA 3JQRA 3CC7B 1F20A 4F7DA 1NDHA 3QFTA 3LO8A 1B23P 2B7CA 3VNVA 3ZZ0A 4ZCLA 2NPFA 2QMUA 2VZLA 1Q82D 3U6BA 1M1KD 3ZZUA 3OJWA 3I1FA 4YHBA 3ZBUA 1KC8D 4DQLA 2HCJB 2BSAA 1ZM9A 3W5HA 2BM0A 2YWHA 2B7BA 2RC6A 3PENA 1KK0A 1H85A 1EP1B 4NCNA 3I55B 1IJEA 1D2EA 2QN6A 3CCSB 3W5UA 4ZCMA 4B48A 5H5JA 1G7RA 3CCMB 4YAWA 1E64A 3CC2B 1B2RA 3CCRB 1R5BA 3LVBA 4FK8A 1E62A 1R5OA 4PC3A 4BPRA 3W5VA 5TY0A 3WBJA 3WBKA 3CXCB 2J7KA 4WQMA 4DQKA 3CCQB 4RD2A 1FNMA 3P26A 3AVXA 1SKQA 4YALA 5KSWB 2PLFA 2QTZA 1NJID 4P3YA 4LBVA 1EP2B 1TTTA 3WY9A 2QA4B 1Q86D 4G5GA 3G6EB 4J0QA 2OTJB 2VNIA 1DG1G 4LBYA 2HMAA 2DEUA 1TLLA 4RD3A 2B5OA 1W34A 3E1YE 1QFYA 2VYQA 3B8HA 2PMDA 3W2FA 3W2HA 1KJZA 4N3NA 2X3UA 1G7CA 2QDXA 4ACAA 3I56B 1XB2A 2DCUA 4B44A 3G71B 3FPKA 1ZM4A 1OGIA 2ZITA 1KD1D 1EP3B 4B47A 1FNDA 4RD4A 4MYUA 4Q7JB 1FRNA 3G4SB 1BX1A 3AVYA 3CC4B 1KK1A 2GQFA 4AF7A 1K9MD 3U2QA 2BF4A 1XE1A 4C43A 4M53A 1J9ZA 3OW2B 5GV7A 4AC9A 1TVCA 1AIPA 1YI2B 1BQEA 4LC0A 1UMKA 3AGPA 4K1XA 3VMFA 4LBWA 1GVHA 4M4SA 3WNBA 1ZUNB 1WDTA 1W2BB 3V76A 4QFMA 1N8RD 3OJXA 1N0VC 3ZZTA 4HE5A 1S72B 3WNDA 1VQOB 3WYAA 4FWTA 3B78A 3OZWA 3FJOA 5H59A 1GAWA 2VNKA 3AVVA 2BV3A 1VQMB 2XNJA 1SM4A 2HDNB 4RD0A 4B3XA 1E63A 1OB5A 2C77A 2QTLA 3SJZA 2AHOA 3ZC3A 3U6KA 4RJLA 2DETA 2OK7A 4RCZA 3CRZA 4Y9UA 4M0LA 1D8TA 3QFSA 1DDIA 3QFCA 4EH1A 2CNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VO1 A;  4YAF A;  2FX3 A;  2BGI A;  2XNC A;  4M2L A;  4P6V F;  4B4D A;  1BX0 A;  2C78 A;  3QE2 A;  1Q81 D;  2OK8 A;  3ES9 A;  1VQ4 B;  3ZBT A;  5JBQ A;  1QGZ A;  1VQ5 B;  4TMW A;  1VQ7 B;  1KTV A;  2DY1 A;  1EFC A;  4PGO A;  5DSZ A;  1A8P A;  2EFG A;  4Y7C A;  1K73 D;  4TMT A;  2PIA A;  4PC1 A;  2YWE A;  1Q7Y D;  1VQL B;  2E1R A;  1R5N A;  3JQP A;  4RD6 A;  5TV2 A;  3CPW B;  2BVN A;  3B82 A;  4C0S A;  3AVU A;  2D74 A;  1QGA A;  2BGJ A;  5GV8 A;  1JA1 A;  4HE6 A;  3W2G A;  1VQ8 B;  1IB0 A;  1JNY A;  4TMZ A;  1QFJ A;  1EWY A;  2BN4 A;  1VQK B;  1F60 A;  1JJ2 B;  3AVT A;  4AF6 A;  1IJF A;  1EFT A;  4LBZ A;  1VQP B;  4TMV A;  1QX4 A;  1TUI A;  4H9G A;  2BPO A;  1U2R A;  1CNE A;  3CMA B;  3CCU B;  4Y9R A;  2GPJ A;  1DDG A;  2CRV A;  1YHQ B;  3VNU A;  4ACB A;  1M90 D;  1OB2 A;  1BJK A;  4R71 A;  1W35 A;  1KQS B;  1YJN B;  1OGJ A;  3CME B;  4ZV4 A;  5EMN A;  1KK2 A;  4YAO A;  3CW2 A;  1YJ9 B;  4FN5 A;  4PC6 A;  1VQN B;  4RCY A;  4NBS A;  5AN9 A;  4IW3 B;  1KK3 A;  3CCV B;  4ZGQ B;  1QUE A;  1QH0 A;  2YWG A;  4UAJ A;  3E20 A;  3MHP A;  3AVW A;  1QUF A;  4RD1 A;  4PC7 A;  1YIT B;  1JB9 A;  1CQX A;  1FNB A;  1GJR A;  4ZCI A;  1QG0 A;  1JA0 A;  1DAR A;  1AMO A;  1I7P A;  1G7S A;  4G1B A;  1GAQ A;  3MCA A;  1QVG B;  3OZV A;  5THX A;  2XEX A;  1ZM2 A;  1D1N A;  1FNC A;  3CD6 B;  3WXM A;  1CNF A;  4TMX A;  1ELO A;  1G7T A;  1W87 A;  2QEX B;  3QSY A;  3JQQ A;  1QFZ A;  3CCL B;  1EFU A;  4ZGN B;  4N3G A;  3QFR A;  3OZU A;  2VNH A;  1KRH A;  2R6H A;  1ZM3 A;  1N0U A;  1GR1 A;  4B43 A;  1QGY A;  1QVF B;  2BM1 A;  2BMW A;  4QHY A;  3J81 k;  4TN1 A;  4YAU A;  1YIJ B;  2EIX A;  1YJW B;  1GO2 A;  1VQ9 B;  3W2E A;  2YWF A;  2OTL B;  3AGQ A;  3CCJ B;  5FA6 A;  1HA3 A;  1FDR A;  1EXM A;  4U9U A;  4G1V A;  4PC2 A;  1S0U A;  1VQ6 B;  3WNC A;  2RC5 A;  3CB4 A;  1K8A D;  5TR9 A;  5HXB A;  3P27 A;  4MYT A;  3MMP A;  3CCE B;  3W2I A;  1FRQ A;  2DER A;  4M1K A;  3VO2 A;  1H42 A;  2VNJ A;  3JQR A;  3CC7 B;  1F20 A;  4F7D A;  1NDH A;  3QFT A;  3LO8 A;  1B23 P;  2B7C A;  3VNV A;  3ZZ0 A;  4ZCL A;  2NPF A;  2QMU A;  2VZL A;  1Q82 D;  3U6B A;  1M1K D;  3ZZU A;  3OJW A;  3I1F A;  4YHB A;  3ZBU A;  1KC8 D;  4DQL A;  2HCJ B;  2BSA A;  1ZM9 A;  3W5H A;  2BM0 A;  2YWH A;  2B7B A;  2RC6 A;  3PEN A;  1KK0 A;  1H85 A;  1EP1 B;  4NCN A;  3I55 B;  1IJE A;  1D2E A;  2QN6 A;  3CCS B;  3W5U A;  4ZCM A;  4B48 A;  5H5J A;  1G7R A;  3CCM B;  4YAW A;  1E64 A;  3CC2 B;  1B2R A;  3CCR B;  1R5B A;  3LVB A;  4FK8 A;  1E62 A;  1R5O A;  4PC3 A;  4BPR A;  3W5V A;  5TY0 A;  3WBJ A;  3WBK A;  3CXC B;  2J7K A;  4WQM A;  4DQK A;  3CCQ B;  4RD2 A;  1FNM A;  3P26 A;  3AVX A;  1SKQ A;  4YAL A;  5KSW B;  2PLF A;  2QTZ A;  1NJI D;  4P3Y A;  4LBV A;  1EP2 B;  1TTT A;  3WY9 A;  2QA4 B;  1Q86 D;  4G5G A;  3G6E B;  4J0Q A;  2OTJ B;  2VNI A;  1DG1 G;  4LBY A;  2HMA A;  2DEU A;  1TLL A;  4RD3 A;  2B5O A;  1W34 A;  3E1Y E;  1QFY A;  2VYQ A;  3B8H A;  2PMD A;  3W2F A;  3W2H A;  1KJZ A;  4N3N A;  2X3U A;  1G7C A;  2QDX A;  4ACA A;  3I56 B;  1XB2 A;  2DCU A;  4B44 A;  3G71 B;  3FPK A;  1ZM4 A;  1OGI A;  2ZIT A;  1KD1 D;  1EP3 B;  4B47 A;  1FND A;  4RD4 A;  4MYU A;  4Q7J B;  1FRN A;  3G4S B;  1BX1 A;  3AVY A;  3CC4 B;  1KK1 A;  2GQF A;  4AF7 A;  1K9M D;  3U2Q A;  2BF4 A;  1XE1 A;  4C43 A;  4M53 A;  1J9Z A;  3OW2 B;  5GV7 A;  4AC9 A;  1TVC A;  1AIP A;  1YI2 B;  1BQE A;  4LC0 A;  1UMK A;  3AGP A;  4K1X A;  3VMF A;  4LBW A;  1GVH A;  4M4S A;  3WNB A;  1ZUN B;  1WDT A;  1W2B B;  3V76 A;  4QFM A;  1N8R D;  3OJX A;  1N0V C;  3ZZT A;  4HE5 A;  1S72 B;  3WND A;  1VQO B;  3WYA A;  4FWT A;  3B78 A;  3OZW A;  3FJO A;  5H59 A;  1GAW A;  2VNK A;  3AVV A;  2BV3 A;  1VQM B;  2XNJ A;  1SM4 A;  2HDN B;  4RD0 A;  4B3X A;  1E63 A;  1OB5 A;  2C77 A;  2QTL A;  3SJZ A;  2AHO A;  3ZC3 A;  3U6K A;  4RJL A;  2DET A;  2OK7 A;  4RCZ A;  3CRZ A;  4Y9U A;  4M0L A;  1D8T A;  3QFS A;  1DDI A;  3QFC A;  4EH1 A;  2CND A; 
#chains in the Genus database with same CATH topology
 3VO1 A;  3ZPN A;  4YAF A;  2F43 A;  1I18 A;  4XM3 A;  1E1Q A;  2FX3 A;  1T6X A;  2BGI A;  2XNC A;  2ZZE A;  4M2L A;  4P6V F;  4B4D A;  3FKS A;  1BX0 A;  2C78 A;  3QE2 A;  1Q81 D;  2Z6B D;  4G7X A;  3H9N A;  4L8J A;  2OK8 A;  3OE7 A;  1UD8 A;  2WZP P;  2DYI A;  2C5H A;  3ASP A;  2DOG A;  1N05 A;  2QGG A;  3ES9 A;  1NRK A;  1VQ4 B;  3ZBT A;  5JBQ A;  1QGZ A;  1VQ5 B;  4TMW A;  1VQ7 B;  3OFN A;  4RDK A;  1KTV A;  2DY1 A;  1EFC A;  4PGO A;  5DSZ A;  5F4M A;  1A8P A;  2EFG A;  4Y7C A;  1K73 D;  2XZL A;  4TMT A;  2PIA A;  1WTH D;  4PC1 A;  2YWE A;  1Q7Y D;  1VQL B;  2E1R A;  1R5N A;  3JQP A;  4RD6 A;  5TV2 A;  1MAB A;  3CPW B;  2BVN A;  3B82 A;  3PA2 A;  4Z4U A;  3OKX A;  5F4J A;  3Q38 A;  3R6K A;  4C0S A;  3AVU A;  5F4O A;  2D74 A;  1QGA A;  2JN9 A;  4GQN A;  2BGJ A;  5GV8 A;  1JA1 A;  3T56 B;  4XLA A;  3VR6 A;  4HE6 A;  4ASU A;  5B6I A;  4XLE A;  1N08 A;  5IYN A;  3W2G A;  5FNZ A;  1VQ8 B;  1IB0 A;  2ZL7 A;  1JNY A;  4TMZ A;  3ONU A;  4XLF A;  1QFJ A;  1EWY A;  2BN4 A;  1WOR A;  2Q6K A;  2X6W A;  1VQK B;  3V7A A;  1F60 A;  1JJ2 B;  5L46 A;  5BSX A;  3AVT A;  4AF6 A;  1IJF A;  1EFT A;  4LBZ A;  2OBR A;  3D26 A;  1VQP B;  1E43 A;  4TMV A;  1P4M A;  1FX0 A;  3WQZ A;  1QX4 A;  1TUI A;  4UZF A;  4H9G A;  1T6Y A;  2BPO A;  1U2R A;  1BLI A;  2V7V A;  1CNE A;  1WOO A;  3CMA B;  4B3G A;  3CCU B;  3A35 A;  4Y9R A;  1RQR A;  1DDG A;  2CRV A;  2GPJ A;  1YHQ B;  2ZZQ A;  3VNU A;  5KNL A;  4XOT A;  5HKK A;  2WYR A;  2XOK A;  3KEW A;  4ACB A;  1M90 D;  4QUZ A;  1OB2 A;  4UZE A;  2LZJ A;  2V7T A;  1WOS A;  1BJK A;  3OP1 A;  4R71 A;  1W35 A;  1KQS B;  1YJN B;  1OGJ A;  1OHH A;  4ZV4 A;  3CME B;  4JMQ A;  5EMN A;  2CBX A;  1H8E A;  1KK2 A;  2HLD A;  1HZE A;  4YAO A;  2OYN A;  2X53 S;  3CW2 A;  1YJ9 B;  4FN5 A;  3FPP A;  4PC6 A;  1VQN B;  2WPD A;  4DNR B;  3A8J A;  2WR8 A;  4RCY A;  3CES A;  2VBT A;  2ZBU A;  4NBS A;  5AN9 A;  3PA1 A;  4IW3 B;  1KK3 A;  3CCV B;  1COW A;  4Z4T A;  4Z4S A;  1QUE A;  1QH0 A;  2YWG A;  4ZGQ B;  4UAJ A;  3E20 A;  2GK6 A;  3A3G A;  2D3N A;  4P12 A;  3MHP A;  3GVK A;  4ROX A;  4X8I A;  1HVX A;  3AVW A;  1QUF A;  4RD1 A;  4PC7 A;  5CDF A;  1YIT B;  3GVJ A;  1JB9 A;  4XLC A;  1CQX A;  1FNB A;  1GJR A;  3BNW A;  4ZCI A;  1QG0 A;  1JA0 A;  1DAR A;  2V4D A;  3SEJ A;  1AMO A;  1I7P A;  4YEJ A;  1T5E A;  1G7S A;  4G6I A;  4G1B A;  1GAQ A;  4WZL A;  3MCA A;  1W0K A;  1QVG B;  3OZV A;  5THX A;  4XN3 A;  2XEX A;  1ZM2 A;  2QE7 A;  2W6J A;  1D1N A;  1FNC A;  1E3X A;  4P2N A;  1UD3 A;  1CNF A;  4TMX A;  1ELO A;  2X6X A;  4FXU A;  4TT3 A;  3WXM A;  1G7T A;  1W87 A;  2QEX B;  3QSY A;  3JQQ A;  2Q6L A;  1QFZ A;  3CCL B;  3CMM A;  1UD4 A;  1UD6 A;  4DK0 A;  1EFU A;  1V0F A;  4ZGN B;  4N3G A;  4RPB A;  3QFR A;  3ZIA A;  1VHE A;  3OZU A;  1E1R A;  2VNH A;  4UZU A;  1V0E A;  4WZK A;  1KRH A;  2R6H A;  1ZM3 A;  4KKS A;  4XKV A;  5J3O A;  3CP2 A;  5LMZ A;  1N0U A;  4YEL A;  2Q6I A;  4X7C A;  4HIZ A;  1GR1 A;  5IK2 A;  4B3F X;  4B43 A;  1QGY A;  1QVF B;  2BM1 A;  2BMW A;  4QHY A;  3J81 k;  2CK3 A;  4TN1 A;  4P26 A;  4YAU A;  1WSV A;  1IHM A;  2WSS A;  1YIJ B;  2EIX A;  3OPO A;  5FL7 A;  4RPD A;  1YJW B;  1GO2 A;  2OBS A;  2E1B A;  4II2 A;  4TSF A;  1VQ9 B;  1I8D A;  1VHO A;  4X7E A;  2V7U A;  3OOC A;  2YWF A;  3W2E A;  1K28 D;  3LQE A;  4Z4W A;  4G7W A;  2OTL B;  2WZN A;  3AGQ A;  2ZTG A;  1RQP A;  4QV2 A;  5DS0 A;  2F4N A;  2KVO A;  3CCJ B;  2WJV A;  5FA6 A;  1HA3 A;  4KKT A;  1N07 A;  4X06 A;  4XL9 A;  5KW9 A;  1FDR A;  1EXM A;  4PAB A;  3AST A;  2C5B A;  3CP8 A;  3T53 B;  2GRE A;  3LQ6 A;  4G1V A;  4U9U A;  2VJI A;  4RDJ A;  4PC2 A;  1S0U A;  3ONY A;  3WNC A;  2RC5 A;  1VQ6 B;  1WSR A;  4XNF A;  3CB4 A;  1VLO A;  2CW5 A;  1K8A D;  2JIZ A;  5TR9 A;  5A88 A;  5FO1 A;  5HXB A;  2WJY A;  2R9V A;  3P27 A;  2GJP A;  4XOR A;  3SLD A;  4MYT A;  3MMP A;  3CCE B;  1FRQ A;  1Y0Y A;  3W2I A;  1UD5 A;  2DER A;  4M1K A;  5DN6 A;  3VO2 A;  1PJ7 A;  1H42 A;  2VNJ A;  3JQR A;  3CC7 B;  4P1V A;  1F20 A;  4F7D A;  1NDH A;  3QFT A;  3LO8 A;  4DNT B;  1B23 P;  1WOP A;  3CPX A;  2JJ2 A;  2B7C A;  3VNV A;  2GK7 A;  3ZZ0 A;  2GJK A;  2V7Q A;  4ZCL A;  2PE3 A;  2W6I A;  3H94 A;  4X05 A;  2NPF A;  2QMU A;  2VZL A;  1Q82 D;  4OOX A;  1S4M A;  2F1M A;  1VLY A;  2V7X A;  2XZP A;  4WWV A;  3U6B A;  4Z4V A;  1M1K D;  1PJ6 A;  3ZZU A;  3OJW A;  3I1F A;  1WU8 A;  4QVJ A;  4YHB A;  4XON A;  3ZBU A;  1KC8 D;  3HAG A;  4DQL A;  2HCJ B;  2BSA A;  4OOV A;  1ZM9 A;  3KL9 A;  3W5H A;  2BM0 A;  3BY2 A;  2YWH A;  2B7B A;  2X8K A;  3Q3A A;  1NB9 A;  2RC6 A;  1WP6 A;  3LNN A;  3PEN A;  2ZXH A;  1KK0 A;  1H85 A;  1EP1 B;  4E0F A;  4NCN A;  3SJP A;  3I55 B;  2VBV A;  1IJE A;  5IYP A;  1D2E A;  2JDI A;  2QN6 A;  3CD6 B;  3CCS B;  2C4T A;  2VBU A;  1WPC A;  1XFO A;  3W5U A;  4ZCM A;  3BCD A;  4XMY A;  4B48 A;  2X0K A;  5H5J A;  1G7R A;  2F1L A;  4YAW A;  3CCM B;  2ZBV A;  1Q9S A;  1E64 A;  3CC2 B;  3R6J A;  4XN0 A;  1B2R A;  4P25 A;  2XGJ A;  3CCR B;  2ZL6 A;  4RM0 A;  4XD7 A;  4TKO B;  1R5B A;  3LVB A;  4FK8 A;  1E62 A;  1R5O A;  1YLO A;  4PC3 A;  4BPR A;  3W5V A;  5TY0 A;  3WBJ A;  2I1L A;  3WBK A;  4PAA A;  2ZTN A;  2ZZF A;  3CXC B;  2J7K A;  4Z4Z A;  5A8A A;  4WQM A;  4DQK A;  3CCQ B;  3ISX A;  5FIU A;  3BCF A;  4XLH A;  3OEE A;  4RD2 A;  4WZE A;  1FNM A;  5FO0 A;  3P26 A;  3GQB A;  3AVX A;  3A3B A;  2V7W A;  1SKQ A;  4YAL A;  3PUM A;  4OPS A;  2PLF A;  2QTZ A;  5KSW B;  5BSY A;  1NJI D;  4P3Y A;  4LBV A;  1EP2 B;  1TTT A;  4X07 A;  3WY9 A;  2QA4 B;  4XR6 A;  1Q86 D;  4G5G A;  3G6E B;  4J0Q A;  3CTA A;  2OTJ B;  3A1P A;  2VNI A;  2X6Y A;  3OEH A;  1DG1 G;  4LBY A;  3A8I A;  4AVZ A;  2CC2 A;  1NB0 A;  2HMA A;  2DEU A;  3GSI A;  1SKY B;  2V31 A;  1TLL A;  4RD3 A;  2B5O A;  1W34 A;  3E1Y E;  1QFY A;  2VYQ A;  3B8H A;  5A89 A;  3NE5 B;  2PMD A;  4Z4Y A;  3W2F A;  3BQJ A;  3GIR A;  3OW7 A;  3W2H A;  1MRZ A;  1KJZ A;  1H8H A;  1Y0R A;  2ZZG A;  5IYW A;  1E79 A;  4P22 A;  1V5V A;  2ZL5 A;  4CQJ A;  4N3N A;  1W0J A;  1G7C A;  2QDX A;  2X3U A;  4ACA A;  3ASR A;  3I56 B;  1XB2 A;  1PKV A;  3ASS A;  2DCU A;  1KMH A;  2DIE A;  4B44 A;  3G71 B;  3FPK A;  2C4U A;  1VF7 A;  1ZM4 A;  4XOP A;  1OGI A;  2ZIT A;  1VJS A;  4NNJ A;  1KD1 D;  1EP3 B;  3BH4 A;  4OOS A;  2XND A;  4B47 A;  1FND A;  4RD4 A;  4MYU A;  4P6Y A;  4Q7J B;  1FRN A;  1EFR A;  3G4S B;  1BX1 A;  3AVY A;  3CC4 B;  1KK1 A;  1KZL A;  2GQF A;  4AF7 A;  3Q6Q A;  1K9M D;  3U2Q A;  2JJ1 A;  3ASQ A;  4DK1 A;  4RDL A;  1UD2 A;  2BF4 A;  1XE1 A;  4C43 A;  2GJR A;  4X7D A;  2D3L A;  4M53 A;  3RY8 A;  1OB0 A;  1J9Z A;  1BMF A;  3OW2 B;  5GV7 A;  4AC9 A;  1TVC A;  1AIP A;  1YI2 B;  5HZA A;  4OPV A;  1BQE A;  4LC0 A;  1UMK A;  3AGP A;  4K1X A;  5E6T A;  4XKW A;  4RLZ A;  3JU4 A;  1BPL A;  3ZUG A;  4KKU A;  3VMF A;  2Q6O A;  5IYQ A;  5TRD A;  3GVL A;  1YX2 A;  4LBW A;  1GVH A;  3Q6R A;  3SLN A;  2XZO A;  4M4S A;  1ZUN B;  3WNB A;  1WDT A;  1W2B B;  2VJJ A;  1W9X A;  3V76 A;  1T6Z A;  4QFM A;  1N8R D;  1XQB A;  3OJX A;  1N0V C;  2X85 A;  3T51 B;  4OP7 A;  3G05 A;  2NV4 A;  2ZXI A;  3ZZT A;  4HE5 A;  1S72 B;  4WZT A;  3WND A;  2CF4 A;  2OBT A;  3WYA A;  1VQO B;  4YXW A;  4FWT A;  1NBM A;  4X7F A;  3B78 A;  3OZW A;  3FJO A;  4QVA A;  1N06 A;  3BY1 A;  4P3I A;  1GAW A;  5H59 A;  4X0C A;  2VNK A;  3AVV A;  4Z4R A;  5J35 A;  2C2W A;  3OAA A;  2BV3 A;  2FVG A;  1VQM B;  2XNJ A;  1SM4 A;  1E3Z A;  2HDN B;  4RD0 A;  4B3X A;  2VBS A;  1E63 A;  3PVD A;  1OB5 A;  2C77 A;  2QTL A;  3BC9 A;  2AHO A;  3SJZ A;  3ZC3 A;  4RJL A;  5HZB A;  3U6K A;  2DET A;  2OK7 A;  4RCZ A;  4P9S A;  3Q39 A;  3CRZ A;  4Z1M A;  1PJ5 A;  2D9R A;  4OPO A;  3SKB A;  3DDY A;  4Y9U A;  4M0L A;  5IYR A;  2P3M A;  1D8T A;  3QFS A;  3A8K A;  1DDI A;  3QFC A;  4II3 A;  4XQF A;  3PUN A;  4EH1 A;  2M5S A;  2CND A; 
#chains in the Genus database with same CATH homology
 3VO1 A;  4YAF A;  2FX3 A;  2BGI A;  2XNC A;  4M2L A;  4P6V F;  4B4D A;  1BX0 A;  2C78 A;  3QE2 A;  1Q81 D;  2OK8 A;  3ES9 A;  1VQ4 B;  3ZBT A;  5JBQ A;  1QGZ A;  1VQ5 B;  4TMW A;  1VQ7 B;  1KTV A;  2DY1 A;  1EFC A;  4PGO A;  5DSZ A;  1A8P A;  2EFG A;  4Y7C A;  1K73 D;  4TMT A;  2PIA A;  4PC1 A;  2YWE A;  1Q7Y D;  1VQL B;  2E1R A;  1R5N A;  3JQP A;  4RD6 A;  5TV2 A;  3CPW B;  2BVN A;  3B82 A;  4C0S A;  3AVU A;  2D74 A;  1QGA A;  2BGJ A;  5GV8 A;  1JA1 A;  4HE6 A;  3W2G A;  1VQ8 B;  1IB0 A;  1JNY A;  4TMZ A;  1QFJ A;  1EWY A;  2BN4 A;  1VQK B;  1F60 A;  1JJ2 B;  3AVT A;  4AF6 A;  1IJF A;  1EFT A;  4LBZ A;  1VQP B;  4TMV A;  1QX4 A;  1TUI A;  4H9G A;  2BPO A;  1U2R A;  1CNE A;  3CMA B;  3CCU B;  4Y9R A;  2GPJ A;  1DDG A;  2CRV A;  1YHQ B;  3VNU A;  4ACB A;  1M90 D;  1OB2 A;  1BJK A;  4R71 A;  1W35 A;  1KQS B;  1YJN B;  1OGJ A;  3CME B;  4ZV4 A;  5EMN A;  1KK2 A;  4YAO A;  3CW2 A;  1YJ9 B;  4FN5 A;  4PC6 A;  1VQN B;  4RCY A;  4NBS A;  5AN9 A;  4IW3 B;  1KK3 A;  3CCV B;  4ZGQ B;  1QUE A;  1QH0 A;  2YWG A;  4UAJ A;  3E20 A;  3MHP A;  3AVW A;  1QUF A;  4RD1 A;  4PC7 A;  1YIT B;  1JB9 A;  1CQX A;  1FNB A;  1GJR A;  4ZCI A;  1QG0 A;  1JA0 A;  1DAR A;  1AMO A;  1I7P A;  1G7S A;  4G1B A;  1GAQ A;  3MCA A;  1QVG B;  3OZV A;  5THX A;  2XEX A;  1ZM2 A;  1D1N A;  1FNC A;  3CD6 B;  3WXM A;  1CNF A;  4TMX A;  1ELO A;  1G7T A;  1W87 A;  2QEX B;  3QSY A;  3JQQ A;  1QFZ A;  3CCL B;  1EFU A;  4ZGN B;  4N3G A;  3QFR A;  3OZU A;  2VNH A;  1KRH A;  2R6H A;  1ZM3 A;  1N0U A;  1GR1 A;  4B43 A;  1QGY A;  1QVF B;  2BM1 A;  2BMW A;  4QHY A;  3J81 k;  4TN1 A;  4YAU A;  1YIJ B;  2EIX A;  1YJW B;  1GO2 A;  1VQ9 B;  3W2E A;  2YWF A;  2OTL B;  3AGQ A;  3CCJ B;  5FA6 A;  1HA3 A;  1FDR A;  1EXM A;  4U9U A;  4G1V A;  4PC2 A;  1S0U A;  1VQ6 B;  3WNC A;  2RC5 A;  3CB4 A;  1K8A D;  5TR9 A;  5HXB A;  3P27 A;  4MYT A;  3MMP A;  3CCE B;  3W2I A;  1FRQ A;  2DER A;  4M1K A;  3VO2 A;  1H42 A;  2VNJ A;  3JQR A;  3CC7 B;  1F20 A;  4F7D A;  1NDH A;  3QFT A;  3LO8 A;  1B23 P;  2B7C A;  3VNV A;  3ZZ0 A;  4ZCL A;  2NPF A;  2QMU A;  2VZL A;  1Q82 D;  3U6B A;  1M1K D;  3ZZU A;  3OJW A;  3I1F A;  4YHB A;  3ZBU A;  1KC8 D;  4DQL A;  2HCJ B;  2BSA A;  1ZM9 A;  3W5H A;  2BM0 A;  2YWH A;  2B7B A;  2RC6 A;  3PEN A;  1KK0 A;  1H85 A;  1EP1 B;  4NCN A;  3I55 B;  1IJE A;  1D2E A;  2QN6 A;  3CCS B;  3W5U A;  4ZCM A;  4B48 A;  5H5J A;  1G7R A;  3CCM B;  4YAW A;  1E64 A;  3CC2 B;  1B2R A;  3CCR B;  1R5B A;  3LVB A;  4FK8 A;  1E62 A;  1R5O A;  4PC3 A;  4BPR A;  3W5V A;  5TY0 A;  3WBJ A;  3WBK A;  3CXC B;  2J7K A;  4WQM A;  4DQK A;  3CCQ B;  4RD2 A;  1FNM A;  3P26 A;  3AVX A;  1SKQ A;  4YAL A;  5KSW B;  2PLF A;  2QTZ A;  1NJI D;  4P3Y A;  4LBV A;  1EP2 B;  1TTT A;  3WY9 A;  2QA4 B;  1Q86 D;  4G5G A;  3G6E B;  4J0Q A;  2OTJ B;  2VNI A;  1DG1 G;  4LBY A;  2HMA A;  2DEU A;  1TLL A;  4RD3 A;  2B5O A;  1W34 A;  3E1Y E;  1QFY A;  2VYQ A;  3B8H A;  2PMD A;  3W2F A;  3W2H A;  1KJZ A;  4N3N A;  2X3U A;  1G7C A;  2QDX A;  4ACA A;  3I56 B;  1XB2 A;  2DCU A;  4B44 A;  3G71 B;  3FPK A;  1ZM4 A;  1OGI A;  2ZIT A;  1KD1 D;  1EP3 B;  4B47 A;  1FND A;  4RD4 A;  4MYU A;  4Q7J B;  1FRN A;  3G4S B;  1BX1 A;  3AVY A;  3CC4 B;  1KK1 A;  2GQF A;  4AF7 A;  1K9M D;  3U2Q A;  2BF4 A;  1XE1 A;  4C43 A;  4M53 A;  1J9Z A;  3OW2 B;  5GV7 A;  4AC9 A;  1TVC A;  1AIP A;  1YI2 B;  1BQE A;  4LC0 A;  1UMK A;  3AGP A;  4K1X A;  3VMF A;  4LBW A;  1GVH A;  4M4S A;  3WNB A;  1ZUN B;  1WDT A;  1W2B B;  3V76 A;  4QFM A;  1N8R D;  3OJX A;  1N0V C;  3ZZT A;  4HE5 A;  1S72 B;  3WND A;  1VQO B;  3WYA A;  4FWT A;  3B78 A;  3OZW A;  3FJO A;  5H59 A;  1GAW A;  2VNK A;  3AVV A;  2BV3 A;  1VQM B;  2XNJ A;  1SM4 A;  2HDN B;  4RD0 A;  4B3X A;  1E63 A;  1OB5 A;  2C77 A;  2QTL A;  3SJZ A;  2AHO A;  3ZC3 A;  3U6K A;  4RJL A;  2DET A;  2OK7 A;  4RCZ A;  3CRZ A;  4Y9U A;  4M0L A;  1D8T A;  3QFS A;  1DDI A;  3QFC A;  4EH1 A;  2CND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...