1XE1A

Hypothetical protein from pyrococcus furiosus pfu-880080-001
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
IEILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical Protein From Pyrococcus Furiosus Pfu-880080-001
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PF0907
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1xe1A00
2YWGA 2VZLA 4TMTA 4M2LA 2R6HA 1BJKA 3P26A 3CD6B 3CCVB 1QUFA 1ZM3A 1KRHA 1EFCA 2VNHA 1QH0A 4HE5A 1GAWA 1DDIA 1E63A 3VNUA 4RJLA 2QMUA 2X3UA 4YAOA 5JBQA 1G7SA 5DSZA 4B3XA 3AVWA 4M1KA 1TLLA 2BGJA 4YAUA 1K8AD 4Y9RA 1DARA 1W34A 2DY1A 1YJ9B 1AMOA 3QSYA 2OTJB 4EH1A 2QA4B 4LBVA 4J0QA 1FNDA 5THXA 4PC1A 3OW2B 3CC2B 2VNIA 2DEUA 1G7TA 2BM1A 3I56B 4DQLA 2B5OA 4LBZA 3WBJA 3WNBA 1SM4A 1TVCA 1ZM9A 3W2IA 1VQ9B 4RD2A 2DERA 1QFZA 2BPOA 1VQ7B 1BX0A 1IJEA 5FA6A 2QTZA 4Y9UA 4PC2A 1DG1G 4PC6A 3I1FA 3ZZTA 1KK1A 4BPRA 2BSAA 1G7RA 1EWYA 1DDGA 3W5UA 1QVFB 3W2GA 3WNCA 1J9ZA 1EP3B 3CW2A 1S72B 1QGYA 4FWTA 4ZCMA 4C0SA 3G71B 5HXBA 3U6KA 1QFYA 1HA3A 3JQPA 1QX4A 2C77A 3CCLB 2BGIA 3CCMB 1QG0A 4FN5A 4ZV4A 1N8RD 2QTLA 2RC6A 1N0UA 4N3NA 1Q7YD 3AVVA 3ZZUA 4RCYA 2OK8A 2PLFA 2CNDA 1QUEA 1OB2A 2VNKA 4ZCIA 3LO8A 1GO2A 3W5HA 1XB2A 5TV2A 3AVXA 1D2EA 3ZC3A 1D8TA 2QDXA 1W2BB 2OTLB 2D74A 3W2EA 2HDNB 4TMZA 3CC7B 3CCQB 1M1KD 1FDRA 4C43A 3CCRB 3CC4B 1U2RA 1FNBA 4RD4A 3VO1A 3CCSB 3CRZA 4P3YA 1KK0A 1AIPA 4YAWA 4RD6A 1VQ4B 2YWHA 4TMXA 5TY0A 2EFGA 2GPJA 3QE2A 5TR9A 3W2FA 4MYTA 3OZVA 2BVNA 4ZCLA 3V76A 2VYQA 1GVHA 2BF4A 3LVBA 4NBSA 1Q86D 1D1NA 1EFTA 1FNCA 1YJNB 3AVTA 3WYAA 4B43A 1KTVA 1W87A 1BQEA 3U6BA 1S0UA 3CB4A 3CCJB 3MCAA 4B47A 1Q81D 4UAJA 2ZITA 3QFRA 1F20A 1EP1B 1VQMB 1ZM4A 4TN1A 1FRNA 2HCJB 2B7CA 4YAFA 1B23P 1OGIA 1G7CA 5GV7A 1KK3A 4RD3A 1GJRA 2HMAA 1KJZA 4DQKA 3FPKA 4QHYA 4LBYA 3WY9A 3G6EB 1R5BA 4G5GA 1GR1A 4M53A 2PMDA 2XNJA 1FRQA 3B82A 2DETA 4B44A 1M90D 1SKQA 4YALA 1QGAA 3OJWA 3OZUA 4ZGQB 4U9UA 1TUIA 1VQOB 5H5JA 3VO2A 2BMWA 3CPWB 1KQSB 1NDHA 1H85A 1E64A 4ACAA 1JA0A 3JQRA 4NCNA 1CNFA 3VNVA 3AGPA 3W2HA 2BV3A 4R71A 4LBWA 1YITB 4Q7JB 3ZZ0A 1E62A 1WDTA 3CMAB 2DCUA 1W35A 2GQFA 1TTTA 3JQQA 1VQPB 4FK8A 2RC5A 4AC9A 1F60A 2B7BA 3G4SB 4M0LA 3ES9A 4PC3A 3OJXA 1JB9A 4AF6A 3ZBUA 3I55B 2YWFA 1VQKB 1YHQB 1B2RA 1R5NA 3FJOA 1QFJA 5H59A 5EMNA 3QFTA 1ELOA 3MHPA 3WXMA 3MMPA 1CNEA 2PIAA 3QFSA 4F7DA 1CQXA 1H42A 4TMVA 1VQ5B 3VMFA 2OK7A 4B4DA 1EXMA 3CCUB 3WNDA 1FNMA 4PGOA 4TMWA 4PC7A 1KC8D 3CMEB 1ZUNB 2XEXA 1JJ2B 4H9GA 1OB5A 2J7KA 1YIJB 3B8HA 4ACBA 3PENA 4HE6A 2BN4A 4K1XA 3U2QA 1A8PA 1R5OA 5KSWB 2VNJA 3B78A 3ZBTA 1UMKA 3E20A 1YJWB 1VQLB 1EP2B 3W5VA 1NJID 1YI2B 4G1BA 2EIXA 3E1YE 1ZM2A 3AVUA 4M4SA 4YHBA 2AHOA 3CXCB 2BM0A 4AF7A 4G1VA 1JA1A 2E1RA 3CCEB 2XNCA 3QFCA 2QEXB 4IW3B 4QFMA 4RCZA 1K9MD 2CRVA 4LC0A 4Y7CA 4MYUA 3AGQA 1EFUA 5GV8A 5AN9A 1K73D 4RD1A 3AVYA 1OGJA 4B48A 1QVGB 4WQMA 1JNYA 1Q82D 3SJZA 4ZGNB 3WBKA 1IB0A 2NPFA 1N0VC 1VQ6B 4N3GA 1KD1D 1VQ8B 2QN6A 1BX1A 2C78A 1IJFA 1XE1A 1QGZA 3P27A 4RD0A 4P6VF 3OZWA 2FX3A 1I7PA 1GAQA 3J81k 1VQNB 2YWEA 1KK2A
chains in the Genus database with same CATH superfamily
1PKVA 2GK7A 2YWGA 2VZLA 2ZZQA 4TMTA 4M2LA 4OOVA 4XLHA 1E3XA 1T6ZA 4FXUA 2R6HA 4UZFA 4ASUA 1BJKA 1NBMA 4X7FA 3P26A 3CD6B 3CCVB 1QUFA 3Q38A 1ZM3A 5L46A 1KRHA 1EFCA 2VNHA 2Q6IA 1QH0A 4HE5A 1GAWA 4PAAA 1DDIA 3ONUA 1E1QA 1E63A 4P3IA 4P2NA 3VNUA 4RJLA 2QMUA 1WPCA 2X3UA 4YAOA 5BSXA 1G7SA 3SEJA 5DSZA 4KKUA 4B3XA 5JBQA 3ASPA 1XQBA 3AVWA 4M1KA 1TLLA 2BGJA 4YAUA 4P6YA 1K8AD 4HIZA 2C4UA 4XN0A 4Y9RA 4RPBA 1DARA 1E43A 3HAGA 2W6JA 5DN6A 4XLCA 4AVZA 1W34A 2XGJA 2CW5A 2DY1A 2VBTA 1PJ7A 1YJ9B 1AMOA 3QSYA 4UZEA 2OTJB 2XZLA 4EH1A 2QA4B 3Q6RA 4LBVA 4J0QA 1UD5A 5TRDA 4WZLA 1FNDA 2V7WA 2I1LA 5THXA 4PC1A 3OW2B 3CC2B 2VNIA 2DEUA 1G7TA 4OP7A 5E6TA 2BM1A 3I56B 4DQLA 2B5OA 4LBZA 4X07A 3WBJA 3WNBA 3A35A 1SM4A 1TVCA 1ZM9A 3PVDA 3W2IA 2DIEA 4DNTB 2C2WA 1VQ9B 1VF7A 1E3ZA 4RD2A 4Z4UA 2DERA 1QFZA 2BPOA 1VQ7B 1BX0A 3A8JA 1E79A 2WJYA 1IJEA 5FA6A 2QTZA 4Y9UA 4PC2A 1DG1G 1MABA 3I1FA 4PC6A 4XMYA 2D3NA 2V7VA 3OKXA 1KK1A 3ONYA 3ZZTA 4BPRA 5HZAA 2BSAA 3JU4A 1G7RA 1EWYA 1DDGA 1Y0RA 3W5UA 1QVFB 5IYRA 2P3MA 3A8IA 2PE3A 3W2GA 4WZEA 1J9ZA 1EP3B 3CW2A 3SKBA 3WNCA 3Q3AA 1S72B 1W9XA 1QGYA 2X6XA 4FWTA 4ZCMA 4C0SA 3G71B 5HXBA 2V7XA 2M5SA 3U6KA 1QFYA 1HA3A 1VLOA 3JQPA 2ZTGA 1QX4A 2ZL7A 2C77A 3CCLB 4JMQA 2BGIA 3CCMB 1QG0A 4WZKA 4XLEA 3FKSA 4FN5A 4ZV4A 3A8KA 1N8RD 2QTLA 2C4TA 2C5BA 2RC6A 4TSFA 4WZTA 4GQNA 4KKSA 3PUNA 1N0UA 4N3NA 1Q7YD 2ZXIA 1BMFA 3AVVA 1UD4A 3ZZUA 4TT3A 5A88A 4RCYA 4G7XA 4QVAA 2OK8A 2PLFA 4X7CA 3ZIAA 1I18A 2CNDA 5FO0A 1QUEA 1OB2A 2VNKA 4ZCIA 3LO8A 1K28D 1GO2A 3W5HA 1XB2A 5TV2A 3AVXA 2ZBVA 1D2EA 1SKYB 3ZC3A 1NRKA 1D8TA 2QDXA 1W2BB 1HVXA 4P12A 1VHEA 2D74A 2OTLB 5HZBA 1H8EA 1VHOA 4UZUA 3W2EA 2HDNB 1OHHA 4TMZA 3PA1A 4Z4VA 3CC7B 3CCQB 4RDLA 4Z4RA 1M1KD 1FDRA 4C43A 2WR8A 3CCRB 3CC4B 5FIUA 1U2RA 2X6YA 1N08A 5F4OA 1RQPA 2JJ1A 2OBSA 4OOXA 3BC9A 1FNBA 4RD4A 3VO1A 1V0EA 3CCSB 1OB0A 3CRZA 3R6KA 3GVJA 4P3YA 1WSVA 1KK0A 1AIPA 5HKKA 4YAWA 4OOSA 2R9VA 4RD6A 1VQ4B 1YX2A 2Z6BD 1P4MA 3OW7A 3BY1A 4P26A 2F43A 3GQBA 4Z1MA 5IYQA 3BY2A 2YWHA 3NE5B 4TMXA 2V7TA 5TY0A 2EFGA 2GPJA 3QE2A 4G7WA 5TR9A 3W2FA 5IYWA 3BH4A 4MYTA 3OZVA 2BVNA 3ISXA 4OPSA 4ZCLA 1WOPA 3V76A 4Z4ZA 2ZL5A 4XOPA 2GJRA 1WSRA 3OE7A 3ZUGA 2VYQA 4XR6A 1GVHA 2BF4A 3H94A 4RDJA 2KVOA 3LVBA 4NBSA 4NNJA 4XOTA 1Q86D 1D1NA 2WZPP 4XKVA 2D3LA 1EFTA 1FNCA 1YJNB 3AVTA 3WYAA 4B43A 1UD6A 2JIZA 1KTVA 1S4MA 5A8AA 1T6YA 1W87A 1BQEA 3U6BA 1S0UA 3LNNA 3CB4A 5FO1A 4DK1A 3CCJB 1E1RA 2WJVA 3MCAA 4B47A 3CESA 1Q81D 4UAJA 3DDYA 4CQJA 2ZITA 1VLYA 5F4MA 3QFRA 1F20A 5IK2A 1EP1B 1Q9SA 2ZZFA 1VQMB 1ZM4A 1VJSA 2DYIA 4KKTA 2VBVA 4TN1A 4P9SA 1FRNA 2HCJB 1V0FA 2B7CA 4YAFA 2VJJA 3ASRA 1B23P 1OGIA 1G7CA 5GV7A 4Z4TA 4XQFA 3KL9A 4DNRB 4X8IA 1KK3A 4RD3A 1WTHD 1WORA 1GJRA 2HMAA 5BSYA 2FVGA 1KJZA 4DQKA 4X7EA 3FPKA 3OAAA 4LBYA 4QHYA 3WY9A 4B3GA 4XD7A 3OEHA 2GK6A 3G6EB 1H8HA 1R5BA 4YEJA 4G5GA 4II2A 1GR1A 4M53A 1HZEA 2PMDA 4RLZA 2XNJA 2NV4A 1FRQA 3B82A 2JJ2A 3CPXA 2WSSA 1PJ6A 1NB9A 4Z4YA 1RQRA 2Q6KA 3RY8A 1T5EA 2DETA 4B44A 4G6IA 1M90D 1BPLA 1SKQA 4YALA 3PA2A 1QGAA 3OJWA 4YELA 3OZUA 4ZGQB 4U9UA 2V7UA 1TUIA 1VQOB 4XM3A 5FNZA 5H5JA 3VO2A 2BMWA 3CPWB 3LQ6A 1KQSB 1NB0A 4B3FX 1NDHA 1H85A 3A1PA 1E64A 4ACAA 2E1BA 1JA0A 1MRZA 3JQRA 5KW9A 4NCNA 1CNFA 4P1VA 2LZJA 3CTAA 3VNVA 3AGPA 2ZZEA 2Q6LA 1I8DA 3W2HA 2XZPA 2BV3A 4R71A 4LBWA 1YITB 2HLDA 4Q7JB 3ZZ0A 3KEWA 1E62A 5KNLA 3BNWA 2V31A 2F1LA 2JDIA 1WDTA 3CMAB 2DCUA 1W35A 3ASTA 2GQFA 1TTTA 2XZOA 3JQQA 1VQPB 4FK8A 3SLNA 5A89A 4E0FA 1WOSA 2ZXHA 3Q6QA 3CP8A 2RC5A 4AC9A 1PJ5A 1F60A 4XORA 2B7BA 2XOKA 3G4SB 4M0LA 2OBRA 3ES9A 3H9NA 4PC3A 4TKOB 2ZZGA 3OJXA 1JB9A 4AF6A 1W0JA 3FPPA 3PUMA 3ZBUA 3I55B 3V7AA 4Z4SA 3BQJA 2X6WA 2YWFA 5DS0A 1VQKB 2QE7A 4OPVA 1YHQB 2WYRA 1B2RA 4WWVA 3ASSA 3G05A 1R5NA 4XN3A 3T56B 1IHMA 3FJOA 3Q39A 1QFJA 5H59A 4X7DA 5EMNA 2CK3A 3QFTA 1UD3A 2X8KA 1ELOA 3MHPA 4PABA 2CF4A 3MMPA 1CNEA 3WXMA 2PIAA 1W0KA 1WP6A 3QFSA 4F7DA 1CQXA 1H42A 5IYPA 1UD2A 4TMVA 1VQ5B 3VMFA 2OK7A 4B4DA 1EXMA 4ROXA 3CCUB 3WNDA 1FNMA 2GREA 4PGOA 4TMWA 1KMHA 4PC7A 3WQZA 2VBSA 3A3BA 1KC8D 3CMEB 1ZUNB 2WZNA 2XEXA 2GJKA 3CP2A 1JJ2B 4QUZA 4H9GA 5F4JA 5CDFA 2J7KA 1OB5A 5J3OA 3BCFA 2X53S 1N07A 4RDKA 2V7QA 2F1MA 3OPOA 3OP1A 4X0CA 1YIJB 3B8HA 4QVJA 4ACBA 2VBUA 3PENA 4HE6A 2BN4A 4K1XA 5J35A 2VJIA 4L8JA 4XLAA 1A8PA 3U2QA 4DK0A 1R5OA 5KSWB 2CBXA 2VNJA 3B78A 2D9RA 3ZBTA 1UMKA 2GJPA 4II3A 4X06A 3OEEA 3VR6A 3GIRA 3E20A 1YJWB 1VQLB 1EP2B 2QGGA 3GVKA 3W5VA 1NJID 1YI2B 4OPOA 4G1BA 2EIXA 3E1YE 1ZM2A 4QV2A 4XNFA 3AVUA 2W6IA 4M4SA 4YHBA 2AHOA 1WOOA 3CXCB 2BM0A 4AF7A 1KZLA 3ZPNA 4Z4WA 4G1VA 1JA1A 2E1RA 1Y0YA 3CCEB 5FL7A 2XNCA 2WPDA 3QFCA 3SLDA 4IW3B 2QEXB 1EFRA 4P25A 4QFMA 4P22A 4RCZA 3A3GA 1K9MD 1FX0A 4RM0A 2CRVA 1T6XA 1UD8A 3GVLA 3OFNA 3SJPA 1XFOA 2Q6OA 4LC0A 4Y7CA 4MYUA 3AGQA 2X85A 2ZBUA 2JN9A 1EFUA 4XL9A 2C5HA 4XKWA 5GV8A 5AN9A 4X05A 1K73D 4RD1A 5LMZA 3AVYA 1BLIA 1OGJA 2ZTNA 4B48A 1QVGB 4WQMA 3ASQA 1JNYA 1Q82D 3SJZA 4ZGNB 3WBKA 1IB0A 2OBTA 1COWA 4XLFA 2CC2A 2NPFA 1N0VC 3R6JA 5B6IA 1YLOA 1VQ6B 3BCDA 4N3GA 1WU8A 3T53B 1KD1D 4YXWA 1VQ8B 2QN6A 3GSIA 1BX1A 2DOGA 2ZL6A 2C78A 2X0KA 4XONA 1IJFA 1XE1A 1N05A 1QGZA 3D26A 3P27A 4RD0A 3OOCA 4P6VF 2OYNA 2XNDA 3CMMA 3OZWA 2FX3A 1I7PA 1N06A 2V4DA 1GAQA 3J81k 1VQNB 3T51B 5IYNA 3LQEA 2F4NA 1KK2A 2YWEA 1V5VA 4RPDA
chains in the Genus database with same CATH topology
2YWGA 2VZLA 4TMTA 4M2LA 2R6HA 1BJKA 3P26A 3CD6B 3CCVB 1QUFA 1ZM3A 1KRHA 1EFCA 2VNHA 1QH0A 4HE5A 1GAWA 1DDIA 1E63A 3VNUA 4RJLA 2QMUA 2X3UA 4YAOA 5JBQA 1G7SA 5DSZA 4B3XA 3AVWA 4M1KA 1TLLA 2BGJA 4YAUA 1K8AD 4Y9RA 1DARA 1W34A 2DY1A 1YJ9B 1AMOA 3QSYA 2OTJB 4EH1A 2QA4B 4LBVA 4J0QA 1FNDA 5THXA 4PC1A 3OW2B 3CC2B 2VNIA 2DEUA 1G7TA 2BM1A 3I56B 4DQLA 2B5OA 4LBZA 3WBJA 3WNBA 1SM4A 1TVCA 1ZM9A 3W2IA 1VQ9B 4RD2A 2DERA 1QFZA 2BPOA 1VQ7B 1BX0A 1IJEA 5FA6A 2QTZA 4Y9UA 4PC2A 1DG1G 4PC6A 3I1FA 3ZZTA 1KK1A 4BPRA 2BSAA 1G7RA 1EWYA 1DDGA 3W5UA 1QVFB 3W2GA 3WNCA 1J9ZA 1EP3B 3CW2A 1S72B 1QGYA 4FWTA 4ZCMA 4C0SA 3G71B 5HXBA 3U6KA 1QFYA 1HA3A 3JQPA 1QX4A 2C77A 3CCLB 2BGIA 3CCMB 1QG0A 4FN5A 4ZV4A 1N8RD 2QTLA 2RC6A 1N0UA 4N3NA 1Q7YD 3AVVA 3ZZUA 4RCYA 2OK8A 2PLFA 2CNDA 1QUEA 1OB2A 2VNKA 4ZCIA 3LO8A 1GO2A 3W5HA 1XB2A 5TV2A 3AVXA 1D2EA 3ZC3A 1D8TA 2QDXA 1W2BB 2OTLB 2D74A 3W2EA 2HDNB 4TMZA 3CC7B 3CCQB 1M1KD 1FDRA 4C43A 3CCRB 3CC4B 1U2RA 1FNBA 4RD4A 3VO1A 3CCSB 3CRZA 4P3YA 1KK0A 1AIPA 4YAWA 4RD6A 1VQ4B 2YWHA 4TMXA 5TY0A 2EFGA 2GPJA 3QE2A 5TR9A 3W2FA 4MYTA 3OZVA 2BVNA 4ZCLA 3V76A 2VYQA 1GVHA 2BF4A 3LVBA 4NBSA 1Q86D 1D1NA 1EFTA 1FNCA 1YJNB 3AVTA 3WYAA 4B43A 1KTVA 1W87A 1BQEA 3U6BA 1S0UA 3CB4A 3CCJB 3MCAA 4B47A 1Q81D 4UAJA 2ZITA 3QFRA 1F20A 1EP1B 1VQMB 1ZM4A 4TN1A 1FRNA 2HCJB 2B7CA 4YAFA 1B23P 1OGIA 1G7CA 5GV7A 1KK3A 4RD3A 1GJRA 2HMAA 1KJZA 4DQKA 3FPKA 4QHYA 4LBYA 3WY9A 3G6EB 1R5BA 4G5GA 1GR1A 4M53A 2PMDA 2XNJA 1FRQA 3B82A 2DETA 4B44A 1M90D 1SKQA 4YALA 1QGAA 3OJWA 3OZUA 4ZGQB 4U9UA 1TUIA 1VQOB 5H5JA 3VO2A 2BMWA 3CPWB 1KQSB 1NDHA 1H85A 1E64A 4ACAA 1JA0A 3JQRA 4NCNA 1CNFA 3VNVA 3AGPA 3W2HA 2BV3A 4R71A 4LBWA 1YITB 4Q7JB 3ZZ0A 1E62A 1WDTA 3CMAB 2DCUA 1W35A 2GQFA 1TTTA 3JQQA 1VQPB 4FK8A 2RC5A 4AC9A 1F60A 2B7BA 3G4SB 4M0LA 3ES9A 4PC3A 3OJXA 1JB9A 4AF6A 3ZBUA 3I55B 2YWFA 1VQKB 1YHQB 1B2RA 1R5NA 3FJOA 1QFJA 5H59A 5EMNA 3QFTA 1ELOA 3MHPA 3WXMA 3MMPA 1CNEA 2PIAA 3QFSA 4F7DA 1CQXA 1H42A 4TMVA 1VQ5B 3VMFA 2OK7A 4B4DA 1EXMA 3CCUB 3WNDA 1FNMA 4PGOA 4TMWA 4PC7A 1KC8D 3CMEB 1ZUNB 2XEXA 1JJ2B 4H9GA 1OB5A 2J7KA 1YIJB 3B8HA 4ACBA 3PENA 4HE6A 2BN4A 4K1XA 3U2QA 1A8PA 1R5OA 5KSWB 2VNJA 3B78A 3ZBTA 1UMKA 3E20A 1YJWB 1VQLB 1EP2B 3W5VA 1NJID 1YI2B 4G1BA 2EIXA 3E1YE 1ZM2A 3AVUA 4M4SA 4YHBA 2AHOA 3CXCB 2BM0A 4AF7A 4G1VA 1JA1A 2E1RA 3CCEB 2XNCA 3QFCA 2QEXB 4IW3B 4QFMA 4RCZA 1K9MD 2CRVA 4LC0A 4Y7CA 4MYUA 3AGQA 1EFUA 5GV8A 5AN9A 1K73D 4RD1A 3AVYA 1OGJA 4B48A 1QVGB 4WQMA 1JNYA 1Q82D 3SJZA 4ZGNB 3WBKA 1IB0A 2NPFA 1N0VC 1VQ6B 4N3GA 1KD1D 1VQ8B 2QN6A 1BX1A 2C78A 1IJFA 1XE1A 1QGZA 3P27A 4RD0A 4P6VF 3OZWA 2FX3A 1I7PA 1GAQA 3J81k 1VQNB 2YWEA 1KK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWG A;  2VZL A;  4TMT A;  4M2L A;  2R6H A;  1BJK A;  3P26 A;  3CD6 B;  3CCV B;  1QUF A;  1ZM3 A;  1KRH A;  1EFC A;  2VNH A;  1QH0 A;  4HE5 A;  1GAW A;  1DDI A;  1E63 A;  3VNU A;  4RJL A;  2QMU A;  2X3U A;  4YAO A;  5JBQ A;  1G7S A;  5DSZ A;  4B3X A;  3AVW A;  4M1K A;  1TLL A;  2BGJ A;  4YAU A;  1K8A D;  4Y9R A;  1DAR A;  1W34 A;  2DY1 A;  1YJ9 B;  1AMO A;  3QSY A;  2OTJ B;  4EH1 A;  2QA4 B;  4LBV A;  4J0Q A;  1FND A;  5THX A;  4PC1 A;  3OW2 B;  3CC2 B;  2VNI A;  2DEU A;  1G7T A;  2BM1 A;  3I56 B;  4DQL A;  2B5O A;  4LBZ A;  3WBJ A;  3WNB A;  1SM4 A;  1TVC A;  1ZM9 A;  3W2I A;  1VQ9 B;  4RD2 A;  2DER A;  1QFZ A;  2BPO A;  1VQ7 B;  1BX0 A;  1IJE A;  5FA6 A;  2QTZ A;  4Y9U A;  4PC2 A;  1DG1 G;  4PC6 A;  3I1F A;  3ZZT A;  1KK1 A;  4BPR A;  2BSA A;  1G7R A;  1EWY A;  1DDG A;  3W5U A;  1QVF B;  3W2G A;  3WNC A;  1J9Z A;  1EP3 B;  3CW2 A;  1S72 B;  1QGY A;  4FWT A;  4ZCM A;  4C0S A;  3G71 B;  5HXB A;  3U6K A;  1QFY A;  1HA3 A;  3JQP A;  1QX4 A;  2C77 A;  3CCL B;  2BGI A;  3CCM B;  1QG0 A;  4FN5 A;  4ZV4 A;  1N8R D;  2QTL A;  2RC6 A;  1N0U A;  4N3N A;  1Q7Y D;  3AVV A;  3ZZU A;  4RCY A;  2OK8 A;  2PLF A;  2CND A;  1QUE A;  1OB2 A;  2VNK A;  4ZCI A;  3LO8 A;  1GO2 A;  3W5H A;  1XB2 A;  5TV2 A;  3AVX A;  1D2E A;  3ZC3 A;  1D8T A;  2QDX A;  1W2B B;  2OTL B;  2D74 A;  3W2E A;  2HDN B;  4TMZ A;  3CC7 B;  3CCQ B;  1M1K D;  1FDR A;  4C43 A;  3CCR B;  3CC4 B;  1U2R A;  1FNB A;  4RD4 A;  3VO1 A;  3CCS B;  3CRZ A;  4P3Y A;  1KK0 A;  1AIP A;  4YAW A;  4RD6 A;  1VQ4 B;  2YWH A;  4TMX A;  5TY0 A;  2EFG A;  2GPJ A;  3QE2 A;  5TR9 A;  3W2F A;  4MYT A;  3OZV A;  2BVN A;  4ZCL A;  3V76 A;  2VYQ A;  1GVH A;  2BF4 A;  3LVB A;  4NBS A;  1Q86 D;  1D1N A;  1EFT A;  1FNC A;  1YJN B;  3AVT A;  3WYA A;  4B43 A;  1KTV A;  1W87 A;  1BQE A;  3U6B A;  1S0U A;  3CB4 A;  3CCJ B;  3MCA A;  4B47 A;  1Q81 D;  4UAJ A;  2ZIT A;  3QFR A;  1F20 A;  1EP1 B;  1VQM B;  1ZM4 A;  4TN1 A;  1FRN A;  2HCJ B;  2B7C A;  4YAF A;  1B23 P;  1OGI A;  1G7C A;  5GV7 A;  1KK3 A;  4RD3 A;  1GJR A;  2HMA A;  1KJZ A;  4DQK A;  3FPK A;  4QHY A;  4LBY A;  3WY9 A;  3G6E B;  1R5B A;  4G5G A;  1GR1 A;  4M53 A;  2PMD A;  2XNJ A;  1FRQ A;  3B82 A;  2DET A;  4B44 A;  1M90 D;  1SKQ A;  4YAL A;  1QGA A;  3OJW A;  3OZU A;  4ZGQ B;  4U9U A;  1TUI A;  1VQO B;  5H5J A;  3VO2 A;  2BMW A;  3CPW B;  1KQS B;  1NDH A;  1H85 A;  1E64 A;  4ACA A;  1JA0 A;  3JQR A;  4NCN A;  1CNF A;  3VNV A;  3AGP A;  3W2H A;  2BV3 A;  4R71 A;  4LBW A;  1YIT B;  4Q7J B;  3ZZ0 A;  1E62 A;  1WDT A;  3CMA B;  2DCU A;  1W35 A;  2GQF A;  1TTT A;  3JQQ A;  1VQP B;  4FK8 A;  2RC5 A;  4AC9 A;  1F60 A;  2B7B A;  3G4S B;  4M0L A;  3ES9 A;  4PC3 A;  3OJX A;  1JB9 A;  4AF6 A;  3ZBU A;  3I55 B;  2YWF A;  1VQK B;  1YHQ B;  1B2R A;  1R5N A;  3FJO A;  1QFJ A;  5H59 A;  5EMN A;  3QFT A;  1ELO A;  3MHP A;  3WXM A;  3MMP A;  1CNE A;  2PIA A;  3QFS A;  4F7D A;  1CQX A;  1H42 A;  4TMV A;  1VQ5 B;  3VMF A;  2OK7 A;  4B4D A;  1EXM A;  3CCU B;  3WND A;  1FNM A;  4PGO A;  4TMW A;  4PC7 A;  1KC8 D;  3CME B;  1ZUN B;  2XEX A;  1JJ2 B;  4H9G A;  1OB5 A;  2J7K A;  1YIJ B;  3B8H A;  4ACB A;  3PEN A;  4HE6 A;  2BN4 A;  4K1X A;  3U2Q A;  1A8P A;  1R5O A;  5KSW B;  2VNJ A;  3B78 A;  3ZBT A;  1UMK A;  3E20 A;  1YJW B;  1VQL B;  1EP2 B;  3W5V A;  1NJI D;  1YI2 B;  4G1B A;  2EIX A;  3E1Y E;  1ZM2 A;  3AVU A;  4M4S A;  4YHB A;  2AHO A;  3CXC B;  2BM0 A;  4AF7 A;  4G1V A;  1JA1 A;  2E1R A;  3CCE B;  2XNC A;  3QFC A;  2QEX B;  4IW3 B;  4QFM A;  4RCZ A;  1K9M D;  2CRV A;  4LC0 A;  4Y7C A;  4MYU A;  3AGQ A;  1EFU A;  5GV8 A;  5AN9 A;  1K73 D;  4RD1 A;  3AVY A;  1OGJ A;  4B48 A;  1QVG B;  4WQM A;  1JNY A;  1Q82 D;  3SJZ A;  4ZGN B;  3WBK A;  1IB0 A;  2NPF A;  1N0V C;  1VQ6 B;  4N3G A;  1KD1 D;  1VQ8 B;  2QN6 A;  1BX1 A;  2C78 A;  1IJF A;  1XE1 A;  1QGZ A;  3P27 A;  4RD0 A;  4P6V F;  3OZW A;  2FX3 A;  1I7P A;  1GAQ A;  3J81 k;  1VQN B;  2YWE A;  1KK2 A; 
#chains in the Genus database with same CATH topology
 1PKV A;  2GK7 A;  2YWG A;  2VZL A;  2ZZQ A;  4TMT A;  4M2L A;  4OOV A;  4XLH A;  1E3X A;  1T6Z A;  4FXU A;  2R6H A;  4UZF A;  4ASU A;  1BJK A;  1NBM A;  4X7F A;  3P26 A;  3CD6 B;  3CCV B;  1QUF A;  3Q38 A;  1ZM3 A;  5L46 A;  1KRH A;  1EFC A;  2VNH A;  2Q6I A;  1QH0 A;  4HE5 A;  1GAW A;  4PAA A;  1DDI A;  3ONU A;  1E1Q A;  1E63 A;  4P3I A;  4P2N A;  3VNU A;  4RJL A;  2QMU A;  1WPC A;  2X3U A;  4YAO A;  5BSX A;  1G7S A;  3SEJ A;  5DSZ A;  4KKU A;  4B3X A;  5JBQ A;  3ASP A;  1XQB A;  3AVW A;  4M1K A;  1TLL A;  2BGJ A;  4YAU A;  4P6Y A;  1K8A D;  4HIZ A;  2C4U A;  4XN0 A;  4Y9R A;  4RPB A;  1DAR A;  1E43 A;  3HAG A;  2W6J A;  5DN6 A;  4XLC A;  4AVZ A;  1W34 A;  2XGJ A;  2CW5 A;  2DY1 A;  2VBT A;  1PJ7 A;  1YJ9 B;  1AMO A;  3QSY A;  4UZE A;  2OTJ B;  2XZL A;  4EH1 A;  2QA4 B;  3Q6R A;  4LBV A;  4J0Q A;  1UD5 A;  5TRD A;  4WZL A;  1FND A;  2V7W A;  2I1L A;  5THX A;  4PC1 A;  3OW2 B;  3CC2 B;  2VNI A;  2DEU A;  1G7T A;  4OP7 A;  5E6T A;  2BM1 A;  3I56 B;  4DQL A;  2B5O A;  4LBZ A;  4X07 A;  3WBJ A;  3WNB A;  3A35 A;  1SM4 A;  1TVC A;  1ZM9 A;  3PVD A;  3W2I A;  2DIE A;  4DNT B;  2C2W A;  1VQ9 B;  1VF7 A;  1E3Z A;  4RD2 A;  4Z4U A;  2DER A;  1QFZ A;  2BPO A;  1VQ7 B;  1BX0 A;  3A8J A;  1E79 A;  2WJY A;  1IJE A;  5FA6 A;  2QTZ A;  4Y9U A;  4PC2 A;  1DG1 G;  1MAB A;  3I1F A;  4PC6 A;  4XMY A;  2D3N A;  2V7V A;  3OKX A;  1KK1 A;  3ONY A;  3ZZT A;  4BPR A;  5HZA A;  2BSA A;  3JU4 A;  1G7R A;  1EWY A;  1DDG A;  1Y0R A;  3W5U A;  1QVF B;  5IYR A;  2P3M A;  3A8I A;  2PE3 A;  3W2G A;  4WZE A;  1J9Z A;  1EP3 B;  3CW2 A;  3SKB A;  3WNC A;  3Q3A A;  1S72 B;  1W9X A;  1QGY A;  2X6X A;  4FWT A;  4ZCM A;  4C0S A;  3G71 B;  5HXB A;  2V7X A;  2M5S A;  3U6K A;  1QFY A;  1HA3 A;  1VLO A;  3JQP A;  2ZTG A;  1QX4 A;  2ZL7 A;  2C77 A;  3CCL B;  4JMQ A;  2BGI A;  3CCM B;  1QG0 A;  4WZK A;  4XLE A;  3FKS A;  4FN5 A;  4ZV4 A;  3A8K A;  1N8R D;  2QTL A;  2C4T A;  2C5B A;  2RC6 A;  4TSF A;  4WZT A;  4GQN A;  4KKS A;  3PUN A;  1N0U A;  4N3N A;  1Q7Y D;  2ZXI A;  1BMF A;  3AVV A;  1UD4 A;  3ZZU A;  4TT3 A;  5A88 A;  4RCY A;  4G7X A;  4QVA A;  2OK8 A;  2PLF A;  4X7C A;  3ZIA A;  1I18 A;  2CND A;  5FO0 A;  1QUE A;  1OB2 A;  2VNK A;  4ZCI A;  3LO8 A;  1K28 D;  1GO2 A;  3W5H A;  1XB2 A;  5TV2 A;  3AVX A;  2ZBV A;  1D2E A;  1SKY B;  3ZC3 A;  1NRK A;  1D8T A;  2QDX A;  1W2B B;  1HVX A;  4P12 A;  1VHE A;  2D74 A;  2OTL B;  5HZB A;  1H8E A;  1VHO A;  4UZU A;  3W2E A;  2HDN B;  1OHH A;  4TMZ A;  3PA1 A;  4Z4V A;  3CC7 B;  3CCQ B;  4RDL A;  4Z4R A;  1M1K D;  1FDR A;  4C43 A;  2WR8 A;  3CCR B;  3CC4 B;  5FIU A;  1U2R A;  2X6Y A;  1N08 A;  5F4O A;  1RQP A;  2JJ1 A;  2OBS A;  4OOX A;  3BC9 A;  1FNB A;  4RD4 A;  3VO1 A;  1V0E A;  3CCS B;  1OB0 A;  3CRZ A;  3R6K A;  3GVJ A;  4P3Y A;  1WSV A;  1KK0 A;  1AIP A;  5HKK A;  4YAW A;  4OOS A;  2R9V A;  4RD6 A;  1VQ4 B;  1YX2 A;  2Z6B D;  1P4M A;  3OW7 A;  3BY1 A;  4P26 A;  2F43 A;  3GQB A;  4Z1M A;  5IYQ A;  3BY2 A;  2YWH A;  3NE5 B;  4TMX A;  2V7T A;  5TY0 A;  2EFG A;  2GPJ A;  3QE2 A;  4G7W A;  5TR9 A;  3W2F A;  5IYW A;  3BH4 A;  4MYT A;  3OZV A;  2BVN A;  3ISX A;  4OPS A;  4ZCL A;  1WOP A;  3V76 A;  4Z4Z A;  2ZL5 A;  4XOP A;  2GJR A;  1WSR A;  3OE7 A;  3ZUG A;  2VYQ A;  4XR6 A;  1GVH A;  2BF4 A;  3H94 A;  4RDJ A;  2KVO A;  3LVB A;  4NBS A;  4NNJ A;  4XOT A;  1Q86 D;  1D1N A;  2WZP P;  4XKV A;  2D3L A;  1EFT A;  1FNC A;  1YJN B;  3AVT A;  3WYA A;  4B43 A;  1UD6 A;  2JIZ A;  1KTV A;  1S4M A;  5A8A A;  1T6Y A;  1W87 A;  1BQE A;  3U6B A;  1S0U A;  3LNN A;  3CB4 A;  5FO1 A;  4DK1 A;  3CCJ B;  1E1R A;  2WJV A;  3MCA A;  4B47 A;  3CES A;  1Q81 D;  4UAJ A;  3DDY A;  4CQJ A;  2ZIT A;  1VLY A;  5F4M A;  3QFR A;  1F20 A;  5IK2 A;  1EP1 B;  1Q9S A;  2ZZF A;  1VQM B;  1ZM4 A;  1VJS A;  2DYI A;  4KKT A;  2VBV A;  4TN1 A;  4P9S A;  1FRN A;  2HCJ B;  1V0F A;  2B7C A;  4YAF A;  2VJJ A;  3ASR A;  1B23 P;  1OGI A;  1G7C A;  5GV7 A;  4Z4T A;  4XQF A;  3KL9 A;  4DNR B;  4X8I A;  1KK3 A;  4RD3 A;  1WTH D;  1WOR A;  1GJR A;  2HMA A;  5BSY A;  2FVG A;  1KJZ A;  4DQK A;  4X7E A;  3FPK A;  3OAA A;  4LBY A;  4QHY A;  3WY9 A;  4B3G A;  4XD7 A;  3OEH A;  2GK6 A;  3G6E B;  1H8H A;  1R5B A;  4YEJ A;  4G5G A;  4II2 A;  1GR1 A;  4M53 A;  1HZE A;  2PMD A;  4RLZ A;  2XNJ A;  2NV4 A;  1FRQ A;  3B82 A;  2JJ2 A;  3CPX A;  2WSS A;  1PJ6 A;  1NB9 A;  4Z4Y A;  1RQR A;  2Q6K A;  3RY8 A;  1T5E A;  2DET A;  4B44 A;  4G6I A;  1M90 D;  1BPL A;  1SKQ A;  4YAL A;  3PA2 A;  1QGA A;  3OJW A;  4YEL A;  3OZU A;  4ZGQ B;  4U9U A;  2V7U A;  1TUI A;  1VQO B;  4XM3 A;  5FNZ A;  5H5J A;  3VO2 A;  2BMW A;  3CPW B;  3LQ6 A;  1KQS B;  1NB0 A;  4B3F X;  1NDH A;  1H85 A;  3A1P A;  1E64 A;  4ACA A;  2E1B A;  1JA0 A;  1MRZ A;  3JQR A;  5KW9 A;  4NCN A;  1CNF A;  4P1V A;  2LZJ A;  3CTA A;  3VNV A;  3AGP A;  2ZZE A;  2Q6L A;  1I8D A;  3W2H A;  2XZP A;  2BV3 A;  4R71 A;  4LBW A;  1YIT B;  2HLD A;  4Q7J B;  3ZZ0 A;  3KEW A;  1E62 A;  5KNL A;  3BNW A;  2V31 A;  2F1L A;  2JDI A;  1WDT A;  3CMA B;  2DCU A;  1W35 A;  3AST A;  2GQF A;  1TTT A;  2XZO A;  3JQQ A;  1VQP B;  4FK8 A;  3SLN A;  5A89 A;  4E0F A;  1WOS A;  2ZXH A;  3Q6Q A;  3CP8 A;  2RC5 A;  4AC9 A;  1PJ5 A;  1F60 A;  4XOR A;  2B7B A;  2XOK A;  3G4S B;  4M0L A;  2OBR A;  3ES9 A;  3H9N A;  4PC3 A;  4TKO B;  2ZZG A;  3OJX A;  1JB9 A;  4AF6 A;  1W0J A;  3FPP A;  3PUM A;  3ZBU A;  3I55 B;  3V7A A;  4Z4S A;  3BQJ A;  2X6W A;  2YWF A;  5DS0 A;  1VQK B;  2QE7 A;  4OPV A;  1YHQ B;  2WYR A;  1B2R A;  4WWV A;  3ASS A;  3G05 A;  1R5N A;  4XN3 A;  3T56 B;  1IHM A;  3FJO A;  3Q39 A;  1QFJ A;  5H59 A;  4X7D A;  5EMN A;  2CK3 A;  3QFT A;  1UD3 A;  2X8K A;  1ELO A;  3MHP A;  4PAB A;  2CF4 A;  3MMP A;  1CNE A;  3WXM A;  2PIA A;  1W0K A;  1WP6 A;  3QFS A;  4F7D A;  1CQX A;  1H42 A;  5IYP A;  1UD2 A;  4TMV A;  1VQ5 B;  3VMF A;  2OK7 A;  4B4D A;  1EXM A;  4ROX A;  3CCU B;  3WND A;  1FNM A;  2GRE A;  4PGO A;  4TMW A;  1KMH A;  4PC7 A;  3WQZ A;  2VBS A;  3A3B A;  1KC8 D;  3CME B;  1ZUN B;  2WZN A;  2XEX A;  2GJK A;  3CP2 A;  1JJ2 B;  4QUZ A;  4H9G A;  5F4J A;  5CDF A;  2J7K A;  1OB5 A;  5J3O A;  3BCF A;  2X53 S;  1N07 A;  4RDK A;  2V7Q A;  2F1M A;  3OPO A;  3OP1 A;  4X0C A;  1YIJ B;  3B8H A;  4QVJ A;  4ACB A;  2VBU A;  3PEN A;  4HE6 A;  2BN4 A;  4K1X A;  5J35 A;  2VJI A;  4L8J A;  4XLA A;  1A8P A;  3U2Q A;  4DK0 A;  1R5O A;  5KSW B;  2CBX A;  2VNJ A;  3B78 A;  2D9R A;  3ZBT A;  1UMK A;  2GJP A;  4II3 A;  4X06 A;  3OEE A;  3VR6 A;  3GIR A;  3E20 A;  1YJW B;  1VQL B;  1EP2 B;  2QGG A;  3GVK A;  3W5V A;  1NJI D;  1YI2 B;  4OPO A;  4G1B A;  2EIX A;  3E1Y E;  1ZM2 A;  4QV2 A;  4XNF A;  3AVU A;  2W6I A;  4M4S A;  4YHB A;  2AHO A;  1WOO A;  3CXC B;  2BM0 A;  4AF7 A;  1KZL A;  3ZPN A;  4Z4W A;  4G1V A;  1JA1 A;  2E1R A;  1Y0Y A;  3CCE B;  5FL7 A;  2XNC A;  2WPD A;  3QFC A;  3SLD A;  4IW3 B;  2QEX B;  1EFR A;  4P25 A;  4QFM A;  4P22 A;  4RCZ A;  3A3G A;  1K9M D;  1FX0 A;  4RM0 A;  2CRV A;  1T6X A;  1UD8 A;  3GVL A;  3OFN A;  3SJP A;  1XFO A;  2Q6O A;  4LC0 A;  4Y7C A;  4MYU A;  3AGQ A;  2X85 A;  2ZBU A;  2JN9 A;  1EFU A;  4XL9 A;  2C5H A;  4XKW A;  5GV8 A;  5AN9 A;  4X05 A;  1K73 D;  4RD1 A;  5LMZ A;  3AVY A;  1BLI A;  1OGJ A;  2ZTN A;  4B48 A;  1QVG B;  4WQM A;  3ASQ A;  1JNY A;  1Q82 D;  3SJZ A;  4ZGN B;  3WBK A;  1IB0 A;  2OBT A;  1COW A;  4XLF A;  2CC2 A;  2NPF A;  1N0V C;  3R6J A;  5B6I A;  1YLO A;  1VQ6 B;  3BCD A;  4N3G A;  1WU8 A;  3T53 B;  1KD1 D;  4YXW A;  1VQ8 B;  2QN6 A;  3GSI A;  1BX1 A;  2DOG A;  2ZL6 A;  2C78 A;  2X0K A;  4XON A;  1IJF A;  1XE1 A;  1N05 A;  1QGZ A;  3D26 A;  3P27 A;  4RD0 A;  3OOC A;  4P6V F;  2OYN A;  2XND A;  3CMM A;  3OZW A;  2FX3 A;  1I7P A;  1N06 A;  2V4D A;  1GAQ A;  3J81 k;  1VQN B;  3T51 B;  5IYN A;  3LQE A;  2F4N A;  1KK2 A;  2YWE A;  1V5V A;  4RPD A; 
#chains in the Genus database with same CATH homology
 2YWG A;  2VZL A;  4TMT A;  4M2L A;  2R6H A;  1BJK A;  3P26 A;  3CD6 B;  3CCV B;  1QUF A;  1ZM3 A;  1KRH A;  1EFC A;  2VNH A;  1QH0 A;  4HE5 A;  1GAW A;  1DDI A;  1E63 A;  3VNU A;  4RJL A;  2QMU A;  2X3U A;  4YAO A;  5JBQ A;  1G7S A;  5DSZ A;  4B3X A;  3AVW A;  4M1K A;  1TLL A;  2BGJ A;  4YAU A;  1K8A D;  4Y9R A;  1DAR A;  1W34 A;  2DY1 A;  1YJ9 B;  1AMO A;  3QSY A;  2OTJ B;  4EH1 A;  2QA4 B;  4LBV A;  4J0Q A;  1FND A;  5THX A;  4PC1 A;  3OW2 B;  3CC2 B;  2VNI A;  2DEU A;  1G7T A;  2BM1 A;  3I56 B;  4DQL A;  2B5O A;  4LBZ A;  3WBJ A;  3WNB A;  1SM4 A;  1TVC A;  1ZM9 A;  3W2I A;  1VQ9 B;  4RD2 A;  2DER A;  1QFZ A;  2BPO A;  1VQ7 B;  1BX0 A;  1IJE A;  5FA6 A;  2QTZ A;  4Y9U A;  4PC2 A;  1DG1 G;  4PC6 A;  3I1F A;  3ZZT A;  1KK1 A;  4BPR A;  2BSA A;  1G7R A;  1EWY A;  1DDG A;  3W5U A;  1QVF B;  3W2G A;  3WNC A;  1J9Z A;  1EP3 B;  3CW2 A;  1S72 B;  1QGY A;  4FWT A;  4ZCM A;  4C0S A;  3G71 B;  5HXB A;  3U6K A;  1QFY A;  1HA3 A;  3JQP A;  1QX4 A;  2C77 A;  3CCL B;  2BGI A;  3CCM B;  1QG0 A;  4FN5 A;  4ZV4 A;  1N8R D;  2QTL A;  2RC6 A;  1N0U A;  4N3N A;  1Q7Y D;  3AVV A;  3ZZU A;  4RCY A;  2OK8 A;  2PLF A;  2CND A;  1QUE A;  1OB2 A;  2VNK A;  4ZCI A;  3LO8 A;  1GO2 A;  3W5H A;  1XB2 A;  5TV2 A;  3AVX A;  1D2E A;  3ZC3 A;  1D8T A;  2QDX A;  1W2B B;  2OTL B;  2D74 A;  3W2E A;  2HDN B;  4TMZ A;  3CC7 B;  3CCQ B;  1M1K D;  1FDR A;  4C43 A;  3CCR B;  3CC4 B;  1U2R A;  1FNB A;  4RD4 A;  3VO1 A;  3CCS B;  3CRZ A;  4P3Y A;  1KK0 A;  1AIP A;  4YAW A;  4RD6 A;  1VQ4 B;  2YWH A;  4TMX A;  5TY0 A;  2EFG A;  2GPJ A;  3QE2 A;  5TR9 A;  3W2F A;  4MYT A;  3OZV A;  2BVN A;  4ZCL A;  3V76 A;  2VYQ A;  1GVH A;  2BF4 A;  3LVB A;  4NBS A;  1Q86 D;  1D1N A;  1EFT A;  1FNC A;  1YJN B;  3AVT A;  3WYA A;  4B43 A;  1KTV A;  1W87 A;  1BQE A;  3U6B A;  1S0U A;  3CB4 A;  3CCJ B;  3MCA A;  4B47 A;  1Q81 D;  4UAJ A;  2ZIT A;  3QFR A;  1F20 A;  1EP1 B;  1VQM B;  1ZM4 A;  4TN1 A;  1FRN A;  2HCJ B;  2B7C A;  4YAF A;  1B23 P;  1OGI A;  1G7C A;  5GV7 A;  1KK3 A;  4RD3 A;  1GJR A;  2HMA A;  1KJZ A;  4DQK A;  3FPK A;  4QHY A;  4LBY A;  3WY9 A;  3G6E B;  1R5B A;  4G5G A;  1GR1 A;  4M53 A;  2PMD A;  2XNJ A;  1FRQ A;  3B82 A;  2DET A;  4B44 A;  1M90 D;  1SKQ A;  4YAL A;  1QGA A;  3OJW A;  3OZU A;  4ZGQ B;  4U9U A;  1TUI A;  1VQO B;  5H5J A;  3VO2 A;  2BMW A;  3CPW B;  1KQS B;  1NDH A;  1H85 A;  1E64 A;  4ACA A;  1JA0 A;  3JQR A;  4NCN A;  1CNF A;  3VNV A;  3AGP A;  3W2H A;  2BV3 A;  4R71 A;  4LBW A;  1YIT B;  4Q7J B;  3ZZ0 A;  1E62 A;  1WDT A;  3CMA B;  2DCU A;  1W35 A;  2GQF A;  1TTT A;  3JQQ A;  1VQP B;  4FK8 A;  2RC5 A;  4AC9 A;  1F60 A;  2B7B A;  3G4S B;  4M0L A;  3ES9 A;  4PC3 A;  3OJX A;  1JB9 A;  4AF6 A;  3ZBU A;  3I55 B;  2YWF A;  1VQK B;  1YHQ B;  1B2R A;  1R5N A;  3FJO A;  1QFJ A;  5H59 A;  5EMN A;  3QFT A;  1ELO A;  3MHP A;  3WXM A;  3MMP A;  1CNE A;  2PIA A;  3QFS A;  4F7D A;  1CQX A;  1H42 A;  4TMV A;  1VQ5 B;  3VMF A;  2OK7 A;  4B4D A;  1EXM A;  3CCU B;  3WND A;  1FNM A;  4PGO A;  4TMW A;  4PC7 A;  1KC8 D;  3CME B;  1ZUN B;  2XEX A;  1JJ2 B;  4H9G A;  1OB5 A;  2J7K A;  1YIJ B;  3B8H A;  4ACB A;  3PEN A;  4HE6 A;  2BN4 A;  4K1X A;  3U2Q A;  1A8P A;  1R5O A;  5KSW B;  2VNJ A;  3B78 A;  3ZBT A;  1UMK A;  3E20 A;  1YJW B;  1VQL B;  1EP2 B;  3W5V A;  1NJI D;  1YI2 B;  4G1B A;  2EIX A;  3E1Y E;  1ZM2 A;  3AVU A;  4M4S A;  4YHB A;  2AHO A;  3CXC B;  2BM0 A;  4AF7 A;  4G1V A;  1JA1 A;  2E1R A;  3CCE B;  2XNC A;  3QFC A;  2QEX B;  4IW3 B;  4QFM A;  4RCZ A;  1K9M D;  2CRV A;  4LC0 A;  4Y7C A;  4MYU A;  3AGQ A;  1EFU A;  5GV8 A;  5AN9 A;  1K73 D;  4RD1 A;  3AVY A;  1OGJ A;  4B48 A;  1QVG B;  4WQM A;  1JNY A;  1Q82 D;  3SJZ A;  4ZGN B;  3WBK A;  1IB0 A;  2NPF A;  1N0V C;  1VQ6 B;  4N3G A;  1KD1 D;  1VQ8 B;  2QN6 A;  1BX1 A;  2C78 A;  1IJF A;  1XE1 A;  1QGZ A;  3P27 A;  4RD0 A;  4P6V F;  3OZW A;  2FX3 A;  1I7P A;  1GAQ A;  3J81 k;  1VQN B;  2YWE A;  1KK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...