1XE1A

Hypothetical protein from pyrococcus furiosus pfu-880080-001
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
IEILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical Protein From Pyrococcus Furiosus Pfu-880080-001
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PF0907
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1xe1A00
1I7PA 3JQQA 5JBQA 3G71B 1F60A 4B4DA 1QFYA 3WNBA 3MCAA 4LBYA 4PGOA 4ZGNB 4Y9UA 2RC6A 3G4SB 1JA0A 4G1BA 1XB2A 1GVHA 3AVXA 4RD3A 3ZZ0A 4Q7JB 1G7TA 3CC7B 3CB4A 2B7CA 4PC1A 1VQLB 2DETA 2CNDA 1YIJB 1Q81D 3ZZTA 1S0UA 1E62A 1SKQA 4U9UA 4H9GA 4RD1A 1B23P 3W2EA 3G6EB 3VNUA 4TMTA 1R5NA 2EIXA 4M2LA 1Q7YD 4WQMA 4QHYA 4RD6A 5DSZA 4TMZA 1QH0A 4M4SA 1W2BB 3QSYA 2BSAA 1XE1A 1W34A 4AF6A 2D74A 1OB5A 4C43A 3QFTA 3AVWA 3ES9A 4RD2A 2QEXB 3W5VA 3VO1A 4AF7A 1GO2A 4LBZA 4RCYA 3WYAA 3E1YE 3PENA 3ZBUA 3QFRA 2QDXA 1S72B 3AVTA 2VNJA 2BMWA 3AVVA 1VQNB 4R71A 5AN9A 1AIPA 1ZM9A 4ZCMA 1E63A 3ZC3A 4P3YA 1HA3A 3QE2A 4NBSA 1QFZA 3CC2B 3MHPA 1DDIA 3AVYA 1D1NA 1KK3A 1JJ2B 4TN1A 3W5UA 1KRHA 3B82A 4J0QA 1EFTA 3I56B 1CNEA 3OZUA 1EFCA 1ZUNB 5KSWB 3I55B 1N0VC 2VZLA 1KC8D 2QTZA 5EMNA 2VNIA 2CRVA 3CCLB 1ZM4A 1TUIA 4K1XA 1F20A 4RCZA 1FNBA 4G5GA 1YJWB 2PMDA 3B78A 4LBVA 1K8AD 1QG0A 1KD1D 3W2GA 2AHOA 2X3UA 1VQPB 3CCVB 2HCJB 3J81k 2PLFA 1R5OA 3CRZA 4MYTA 2GQFA 1IB0A 5GV8A 2NPFA 3CMAB 3JQRA 1B2RA 4PC3A 4ZV4A 2HMAA 2BF4A 4N3NA 2YWHA 4B3XA 1JNYA 2RC5A 2B5OA 1NDHA 4PC6A 1SM4A 1VQ6B 4RD4A 5H59A 1EFUA 1QFJA 1FNCA 4N3GA 3E20A 1EXMA 1G7RA 1YHQB 3W2HA 3I1FA 1IJFA 2J7KA 2VNKA 1N0UA 2VNHA 1OGJA 1R5BA 2DY1A 3LO8A 4HE5A 4YAUA 1YITB 1KQSB 1A8PA 1K73D 1EP2B 4TMWA 4B47A 3AGPA 1FNMA 3VNVA 4LBWA 3FPKA 3CPWB 4P6VF 2PIAA 1KK1A 1GAWA 1TLLA 4LC0A 3WY9A 3CCSB 3CC4B 5H5JA 1DG1G 2YWGA 1KK2A 1WDTA 2DERA 2DCUA 5TV2A 2HDNB 3CCQB 4FWTA 4ACBA 1DARA 4RJLA 2BGJA 1EP3B 1FRNA 4YALA 3WNDA 3OJWA 2OTJB 1TVCA 1GR1A 3P26A 1IJEA 1VQ8B 2B7BA 1EP1B 3WBKA 2BGIA 4M0LA 4PC2A 4ACAA 4M1KA 1BJKA 4F7DA 5FA6A 1CQXA 4NCNA 4Y7CA 1ELOA 1UMKA 1QX4A 1TTTA 4YAWA 2C77A 3SJZA 3AVUA 1KTVA 3W2FA 3CXCB 4FK8A 4YAFA 1EWYA 1W87A 1YI2B 5GV7A 1M90D 3WBJA 1QVFB 3JQPA 1VQ7B 1VQ4B 4G1VA 1BX1A 2YWFA 3MMPA 1QGAA 3FJOA 3P27A 2XEXA 5TY0A 1H85A 1H42A 3OZVA 3AGQA 1VQKB 2YWEA 2XNJA 3CCRB 1DDGA 3U2QA 1Q82D 1GJRA 1G7CA 3CCUB 4ZCIA 4YHBA 4EH1A 1GAQA 4TMVA 1VQ5B 1W35A 1KK0A 3U6BA 1QUFA 5THXA 1CNFA 3CD6B 4PC7A 1FDRA 3U6KA 1VQOB 4BPRA 2BVNA 3LVBA 4B48A 3OJXA 4QFMA 1G7SA 2BV3A 2OK7A 4YAOA 2ZITA 1YJNB 1M1KD 1KJZA 4Y9RA 2OK8A 1BQEA 2VYQA 3VO2A 1AMOA 2FX3A 2GPJA 1QGZA 2XNCA 4HE6A 2QA4B 2QN6A 2BM0A 1YJ9B 1FRQA 3OZWA 2R6HA 1VQ9B 2E1RA 1QUEA 4AC9A 1ZM3A 4MYUA 3W5HA 3W2IA 3CCJB 5HXBA 5TR9A 1D2EA 3CW2A 1E64A 1N8RD 2BPOA 3ZBTA 2QMUA 1Q86D 1D8TA 4C0SA 2OTLB 2BM1A 1K9MD 2DEUA 4UAJA 1OGIA 2C78A 3CMEB 1BX0A 3V76A 1U2RA 2BN4A 1ZM2A 3QFCA 4ZCLA 1QGYA 3VMFA 3QFSA 3ZZUA 1FNDA 4RD0A 4IW3B 1VQMB 4FN5A 3OW2B 4B44A 4TMXA 3CCEB 2EFGA 4M53A 1OB2A 1JA1A 4DQKA 4DQLA 3CCMB 3WNCA 4ZGQB 1JB9A 3B8HA 3WXMA 1QVGB 4B43A 1J9ZA 2QTLA 1NJID
chains in the Genus database with same CATH superfamily
1I7PA 3ASPA 3JQQA 5JBQA 3G71B 2ZZQA 1F60A 4B4DA 5FL7A 1QFYA 3WNBA 3MCAA 1COWA 2WR8A 2GJKA 4LBYA 4PGOA 4ZGNB 1W0KA 4Y9UA 2RC6A 5BSYA 1JA0A 4G1BA 3G4SB 4DK1A 3R6KA 1T6YA 1XB2A 1GVHA 1V0EA 3AVXA 4RD3A 3ONUA 2ZXIA 3PUMA 2XZLA 3ZZ0A 2ZL7A 3RY8A 2X6YA 4Q7JB 5E6TA 3ASRA 4OOXA 4XN3A 1G7TA 1WSRA 1Y0RA 1N08A 3CC7B 4G7XA 1T6XA 4FXUA 5IK2A 3T56B 2XZOA 3CB4A 2B7CA 4PC1A 1V5VA 2JJ1A 4B3FX 3GIRA 1VQLB 2CW5A 2OBTA 2DETA 2OBRA 5IYNA 3ASSA 2CNDA 1YIJB 3PA2A 1NRKA 1NB0A 1Q81D 3ZZTA 5FNZA 1S0UA 1E62A 1SKQA 4U9UA 4H9GA 4UZEA 4RD1A 3ISXA 1B23P 3W2EA 4KKUA 3G6EB 3VNUA 3R6JA 4TMTA 1R5NA 2E1BA 3D26A 2EIXA 4M2LA 1Q7YD 4RPDA 4XQFA 1VHEA 4WQMA 4QHYA 2V7WA 4RD6A 4XKWA 5DSZA 2QGGA 4TMZA 1WORA 1QH0A 4M4SA 4RLZA 5A89A 2ZBVA 2V4DA 4RDKA 1W2BB 3QSYA 2BSAA 3Q3AA 1XE1A 1W34A 4WZTA 4AF6A 2D74A 1OB5A 4C43A 3QFTA 3AVWA 3ES9A 4GQNA 4RD2A 4G7WA 4OPVA 2ZZFA 3BH4A 3W5VA 3VO1A 2QEXB 5IYRA 3FPPA 4AF7A 1E3XA 2V7VA 4Z4TA 2VBTA 1GO2A 4LBZA 4AVZA 4YEJA 4RCYA 3WYAA 2VJJA 3E1YE 3PENA 2QDXA 3QFRA 3Q6RA 3ZBUA 1S72B 2VNJA 2BMWA 3AVTA 4QUZA 1VQNB 3AVVA 4R71A 5AN9A 4G6IA 4XMYA 1AIPA 4X05A 1ZM9A 4ZCMA 1E63A 4ROXA 2V7QA 3ZC3A 1EFRA 4TSFA 4P3YA 2X6WA 1Y0YA 3OPOA 1HA3A 1T6ZA 3PVDA 1E1QA 3HAGA 3QE2A 3SLDA 1QFZA 4NBSA 3CC2B 3MHPA 4X7FA 2ZZEA 3BC9A 4KKTA 2W6IA 1DDIA 3AVYA 1D1NA 3GQBA 1Q9SA 1P4MA 3Q39A 4X7DA 1KK3A 2Z6BD 3ASQA 1JJ2B 4TN1A 4XONA 2ZTGA 3W5UA 3OAAA 3ONYA 2XZPA 1UD3A 1KRHA 4X8IA 5DS0A 5F4MA 2V7TA 1H8EA 3B82A 4J0QA 4YELA 5FO1A 3H94A 1NB9A 1EFTA 3I56B 2WJVA 1CNEA 3OZUA 2WZNA 1EFCA 1ZUNB 5F4JA 5KSWB 4CQJA 1N0VC 4RDLA 4XKVA 3T51B 5A88A 3I55B 2VZLA 2X85A 4P3IA 1KC8D 3H9NA 2QTZA 4KKSA 5EMNA 1UD2A 2VNIA 2CRVA 2F1LA 3SKBA 3CCLB 1ZM4A 4Z1MA 1TUIA 4K1XA 1F20A 2VJIA 4RCZA 1FNBA 4G5GA 2PE3A 2C4TA 3BY2A 3SLNA 1YJWB 3Q6QA 1WOSA 2XGJA 2PMDA 2WPDA 2X8KA 2X0KA 3B78A 3KEWA 2GREA 4LBVA 1K8AD 1QG0A 2GK6A 1KD1D 3W2GA 2AHOA 1KZLA 2X3UA 4WZLA 3SEJA 3CCVB 1VQPB 2HCJB 2PLFA 4RPBA 1R5OA 3CRZA 4MYTA 2XOKA 3DDYA 4PAAA 2GQFA 3J81k 1IB0A 5GV8A 2NPFA 3CMAB 3JQRA 1B2RA 2JIZA 3ASTA 4P25A 4PC3A 4ZV4A 2HMAA 2BF4A 3NE5B 4N3NA 2YWHA 4B3XA 1OB0A 1JNYA 2DIEA 2RC5A 2B5OA 1NDHA 4PC6A 1WSVA 4NNJA 1YLOA 1SM4A 4XLHA 5L46A 1VQ6B 4RD4A 1N06A 4X07A 2Q6IA 1V0FA 4QVAA 4RDJA 1HVXA 3FKSA 3BCFA 5H59A 4XNFA 1MRZA 1EFUA 2CK3A 1QFJA 1FNCA 4N3GA 1VHOA 4QVJA 3E20A 1EXMA 3A3GA 1G7RA 3V7AA 1YHQB 5J3OA 3W2HA 3I1FA 4X0CA 1IJFA 1NBMA 3OE7A 2J7KA 2VNKA 1N0UA 2WJYA 2VNHA 1OGJA 1R5BA 1PJ5A 2DY1A 3LO8A 4HE5A 4OPOA 4YAUA 1XFOA 4DNRB 1YITB 3GVKA 1KQSB 4P6YA 2CBXA 4XL9A 5TRDA 2Q6KA 2F1MA 2OYNA 2D9RA 1RQPA 1A8PA 4WZEA 1K73D 1EP2B 4Z4SA 4P9SA 4TMWA 1XQBA 1VLOA 4B47A 3AGPA 4UZFA 1FNMA 2HLDA 2LZJA 1UD4A 4B3GA 4YXWA 4Z4WA 2GJPA 2R9VA 3VNVA 4LBWA 3FPKA 4P26A 5FO0A 3CPWB 4P6VF 4TKOB 2DOGA 2C4UA 1PJ7A 1KK1A 1GAWA 2PIAA 2X6XA 3BY1A 1TLLA 3CTAA 4LC0A 3WY9A 3CCSB 3CC4B 3OEHA 5H5JA 1VJSA 1DG1G 2DYIA 1W9XA 2YWGA 1KK2A 1WDTA 2DERA 3GSIA 4Z4VA 2Q6LA 2ZL5A 2M5SA 5BSXA 3CMMA 2DCUA 1T5EA 2P3MA 5TV2A 2HDNB 4XLAA 2VBUA 3CCQB 4FWTA 4II3A 5J35A 4ACBA 1DARA 2ZZGA 4RJLA 2BGJA 1EP3B 1FRNA 4XOPA 4YALA 4ASUA 3WNDA 4OP7A 1OHHA 3OJWA 2OTJB 3PUNA 1TVCA 3OKXA 1GR1A 3P26A 1IJEA 2KVOA 1VQ8B 2JN9A 2B7BA 2QE7A 3OEEA 1EP1B 1E3ZA 3WBKA 2BGIA 1SKYB 4M0LA 4PC2A 4ACAA 4M1KA 1BJKA 4F7DA 5FA6A 1WOOA 1CQXA 2WZPP 4NCNA 4Y7CA 1ELOA 1UMKA 4OOVA 5B6IA 1QX4A 1TTTA 4YAWA 2C77A 5IYPA 3SJZA 3AVUA 1KTVA 4RM0A 4XLCA 3LQEA 1PJ6A 3WQZA 4P22A 4HIZA 3W2FA 5KNLA 3CXCB 2F43A 1H8HA 4FK8A 4YAFA 2GJRA 1EWYA 1BMFA 1W87A 1YI2B 5GV7A 3BNWA 4Z4RA 3WBJA 4P2NA 5LMZA 3JQPA 1M90D 1QVFB 1HZEA 1VQ7B 1VQ4B 1UD5A 4JMQA 4G1VA 1BX1A 4E0FA 2YWFA 5A8AA 3MMPA 1WPCA 1BLIA 5HZBA 1QGAA 3FJOA 3P27A 2XEXA 2V31A 2V7UA 5TY0A 1H85A 4XR6A 1H42A 3OZVA 2C5HA 3AGQA 1VQKB 2YWEA 2XNJA 4WZKA 1E79A 1WU8A 3CCRB 1DDGA 3U2QA 1Q82D 1GJRA 3ZUGA 1G7CA 4P1VA 2NV4A 3CCUB 5HKKA 3BCDA 2W6JA 4ZCIA 4YHBA 2C5BA 2X53S 4OOSA 4EH1A 1GAQA 2D3LA 3LQ6A 4TMVA 1VQ5B 1W35A 1KK0A 3U6BA 3CESA 1MABA 1QUFA 5THXA 1CNFA 3CD6B 4PC7A 1FDRA 3CP2A 3U6KA 3BQJA 3OP1A 4L8JA 4BPRA 1N05A 1VQOB 4DK0A 2BVNA 3LVBA 4B48A 3OJXA 1I8DA 4P12A 5FIUA 1UD8A 4QFMA 1G7SA 2BV3A 2OK7A 4YAOA 3VR6A 2ZITA 2WSSA 3Q38A 4OPSA 3ZPNA 5IYQA 1YJNB 1KMHA 4XORA 1M1KD 1KJZA 4X06A 4Y9RA 1WOPA 3GVLA 3OW7A 2OK8A 3CP8A 1BQEA 1N07A 2VYQA 3VO2A 1AMOA 1VF7A 2FX3A 1PKVA 1W0JA 2GPJA 1QGZA 3JU4A 4XLEA 4Z4YA 2XNCA 4QV2A 2ZXHA 4DNTB 4UZUA 4HE6A 2QA4B 2QN6A 2GK7A 2BM0A 3CPXA 1YJ9B 3T53B 1FRQA 3OZWA 5CDFA 1YX2A 4WWVA 2R6HA 1VQ9B 2E1RA 2V7XA 2JDIA 2ZTNA 1RQRA 1VLYA 1QUEA 3A1PA 1UD6A 1WP6A 1ZM3A 3A8JA 4MYUA 4AC9A 3W5HA 4Z4ZA 1S4MA 1IHMA 2CF4A 3W2IA 2F4NA 3CCJB 5HXBA 3OFNA 5TR9A 2OBSA 1D2EA 4XN0A 2D3NA 1E64A 3CW2A 2BPOA 2QMUA 3ZBTA 1Q86D 1N8RD 1D8TA 3A35A 4C0SA 4XOTA 2VBVA 2OTLB 1FX0A 2BM1A 5DN6A 1K9MD 2DEUA 3OOCA 3PA1A 4UAJA 4X7CA 1OGIA 2C78A 3A8KA 3CMEB 3A3BA 1BX0A 1I18A 3V76A 3SJPA 2Q6OA 1U2RA 2BN4A 2ZBUA 1ZM2A 3KL9A 1BPLA 3QFCA 4ZCLA 1QGYA 4XM3A 2JJ2A 3VMFA 2VBSA 3QFSA 3ZZUA 1FNDA 4RD0A 5F4OA 4IW3B 3LNNA 1VQMB 3A8IA 2FVGA 4FN5A 3OW2B 4B44A 4Z4UA 4XD7A 5IYWA 4X7EA 4TMXA 3ZIAA 5HZAA 3CCEB 2EFGA 1K28D 4M53A 3G05A 1OB2A 1JA1A 2C2WA 4PABA 2CC2A 4TT3A 4XLFA 4DQKA 2WYRA 4DQLA 2ZL6A 3CCMB 2XNDA 3WNCA 5KW9A 2I1LA 4ZGQB 3GVJA 1JB9A 1E1RA 3B8HA 3WXMA 1QVGB 1E43A 4B43A 1J9ZA 2QTLA 4II2A 1NJID 1WTHD
chains in the Genus database with same CATH topology
1I7PA 3JQQA 5JBQA 3G71B 1F60A 4B4DA 1QFYA 3WNBA 3MCAA 4LBYA 4PGOA 4ZGNB 4Y9UA 2RC6A 3G4SB 1JA0A 4G1BA 1XB2A 1GVHA 3AVXA 4RD3A 3ZZ0A 4Q7JB 1G7TA 3CC7B 3CB4A 2B7CA 4PC1A 1VQLB 2DETA 2CNDA 1YIJB 1Q81D 3ZZTA 1S0UA 1E62A 1SKQA 4U9UA 4H9GA 4RD1A 1B23P 3W2EA 3G6EB 3VNUA 4TMTA 1R5NA 2EIXA 4M2LA 1Q7YD 4WQMA 4QHYA 4RD6A 5DSZA 4TMZA 1QH0A 4M4SA 1W2BB 3QSYA 2BSAA 1XE1A 1W34A 4AF6A 2D74A 1OB5A 4C43A 3QFTA 3AVWA 3ES9A 4RD2A 2QEXB 3W5VA 3VO1A 4AF7A 1GO2A 4LBZA 4RCYA 3WYAA 3E1YE 3PENA 3ZBUA 3QFRA 2QDXA 1S72B 3AVTA 2VNJA 2BMWA 3AVVA 1VQNB 4R71A 5AN9A 1AIPA 1ZM9A 4ZCMA 1E63A 3ZC3A 4P3YA 1HA3A 3QE2A 4NBSA 1QFZA 3CC2B 3MHPA 1DDIA 3AVYA 1D1NA 1KK3A 1JJ2B 4TN1A 3W5UA 1KRHA 3B82A 4J0QA 1EFTA 3I56B 1CNEA 3OZUA 1EFCA 1ZUNB 5KSWB 3I55B 1N0VC 2VZLA 1KC8D 2QTZA 5EMNA 2VNIA 2CRVA 3CCLB 1ZM4A 1TUIA 4K1XA 1F20A 4RCZA 1FNBA 4G5GA 1YJWB 2PMDA 3B78A 4LBVA 1K8AD 1QG0A 1KD1D 3W2GA 2AHOA 2X3UA 1VQPB 3CCVB 2HCJB 3J81k 2PLFA 1R5OA 3CRZA 4MYTA 2GQFA 1IB0A 5GV8A 2NPFA 3CMAB 3JQRA 1B2RA 4PC3A 4ZV4A 2HMAA 2BF4A 4N3NA 2YWHA 4B3XA 1JNYA 2RC5A 2B5OA 1NDHA 4PC6A 1SM4A 1VQ6B 4RD4A 5H59A 1EFUA 1QFJA 1FNCA 4N3GA 3E20A 1EXMA 1G7RA 1YHQB 3W2HA 3I1FA 1IJFA 2J7KA 2VNKA 1N0UA 2VNHA 1OGJA 1R5BA 2DY1A 3LO8A 4HE5A 4YAUA 1YITB 1KQSB 1A8PA 1K73D 1EP2B 4TMWA 4B47A 3AGPA 1FNMA 3VNVA 4LBWA 3FPKA 3CPWB 4P6VF 2PIAA 1KK1A 1GAWA 1TLLA 4LC0A 3WY9A 3CCSB 3CC4B 5H5JA 1DG1G 2YWGA 1KK2A 1WDTA 2DERA 2DCUA 5TV2A 2HDNB 3CCQB 4FWTA 4ACBA 1DARA 4RJLA 2BGJA 1EP3B 1FRNA 4YALA 3WNDA 3OJWA 2OTJB 1TVCA 1GR1A 3P26A 1IJEA 1VQ8B 2B7BA 1EP1B 3WBKA 2BGIA 4M0LA 4PC2A 4ACAA 4M1KA 1BJKA 4F7DA 5FA6A 1CQXA 4NCNA 4Y7CA 1ELOA 1UMKA 1QX4A 1TTTA 4YAWA 2C77A 3SJZA 3AVUA 1KTVA 3W2FA 3CXCB 4FK8A 4YAFA 1EWYA 1W87A 1YI2B 5GV7A 1M90D 3WBJA 1QVFB 3JQPA 1VQ7B 1VQ4B 4G1VA 1BX1A 2YWFA 3MMPA 1QGAA 3FJOA 3P27A 2XEXA 5TY0A 1H85A 1H42A 3OZVA 3AGQA 1VQKB 2YWEA 2XNJA 3CCRB 1DDGA 3U2QA 1Q82D 1GJRA 1G7CA 3CCUB 4ZCIA 4YHBA 4EH1A 1GAQA 4TMVA 1VQ5B 1W35A 1KK0A 3U6BA 1QUFA 5THXA 1CNFA 3CD6B 4PC7A 1FDRA 3U6KA 1VQOB 4BPRA 2BVNA 3LVBA 4B48A 3OJXA 4QFMA 1G7SA 2BV3A 2OK7A 4YAOA 2ZITA 1YJNB 1M1KD 1KJZA 4Y9RA 2OK8A 1BQEA 2VYQA 3VO2A 1AMOA 2FX3A 2GPJA 1QGZA 2XNCA 4HE6A 2QA4B 2QN6A 2BM0A 1YJ9B 1FRQA 3OZWA 2R6HA 1VQ9B 2E1RA 1QUEA 4AC9A 1ZM3A 4MYUA 3W5HA 3W2IA 3CCJB 5HXBA 5TR9A 1D2EA 3CW2A 1E64A 1N8RD 2BPOA 3ZBTA 2QMUA 1Q86D 1D8TA 4C0SA 2OTLB 2BM1A 1K9MD 2DEUA 4UAJA 1OGIA 2C78A 3CMEB 1BX0A 3V76A 1U2RA 2BN4A 1ZM2A 3QFCA 4ZCLA 1QGYA 3VMFA 3QFSA 3ZZUA 1FNDA 4RD0A 4IW3B 1VQMB 4FN5A 3OW2B 4B44A 4TMXA 3CCEB 2EFGA 4M53A 1OB2A 1JA1A 4DQKA 4DQLA 3CCMB 3WNCA 4ZGQB 1JB9A 3B8HA 3WXMA 1QVGB 4B43A 1J9ZA 2QTLA 1NJID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I7P A;  3JQQ A;  5JBQ A;  3G71 B;  1F60 A;  4B4D A;  1QFY A;  3WNB A;  3MCA A;  4LBY A;  4PGO A;  4ZGN B;  4Y9U A;  2RC6 A;  3G4S B;  1JA0 A;  4G1B A;  1XB2 A;  1GVH A;  3AVX A;  4RD3 A;  3ZZ0 A;  4Q7J B;  1G7T A;  3CC7 B;  3CB4 A;  2B7C A;  4PC1 A;  1VQL B;  2DET A;  2CND A;  1YIJ B;  1Q81 D;  3ZZT A;  1S0U A;  1E62 A;  1SKQ A;  4U9U A;  4H9G A;  4RD1 A;  1B23 P;  3W2E A;  3G6E B;  3VNU A;  4TMT A;  1R5N A;  2EIX A;  4M2L A;  1Q7Y D;  4WQM A;  4QHY A;  4RD6 A;  5DSZ A;  4TMZ A;  1QH0 A;  4M4S A;  1W2B B;  3QSY A;  2BSA A;  1XE1 A;  1W34 A;  4AF6 A;  2D74 A;  1OB5 A;  4C43 A;  3QFT A;  3AVW A;  3ES9 A;  4RD2 A;  2QEX B;  3W5V A;  3VO1 A;  4AF7 A;  1GO2 A;  4LBZ A;  4RCY A;  3WYA A;  3E1Y E;  3PEN A;  3ZBU A;  3QFR A;  2QDX A;  1S72 B;  3AVT A;  2VNJ A;  2BMW A;  3AVV A;  1VQN B;  4R71 A;  5AN9 A;  1AIP A;  1ZM9 A;  4ZCM A;  1E63 A;  3ZC3 A;  4P3Y A;  1HA3 A;  3QE2 A;  4NBS A;  1QFZ A;  3CC2 B;  3MHP A;  1DDI A;  3AVY A;  1D1N A;  1KK3 A;  1JJ2 B;  4TN1 A;  3W5U A;  1KRH A;  3B82 A;  4J0Q A;  1EFT A;  3I56 B;  1CNE A;  3OZU A;  1EFC A;  1ZUN B;  5KSW B;  3I55 B;  1N0V C;  2VZL A;  1KC8 D;  2QTZ A;  5EMN A;  2VNI A;  2CRV A;  3CCL B;  1ZM4 A;  1TUI A;  4K1X A;  1F20 A;  4RCZ A;  1FNB A;  4G5G A;  1YJW B;  2PMD A;  3B78 A;  4LBV A;  1K8A D;  1QG0 A;  1KD1 D;  3W2G A;  2AHO A;  2X3U A;  1VQP B;  3CCV B;  2HCJ B;  3J81 k;  2PLF A;  1R5O A;  3CRZ A;  4MYT A;  2GQF A;  1IB0 A;  5GV8 A;  2NPF A;  3CMA B;  3JQR A;  1B2R A;  4PC3 A;  4ZV4 A;  2HMA A;  2BF4 A;  4N3N A;  2YWH A;  4B3X A;  1JNY A;  2RC5 A;  2B5O A;  1NDH A;  4PC6 A;  1SM4 A;  1VQ6 B;  4RD4 A;  5H59 A;  1EFU A;  1QFJ A;  1FNC A;  4N3G A;  3E20 A;  1EXM A;  1G7R A;  1YHQ B;  3W2H A;  3I1F A;  1IJF A;  2J7K A;  2VNK A;  1N0U A;  2VNH A;  1OGJ A;  1R5B A;  2DY1 A;  3LO8 A;  4HE5 A;  4YAU A;  1YIT B;  1KQS B;  1A8P A;  1K73 D;  1EP2 B;  4TMW A;  4B47 A;  3AGP A;  1FNM A;  3VNV A;  4LBW A;  3FPK A;  3CPW B;  4P6V F;  2PIA A;  1KK1 A;  1GAW A;  1TLL A;  4LC0 A;  3WY9 A;  3CCS B;  3CC4 B;  5H5J A;  1DG1 G;  2YWG A;  1KK2 A;  1WDT A;  2DER A;  2DCU A;  5TV2 A;  2HDN B;  3CCQ B;  4FWT A;  4ACB A;  1DAR A;  4RJL A;  2BGJ A;  1EP3 B;  1FRN A;  4YAL A;  3WND A;  3OJW A;  2OTJ B;  1TVC A;  1GR1 A;  3P26 A;  1IJE A;  1VQ8 B;  2B7B A;  1EP1 B;  3WBK A;  2BGI A;  4M0L A;  4PC2 A;  4ACA A;  4M1K A;  1BJK A;  4F7D A;  5FA6 A;  1CQX A;  4NCN A;  4Y7C A;  1ELO A;  1UMK A;  1QX4 A;  1TTT A;  4YAW A;  2C77 A;  3SJZ A;  3AVU A;  1KTV A;  3W2F A;  3CXC B;  4FK8 A;  4YAF A;  1EWY A;  1W87 A;  1YI2 B;  5GV7 A;  1M90 D;  3WBJ A;  1QVF B;  3JQP A;  1VQ7 B;  1VQ4 B;  4G1V A;  1BX1 A;  2YWF A;  3MMP A;  1QGA A;  3FJO A;  3P27 A;  2XEX A;  5TY0 A;  1H85 A;  1H42 A;  3OZV A;  3AGQ A;  1VQK B;  2YWE A;  2XNJ A;  3CCR B;  1DDG A;  3U2Q A;  1Q82 D;  1GJR A;  1G7C A;  3CCU B;  4ZCI A;  4YHB A;  4EH1 A;  1GAQ A;  4TMV A;  1VQ5 B;  1W35 A;  1KK0 A;  3U6B A;  1QUF A;  5THX A;  1CNF A;  3CD6 B;  4PC7 A;  1FDR A;  3U6K A;  1VQO B;  4BPR A;  2BVN A;  3LVB A;  4B48 A;  3OJX A;  4QFM A;  1G7S A;  2BV3 A;  2OK7 A;  4YAO A;  2ZIT A;  1YJN B;  1M1K D;  1KJZ A;  4Y9R A;  2OK8 A;  1BQE A;  2VYQ A;  3VO2 A;  1AMO A;  2FX3 A;  2GPJ A;  1QGZ A;  2XNC A;  4HE6 A;  2QA4 B;  2QN6 A;  2BM0 A;  1YJ9 B;  1FRQ A;  3OZW A;  2R6H A;  1VQ9 B;  2E1R A;  1QUE A;  4AC9 A;  1ZM3 A;  4MYU A;  3W5H A;  3W2I A;  3CCJ B;  5HXB A;  5TR9 A;  1D2E A;  3CW2 A;  1E64 A;  1N8R D;  2BPO A;  3ZBT A;  2QMU A;  1Q86 D;  1D8T A;  4C0S A;  2OTL B;  2BM1 A;  1K9M D;  2DEU A;  4UAJ A;  1OGI A;  2C78 A;  3CME B;  1BX0 A;  3V76 A;  1U2R A;  2BN4 A;  1ZM2 A;  3QFC A;  4ZCL A;  1QGY A;  3VMF A;  3QFS A;  3ZZU A;  1FND A;  4RD0 A;  4IW3 B;  1VQM B;  4FN5 A;  3OW2 B;  4B44 A;  4TMX A;  3CCE B;  2EFG A;  4M53 A;  1OB2 A;  1JA1 A;  4DQK A;  4DQL A;  3CCM B;  3WNC A;  4ZGQ B;  1JB9 A;  3B8H A;  3WXM A;  1QVG B;  4B43 A;  1J9Z A;  2QTL A;  1NJI D; 
#chains in the Genus database with same CATH topology
 1I7P A;  3ASP A;  3JQQ A;  5JBQ A;  3G71 B;  2ZZQ A;  1F60 A;  4B4D A;  5FL7 A;  1QFY A;  3WNB A;  3MCA A;  1COW A;  2WR8 A;  2GJK A;  4LBY A;  4PGO A;  4ZGN B;  1W0K A;  4Y9U A;  2RC6 A;  5BSY A;  1JA0 A;  4G1B A;  3G4S B;  4DK1 A;  3R6K A;  1T6Y A;  1XB2 A;  1GVH A;  1V0E A;  3AVX A;  4RD3 A;  3ONU A;  2ZXI A;  3PUM A;  2XZL A;  3ZZ0 A;  2ZL7 A;  3RY8 A;  2X6Y A;  4Q7J B;  5E6T A;  3ASR A;  4OOX A;  4XN3 A;  1G7T A;  1WSR A;  1Y0R A;  1N08 A;  3CC7 B;  4G7X A;  1T6X A;  4FXU A;  5IK2 A;  3T56 B;  2XZO A;  3CB4 A;  2B7C A;  4PC1 A;  1V5V A;  2JJ1 A;  4B3F X;  3GIR A;  1VQL B;  2CW5 A;  2OBT A;  2DET A;  2OBR A;  5IYN A;  3ASS A;  2CND A;  1YIJ B;  3PA2 A;  1NRK A;  1NB0 A;  1Q81 D;  3ZZT A;  5FNZ A;  1S0U A;  1E62 A;  1SKQ A;  4U9U A;  4H9G A;  4UZE A;  4RD1 A;  3ISX A;  1B23 P;  3W2E A;  4KKU A;  3G6E B;  3VNU A;  3R6J A;  4TMT A;  1R5N A;  2E1B A;  3D26 A;  2EIX A;  4M2L A;  1Q7Y D;  4RPD A;  4XQF A;  1VHE A;  4WQM A;  4QHY A;  2V7W A;  4RD6 A;  4XKW A;  5DSZ A;  2QGG A;  4TMZ A;  1WOR A;  1QH0 A;  4M4S A;  4RLZ A;  5A89 A;  2ZBV A;  2V4D A;  4RDK A;  1W2B B;  3QSY A;  2BSA A;  3Q3A A;  1XE1 A;  1W34 A;  4WZT A;  4AF6 A;  2D74 A;  1OB5 A;  4C43 A;  3QFT A;  3AVW A;  3ES9 A;  4GQN A;  4RD2 A;  4G7W A;  4OPV A;  2ZZF A;  3BH4 A;  3W5V A;  3VO1 A;  2QEX B;  5IYR A;  3FPP A;  4AF7 A;  1E3X A;  2V7V A;  4Z4T A;  2VBT A;  1GO2 A;  4LBZ A;  4AVZ A;  4YEJ A;  4RCY A;  3WYA A;  2VJJ A;  3E1Y E;  3PEN A;  2QDX A;  3QFR A;  3Q6R A;  3ZBU A;  1S72 B;  2VNJ A;  2BMW A;  3AVT A;  4QUZ A;  1VQN B;  3AVV A;  4R71 A;  5AN9 A;  4G6I A;  4XMY A;  1AIP A;  4X05 A;  1ZM9 A;  4ZCM A;  1E63 A;  4ROX A;  2V7Q A;  3ZC3 A;  1EFR A;  4TSF A;  4P3Y A;  2X6W A;  1Y0Y A;  3OPO A;  1HA3 A;  1T6Z A;  3PVD A;  1E1Q A;  3HAG A;  3QE2 A;  3SLD A;  1QFZ A;  4NBS A;  3CC2 B;  3MHP A;  4X7F A;  2ZZE A;  3BC9 A;  4KKT A;  2W6I A;  1DDI A;  3AVY A;  1D1N A;  3GQB A;  1Q9S A;  1P4M A;  3Q39 A;  4X7D A;  1KK3 A;  2Z6B D;  3ASQ A;  1JJ2 B;  4TN1 A;  4XON A;  2ZTG A;  3W5U A;  3OAA A;  3ONY A;  2XZP A;  1UD3 A;  1KRH A;  4X8I A;  5DS0 A;  5F4M A;  2V7T A;  1H8E A;  3B82 A;  4J0Q A;  4YEL A;  5FO1 A;  3H94 A;  1NB9 A;  1EFT A;  3I56 B;  2WJV A;  1CNE A;  3OZU A;  2WZN A;  1EFC A;  1ZUN B;  5F4J A;  5KSW B;  4CQJ A;  1N0V C;  4RDL A;  4XKV A;  3T51 B;  5A88 A;  3I55 B;  2VZL A;  2X85 A;  4P3I A;  1KC8 D;  3H9N A;  2QTZ A;  4KKS A;  5EMN A;  1UD2 A;  2VNI A;  2CRV A;  2F1L A;  3SKB A;  3CCL B;  1ZM4 A;  4Z1M A;  1TUI A;  4K1X A;  1F20 A;  2VJI A;  4RCZ A;  1FNB A;  4G5G A;  2PE3 A;  2C4T A;  3BY2 A;  3SLN A;  1YJW B;  3Q6Q A;  1WOS A;  2XGJ A;  2PMD A;  2WPD A;  2X8K A;  2X0K A;  3B78 A;  3KEW A;  2GRE A;  4LBV A;  1K8A D;  1QG0 A;  2GK6 A;  1KD1 D;  3W2G A;  2AHO A;  1KZL A;  2X3U A;  4WZL A;  3SEJ A;  3CCV B;  1VQP B;  2HCJ B;  2PLF A;  4RPB A;  1R5O A;  3CRZ A;  4MYT A;  2XOK A;  3DDY A;  4PAA A;  2GQF A;  3J81 k;  1IB0 A;  5GV8 A;  2NPF A;  3CMA B;  3JQR A;  1B2R A;  2JIZ A;  3AST A;  4P25 A;  4PC3 A;  4ZV4 A;  2HMA A;  2BF4 A;  3NE5 B;  4N3N A;  2YWH A;  4B3X A;  1OB0 A;  1JNY A;  2DIE A;  2RC5 A;  2B5O A;  1NDH A;  4PC6 A;  1WSV A;  4NNJ A;  1YLO A;  1SM4 A;  4XLH A;  5L46 A;  1VQ6 B;  4RD4 A;  1N06 A;  4X07 A;  2Q6I A;  1V0F A;  4QVA A;  4RDJ A;  1HVX A;  3FKS A;  3BCF A;  5H59 A;  4XNF A;  1MRZ A;  1EFU A;  2CK3 A;  1QFJ A;  1FNC A;  4N3G A;  1VHO A;  4QVJ A;  3E20 A;  1EXM A;  3A3G A;  1G7R A;  3V7A A;  1YHQ B;  5J3O A;  3W2H A;  3I1F A;  4X0C A;  1IJF A;  1NBM A;  3OE7 A;  2J7K A;  2VNK A;  1N0U A;  2WJY A;  2VNH A;  1OGJ A;  1R5B A;  1PJ5 A;  2DY1 A;  3LO8 A;  4HE5 A;  4OPO A;  4YAU A;  1XFO A;  4DNR B;  1YIT B;  3GVK A;  1KQS B;  4P6Y A;  2CBX A;  4XL9 A;  5TRD A;  2Q6K A;  2F1M A;  2OYN A;  2D9R A;  1RQP A;  1A8P A;  4WZE A;  1K73 D;  1EP2 B;  4Z4S A;  4P9S A;  4TMW A;  1XQB A;  1VLO A;  4B47 A;  3AGP A;  4UZF A;  1FNM A;  2HLD A;  2LZJ A;  1UD4 A;  4B3G A;  4YXW A;  4Z4W A;  2GJP A;  2R9V A;  3VNV A;  4LBW A;  3FPK A;  4P26 A;  5FO0 A;  3CPW B;  4P6V F;  4TKO B;  2DOG A;  2C4U A;  1PJ7 A;  1KK1 A;  1GAW A;  2PIA A;  2X6X A;  3BY1 A;  1TLL A;  3CTA A;  4LC0 A;  3WY9 A;  3CCS B;  3CC4 B;  3OEH A;  5H5J A;  1VJS A;  1DG1 G;  2DYI A;  1W9X A;  2YWG A;  1KK2 A;  1WDT A;  2DER A;  3GSI A;  4Z4V A;  2Q6L A;  2ZL5 A;  2M5S A;  5BSX A;  3CMM A;  2DCU A;  1T5E A;  2P3M A;  5TV2 A;  2HDN B;  4XLA A;  2VBU A;  3CCQ B;  4FWT A;  4II3 A;  5J35 A;  4ACB A;  1DAR A;  2ZZG A;  4RJL A;  2BGJ A;  1EP3 B;  1FRN A;  4XOP A;  4YAL A;  4ASU A;  3WND A;  4OP7 A;  1OHH A;  3OJW A;  2OTJ B;  3PUN A;  1TVC A;  3OKX A;  1GR1 A;  3P26 A;  1IJE A;  2KVO A;  1VQ8 B;  2JN9 A;  2B7B A;  2QE7 A;  3OEE A;  1EP1 B;  1E3Z A;  3WBK A;  2BGI A;  1SKY B;  4M0L A;  4PC2 A;  4ACA A;  4M1K A;  1BJK A;  4F7D A;  5FA6 A;  1WOO A;  1CQX A;  2WZP P;  4NCN A;  4Y7C A;  1ELO A;  1UMK A;  4OOV A;  5B6I A;  1QX4 A;  1TTT A;  4YAW A;  2C77 A;  5IYP A;  3SJZ A;  3AVU A;  1KTV A;  4RM0 A;  4XLC A;  3LQE A;  1PJ6 A;  3WQZ A;  4P22 A;  4HIZ A;  3W2F A;  5KNL A;  3CXC B;  2F43 A;  1H8H A;  4FK8 A;  4YAF A;  2GJR A;  1EWY A;  1BMF A;  1W87 A;  1YI2 B;  5GV7 A;  3BNW A;  4Z4R A;  3WBJ A;  4P2N A;  5LMZ A;  3JQP A;  1M90 D;  1QVF B;  1HZE A;  1VQ7 B;  1VQ4 B;  1UD5 A;  4JMQ A;  4G1V A;  1BX1 A;  4E0F A;  2YWF A;  5A8A A;  3MMP A;  1WPC A;  1BLI A;  5HZB A;  1QGA A;  3FJO A;  3P27 A;  2XEX A;  2V31 A;  2V7U A;  5TY0 A;  1H85 A;  4XR6 A;  1H42 A;  3OZV A;  2C5H A;  3AGQ A;  1VQK B;  2YWE A;  2XNJ A;  4WZK A;  1E79 A;  1WU8 A;  3CCR B;  1DDG A;  3U2Q A;  1Q82 D;  1GJR A;  3ZUG A;  1G7C A;  4P1V A;  2NV4 A;  3CCU B;  5HKK A;  3BCD A;  2W6J A;  4ZCI A;  4YHB A;  2C5B A;  2X53 S;  4OOS A;  4EH1 A;  1GAQ A;  2D3L A;  3LQ6 A;  4TMV A;  1VQ5 B;  1W35 A;  1KK0 A;  3U6B A;  3CES A;  1MAB A;  1QUF A;  5THX A;  1CNF A;  3CD6 B;  4PC7 A;  1FDR A;  3CP2 A;  3U6K A;  3BQJ A;  3OP1 A;  4L8J A;  4BPR A;  1N05 A;  1VQO B;  4DK0 A;  2BVN A;  3LVB A;  4B48 A;  3OJX A;  1I8D A;  4P12 A;  5FIU A;  1UD8 A;  4QFM A;  1G7S A;  2BV3 A;  2OK7 A;  4YAO A;  3VR6 A;  2ZIT A;  2WSS A;  3Q38 A;  4OPS A;  3ZPN A;  5IYQ A;  1YJN B;  1KMH A;  4XOR A;  1M1K D;  1KJZ A;  4X06 A;  4Y9R A;  1WOP A;  3GVL A;  3OW7 A;  2OK8 A;  3CP8 A;  1BQE A;  1N07 A;  2VYQ A;  3VO2 A;  1AMO A;  1VF7 A;  2FX3 A;  1PKV A;  1W0J A;  2GPJ A;  1QGZ A;  3JU4 A;  4XLE A;  4Z4Y A;  2XNC A;  4QV2 A;  2ZXH A;  4DNT B;  4UZU A;  4HE6 A;  2QA4 B;  2QN6 A;  2GK7 A;  2BM0 A;  3CPX A;  1YJ9 B;  3T53 B;  1FRQ A;  3OZW A;  5CDF A;  1YX2 A;  4WWV A;  2R6H A;  1VQ9 B;  2E1R A;  2V7X A;  2JDI A;  2ZTN A;  1RQR A;  1VLY A;  1QUE A;  3A1P A;  1UD6 A;  1WP6 A;  1ZM3 A;  3A8J A;  4MYU A;  4AC9 A;  3W5H A;  4Z4Z A;  1S4M A;  1IHM A;  2CF4 A;  3W2I A;  2F4N A;  3CCJ B;  5HXB A;  3OFN A;  5TR9 A;  2OBS A;  1D2E A;  4XN0 A;  2D3N A;  1E64 A;  3CW2 A;  2BPO A;  2QMU A;  3ZBT A;  1Q86 D;  1N8R D;  1D8T A;  3A35 A;  4C0S A;  4XOT A;  2VBV A;  2OTL B;  1FX0 A;  2BM1 A;  5DN6 A;  1K9M D;  2DEU A;  3OOC A;  3PA1 A;  4UAJ A;  4X7C A;  1OGI A;  2C78 A;  3A8K A;  3CME B;  3A3B A;  1BX0 A;  1I18 A;  3V76 A;  3SJP A;  2Q6O A;  1U2R A;  2BN4 A;  2ZBU A;  1ZM2 A;  3KL9 A;  1BPL A;  3QFC A;  4ZCL A;  1QGY A;  4XM3 A;  2JJ2 A;  3VMF A;  2VBS A;  3QFS A;  3ZZU A;  1FND A;  4RD0 A;  5F4O A;  4IW3 B;  3LNN A;  1VQM B;  3A8I A;  2FVG A;  4FN5 A;  3OW2 B;  4B44 A;  4Z4U A;  4XD7 A;  5IYW A;  4X7E A;  4TMX A;  3ZIA A;  5HZA A;  3CCE B;  2EFG A;  1K28 D;  4M53 A;  3G05 A;  1OB2 A;  1JA1 A;  2C2W A;  4PAB A;  2CC2 A;  4TT3 A;  4XLF A;  4DQK A;  2WYR A;  4DQL A;  2ZL6 A;  3CCM B;  2XND A;  3WNC A;  5KW9 A;  2I1L A;  4ZGQ B;  3GVJ A;  1JB9 A;  1E1R A;  3B8H A;  3WXM A;  1QVG B;  1E43 A;  4B43 A;  1J9Z A;  2QTL A;  4II2 A;  1NJI D;  1WTH D; 
#chains in the Genus database with same CATH homology
 1I7P A;  3JQQ A;  5JBQ A;  3G71 B;  1F60 A;  4B4D A;  1QFY A;  3WNB A;  3MCA A;  4LBY A;  4PGO A;  4ZGN B;  4Y9U A;  2RC6 A;  3G4S B;  1JA0 A;  4G1B A;  1XB2 A;  1GVH A;  3AVX A;  4RD3 A;  3ZZ0 A;  4Q7J B;  1G7T A;  3CC7 B;  3CB4 A;  2B7C A;  4PC1 A;  1VQL B;  2DET A;  2CND A;  1YIJ B;  1Q81 D;  3ZZT A;  1S0U A;  1E62 A;  1SKQ A;  4U9U A;  4H9G A;  4RD1 A;  1B23 P;  3W2E A;  3G6E B;  3VNU A;  4TMT A;  1R5N A;  2EIX A;  4M2L A;  1Q7Y D;  4WQM A;  4QHY A;  4RD6 A;  5DSZ A;  4TMZ A;  1QH0 A;  4M4S A;  1W2B B;  3QSY A;  2BSA A;  1XE1 A;  1W34 A;  4AF6 A;  2D74 A;  1OB5 A;  4C43 A;  3QFT A;  3AVW A;  3ES9 A;  4RD2 A;  2QEX B;  3W5V A;  3VO1 A;  4AF7 A;  1GO2 A;  4LBZ A;  4RCY A;  3WYA A;  3E1Y E;  3PEN A;  3ZBU A;  3QFR A;  2QDX A;  1S72 B;  3AVT A;  2VNJ A;  2BMW A;  3AVV A;  1VQN B;  4R71 A;  5AN9 A;  1AIP A;  1ZM9 A;  4ZCM A;  1E63 A;  3ZC3 A;  4P3Y A;  1HA3 A;  3QE2 A;  4NBS A;  1QFZ A;  3CC2 B;  3MHP A;  1DDI A;  3AVY A;  1D1N A;  1KK3 A;  1JJ2 B;  4TN1 A;  3W5U A;  1KRH A;  3B82 A;  4J0Q A;  1EFT A;  3I56 B;  1CNE A;  3OZU A;  1EFC A;  1ZUN B;  5KSW B;  3I55 B;  1N0V C;  2VZL A;  1KC8 D;  2QTZ A;  5EMN A;  2VNI A;  2CRV A;  3CCL B;  1ZM4 A;  1TUI A;  4K1X A;  1F20 A;  4RCZ A;  1FNB A;  4G5G A;  1YJW B;  2PMD A;  3B78 A;  4LBV A;  1K8A D;  1QG0 A;  1KD1 D;  3W2G A;  2AHO A;  2X3U A;  1VQP B;  3CCV B;  2HCJ B;  3J81 k;  2PLF A;  1R5O A;  3CRZ A;  4MYT A;  2GQF A;  1IB0 A;  5GV8 A;  2NPF A;  3CMA B;  3JQR A;  1B2R A;  4PC3 A;  4ZV4 A;  2HMA A;  2BF4 A;  4N3N A;  2YWH A;  4B3X A;  1JNY A;  2RC5 A;  2B5O A;  1NDH A;  4PC6 A;  1SM4 A;  1VQ6 B;  4RD4 A;  5H59 A;  1EFU A;  1QFJ A;  1FNC A;  4N3G A;  3E20 A;  1EXM A;  1G7R A;  1YHQ B;  3W2H A;  3I1F A;  1IJF A;  2J7K A;  2VNK A;  1N0U A;  2VNH A;  1OGJ A;  1R5B A;  2DY1 A;  3LO8 A;  4HE5 A;  4YAU A;  1YIT B;  1KQS B;  1A8P A;  1K73 D;  1EP2 B;  4TMW A;  4B47 A;  3AGP A;  1FNM A;  3VNV A;  4LBW A;  3FPK A;  3CPW B;  4P6V F;  2PIA A;  1KK1 A;  1GAW A;  1TLL A;  4LC0 A;  3WY9 A;  3CCS B;  3CC4 B;  5H5J A;  1DG1 G;  2YWG A;  1KK2 A;  1WDT A;  2DER A;  2DCU A;  5TV2 A;  2HDN B;  3CCQ B;  4FWT A;  4ACB A;  1DAR A;  4RJL A;  2BGJ A;  1EP3 B;  1FRN A;  4YAL A;  3WND A;  3OJW A;  2OTJ B;  1TVC A;  1GR1 A;  3P26 A;  1IJE A;  1VQ8 B;  2B7B A;  1EP1 B;  3WBK A;  2BGI A;  4M0L A;  4PC2 A;  4ACA A;  4M1K A;  1BJK A;  4F7D A;  5FA6 A;  1CQX A;  4NCN A;  4Y7C A;  1ELO A;  1UMK A;  1QX4 A;  1TTT A;  4YAW A;  2C77 A;  3SJZ A;  3AVU A;  1KTV A;  3W2F A;  3CXC B;  4FK8 A;  4YAF A;  1EWY A;  1W87 A;  1YI2 B;  5GV7 A;  1M90 D;  3WBJ A;  1QVF B;  3JQP A;  1VQ7 B;  1VQ4 B;  4G1V A;  1BX1 A;  2YWF A;  3MMP A;  1QGA A;  3FJO A;  3P27 A;  2XEX A;  5TY0 A;  1H85 A;  1H42 A;  3OZV A;  3AGQ A;  1VQK B;  2YWE A;  2XNJ A;  3CCR B;  1DDG A;  3U2Q A;  1Q82 D;  1GJR A;  1G7C A;  3CCU B;  4ZCI A;  4YHB A;  4EH1 A;  1GAQ A;  4TMV A;  1VQ5 B;  1W35 A;  1KK0 A;  3U6B A;  1QUF A;  5THX A;  1CNF A;  3CD6 B;  4PC7 A;  1FDR A;  3U6K A;  1VQO B;  4BPR A;  2BVN A;  3LVB A;  4B48 A;  3OJX A;  4QFM A;  1G7S A;  2BV3 A;  2OK7 A;  4YAO A;  2ZIT A;  1YJN B;  1M1K D;  1KJZ A;  4Y9R A;  2OK8 A;  1BQE A;  2VYQ A;  3VO2 A;  1AMO A;  2FX3 A;  2GPJ A;  1QGZ A;  2XNC A;  4HE6 A;  2QA4 B;  2QN6 A;  2BM0 A;  1YJ9 B;  1FRQ A;  3OZW A;  2R6H A;  1VQ9 B;  2E1R A;  1QUE A;  4AC9 A;  1ZM3 A;  4MYU A;  3W5H A;  3W2I A;  3CCJ B;  5HXB A;  5TR9 A;  1D2E A;  3CW2 A;  1E64 A;  1N8R D;  2BPO A;  3ZBT A;  2QMU A;  1Q86 D;  1D8T A;  4C0S A;  2OTL B;  2BM1 A;  1K9M D;  2DEU A;  4UAJ A;  1OGI A;  2C78 A;  3CME B;  1BX0 A;  3V76 A;  1U2R A;  2BN4 A;  1ZM2 A;  3QFC A;  4ZCL A;  1QGY A;  3VMF A;  3QFS A;  3ZZU A;  1FND A;  4RD0 A;  4IW3 B;  1VQM B;  4FN5 A;  3OW2 B;  4B44 A;  4TMX A;  3CCE B;  2EFG A;  4M53 A;  1OB2 A;  1JA1 A;  4DQK A;  4DQL A;  3CCM B;  3WNC A;  4ZGQ B;  1JB9 A;  3B8H A;  3WXM A;  1QVG B;  4B43 A;  1J9Z A;  2QTL A;  1NJI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...