1XE1A

Hypothetical protein from pyrococcus furiosus pfu-880080-001
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
b'IEILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PF0907
publication title Hypothetical Protein From Pyrococcus Furiosus Pfu-880080-001
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1xe1A00
3U2QA 1FNCA 1ZM4A 1HA3A 1AMOA 4K1XA 3WNBA 1KQSB 1VQLB 4RD6A 1YHQB 1E63A 4DQKA 2DCUA 3WYAA 3OW2B 3CCVB 2RC5A 1FDRA 1ZM9A 1H42A 4RJLA 4HE6A 1U2RA 3CC2B 4FWTA 4Y9UA 1VQ4B 1IB0A 1TTTA 3AVUA 2XEXA 4PC2A 1K73D 2VZLA 4B43A 1Q86D 1GO2A 4Y7CA 1UMKA 5H5JA 1KTVA 4R71A 4AF6A 3CCRB 1YI2B 1VQOB 4TMZA 4C0SA 1EFCA 2HCJB 2YWFA 1CQXA 3MHPA 1H85A 2DETA 3CCLB 2BVNA 1F60A 4YALA 3ES9A 3CMAB 3FJOA 1B23P 4ZCMA 2BM0A 1W87A 2BN4A 1Q7YD 3PENA 4TN1A 3CXCB 3QSYA 4M4SA 1R5NA 4PC7A 4C43A 1TUIA 1D8TA 1QFJA 1QGAA 3ZZUA 1ELOA 3CCJB 1K8AD 3CC4B 1CNEA 3CC7B 5GV7A 1QUFA 1G7TA 3OZVA 1R5OA 2DEUA 1G7SA 3W5VA 2OK7A 4QHYA 2AHOA 1EXMA 4M0LA 1FRQA 2QEXB 1XE1A 3G4SB 3ZZTA 2C78A 1CNFA 1KJZA 1BX1A 3W2FA 3MCAA 3E20A 2VYQA 3ZZ0A 3WNDA 2BGIA 1YJNB 1YJ9B 1QGZA 3WBKA 1VQPB 2C77A 2DERA 1GVHA 4RD1A 1EWYA 3QFRA 3VNVA 1GAQA 2YWGA 4RD4A 1AIPA 1A8PA 2HMAA 2CRVA 1BQEA 1G7RA 3JQRA 3OJWA 3VO1A 3ZBUA 1OB5A 1QUEA 2XNCA 4MYUA 4PC3A 1VQ8B 3JQPA 3CMEB 4PC6A 5TR9A 3CCQB 2HDNB 2BMWA 4EH1A 5H59A 3CCUB 1KK3A 1BX0A 4B3XA 3VO2A 1FNMA 3E1YE 3LO8A 1KK0A 1FRNA 4M2LA 3AVXA 2QDXA 3AVVA 3OJXA 3W2HA 4M1KA 1EFTA 4RD2A 1GAWA 2OTLB 3JQQA 3CPWB 4AF7A 4RD0A 2B7BA 1W2BB 1E64A 5TV2A 3J81k 1YITB 1Q82D 1DDGA 4P6VF 1S0UA 2E1RA 3OZWA 5TY0A 2PIAA 1VQKB 1GJRA 5HXBA 2EFGA 3CCSB 1VQNB 3W2GA 4MYTA 3G6EB 1KD1D 1QVFB 1QG0A 1JNYA 2QMUA 3VNUA 4LC0A 1ZM2A 4RD3A 2J7KA 4YAUA 3U6BA 3MMPA 1GR1A 4TMTA 2YWEA 4LBWA 4ZGNB 3ZBTA 1F20A 3I55B 3CCEB 3P27A 2PMDA 1NJID 5EMNA 2QN6A 1YJWB 3AVWA 3W5HA 3QFCA 1I7PA 2QTLA 5FA6A 1WDTA 3CW2A 4B44A 4YAWA 3W2IA 1KC8D 2XNJA 3WXMA 1SM4A 2PLFA 3AVYA 1QH0A 4Q7JB 2GPJA 4B47A 4BPRA 4TMVA 2QA4B 2VNJA 4RCYA 1E62A 3AGPA 1XB2A 4LBYA 1R5BA 2D74A 4B48A 2ZITA 2R6HA 2RC6A 2BF4A 1OGJA 1N8RD 1QGYA 1G7CA 4B4DA 5DSZA 3G71B 1IJFA 1FNDA 4IW3B 1VQ6B 3QE2A 3CB4A 1NDHA 2YWHA 1SKQA 4U9UA 1KRHA 1M1KD 1EP2B 3B8HA 1EP3B 4TMXA 1KK2A 1FNBA 3I1FA 3CD6B 3QFTA 1Q81D 3U6KA 3LVBA 3W2EA 4P3YA 2EIXA 4WQMA 2NPFA 3B82A 5JBQA 1JA0A 3CCMB 2BGJA 4G5GA 4UAJA 2VNHA 4LBZA 4ZCLA 1QVGB 2BPOA 2VNKA 4YHBA 3W5UA 2FX3A 1D2EA 3AVTA 2CNDA 1N0UA 3WNCA 2B5OA 1D1NA 2BV3A 3FPKA 3AGQA 3WBJA 1DDIA 3V76A 3SJZA 4J0QA 5KSWB 1VQ7B 3OZUA 4FN5A 2QTZA 5THXA 1S72B 1B2RA 2DY1A 4Y9RA 1VQ9B 5AN9A 1QFYA 3B78A 1N0VC 4M53A 4G1BA 1J9ZA 1ZUNB 1TVCA 4YAFA 4LBVA 1JJ2B 1ZM3A 1TLLA 4RCZA 2GQFA 1BJKA 4TMWA 1DG1G 2BM1A 1KK1A 5GV8A 4YAOA 4ACAA 4H9GA 4AC9A 4FK8A 3CRZA 2OTJB 2B7CA 1DARA 1QX4A 4G1VA 1W35A 4NCNA 1QFZA 3ZC3A 1VQMB 1EP1B 1JB9A 4PC1A 3P26A 1VQ5B 1OGIA 2X3UA 4PGOA 3I56B 1OB2A 3WY9A 1K9MD 3VMFA 1YIJB 2OK8A 1IJEA 3QFSA 2BSAA 1M90D 4F7DA 4NBSA 4ACBA 4ZGQB 4HE5A 1EFUA 4DQLA 4N3NA 2VNIA 1JA1A 4ZV4A 1W34A 4N3GA 4ZCIA 4QFMA
chains in the Genus database with same CATH superfamily
2WYRA 3U2QA 1FNCA 1ZM4A 1HA3A 4OOSA 4P26A 3T51B 1AMOA 4K1XA 3WNBA 1KQSB 3A8KA 1VQLB 4RD6A 1YHQB 3BY2A 1E63A 2C2WA 3LQ6A 2ZTGA 4DQKA 2DCUA 4XONA 1WOOA 3WYAA 3OW7A 3OW2B 4Z4RA 3CCVB 3SEJA 2RC5A 1FDRA 1ZM9A 1H42A 4RJLA 4XLEA 4HE6A 5F4OA 1U2RA 3CC2B 2D3LA 4XM3A 5A88A 4FWTA 3GVKA 3PUNA 4Y9UA 2QGGA 1VQ4B 1IB0A 1TTTA 2ZZFA 3V7AA 3AVUA 5BSYA 3HAGA 2V31A 2XEXA 4PC2A 1K73D 2VZLA 3LNNA 4B43A 1Q86D 3ZUGA 2GJPA 4X7CA 1UD3A 1GO2A 4P22A 2JDIA 2VBUA 4Y7CA 1UMKA 5H5JA 4KKTA 1KTVA 4Z4SA 4XLCA 3A3GA 4R71A 4AF6A 3CCRB 1YI2B 2C5HA 1BMFA 4X8IA 1VQOB 3SJPA 1IHMA 2X85A 4TMZA 4C0SA 1EFCA 3BH4A 2HCJB 1COWA 2YWFA 1CQXA 4X7FA 3MHPA 1H85A 2DETA 3GIRA 2ZXIA 4Z4ZA 2Q6OA 3CCLB 2BVNA 1W9XA 1VLYA 3OEEA 1F60A 4YALA 3ES9A 3Q39A 3CMAB 1VHOA 4AVZA 3FJOA 2W6JA 2ZXHA 1S4MA 2WZNA 1B23P 4ZCMA 2BM0A 1W87A 4XLHA 2BN4A 1Q7YD 4ROXA 3PENA 4TN1A 3CP8A 3CXCB 3QSYA 2V4DA 4L8JA 2Q6LA 2ZL5A 2V7TA 4XMYA 4M4SA 4GQNA 4UZEA 1R5NA 3VR6A 4PC7A 5IYNA 4C43A 1TUIA 1D8TA 4OPOA 5KW9A 1QFJA 1QGAA 3PA1A 3ZZUA 4Z4TA 4II2A 1ELOA 5A8AA 2X8KA 4P25A 3CCJB 3ASPA 1K8AD 3CC4B 4G7WA 1CNEA 3CMMA 3CTAA 4RLZA 1FX0A 1OB0A 3CC7B 5GV7A 3OKXA 1QUFA 1G7TA 3OZVA 1R5OA 1Y0YA 2DEUA 1G7SA 1VHEA 4XOPA 1E3XA 3W5VA 2OK7A 3Q6RA 4QHYA 2AHOA 1EXMA 4M0LA 1FRQA 5HZAA 2QEXB 3A1PA 1T6YA 1XE1A 3G4SB 3ZZTA 2C78A 1CNFA 1KJZA 1BX1A 2XZPA 3W2FA 4QUZA 3MCAA 3E20A 5FL7A 3SKBA 2Q6KA 2QE7A 2VYQA 1VLOA 4UZUA 4DNRB 3ZZ0A 3WNDA 2CF4A 2BGIA 1YJNB 1YJ9B 2GJKA 1QGZA 3SLNA 3WBKA 2WPDA 1VQPB 1T6XA 2C77A 2DERA 1VF7A 1NB0A 1GVHA 2KVOA 4RD1A 1EWYA 3QFRA 3VNVA 3SLDA 2XZOA 1GAQA 2F4NA 2V7XA 2YWGA 1PKVA 4RD4A 1WORA 1AIPA 1A8PA 4ASUA 2HMAA 2CRVA 1BQEA 1G7RA 3JQRA 5KNLA 5HZBA 1HVXA 3ZIAA 3OJWA 3VO1A 3ONUA 2X53S 3ZBUA 4RDLA 1WPCA 2P3MA 1T6ZA 3ISXA 4X0CA 1OB5A 1QUEA 3ZPNA 4RDKA 2XNCA 4MYUA 2XGJA 4PC3A 1VQ8B 3ONYA 3JU4A 3JQPA 3CMEB 1WU8A 4QV2A 2OBRA 4PC6A 1W0KA 3CP2A 5TR9A 2VBVA 3CCQB 1N05A 2HDNB 5B6IA 3OE7A 2Q6IA 2BMWA 4EH1A 5H59A 1BLIA 3CCUB 1KK3A 3R6JA 1BX0A 4B3XA 2W6IA 3VO2A 1FNMA 3E1YE 3LO8A 1KK0A 1FRNA 4M2LA 3DDYA 3AVXA 4II3A 1VJSA 2QDXA 3AVVA 3OJXA 4Z1MA 1E43A 3W2HA 4M1KA 2XOKA 1EFTA 4RD2A 1WSRA 2ZL6A 1N08A 3D26A 3PVDA 1OHHA 4G7XA 1GAWA 4P1VA 2VBSA 2I1LA 4TSFA 2OTLB 2GJRA 1T5EA 3JQQA 3CPWB 1EFRA 4AF7A 4RD0A 2B7BA 4XNFA 2F1MA 2R9VA 1W2BB 3ASQA 4KKSA 4PAAA 1E64A 2OBTA 5TV2A 2WJVA 5BSXA 3J81k 4P6YA 1YITB 1Q82D 1DDGA 3GVLA 4P12A 4P6VF 2ZBUA 3H9NA 1S0UA 2E1RA 1P4MA 3OZWA 4OOXA 1RQRA 5TY0A 4RPBA 5CDFA 4WZEA 3H94A 2PIAA 4RM0A 1GJRA 1VQKB 1I18A 4WZTA 5HXBA 2EFGA 3CCSB 1RQPA 1VQNB 3WQZA 4X07A 5E6TA 3CESA 4XKVA 1NB9A 2C4UA 3W2GA 4MYTA 3G6EB 1KD1D 1QVFB 3FPPA 1QG0A 1JNYA 2PE3A 5TRDA 3BNWA 4B3GA 4Z4WA 2QMUA 4YXWA 4FXUA 1BPLA 3VNUA 2ZZEA 5IYRA 1PJ5A 1UD8A 4LC0A 1ZM2A 5L46A 4RD3A 1YX2A 4CQJA 2X6YA 2J7KA 4YAUA 2WZPP 3U6BA 5FIUA 3MMPA 1SKYB 1WOPA 4X06A 1GR1A 4TMTA 2C5BA 2YWEA 1H8EA 4LBWA 4ZGNB 3ZBTA 1F20A 3BCFA 4QVJA 3I55B 3CCEB 1XQBA 3P27A 3PA2A 2PMDA 4UZFA 1H8HA 1NJID 5EMNA 2QN6A 3GSIA 2WSSA 4WWVA 4YELA 5FO1A 3KL9A 1UD5A 3OPOA 1YJWB 4PABA 3W5HA 3QFCA 3AVWA 1I7PA 2QTLA 4OP7A 5IK2A 2X6WA 5FA6A 1V5VA 1WDTA 4HIZA 3CW2A 4B44A 4YAWA 2GK6A 3CPXA 3W2IA 1KC8D 3PUMA 2XNJA 4G6IA 3WXMA 1SM4A 2PLFA 3AVYA 2VJIA 3ASRA 2ZTNA 1QH0A 4Q7JB 2GPJA 1E1RA 2VJJA 3A3BA 3ASTA 1N07A 2V7QA 5J3OA 4B47A 3BQJA 4XLFA 4BPRA 4TMVA 2QA4B 4Z4VA 2VNJA 4RCYA 1E62A 2V7WA 3A8JA 3AGPA 1XB2A 4LBYA 4KKUA 2WR8A 2V7UA 4WZKA 5DN6A 2JJ1A 1WSVA 1R5BA 1PJ7A 2GREA 2D74A 2ZZQA 3T56B 4B48A 3A8IA 2ZITA 3OEHA 2F1LA 4XOTA 2R6HA 1XFOA 2RC6A 2BF4A 2F43A 1OGJA 1N8RD 1QGYA 3KEWA 1G7CA 4B4DA 5DSZA 1UD4A 3G71B 2HLDA 1IJFA 1FNDA 1KMHA 4IW3B 1V0FA 1VQ6B 3QE2A 2CC2A 4X05A 1W34A 5FO0A 3Q6QA 4P2NA 3CB4A 4DNTB 4DK1A 1NDHA 2YWHA 1SKQA 2GK7A 4U9UA 5DS0A 1KRHA 1M1KD 3BC9A 1EP2B 2FVGA 3B8HA 1YLOA 4OPVA 1EP3B 4WZLA 3R6KA 4TMXA 1N06A 2XZLA 1KK2A 1FNBA 2E1BA 3I1FA 3LQEA 3CD6B 3QFTA 1Q81D 3U6KA 3LVBA 2EIXA 2DOGA 2VBTA 3OAAA 4P3YA 3W2EA 1NBMA 4WQMA 2NPFA 3B82A 4X7EA 5JBQA 1JA0A 3CCMB 2BGJA 4G5GA 2D3NA 4UAJA 5IYQA 2VNHA 4LBZA 4ZCLA 1W0JA 5A89A 1QVGB 2BPOA 2JIZA 2VNKA 1UD6A 4YHBA 3W5UA 2FX3A 3BY1A 1D2EA 3AVTA 2CNDA 4RPDA 1N0UA 3GQBA 1NRKA 3WNCA 2B5OA 4DK0A 2BV3A 3FPKA 1D1NA 3AGQA 3WBJA 1DDIA 2Z6BD 3V76A 3SJZA 4J0QA 5FNZA 2M5SA 2WJYA 5KSWB 3NE5B 1WP6A 4P3IA 3T53B 3OZUA 1VQ7B 4FN5A 2QTZA 4E0FA 1HZEA 2CBXA 2LZJA 5F4MA 5IYPA 3Q38A 5THXA 5F4JA 1Q9SA 2OBSA 1E1QA 1S72B 4XN3A 4RDJA 1B2RA 2DY1A 4XR6A 4Y9RA 1K28D 2DIEA 1VQ9B 5AN9A 5J35A 2XNDA 1QFYA 3A35A 4B3FX 3B78A 1N0VC 4M53A 3OP1A 4XN0A 4X7DA 4Z4YA 4G1BA 1J9ZA 4XKWA 1ZUNB 4QVAA 2X6XA 1TVCA 4YAFA 4LBVA 2C4TA 2X0KA 4XL9A 2OYNA 1JJ2B 5LMZA 1ZM3A 1TLLA 4RCZA 5HKKA 3RY8A 4YEJA 2GQFA 2JN9A 1BJKA 4OPSA 1PJ6A 1V0EA 4TMWA 2CK3A 1DG1G 2CW5A 2ZBVA 2ZL7A 2BM1A 4TKOB 3OFNA 1KK1A 3Q3AA 5GV8A 2DYIA 4YAOA 4ACAA 4H9GA 4AC9A 4XQFA 1E3ZA 4FK8A 3CRZA 2ZZGA 2OTJB 2B7CA 1KZLA 4Z4UA 1DARA 1QX4A 1WOSA 2D9RA 4G1VA 4XLAA 1W35A 4XORA 4NCNA 4TT3A 1QFZA 3ZC3A 1VQMB 3OOCA 1EP1B 1JB9A 4PC1A 3P26A 1VQ5B 1OGIA 2X3UA 4PGOA 4P9SA 5IYWA 3I56B 1MRZA 1OB2A 1MABA 1I8DA 1UD2A 3WY9A 1K9MD 3VMFA 1Y0RA 1YIJB 2OK8A 1IJEA 3QFSA 3ASSA 2BSAA 1M90D 4F7DA 4NBSA 3G05A 1E79A 2JJ2A 4XD7A 2V7VA 4OOVA 3BCDA 3FKSA 4ACBA 4ZGQB 4HE5A 1EFUA 4NNJA 4DQLA 4N3NA 3GVJA 2VNIA 1JA1A 1WTHD 4ZV4A 4JMQA 2NV4A 4N3GA 4ZCIA 4QFMA
chains in the Genus database with same CATH topology
3U2QA 1FNCA 1ZM4A 1HA3A 1AMOA 4K1XA 3WNBA 1KQSB 1VQLB 4RD6A 1YHQB 1E63A 4DQKA 2DCUA 3WYAA 3OW2B 3CCVB 2RC5A 1FDRA 1ZM9A 1H42A 4RJLA 4HE6A 1U2RA 3CC2B 4FWTA 4Y9UA 1VQ4B 1IB0A 1TTTA 3AVUA 2XEXA 4PC2A 1K73D 2VZLA 4B43A 1Q86D 1GO2A 4Y7CA 1UMKA 5H5JA 1KTVA 4R71A 4AF6A 3CCRB 1YI2B 1VQOB 4TMZA 4C0SA 1EFCA 2HCJB 2YWFA 1CQXA 3MHPA 1H85A 2DETA 3CCLB 2BVNA 1F60A 4YALA 3ES9A 3CMAB 3FJOA 1B23P 4ZCMA 2BM0A 1W87A 2BN4A 1Q7YD 3PENA 4TN1A 3CXCB 3QSYA 4M4SA 1R5NA 4PC7A 4C43A 1TUIA 1D8TA 1QFJA 1QGAA 3ZZUA 1ELOA 3CCJB 1K8AD 3CC4B 1CNEA 3CC7B 5GV7A 1QUFA 1G7TA 3OZVA 1R5OA 2DEUA 1G7SA 3W5VA 2OK7A 4QHYA 2AHOA 1EXMA 4M0LA 1FRQA 2QEXB 1XE1A 3G4SB 3ZZTA 2C78A 1CNFA 1KJZA 1BX1A 3W2FA 3MCAA 3E20A 2VYQA 3ZZ0A 3WNDA 2BGIA 1YJNB 1YJ9B 1QGZA 3WBKA 1VQPB 2C77A 2DERA 1GVHA 4RD1A 1EWYA 3QFRA 3VNVA 1GAQA 2YWGA 4RD4A 1AIPA 1A8PA 2HMAA 2CRVA 1BQEA 1G7RA 3JQRA 3OJWA 3VO1A 3ZBUA 1OB5A 1QUEA 2XNCA 4MYUA 4PC3A 1VQ8B 3JQPA 3CMEB 4PC6A 5TR9A 3CCQB 2HDNB 2BMWA 4EH1A 5H59A 3CCUB 1KK3A 1BX0A 4B3XA 3VO2A 1FNMA 3E1YE 3LO8A 1KK0A 1FRNA 4M2LA 3AVXA 2QDXA 3AVVA 3OJXA 3W2HA 4M1KA 1EFTA 4RD2A 1GAWA 2OTLB 3JQQA 3CPWB 4AF7A 4RD0A 2B7BA 1W2BB 1E64A 5TV2A 3J81k 1YITB 1Q82D 1DDGA 4P6VF 1S0UA 2E1RA 3OZWA 5TY0A 2PIAA 1VQKB 1GJRA 5HXBA 2EFGA 3CCSB 1VQNB 3W2GA 4MYTA 3G6EB 1KD1D 1QVFB 1QG0A 1JNYA 2QMUA 3VNUA 4LC0A 1ZM2A 4RD3A 2J7KA 4YAUA 3U6BA 3MMPA 1GR1A 4TMTA 2YWEA 4LBWA 4ZGNB 3ZBTA 1F20A 3I55B 3CCEB 3P27A 2PMDA 1NJID 5EMNA 2QN6A 1YJWB 3AVWA 3W5HA 3QFCA 1I7PA 2QTLA 5FA6A 1WDTA 3CW2A 4B44A 4YAWA 3W2IA 1KC8D 2XNJA 3WXMA 1SM4A 2PLFA 3AVYA 1QH0A 4Q7JB 2GPJA 4B47A 4BPRA 4TMVA 2QA4B 2VNJA 4RCYA 1E62A 3AGPA 1XB2A 4LBYA 1R5BA 2D74A 4B48A 2ZITA 2R6HA 2RC6A 2BF4A 1OGJA 1N8RD 1QGYA 1G7CA 4B4DA 5DSZA 3G71B 1IJFA 1FNDA 4IW3B 1VQ6B 3QE2A 3CB4A 1NDHA 2YWHA 1SKQA 4U9UA 1KRHA 1M1KD 1EP2B 3B8HA 1EP3B 4TMXA 1KK2A 1FNBA 3I1FA 3CD6B 3QFTA 1Q81D 3U6KA 3LVBA 3W2EA 4P3YA 2EIXA 4WQMA 2NPFA 3B82A 5JBQA 1JA0A 3CCMB 2BGJA 4G5GA 4UAJA 2VNHA 4LBZA 4ZCLA 1QVGB 2BPOA 2VNKA 4YHBA 3W5UA 2FX3A 1D2EA 3AVTA 2CNDA 1N0UA 3WNCA 2B5OA 1D1NA 2BV3A 3FPKA 3AGQA 3WBJA 1DDIA 3V76A 3SJZA 4J0QA 5KSWB 1VQ7B 3OZUA 4FN5A 2QTZA 5THXA 1S72B 1B2RA 2DY1A 4Y9RA 1VQ9B 5AN9A 1QFYA 3B78A 1N0VC 4M53A 4G1BA 1J9ZA 1ZUNB 1TVCA 4YAFA 4LBVA 1JJ2B 1ZM3A 1TLLA 4RCZA 2GQFA 1BJKA 4TMWA 1DG1G 2BM1A 1KK1A 5GV8A 4YAOA 4ACAA 4H9GA 4AC9A 4FK8A 3CRZA 2OTJB 2B7CA 1DARA 1QX4A 4G1VA 1W35A 4NCNA 1QFZA 3ZC3A 1VQMB 1EP1B 1JB9A 4PC1A 3P26A 1VQ5B 1OGIA 2X3UA 4PGOA 3I56B 1OB2A 3WY9A 1K9MD 3VMFA 1YIJB 2OK8A 1IJEA 3QFSA 2BSAA 1M90D 4F7DA 4NBSA 4ACBA 4ZGQB 4HE5A 1EFUA 4DQLA 4N3NA 2VNIA 1JA1A 4ZV4A 1W34A 4N3GA 4ZCIA 4QFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2Q A;  1FNC A;  1ZM4 A;  1HA3 A;  1AMO A;  4K1X A;  3WNB A;  1KQS B;  1VQL B;  4RD6 A;  1YHQ B;  1E63 A;  4DQK A;  2DCU A;  3WYA A;  3OW2 B;  3CCV B;  2RC5 A;  1FDR A;  1ZM9 A;  1H42 A;  4RJL A;  4HE6 A;  1U2R A;  3CC2 B;  4FWT A;  4Y9U A;  1VQ4 B;  1IB0 A;  1TTT A;  3AVU A;  2XEX A;  4PC2 A;  1K73 D;  2VZL A;  4B43 A;  1Q86 D;  1GO2 A;  4Y7C A;  1UMK A;  5H5J A;  1KTV A;  4R71 A;  4AF6 A;  3CCR B;  1YI2 B;  1VQO B;  4TMZ A;  4C0S A;  1EFC A;  2HCJ B;  2YWF A;  1CQX A;  3MHP A;  1H85 A;  2DET A;  3CCL B;  2BVN A;  1F60 A;  4YAL A;  3ES9 A;  3CMA B;  3FJO A;  1B23 P;  4ZCM A;  2BM0 A;  1W87 A;  2BN4 A;  1Q7Y D;  3PEN A;  4TN1 A;  3CXC B;  3QSY A;  4M4S A;  1R5N A;  4PC7 A;  4C43 A;  1TUI A;  1D8T A;  1QFJ A;  1QGA A;  3ZZU A;  1ELO A;  3CCJ B;  1K8A D;  3CC4 B;  1CNE A;  3CC7 B;  5GV7 A;  1QUF A;  1G7T A;  3OZV A;  1R5O A;  2DEU A;  1G7S A;  3W5V A;  2OK7 A;  4QHY A;  2AHO A;  1EXM A;  4M0L A;  1FRQ A;  2QEX B;  1XE1 A;  3G4S B;  3ZZT A;  2C78 A;  1CNF A;  1KJZ A;  1BX1 A;  3W2F A;  3MCA A;  3E20 A;  2VYQ A;  3ZZ0 A;  3WND A;  2BGI A;  1YJN B;  1YJ9 B;  1QGZ A;  3WBK A;  1VQP B;  2C77 A;  2DER A;  1GVH A;  4RD1 A;  1EWY A;  3QFR A;  3VNV A;  1GAQ A;  2YWG A;  4RD4 A;  1AIP A;  1A8P A;  2HMA A;  2CRV A;  1BQE A;  1G7R A;  3JQR A;  3OJW A;  3VO1 A;  3ZBU A;  1OB5 A;  1QUE A;  2XNC A;  4MYU A;  4PC3 A;  1VQ8 B;  3JQP A;  3CME B;  4PC6 A;  5TR9 A;  3CCQ B;  2HDN B;  2BMW A;  4EH1 A;  5H59 A;  3CCU B;  1KK3 A;  1BX0 A;  4B3X A;  3VO2 A;  1FNM A;  3E1Y E;  3LO8 A;  1KK0 A;  1FRN A;  4M2L A;  3AVX A;  2QDX A;  3AVV A;  3OJX A;  3W2H A;  4M1K A;  1EFT A;  4RD2 A;  1GAW A;  2OTL B;  3JQQ A;  3CPW B;  4AF7 A;  4RD0 A;  2B7B A;  1W2B B;  1E64 A;  5TV2 A;  3J81 k;  1YIT B;  1Q82 D;  1DDG A;  4P6V F;  1S0U A;  2E1R A;  3OZW A;  5TY0 A;  2PIA A;  1VQK B;  1GJR A;  5HXB A;  2EFG A;  3CCS B;  1VQN B;  3W2G A;  4MYT A;  3G6E B;  1KD1 D;  1QVF B;  1QG0 A;  1JNY A;  2QMU A;  3VNU A;  4LC0 A;  1ZM2 A;  4RD3 A;  2J7K A;  4YAU A;  3U6B A;  3MMP A;  1GR1 A;  4TMT A;  2YWE A;  4LBW A;  4ZGN B;  3ZBT A;  1F20 A;  3I55 B;  3CCE B;  3P27 A;  2PMD A;  1NJI D;  5EMN A;  2QN6 A;  1YJW B;  3AVW A;  3W5H A;  3QFC A;  1I7P A;  2QTL A;  5FA6 A;  1WDT A;  3CW2 A;  4B44 A;  4YAW A;  3W2I A;  1KC8 D;  2XNJ A;  3WXM A;  1SM4 A;  2PLF A;  3AVY A;  1QH0 A;  4Q7J B;  2GPJ A;  4B47 A;  4BPR A;  4TMV A;  2QA4 B;  2VNJ A;  4RCY A;  1E62 A;  3AGP A;  1XB2 A;  4LBY A;  1R5B A;  2D74 A;  4B48 A;  2ZIT A;  2R6H A;  2RC6 A;  2BF4 A;  1OGJ A;  1N8R D;  1QGY A;  1G7C A;  4B4D A;  5DSZ A;  3G71 B;  1IJF A;  1FND A;  4IW3 B;  1VQ6 B;  3QE2 A;  3CB4 A;  1NDH A;  2YWH A;  1SKQ A;  4U9U A;  1KRH A;  1M1K D;  1EP2 B;  3B8H A;  1EP3 B;  4TMX A;  1KK2 A;  1FNB A;  3I1F A;  3CD6 B;  3QFT A;  1Q81 D;  3U6K A;  3LVB A;  3W2E A;  4P3Y A;  2EIX A;  4WQM A;  2NPF A;  3B82 A;  5JBQ A;  1JA0 A;  3CCM B;  2BGJ A;  4G5G A;  4UAJ A;  2VNH A;  4LBZ A;  4ZCL A;  1QVG B;  2BPO A;  2VNK A;  4YHB A;  3W5U A;  2FX3 A;  1D2E A;  3AVT A;  2CND A;  1N0U A;  3WNC A;  2B5O A;  1D1N A;  2BV3 A;  3FPK A;  3AGQ A;  3WBJ A;  1DDI A;  3V76 A;  3SJZ A;  4J0Q A;  5KSW B;  1VQ7 B;  3OZU A;  4FN5 A;  2QTZ A;  5THX A;  1S72 B;  1B2R A;  2DY1 A;  4Y9R A;  1VQ9 B;  5AN9 A;  1QFY A;  3B78 A;  1N0V C;  4M53 A;  4G1B A;  1J9Z A;  1ZUN B;  1TVC A;  4YAF A;  4LBV A;  1JJ2 B;  1ZM3 A;  1TLL A;  4RCZ A;  2GQF A;  1BJK A;  4TMW A;  1DG1 G;  2BM1 A;  1KK1 A;  5GV8 A;  4YAO A;  4ACA A;  4H9G A;  4AC9 A;  4FK8 A;  3CRZ A;  2OTJ B;  2B7C A;  1DAR A;  1QX4 A;  4G1V A;  1W35 A;  4NCN A;  1QFZ A;  3ZC3 A;  1VQM B;  1EP1 B;  1JB9 A;  4PC1 A;  3P26 A;  1VQ5 B;  1OGI A;  2X3U A;  4PGO A;  3I56 B;  1OB2 A;  3WY9 A;  1K9M D;  3VMF A;  1YIJ B;  2OK8 A;  1IJE A;  3QFS A;  2BSA A;  1M90 D;  4F7D A;  4NBS A;  4ACB A;  4ZGQ B;  4HE5 A;  1EFU A;  4DQL A;  4N3N A;  2VNI A;  1JA1 A;  4ZV4 A;  1W34 A;  4N3G A;  4ZCI A;  4QFM A; 
#chains in the Genus database with same CATH topology
 2WYR A;  3U2Q A;  1FNC A;  1ZM4 A;  1HA3 A;  4OOS A;  4P26 A;  3T51 B;  1AMO A;  4K1X A;  3WNB A;  1KQS B;  3A8K A;  1VQL B;  4RD6 A;  1YHQ B;  3BY2 A;  1E63 A;  2C2W A;  3LQ6 A;  2ZTG A;  4DQK A;  2DCU A;  4XON A;  1WOO A;  3WYA A;  3OW7 A;  3OW2 B;  4Z4R A;  3CCV B;  3SEJ A;  2RC5 A;  1FDR A;  1ZM9 A;  1H42 A;  4RJL A;  4XLE A;  4HE6 A;  5F4O A;  1U2R A;  3CC2 B;  2D3L A;  4XM3 A;  5A88 A;  4FWT A;  3GVK A;  3PUN A;  4Y9U A;  2QGG A;  1VQ4 B;  1IB0 A;  1TTT A;  2ZZF A;  3V7A A;  3AVU A;  5BSY A;  3HAG A;  2V31 A;  2XEX A;  4PC2 A;  1K73 D;  2VZL A;  3LNN A;  4B43 A;  1Q86 D;  3ZUG A;  2GJP A;  4X7C A;  1UD3 A;  1GO2 A;  4P22 A;  2JDI A;  2VBU A;  4Y7C A;  1UMK A;  5H5J A;  4KKT A;  1KTV A;  4Z4S A;  4XLC A;  3A3G A;  4R71 A;  4AF6 A;  3CCR B;  1YI2 B;  2C5H A;  1BMF A;  4X8I A;  1VQO B;  3SJP A;  1IHM A;  2X85 A;  4TMZ A;  4C0S A;  1EFC A;  3BH4 A;  2HCJ B;  1COW A;  2YWF A;  1CQX A;  4X7F A;  3MHP A;  1H85 A;  2DET A;  3GIR A;  2ZXI A;  4Z4Z A;  2Q6O A;  3CCL B;  2BVN A;  1W9X A;  1VLY A;  3OEE A;  1F60 A;  4YAL A;  3ES9 A;  3Q39 A;  3CMA B;  1VHO A;  4AVZ A;  3FJO A;  2W6J A;  2ZXH A;  1S4M A;  2WZN A;  1B23 P;  4ZCM A;  2BM0 A;  1W87 A;  4XLH A;  2BN4 A;  1Q7Y D;  4ROX A;  3PEN A;  4TN1 A;  3CP8 A;  3CXC B;  3QSY A;  2V4D A;  4L8J A;  2Q6L A;  2ZL5 A;  2V7T A;  4XMY A;  4M4S A;  4GQN A;  4UZE A;  1R5N A;  3VR6 A;  4PC7 A;  5IYN A;  4C43 A;  1TUI A;  1D8T A;  4OPO A;  5KW9 A;  1QFJ A;  1QGA A;  3PA1 A;  3ZZU A;  4Z4T A;  4II2 A;  1ELO A;  5A8A A;  2X8K A;  4P25 A;  3CCJ B;  3ASP A;  1K8A D;  3CC4 B;  4G7W A;  1CNE A;  3CMM A;  3CTA A;  4RLZ A;  1FX0 A;  1OB0 A;  3CC7 B;  5GV7 A;  3OKX A;  1QUF A;  1G7T A;  3OZV A;  1R5O A;  1Y0Y A;  2DEU A;  1G7S A;  1VHE A;  4XOP A;  1E3X A;  3W5V A;  2OK7 A;  3Q6R A;  4QHY A;  2AHO A;  1EXM A;  4M0L A;  1FRQ A;  5HZA A;  2QEX B;  3A1P A;  1T6Y A;  1XE1 A;  3G4S B;  3ZZT A;  2C78 A;  1CNF A;  1KJZ A;  1BX1 A;  2XZP A;  3W2F A;  4QUZ A;  3MCA A;  3E20 A;  5FL7 A;  3SKB A;  2Q6K A;  2QE7 A;  2VYQ A;  1VLO A;  4UZU A;  4DNR B;  3ZZ0 A;  3WND A;  2CF4 A;  2BGI A;  1YJN B;  1YJ9 B;  2GJK A;  1QGZ A;  3SLN A;  3WBK A;  2WPD A;  1VQP B;  1T6X A;  2C77 A;  2DER A;  1VF7 A;  1NB0 A;  1GVH A;  2KVO A;  4RD1 A;  1EWY A;  3QFR A;  3VNV A;  3SLD A;  2XZO A;  1GAQ A;  2F4N A;  2V7X A;  2YWG A;  1PKV A;  4RD4 A;  1WOR A;  1AIP A;  1A8P A;  4ASU A;  2HMA A;  2CRV A;  1BQE A;  1G7R A;  3JQR A;  5KNL A;  5HZB A;  1HVX A;  3ZIA A;  3OJW A;  3VO1 A;  3ONU A;  2X53 S;  3ZBU A;  4RDL A;  1WPC A;  2P3M A;  1T6Z A;  3ISX A;  4X0C A;  1OB5 A;  1QUE A;  3ZPN A;  4RDK A;  2XNC A;  4MYU A;  2XGJ A;  4PC3 A;  1VQ8 B;  3ONY A;  3JU4 A;  3JQP A;  3CME B;  1WU8 A;  4QV2 A;  2OBR A;  4PC6 A;  1W0K A;  3CP2 A;  5TR9 A;  2VBV A;  3CCQ B;  1N05 A;  2HDN B;  5B6I A;  3OE7 A;  2Q6I A;  2BMW A;  4EH1 A;  5H59 A;  1BLI A;  3CCU B;  1KK3 A;  3R6J A;  1BX0 A;  4B3X A;  2W6I A;  3VO2 A;  1FNM A;  3E1Y E;  3LO8 A;  1KK0 A;  1FRN A;  4M2L A;  3DDY A;  3AVX A;  4II3 A;  1VJS A;  2QDX A;  3AVV A;  3OJX A;  4Z1M A;  1E43 A;  3W2H A;  4M1K A;  2XOK A;  1EFT A;  4RD2 A;  1WSR A;  2ZL6 A;  1N08 A;  3D26 A;  3PVD A;  1OHH A;  4G7X A;  1GAW A;  4P1V A;  2VBS A;  2I1L A;  4TSF A;  2OTL B;  2GJR A;  1T5E A;  3JQQ A;  3CPW B;  1EFR A;  4AF7 A;  4RD0 A;  2B7B A;  4XNF A;  2F1M A;  2R9V A;  1W2B B;  3ASQ A;  4KKS A;  4PAA A;  1E64 A;  2OBT A;  5TV2 A;  2WJV A;  5BSX A;  3J81 k;  4P6Y A;  1YIT B;  1Q82 D;  1DDG A;  3GVL A;  4P12 A;  4P6V F;  2ZBU A;  3H9N A;  1S0U A;  2E1R A;  1P4M A;  3OZW A;  4OOX A;  1RQR A;  5TY0 A;  4RPB A;  5CDF A;  4WZE A;  3H94 A;  2PIA A;  4RM0 A;  1GJR A;  1VQK B;  1I18 A;  4WZT A;  5HXB A;  2EFG A;  3CCS B;  1RQP A;  1VQN B;  3WQZ A;  4X07 A;  5E6T A;  3CES A;  4XKV A;  1NB9 A;  2C4U A;  3W2G A;  4MYT A;  3G6E B;  1KD1 D;  1QVF B;  3FPP A;  1QG0 A;  1JNY A;  2PE3 A;  5TRD A;  3BNW A;  4B3G A;  4Z4W A;  2QMU A;  4YXW A;  4FXU A;  1BPL A;  3VNU A;  2ZZE A;  5IYR A;  1PJ5 A;  1UD8 A;  4LC0 A;  1ZM2 A;  5L46 A;  4RD3 A;  1YX2 A;  4CQJ A;  2X6Y A;  2J7K A;  4YAU A;  2WZP P;  3U6B A;  5FIU A;  3MMP A;  1SKY B;  1WOP A;  4X06 A;  1GR1 A;  4TMT A;  2C5B A;  2YWE A;  1H8E A;  4LBW A;  4ZGN B;  3ZBT A;  1F20 A;  3BCF A;  4QVJ A;  3I55 B;  3CCE B;  1XQB A;  3P27 A;  3PA2 A;  2PMD A;  4UZF A;  1H8H A;  1NJI D;  5EMN A;  2QN6 A;  3GSI A;  2WSS A;  4WWV A;  4YEL A;  5FO1 A;  3KL9 A;  1UD5 A;  3OPO A;  1YJW B;  4PAB A;  3W5H A;  3QFC A;  3AVW A;  1I7P A;  2QTL A;  4OP7 A;  5IK2 A;  2X6W A;  5FA6 A;  1V5V A;  1WDT A;  4HIZ A;  3CW2 A;  4B44 A;  4YAW A;  2GK6 A;  3CPX A;  3W2I A;  1KC8 D;  3PUM A;  2XNJ A;  4G6I A;  3WXM A;  1SM4 A;  2PLF A;  3AVY A;  2VJI A;  3ASR A;  2ZTN A;  1QH0 A;  4Q7J B;  2GPJ A;  1E1R A;  2VJJ A;  3A3B A;  3AST A;  1N07 A;  2V7Q A;  5J3O A;  4B47 A;  3BQJ A;  4XLF A;  4BPR A;  4TMV A;  2QA4 B;  4Z4V A;  2VNJ A;  4RCY A;  1E62 A;  2V7W A;  3A8J A;  3AGP A;  1XB2 A;  4LBY A;  4KKU A;  2WR8 A;  2V7U A;  4WZK A;  5DN6 A;  2JJ1 A;  1WSV A;  1R5B A;  1PJ7 A;  2GRE A;  2D74 A;  2ZZQ A;  3T56 B;  4B48 A;  3A8I A;  2ZIT A;  3OEH A;  2F1L A;  4XOT A;  2R6H A;  1XFO A;  2RC6 A;  2BF4 A;  2F43 A;  1OGJ A;  1N8R D;  1QGY A;  3KEW A;  1G7C A;  4B4D A;  5DSZ A;  1UD4 A;  3G71 B;  2HLD A;  1IJF A;  1FND A;  1KMH A;  4IW3 B;  1V0F A;  1VQ6 B;  3QE2 A;  2CC2 A;  4X05 A;  1W34 A;  5FO0 A;  3Q6Q A;  4P2N A;  3CB4 A;  4DNT B;  4DK1 A;  1NDH A;  2YWH A;  1SKQ A;  2GK7 A;  4U9U A;  5DS0 A;  1KRH A;  1M1K D;  3BC9 A;  1EP2 B;  2FVG A;  3B8H A;  1YLO A;  4OPV A;  1EP3 B;  4WZL A;  3R6K A;  4TMX A;  1N06 A;  2XZL A;  1KK2 A;  1FNB A;  2E1B A;  3I1F A;  3LQE A;  3CD6 B;  3QFT A;  1Q81 D;  3U6K A;  3LVB A;  2EIX A;  2DOG A;  2VBT A;  3OAA A;  4P3Y A;  3W2E A;  1NBM A;  4WQM A;  2NPF A;  3B82 A;  4X7E A;  5JBQ A;  1JA0 A;  3CCM B;  2BGJ A;  4G5G A;  2D3N A;  4UAJ A;  5IYQ A;  2VNH A;  4LBZ A;  4ZCL A;  1W0J A;  5A89 A;  1QVG B;  2BPO A;  2JIZ A;  2VNK A;  1UD6 A;  4YHB A;  3W5U A;  2FX3 A;  3BY1 A;  1D2E A;  3AVT A;  2CND A;  4RPD A;  1N0U A;  3GQB A;  1NRK A;  3WNC A;  2B5O A;  4DK0 A;  2BV3 A;  3FPK A;  1D1N A;  3AGQ A;  3WBJ A;  1DDI A;  2Z6B D;  3V76 A;  3SJZ A;  4J0Q A;  5FNZ A;  2M5S A;  2WJY A;  5KSW B;  3NE5 B;  1WP6 A;  4P3I A;  3T53 B;  3OZU A;  1VQ7 B;  4FN5 A;  2QTZ A;  4E0F A;  1HZE A;  2CBX A;  2LZJ A;  5F4M A;  5IYP A;  3Q38 A;  5THX A;  5F4J A;  1Q9S A;  2OBS A;  1E1Q A;  1S72 B;  4XN3 A;  4RDJ A;  1B2R A;  2DY1 A;  4XR6 A;  4Y9R A;  1K28 D;  2DIE A;  1VQ9 B;  5AN9 A;  5J35 A;  2XND A;  1QFY A;  3A35 A;  4B3F X;  3B78 A;  1N0V C;  4M53 A;  3OP1 A;  4XN0 A;  4X7D A;  4Z4Y A;  4G1B A;  1J9Z A;  4XKW A;  1ZUN B;  4QVA A;  2X6X A;  1TVC A;  4YAF A;  4LBV A;  2C4T A;  2X0K A;  4XL9 A;  2OYN A;  1JJ2 B;  5LMZ A;  1ZM3 A;  1TLL A;  4RCZ A;  5HKK A;  3RY8 A;  4YEJ A;  2GQF A;  2JN9 A;  1BJK A;  4OPS A;  1PJ6 A;  1V0E A;  4TMW A;  2CK3 A;  1DG1 G;  2CW5 A;  2ZBV A;  2ZL7 A;  2BM1 A;  4TKO B;  3OFN A;  1KK1 A;  3Q3A A;  5GV8 A;  2DYI A;  4YAO A;  4ACA A;  4H9G A;  4AC9 A;  4XQF A;  1E3Z A;  4FK8 A;  3CRZ A;  2ZZG A;  2OTJ B;  2B7C A;  1KZL A;  4Z4U A;  1DAR A;  1QX4 A;  1WOS A;  2D9R A;  4G1V A;  4XLA A;  1W35 A;  4XOR A;  4NCN A;  4TT3 A;  1QFZ A;  3ZC3 A;  1VQM B;  3OOC A;  1EP1 B;  1JB9 A;  4PC1 A;  3P26 A;  1VQ5 B;  1OGI A;  2X3U A;  4PGO A;  4P9S A;  5IYW A;  3I56 B;  1MRZ A;  1OB2 A;  1MAB A;  1I8D A;  1UD2 A;  3WY9 A;  1K9M D;  3VMF A;  1Y0R A;  1YIJ B;  2OK8 A;  1IJE A;  3QFS A;  3ASS A;  2BSA A;  1M90 D;  4F7D A;  4NBS A;  3G05 A;  1E79 A;  2JJ2 A;  4XD7 A;  2V7V A;  4OOV A;  3BCD A;  3FKS A;  4ACB A;  4ZGQ B;  4HE5 A;  1EFU A;  4NNJ A;  4DQL A;  4N3N A;  3GVJ A;  2VNI A;  1JA1 A;  1WTH D;  4ZV4 A;  4JMQ A;  2NV4 A;  4N3G A;  4ZCI A;  4QFM A; 
#chains in the Genus database with same CATH homology
 3U2Q A;  1FNC A;  1ZM4 A;  1HA3 A;  1AMO A;  4K1X A;  3WNB A;  1KQS B;  1VQL B;  4RD6 A;  1YHQ B;  1E63 A;  4DQK A;  2DCU A;  3WYA A;  3OW2 B;  3CCV B;  2RC5 A;  1FDR A;  1ZM9 A;  1H42 A;  4RJL A;  4HE6 A;  1U2R A;  3CC2 B;  4FWT A;  4Y9U A;  1VQ4 B;  1IB0 A;  1TTT A;  3AVU A;  2XEX A;  4PC2 A;  1K73 D;  2VZL A;  4B43 A;  1Q86 D;  1GO2 A;  4Y7C A;  1UMK A;  5H5J A;  1KTV A;  4R71 A;  4AF6 A;  3CCR B;  1YI2 B;  1VQO B;  4TMZ A;  4C0S A;  1EFC A;  2HCJ B;  2YWF A;  1CQX A;  3MHP A;  1H85 A;  2DET A;  3CCL B;  2BVN A;  1F60 A;  4YAL A;  3ES9 A;  3CMA B;  3FJO A;  1B23 P;  4ZCM A;  2BM0 A;  1W87 A;  2BN4 A;  1Q7Y D;  3PEN A;  4TN1 A;  3CXC B;  3QSY A;  4M4S A;  1R5N A;  4PC7 A;  4C43 A;  1TUI A;  1D8T A;  1QFJ A;  1QGA A;  3ZZU A;  1ELO A;  3CCJ B;  1K8A D;  3CC4 B;  1CNE A;  3CC7 B;  5GV7 A;  1QUF A;  1G7T A;  3OZV A;  1R5O A;  2DEU A;  1G7S A;  3W5V A;  2OK7 A;  4QHY A;  2AHO A;  1EXM A;  4M0L A;  1FRQ A;  2QEX B;  1XE1 A;  3G4S B;  3ZZT A;  2C78 A;  1CNF A;  1KJZ A;  1BX1 A;  3W2F A;  3MCA A;  3E20 A;  2VYQ A;  3ZZ0 A;  3WND A;  2BGI A;  1YJN B;  1YJ9 B;  1QGZ A;  3WBK A;  1VQP B;  2C77 A;  2DER A;  1GVH A;  4RD1 A;  1EWY A;  3QFR A;  3VNV A;  1GAQ A;  2YWG A;  4RD4 A;  1AIP A;  1A8P A;  2HMA A;  2CRV A;  1BQE A;  1G7R A;  3JQR A;  3OJW A;  3VO1 A;  3ZBU A;  1OB5 A;  1QUE A;  2XNC A;  4MYU A;  4PC3 A;  1VQ8 B;  3JQP A;  3CME B;  4PC6 A;  5TR9 A;  3CCQ B;  2HDN B;  2BMW A;  4EH1 A;  5H59 A;  3CCU B;  1KK3 A;  1BX0 A;  4B3X A;  3VO2 A;  1FNM A;  3E1Y E;  3LO8 A;  1KK0 A;  1FRN A;  4M2L A;  3AVX A;  2QDX A;  3AVV A;  3OJX A;  3W2H A;  4M1K A;  1EFT A;  4RD2 A;  1GAW A;  2OTL B;  3JQQ A;  3CPW B;  4AF7 A;  4RD0 A;  2B7B A;  1W2B B;  1E64 A;  5TV2 A;  3J81 k;  1YIT B;  1Q82 D;  1DDG A;  4P6V F;  1S0U A;  2E1R A;  3OZW A;  5TY0 A;  2PIA A;  1VQK B;  1GJR A;  5HXB A;  2EFG A;  3CCS B;  1VQN B;  3W2G A;  4MYT A;  3G6E B;  1KD1 D;  1QVF B;  1QG0 A;  1JNY A;  2QMU A;  3VNU A;  4LC0 A;  1ZM2 A;  4RD3 A;  2J7K A;  4YAU A;  3U6B A;  3MMP A;  1GR1 A;  4TMT A;  2YWE A;  4LBW A;  4ZGN B;  3ZBT A;  1F20 A;  3I55 B;  3CCE B;  3P27 A;  2PMD A;  1NJI D;  5EMN A;  2QN6 A;  1YJW B;  3AVW A;  3W5H A;  3QFC A;  1I7P A;  2QTL A;  5FA6 A;  1WDT A;  3CW2 A;  4B44 A;  4YAW A;  3W2I A;  1KC8 D;  2XNJ A;  3WXM A;  1SM4 A;  2PLF A;  3AVY A;  1QH0 A;  4Q7J B;  2GPJ A;  4B47 A;  4BPR A;  4TMV A;  2QA4 B;  2VNJ A;  4RCY A;  1E62 A;  3AGP A;  1XB2 A;  4LBY A;  1R5B A;  2D74 A;  4B48 A;  2ZIT A;  2R6H A;  2RC6 A;  2BF4 A;  1OGJ A;  1N8R D;  1QGY A;  1G7C A;  4B4D A;  5DSZ A;  3G71 B;  1IJF A;  1FND A;  4IW3 B;  1VQ6 B;  3QE2 A;  3CB4 A;  1NDH A;  2YWH A;  1SKQ A;  4U9U A;  1KRH A;  1M1K D;  1EP2 B;  3B8H A;  1EP3 B;  4TMX A;  1KK2 A;  1FNB A;  3I1F A;  3CD6 B;  3QFT A;  1Q81 D;  3U6K A;  3LVB A;  3W2E A;  4P3Y A;  2EIX A;  4WQM A;  2NPF A;  3B82 A;  5JBQ A;  1JA0 A;  3CCM B;  2BGJ A;  4G5G A;  4UAJ A;  2VNH A;  4LBZ A;  4ZCL A;  1QVG B;  2BPO A;  2VNK A;  4YHB A;  3W5U A;  2FX3 A;  1D2E A;  3AVT A;  2CND A;  1N0U A;  3WNC A;  2B5O A;  1D1N A;  2BV3 A;  3FPK A;  3AGQ A;  3WBJ A;  1DDI A;  3V76 A;  3SJZ A;  4J0Q A;  5KSW B;  1VQ7 B;  3OZU A;  4FN5 A;  2QTZ A;  5THX A;  1S72 B;  1B2R A;  2DY1 A;  4Y9R A;  1VQ9 B;  5AN9 A;  1QFY A;  3B78 A;  1N0V C;  4M53 A;  4G1B A;  1J9Z A;  1ZUN B;  1TVC A;  4YAF A;  4LBV A;  1JJ2 B;  1ZM3 A;  1TLL A;  4RCZ A;  2GQF A;  1BJK A;  4TMW A;  1DG1 G;  2BM1 A;  1KK1 A;  5GV8 A;  4YAO A;  4ACA A;  4H9G A;  4AC9 A;  4FK8 A;  3CRZ A;  2OTJ B;  2B7C A;  1DAR A;  1QX4 A;  4G1V A;  1W35 A;  4NCN A;  1QFZ A;  3ZC3 A;  1VQM B;  1EP1 B;  1JB9 A;  4PC1 A;  3P26 A;  1VQ5 B;  1OGI A;  2X3U A;  4PGO A;  3I56 B;  1OB2 A;  3WY9 A;  1K9M D;  3VMF A;  1YIJ B;  2OK8 A;  1IJE A;  3QFS A;  2BSA A;  1M90 D;  4F7D A;  4NBS A;  4ACB A;  4ZGQ B;  4HE5 A;  1EFU A;  4DQL A;  4N3N A;  2VNI A;  1JA1 A;  4ZV4 A;  1W34 A;  4N3G A;  4ZCI A;  4QFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...