1XE8A

Crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
194
structure length
189
Chain Sequence
ANAAIEPASFVKVPMPEPPSSLQQLINDWQLIKHREGGYFKETDRSPYTMEVEKPVNTEMVTRNQSTLIYYLLTPDSPIGKFHKNINRIIHILQRGKGQYVLVYPDGQVKSFKVGFDYKNGEVSQWVVPGGVFKASFLLPNEEFDNGFLISEVVVPGFDFEDHTFLKGEDELKHLVGPEKAAELAFLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region
publication title Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly-roll fold
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 43
structure length 189
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xe8A00
4J1XA 5CU1A 1YFYA 4L2NA 4IEUA 4LULA 5I8TA 5E1RA 2MPFA 1H1IA 2XHKA 1J58A 1ZZ7A 1OFNA 1EYBA 3WW1A 2ET7A 1ZZCA 4JTOA 3GYDA 1SEFA 3I54A 3HQXA 4PIZA 4KU8A 4JV4A 2PFWA 1PM7A 4IESA 5BUVA 1FI2A 4XFBA 4HSLA 3H1YA 1UW8A 4QGLA 1ZNPA 5JSRA 2CV6A 3H50A 4WZCA 4O9EA 4MZUA 4I0BA 3ROUA 2D93A 3LA7A 3MDPA 2ET1A 5BY5A 1ZRCA 3KSCA 4YSFA 5I0SA 3NL1A 5LEJA 1RL3A 2Z69A 2UY8A 2Q1ZB 1NE4A 1J3PA 4HN1A 1FXZA 4EWAA 2XKOA 4KWLA 4KWJA 3U10A 1O7FA 3FJSA 2CGPA 3JZVA 1O3TA 2XKPA 4YYOA 3H1WA 1CX4A 5E16A 2FQPA 3IDCB 1EP0A 2H6BA 2HKXA 4PIXA 1JUHA 2XL9A 1O3SA 1UIJA 4OLLA 1UPIA 1Q3EA 4HBNA 2Z2SB 1ZX5A 1YUDA 2GU9A 2PYTA 3UKNA 1QWRA 3E6CC 3BPZA 1LR5A 3HT1A 1ZVFA 2E9QA 3NVCA 5I8YA 4MGYE 4HVQA 4X6RB 3ES1A 4E2SA 4XF4A 5I93A 1QXJA 4HVRA 3ES4A 3S0MA 2PAEA 2GZWA 5BPXA 3B02A 2XLGA 1J3RA 2EAAA 1O4TA 3GBFA 1Q5OA 4LUMA 4I2OA 5AVPA 3ST7A 4AQ6A 4IERA 2PQQA 3BCWA 3PVBB 4MH0E 3I59B 3LAGA 3D0JA 4CYDA 5JCTA 3M70A 1QXRA 1VJ2A 2ZCWA 4Q0VA 4P9GA 1X8MA 4ZU7A 2Y0OA 2OZ6A 1IPKA 4FT8A 3I59A 3E6BA 3KMHA 5FPXA 2I45A 4XFGA 1NYWA 4KU7A 1EPZA 2OZJA 2O8QA 4D7TA 4EWEA 4XFAA 5LRSA 1YFXA 3RYKA 5JSOA 3EO6A 3U0ZA 3DKWA 4ONUA 1XE8A 5K8SA 4HZFA 4META 4XF0A 3IDBB 3RDIA 3LZZA 1X8EA 5KHHA 3OD0A 3O14A 4PIYA 1EY2A 4LEJA 2GC1A 3E6DA 3H8UA 2D40A 2IXJA 3FFQA 4UBHA 3EBRA 1ZZ9A 1RUOA 4IETA 3BB6A 3UKTA 4N9HA 1G6NA 3FX3A 1ZZ6A 3CO2A 5FPZA 1LRHA 2B5HA 1ZREA 1CAVB 3DV8A 1OMIA 2UYBA 2XLFA 5KHIA 4IEXA 2UY9A 3CLPA 5BV6A 4Q0UA 1WLTA 4F8AA 4XFIA 3DL3A 2WC2A 2CAUA 4Q0SA 2VPVA 3H9AA 3S7IA 3NSTA 5EZWA 4Z07A 1CAVA 3CL1A 1J1LA 3LWCA 2GH2A 5EFUA 3HT2A 1DZTA 4QMAA 5LEKA 2Q4SA 3PNAA 2GC3A 1VR3A 4ORFA 2IXHA 3RNSA 4E2QA 5CVRA 2BGCA 3M3IA 5LRRA 1LKNA 1YFWA 3R6SA 5CADA 3RPQA 3IIAA 2BNNA 3ELNA 3EQEA 4LA2A 4NVPA 4YRDA 4XF1A 4UBGA 2PHLA 4F7ZA 2QVSB 4D7SA 1LB2A 4BHPA 5JR7B 2OA2A 4JVAA 5C8WA 4BYYA 2CAVA 4L11A 4WBBA 1UIKA 2QDRA 3SXWA 4HN0A 3WW2A 3L2HA 4H7LA 5I0RA 4QX5A 3ZDSA 4MGIE 4BH9A 5I91A 2O1QA 2EVXA 1H1MA 2ZKLA 1L3JA 3H3UA 1GQHA 3MYXA 4QXKA 4I02A 2HJIA 1ZRRA 3CEWA 3TNPB 4YNIA 1RUNA 2F4PA 4IEPA 4Z82A 4PJYA 2IXKA 3E5XA 2OYZA 2QJVA 5KBFA 5J48A 1J3QA 3NKTA 4N9IA 4AQ2A 3WW3A 3OGJA 4LA3A 4KL1A 4UXAA 1XE7A 1DGRA 4MV2A 2GAUA 4IEVA 1O3QA 2V09A 3MPBA 4K8FA 3UKVA 4XF3A 2Q30A 1CAUB 2QNKA 3RYRA 1DGWA 3H1MA 2PAMA 3H7JA 3TNQA 1RC6A 5KHGA 1GQGA 5HI0A 4R52A 2QCSB 3CJXA 3PLQA 3S7EA 4AVBA 4IEQA 2H6CA 3CF6E 1CAUA 3FE5A 3OCPA 4XEZA 4I0AA 4ZU4A 4BIFA 3MZHA 1Q43A 4MX3A 2B9UA 2DCTA 2XLAA 1I6XA 3ACLA 1X82A 1ZZ8A 2PTMA 4MUVA 2IXCA 4I3PA 3SMHA 3G7DA 3SCGA 3QACA 5FLHA 1QY4A 1CGPA 3RYPA 3EHKA 5KHKA 1WA4A 2BNOA 4Q29A 2IXIA 2K9ZA 3HIFA 5T3NA 2WFPA 2XL7A 4X6QB 1ZZBA 5J7MA 2MHFA 3USSA 4R8HA 5FCCA 3D0SA 3ETQA 3E97A 5JSPA 1FT9A 4HMZA 3I7DA 3E5QA 4XETA 4A2UA 1V70A 2C0ZA 3KGLA 4XF9A 4XFHA 3IWZA 4FAHA 1VP6A 2BNMA 4J1WA 1I5ZA 4AVAA 3SHRA 4IEYA 4TLFA 4XFFA 3NW4A 5FQ0B 3LOIA 5I0TA 5F1RA 4FAGA 1IPJA 2N7GA 1RTVA 3NJZA 4LTAA 2K0GA 2P17A 4EWDA 4E2GA 4LUKA 1WGPA 1YWKA 3FZ3A 4XFCA 3SCHA 4KWKA 4HSJA 5FQ0A 1UD1A 4RD7A 1SQ4A 4EV0A 4HVOA 2H0VA 5D1IA 1U12A 1XRUA 3BALA 1NE6A 1SFNA 4ZU5A 4B29A 5FLIA 1HW5A 1O5LA 4QM9A 3RZZA 1DZRA 2PHDA 2UYAA 3D82A 3EJKA 4MGZE 4WVZA 5I8SA 3KGZA 4I01A 2BEOA 3C3VA 4JTNA 1NZCA 2KXLA 1ZRFA 4AXOA 1J59A 4QM8A 5JAXA 3FWEA 5BXXA 1O5UA 4AVCA 4IEZA 4QGMA 3WW4A 5FDBA 5KHJA 4O9GA 3N4MA 4YARA 1Y9QA 4FBFA 3LA2A 1CAXB 2PAKA 1NXMA 2PA7A 3H3ZA 4DINB 4I09A 3SCFA 3H7YA 1OI6A 5FLJA 1PMIA 5J3UA 1CAXA 3QOPA 1UCXA 4MGKE 1RGSA 1O3RA 2BYVE 3OF1A 2D5HA 3KCCA 1YLLA 1OD5A 2EA7A 3LA3A 4QGNA 3VHRA 4Q0QA 3U11A 4LLOA 2IC1A 1TQ5A 2GC0A 2MNGA 2IXLA 3IBMA 5I0UA 3FHIB 4IEOA 2B8MA 2VECA 2OPKA 1X7NA 3DN7A 1CAWB 3OTFA 2XGXA 3BU7A 4HLTA 4Q0PA 2VQAA 2ETEA 2Q0AA 4IEWA 2ATFA 2GC2A 4EROA 5C6CA 1ZRDA 3E5UA 1YHFA 4OFGA 4GULA 1Y3TA 1CAWA 2FMYA 2D5FA 1YFUA
chains in the Genus database with same CATH superfamily
5CU1A 2VQUA 5T54A 4B7EA 2ZXQA 3GZUC 5DG1A 4F3JA 2RR11 2XHKA 1YJLA 3VDDB 1Y4WA 3A7QA 3WP6A 3T1LA 5D8AA 5BNOA 5C9AC 4C0BA 1SACA 1NT0A 4IQPA 4XXPA 1JI6A 2ZX2A 4RGAA 1COV1 1T6BX 1XNCA 3I54A 1PK6B 1RUE1 1S2KA 2W94A 4BK5A 5J36A 1IHMA 2D6PA 1H9WA 3WVJA 4FXGB 3VBUC 1E57A 1WLWA 4RS5B 3U75A 3AMMA 3VDDA 3OUJA 1SFPA 1FI2A 1AL22 2E51A 4QDSA 4XUNA 5DZEA 1UNBA 2DFBA 4G4FA 5DUVA 1PK6A 2ZPXA 5HCAA 4GMP1 2VCCA 2XBO2 2JE7A 4GH4B 5CISA 3K51A 1SPPB 4RS5A 5EWSA 5IVEA 1RUH3 2QQPA 5FPAA 5E8AA 4NIIA 2E63A 1HKDA 4PLMA 2XXZA 4KBZA 3PVNA 1F31A 1S0FA 1OPOA 5C5UA 1RL3A 1PZ7A 1ZBA1 1P8JA 1S0BA 5DMYA 3VLBB 5LA1A 2BGOA 3KCXA 1SLAA 3E1F1 4GH4A 4LOSA 1SPPA 1HB2A 1WLDA 3VZOA 4XQDA 4OHWA 5IFTA 4E4SA 5A33B 1ND2B 1WMFA 2XKOA 4A45A 3C7GA 3JQXA 2VU9A 3U10A 3CJIB 2YC0A 1QKQA 3JZVA 4Y22B 1O3TA 4K9SA 5FY7A 3I3EA 2EXHA 3I2KA 1CX4A 1AR73 1CZVA 5C4WC 3M3EA 5L7OC 1C5HA 1EP0A 2HKXA 1F8VA 1AR82 1ND2A 2XL9A 4YM2A 5A33A 3V56A 4ATEA 3I2FA 1UPIA 1VBB2 2WNUA 4LHKA 1H6XA 3CJIA 2IUWA 1AYN2 1ZX5A 1YO8A 4IDZA 3KV9A 4DB5A 1GANA 3AYEA 3UKNA 2HWB2 1QWRA 4AFAA 4GD4A 5APAA 1LR5A 3MFCA 3SH3A 1WW4A 1YJKA 1ZVFA 3AFKA 4LO7A 3BTZA 1MZFA 3K3NA 2PLV2 4MGYE 4RQPC 4FTSA 3LFMA 1YRZA 4Q4X1 5T5OA 1O8SA 5DABA 4XUTA 2JDHA 4E2SA 2P4EA 4N7UA 1RUC2 1DU3D 2B45X 1K5MC 4GQ7A 4LBOA 2D6OX 3OGRA 2WFF1 2GZWA 1YQ8A 4RA0A 2XLGA 4XJ8A 3JBG1 1L7QA 1J3RA 3GBFA 4OI0A 1FMD2 1Y7BA 5A7WB 2JDPA 1W6QA 3VKOA 1QH7A 3ST7A 4IERA 5LWBA 2JDNA 4K21A 1RUI3 2LW8A 2DCZA 2HBTA 4GB33 1LTEA 4BLIA 3D0JA 5J1XA 1H8TB 2WRAA 3M70A 1QXRA 3OBTA 1RVF1 2VCBA 5A7WA 4XYXA 3WV6A 2Y33A 4P9GA 4ZU7A 4YGBA 4AGRA 5CG9A 2Y0OA 2VW2A 2OZ6A 2X5IB 2XPJA 1CJDA 4COVA 1RUG1 3VBHC 3KMHA 4BU2A 2HEYF 1IS3A 1H8TA 1KD7A 2HWE3 1KQRA 2OZJA 2O8QA 4D7TA 2HWC3 4XFAA 5LRSA 1KJRA 2UURA 3MLLA 1VALA 2RHPA 3MW3A 4H7MA 1G9CA 2NP0A 5FZ1A 1SLTA 4I3GA 1DCSA 3UGHA 3MIBA 2X5IA 5FMBA 4QB2A 3ZYRA 4E8DA 5A6YA 2RE9A 3DKWA 2WZR2 1OH4A 4M01A 4XXAA 5BNNC 5JOWA 2LALA 2ZX0A 4ZY9A 4LPLA 1UZWA 1WW5A 4META 1MQTC 4YFWA 3ZKYA 1GZWB 1N1TA 3ZOIA 2R073 3RDIA 5BNQA 3BUCA 4R9AA 3GXUA 5FP9A 2DFCA 5FZMA 1HRI2 4JGZC 4GJZA 4K3UA 4BIOA 3DYOA 4LKFA 4AHXA 1LU1A 4BZ4A 2DYCA 2JDKA 4LEJA 1HB4A 1WCDJ 2RJKA 4OVEA 2ARBA 3A22A 5FY4A 4AVSA 5CKMA 3H8UA 4AEDC 1GZWA 3RSJA 3ZKUA 4CEWB 5FMCA 3ZYJB 1JZ3A 1WBFA 3VUOA 3T1MA 4JC1A 5A1FA 4YZ1A 1ZZ9A 2X53S 3RWNA 3S6PA 1G9AA 1XU2A 1Q8PA 3RGBA 5ACA2 4UW3A 2YGMA 3O1TA 4N9HA 2VZQA 2MEV1 5T52A 1C57A 3APBA 4CEWA 2OKXA 2CWSA 3K75B 2B5HA 2XR4A 4HT1T 4BISA 1TME3 3UV9A 1UX6A 2UYBA 5FP7A 1OQEA 5KHIA 1R1A1 2B4KA 3VZJA 5EJZB 4P08A 2WKKA 1EAH1 4XW3A 5JOYA 1VBE3 3KHBA 5FPLA 2UY9A 1RMU1 1V6NA 5T5LA 5FOJB 5GLWA 1GWMA 4E4HA 2WT1A 3DL3A 4LE4A 4ASKA 4GKXA 3H9AA 2RR12 5T50A 2YZ4A 1AL23 3MIGA 5IAVA 2EXIA 4AFCA 2XG3A 2GH2A 3PVOA 3T4VA 1KJLA 3HT2A 3ZIXA 4RGGA 2VUJA 2NMOA 5CYYA 3B7MA 3ZFGB 4JHZA 3WF1A 1Q8SA 4X8PA 1UY1A 4Y20A 4OCTA 3DPRC 3JQWA 4FOYA 5CVRA 4TZDA 1ONAA 1YFWA 4NAOA 4NROA 5EV7A 5CADA 4CXWA 2BDRA 2E26A 1O59A 3MICA 2A5ZA 4FPYA 4I0WB 1MZ6A 1MS9A 1XE0A 2AACA 3ZFGA 5FZ4A 2VCAA 2ORZA 3ELNA 2JIJA 4BQ5A 4B4QA 2VUCA 3KQ4B 4UBGA 1QJEA 4QX0A 4UOJA 3GDBA 5F3EA 5C71A 4GMP0 1OA2A 3VL8A 3V0BB 1NCQC 1WZXA 1GOFA 1FOD2 1ZBA2 1M06G 1FPN2 3VGIA 3DCQA 4GWIA 1KGYA 4CXXA 4JQRA 2XQRA 1YCIA 1W8ZA 1VAMA 4Q8KA 1ODMA 2ZEZA 4BA6A 1CX1A 3N9QA 1LJ7A 2BW8A 4JKMA 4QX5A 1RINA 3ZDSA 4YGEA 2K2SA 1H1MA 3BOPA 1ULDA 3ZR6A 2VC9A 1L3JA 4QAWA 3ZXLA 1VRH1 4CDQC 3V0BA 2D3SA 4XURA 3NRUA 5EP9A 3MUZ1 3OBZA 3THPA 1BQPA 4PQQA 3CBNA 5A80A 1KRIA 2WQ8A 3BPSA 5F6KA 3CEWA 1AR61 1MEC3 4YNIA 1RUD3 2F4PA 4Z82A 3VZKA 5KXBA 1YI7A 4XCBA 2TNFA 2GNBA 5CIRA 3E5XA 3ZIWA 2QJVA 4Q4W3 3WINE 1J3QA 3L9JT 4N9IA 4UWDA 5FREA 2Q8OA 1GV9A 3MF9A 4FPEA 3WW3A 1NUKA 3AKPA 4AHWA 5FZAA 4BB3A 3R4UA 1I5PA 1NY71 1RIRA 2CYFA 4PDWB 4UXAA 5F5AA 4YW2A 3JD73 1LOAA 1AUYA 2VBBA 2RS12 4B1LA 1DGRA 1W2AX 3HAGA 4MV2A 3T2TA 2XUMA 3WHTA 2GAUA 1O3QA 2WR9A 5F7UA 1W6PA 2WFF2 3AJYA 3MPBA 3PHMA 3ENRA 4K8FA 4GWMA 3UKVA 2GH8A 1OBNA 2OVUA 4PDWA 1SLLA 3UL2A 3SC7X 2Y60A 3H7JA 4HK9A 1RC6A 1QJX1 2DUOA 5EPAA 2XVKA 4C1XA 5KHGA 3THTA 5DXDA 5LK7B 3Q8BA 4RHV3 5CBLA 3KWVA 3CJXA 3AMQA 3HVDA 3Q8AA 3S7EA 5AC92 5FZ8A 1RVF2 3PU3A 4A4AA 2XWJB 4LITA 4YW5A 4LIUA 5FXWA 3WD5A 1F2NA 5AFEA 4P9YA 5FYUA 3R4DB 3H8XA 5GLTA 3RWKX 2RM21 2W3JA 1Z7S3 3ZYHA 1ZZ8A 5CFDC 4PI0A 4A41A 3WF3A 1RUJ1 2ARCA 5HBAA 1ENQA 2J1AA 2NPIA 4I3PA 4QX8A 4RFT0 3G7DA 1EV12 1VMJA 1AR91 3SMHA 4IUGA 2D6KA 2V73A 4S2GA 2DF7A 3ZFEB 1Y43B 3RYPA 2RS31 4PQ9A 3B94A 3T0AA 5FO8B 4I30A 1W8OA 2YFZA 3T3YA 1PIV2 1GNYA 4LKDA 1X50A 2ZGTA 1QJU3 2HWF1 4NIDA 1HRV1 1AHSA 2VG9A 4NIHA 2VZVA 4RR3B 5HCFA 2WO7A 2QZ2A 4QPIB 3O12A 2KR2A 2RDSA 2ZZJA 3HIFA 1YQCA 1NLRA 1ZZBA 4QQ2A 4Q1PA 1ASJ2 5FZLA 2EXJA 1R083 4JDMA 3FBYA 1UYZA 2KD7A 3ETQA 4KG8A 4NHLA 1PO12 1UZ0A 4Y1VA 4BMEA 4RR3A 5JSPA 1DYPA 2ADEA 2CNAA 2J1TA 3C7EA 3I7DA 3M4FA 4OULA 4QPIA 4QKFA 5F5CA 1WMEA 2XJVA 4CUGA 1DLCA 5FYSA 2VW0A 4OI2A 3IWZA 3C7HA 1Q8VA 5D21A 5FZIA 2MEV2 1RB8G 5F3GA 4DXTA 3CKHA 1I5ZA 4AVAA 4ZPIA 1OUSA 2JDMA 4PLNA 4XJZA 2Z79A 3T09A 3JUUA 3NW4A 5FQ0B 5I0TA 2DVAA 5CG8A 1R1A2 4TYSA 2FZ2A 1MR5A 1COV3 5FTTC 5GZFA 4DZGA 1RUE3 1RMU2 1RTVA 1F15A 3NJZA 4P5YA 4QQHA 3ZSEA 3I3DA 3I2JA 4M4PA 4D0QA 1PGSA 4XFCA 1Z78A 3O7OA 4P00B 3B5LB 5FQ0A 2C9AA 2ZBJA 2K46A 4N8MA 4OI4A 5KC5A 4GA9A 1LEMA 2VMDA 1JYCA 3OY8B 1A3KA 1UYPA 5JXHA 2LM3A 3NO8A 4GMP3 4GXLA 4Z92B 1HDKA 5FAXA 3WX5A 2FD8A 2IVIB 1U12A 1VBC1 3LSDA 2VBDA 5LZ6A 4UW6A 1QQP1 3W5MA 3K77A 3UNPA 4B29A 4CCCA 2ILMA 3NV2A 3THCA 5LA2A 2F6BA 4QM9A 1S0IA 3NQHA 3OY8A 3RZZA 4NHYA 1PX3A 3NMBA 3EJKA 4WVZA 5I8SA 2FZ1A 1PGW2 1SMVA 5DPNA 3NNLA 4RYDA 4TTGA 4YVSC 5FK7A 3B3QE 4QM8A 3DYPA 3IIIA 3QBQA 5BXXA 5JAXA 4CP9B 5IYYA 4CCLA 4AVCA 1TMF1 4IEZA 4MYEA 4DEQA 4O9GA 1FNZA 1JN2P 2W39A 1S0EA 2YGLA 1XSRA 4QXHA 3LEGA 2AC1A 4A44A 4HFSA 5GZCA 1W9TA 1Y9QA 2D6NA 2J1VA 3TBDA 4YZ4A 4YZ3A 1OKQA 4CP9A 2PA7A 4FPKA 3H3ZA 3ZFFC 3WDYA 4HG6B 4AR2A 4ZS2A 4CDWB 5IVJA 2J1SA 4A42A 3GHNA 1STMA 3MIEA 4DINB 1VBA1 2Z5WA 5ABJC 1OT5A 1OI6A 2ZAHA 3ZSJA 5FLJA 5BNPC 2JG9B 5FUIA 1W2NA 1RGSA 2QTWB 4IV3C 4Q4X3 5LATA 4BPZA 2RMU1 4AQTA 4CCNA 1SFYA 1TNFA 4WM7C 1NX9A 1PMHX 1OD5A 2J7MA 3D6EA 2ADDA 1OOPB 4H2AA 4JAAA 1TQ5A 4CCKA 1DFQA 2JG9A 2GMPA 4KH9A 3JBG3 4RGKA 1OA3A 4IGPA 1JBCA 5F8PA 1T6GC 1KFUL 2VECA 3ACIA 5JDBA 2OPKA 1XYNA 1ULCA 5JXIA 2AEYA 2P3JA 1EUTA 1MS5A 1OOPA 4OUSA 3BU7A 1D0GA 1UL9A 3JB8A 3MO4A 1S0JA 1SLIA 5ERLA 5LY2A 4ASLA 1QNWA 1WD3A 1LENA 2ETEA 2Q0AA 4IEWA 2GC2A 3VBSB 3WNLA 1JUIA 5C6CA 1G7YA 3LFIA 1IQAA 2OPWA 2ZMKA 1WA6X 3DUIA 3ABZA 3C2UA 4R4XA 1Y3TA 1RUG3 4Y1YA 4DNYA 1UMHA 5FYYA 5FJKA 1YFUA 1H0BA 1F4HA 2R16A 1UOFA 2VL4A 2XBO1 4CP2A 4C91A 1FATA 2PQSA 4L2NA 5C4WB 3VBSA 2R062 4RL7A 5DZGA 1FYUA 3LKJA 3LIHA 1ZZ7A 5EXOA 1A6CA 1EYBA 1OFNA 1VBD2 3WW1A 4DS0A 4LLFA 4NWWA 3GYDA 1YYNA 3AK0A 1RUJ2 4IGQA 4PIZA 1B35C 4IGOA 2WA4A 4CTEA 4JV4A 1AR92 2R49A 1W6NB 2ZGSA 3ITQA 1PM7A 3DKQA 5BUVA 3LEKA 4RN5A 3OPZA 4JCKA 2VGDA 1O4YA 2RDQA 2RS52 3H1YA 4HPKB 5H9RA 1BEV3 1HB3A 3CZUA 5KC6A 4KWUA 1HRV2 1H30A 1H9PA 3GF6A 1W03A 4O9EA 4FP2A 4WZCA 4MZUA 2OW4A 3AVSA 4CPBD 1JYWA 4C0HA 1SG3A 3Q8CA 1GZ9A 4DXSA 1VBB1 3AKQA 3BIWE 2W08A 5HCHA 1AYN1 2ET1A 2LS6A 1B09A 3KSCA 4LBMA 1ZRCA 1DGWX 2FCUA 4YSFA 1ENXA 3NL1A 3WUDA 4NHMA 5I0SA 5JPMB 2HWB1 1H1AA 2YFUA 3WNMA 5C3QA 4E4ZA 3UETA 5JZGB 2Q1ZB 4UT5A 4P9WA 4HN1A 2WQ4A 1BBT2 3ZSMA 3J8F2 3WNPA 3BN6A 2PLV1 5D8AC 1EAH3 2A73B 2ZACA 5BNOC 4KWLA 5K4LA 1UAIA 3IKWA 4A3ZA 2YC2A 4W4ZA 5FZFA 1REFA 3SEPA 5FBJA 2FDJA 3LDKA 1WD4A 2ZTNA 2ZGQA 5A7SA 4N43C 5JZGA 1HXS2 3IDCB 1PO23 3QH6A 3RMXA 3ZXKA 5K0UB 4FO9A 4PIXA 3RI8A 2OUHA 4JDNA 2VNOA 2HWD1 4HBNA 1FMD1 2Z2SB 1X36A 4KGQA 2XJSA 2P2KA 5FK8A 3KV4A 2RV9A 3BPZA 3IB3A 3WDWA 4B7KA 4TWTA 3HT1A 4RS5C 5K0UA 5I0DA 2G9FA 3K4ZA 5C33A 2FDKA 4P5HA 4ZXKA 2WWUA 2VE1A 4X6RB 4XHBA 4QKBA 4FPFA 4P14A 1D4M1 5FYTA 4XF4A 2QQKA 1VBC2 1FX5A 4MGTA 1QQP2 2E53A 1QXJA 1MACA 2WO2A 4N90A 3ES4A 3S0MA 3U4SA 1I3HA 4AL9A 2BERA 3B02A 1HJGA 3TEXA 3KV6A 1CQ9A 2DVDA 2OQ6A 5FFOC 4ARXA 1CONA 3CHXA 3HN3A 4LQRA 4LUMA 1JHNA 4I2OA 2JDUA 1TG7A 1WCKA 4AQ6A 4CP1A 4LO6B 3UT0A 2QQOA 3PVBB 4PCRA 2WZR1 3AP7A 2XJTA 1OSGA 5CKNA 4NPRA 1VRH3 4XTMA 1OVSA 1WWYA 2WNUC 2E6VA 2ZCWA 3CJIC 3POGA 3WG1A 4AI1A 1HRI1 2VMHA 3ME2A 5FY1A 2WABA 1XYPA 5C3PA 4QQPA 4M00A 1HQLA 3E6BA 1AR63 3M3QA 1W28A 1Q8QA 3N7JA 1JHJA 4XFGA 3ZXAC 1NYWA 2J42A 4KU7A 5LK5A 2L9LA 2OX0A 4AI9A 4W50A 1AJOA 4WV8A 3IM0A 3IMMA 3WP5A 1PVC1 1UY4A 5F5IA 5FY0A 4OZXA 3FC0A 4MSVA 4AI8A 4L99A 3EO6A 1FV3A 3U0ZA 1XE8A 5K8SA 2JJ6A 5KXDA 4HZFA 2KM2A 5IT6A 1HJFA 2RMU2 2A1XA 2X09A 1VLNA 1DF0A 5FMDA 1LAJA 3M8LA 5FZOA 3POEA 3TEYA 4Z1VA 4WZFA 3UYJA 1PZ8A 2GN7A 1V0AA 5FZCA 3A23A 5IVBA 2WYFA 3E6DA 5LBCA 3B93A 5A6QA 2Q8CA 4KQ7A 3VZNA 2D40A 3ZXGA 1QJX3 2IXJA 3AP4A 2ZZQA 5FWEA 4UBHA 4AVVA 2D7FA 3RVHA 4MHUA 3VBRB 2BPA2 1G6NA 1WBLA 3NAPB 4Q27A 2OQ7A 3FX3A 3VB9A 1H8TC 1K12A 3DEMA 4AQSA 5JI7A 5FPZA 1HX6A 1LRHA 3B9CA 3LE0A 4ITCA 4JGYB 1S2EA 5CB7A 3W5NA 1CAVB 2BV4A 2XLFA 2RM23 2QQIA 3OBRA 4BQWA 2JG8C 2X5IC 3OGVA 2C24A 2E33A 3PVEA 1O4ZA 4IEXA 4XACA 4EYUA 5BV6A 4Q0UA 1WLTA 4NUBA 4XFIA 4MG2A 2NLRA 1SZBA 1AR93 4Q0SA 4WVVA 3S7IA 4Z8BA 1MS4A 5FWJA 1PX4A 3OGGA 4Z07A 4JGYA 3P3PA 3VV1A 2QE3A 1CAVA 2RS33 3CL1A 4FQZA 4HKOA 5JIAA 3VBFB 3H3LA 4BOWA 4H3WA 5EFUA 3T30A 3T2PA 1DZTA 1FOD1 4HK8A 1FPN1 4EN0A 2Q4SA 5FR3A 2HWF3 4OMDA 2QQVA 5LY1A 1XNKA 2R30A 1VR3A 1W9FA 3WNNA 4R9BA 4ORFA 3WP4A 2IXHA 2R1DA 1IG3A 1BKZA 2XJQA 4Q4V2 2NM1A 5FV3A 4XBQA 2DDUA 2ZJCA 3TOJA 3VBFA 3P1IA 3WDVA 3N9OA 2XH6A 5DDJ2 3RPQA 2B39A 3IIAA 1DHKB 1UOJA 1A34A 2E7QA 2W9XA 3EQEA 4UFMA 2XONA 4V2WA 2YHJA 4LA2A 4GIQA 5CFCB 4CEWC 1OHFA 4N53C 3Q9OA 1R091 2LUWA 4EZ4A 3JB4C 3FLTA 4F7ZA 2IZWA 2Y0IA 1LB2A 4DUVA 1W0PA 3OB8A 4FPCA 4Y22A 1UZVA 4Y5TA 5DQ0A 3CMGA 1AJKA 5LB6A 1K42A 1MPXA 2DU0A 1JS9A 5FJHA 3H8RA 5A1LA 4HL0A 3ZM8A 2WSUA 3AYAA 1AX0A 3NV4A 4WBBA 4YZ5A 2JKBA 3GJAA 5JXGA 1GP5A 3SXWA 3WW2A 4PBPA 3L2HA 1X33A 1NKGA 3R4SA 4H7LA 4LHNA 4MGIE 3M3CA 3WQ7A 5I91A 2RG4A 2YYOA 2HH9A 2RS11 4D6SA 2VQTA 4JX0A 1MVQA 2A3WA 1URXA 1GQHA 3AX4A 2JE9A 4LBKA 1DG6A 5FY5A 2PHTA 3MYXA 3WP3A 2HJIA 5F39A 4RSUA 1LCLA 4CCEA 2HWD2 2GSYA 1NA1C 1S0GA 4PJYA 3C8XA 2WO3A 4CEYB 3ZFGC 1GKBA 3IPVB 5DN2A 5KBFA 3CNAA 5J48A 1O8PA 5H9SA 5AC91 1LESA 4NRQA 2Q1FA 4OHZA 3W58A 2EICA 4WM8B 5T5JA 4R4ZA 1TE1B 3ZN5A 1D0HA 4NHKA 4ATFA 4LA3A 4QPGB 3VDCA 5C8CC 4KL1A 1D4M2 4OHYA 3T2OA 3FHAA 4CEYA 3IPVA 1AZDA 1T2XA 1G8WA 3CDZB 1H2LA 1IGOA 3KLSA 4UYBA 5IK8A 1US2A 2WZ8A 5C9AB 2QBXA 1LU2A 4WM8A 4XTPA 1CAUB 1NQJA 1TMF3 5FPBA 2VAUA 3UJOA 1DGWA 4QPGA 1AXZA 1EV11 2Y8KA 1LOBA 1W2OA 2CGOA 2ZHLA 1PNGA 3TNQA 3VBUB 1GNHA 1C1FA 4LBJA 4OQ8A 2ZA9A 4CCDA 1GSLA 1JZ4A 3HJRA 1ENSA 4XUQA 4E9KA 1W8UA 1PIV1 4QU1A 2QQJA 1BYHA 1YQ6A 2QCSB 2D6MA 4YVWC 1J1TA 2H6CA 1XOYA 4IEQA 1CAUA 2OS2A 4NJ4A 5G04L 4BIFA 4KI5M 4ZU4A 1QJY1 1VBA3 4LBNA 3MZHA 3ZPYA 3THDA 4R9DA 1UY2A 1Q43A 4LNVA 1ASJ1 1UYYA 4IE5A 5A3LA 2DCTA 2BBAA 2XLAA 1I6XA 2D44A 1X82A 3ACLA 4IXLA 3H8OA 1ZRIA 2JIGA 1PO11 2R32A 4YWAA 2RMU3 4CDXB 2WYSA 4L97A 3J9SA 4XAAA 2JDYA 1VAVA 1DBNA 4HOOA 4P9JA 1PVC2 2WO1A 3T4HB 5FLHA 4CU7A 3RZMA 1C8M2 1HV1A 1AX2A 1QY4A 1R1ZA 2DU1A 2V5DA 3GHMA 4Q4Y3 3WXPA 2VUDA 4O7XA 1GR3A 2WZPP 1HB1A 4L9BA 4UW5A 5ISLA 1BMV2 3B9IA 4CDXA 1XXNA 4M0HA 4PDWC 3HMYA 2IXIA 4D7YA 5FYZA 3IDEA 2OIIA 2YROA 2BFUS 3RI9A 5M0TA 2VUAA 4LBQD 5J7MA 2PHUA 2FHRA 2MHFA 3NJYA 2BUKA 1LOFA 5AVAA 2DVGA 1NAEA 1MZ5A 1AYM2 2R7EB 3E5QA 1HN0A 3ON7A 5FO7B 4CDUB 4K6BA 3KGLA 4XF9A 2XBO3 4FAHA 2P37A 4RQPB 1VP6A 3LEMA 2VZOA 4GWNA 1JU4A 3EB7A 3SHRA 4NR1A 2ZMLA 2DCYA 4IEYA 4TLFA 5DG2A 4HKLA 4W65A 4Y4YA 5FZGA 4CDUA 4FAGA 1QIQA 2VNRA 2Q8EA 1GBGA 5FYHA 1H6YA 4FSJA 3WNXA 1YNAA 1MS8A 2P3YA 1WW6A 4RQPA 4E2GA 1PGW1 4LUKA 3MIFA 2WNVB 4AW7A 3O1RA 1KDMA 1WGPA 1W9YA 5HV0A 3SCHA 2WLPA 3LIGA 3J7NA 4KWKA 4IE6A 1DQ6A 4NE9A 3POJA 1UD1A 4RD7A 4YW1A 2P5BA 2P3KA 3VBOB 3PU8A 4YPJA 5FOBB 4AOCA 3OD4A 4ET7A 2GMEA 4AEKA 1ZBE2 2WNVA 1AVBA 5T55A 4AFBA 5CA6A 1AR83 2VJXA 5EYXA 4ZU5A 1S1AA 1VBB3 1W2UA 2DCJA 4QPIC 1LHWA 1AYN3 3WSOA 1UU4A 1UZZA 2G19A 4YG3A 3VBHB 3VBOA 1V00A 2P1BA 1XYOA 2HWB3 1RXGA 2PHDA 2WA3A 3J26N 4LORA 4CUCA 3VD9A 2BEOA 2W95A 3AP9A 2JB4A 4X8NA 4DUXA 2KXLA 2PLV3 1R092 2Q1MA 2VNGA 4AXOA 1J59A 4DUWA 5BNNB 5LBBA 3IT8A 5F3IA 3CZJA 1VAKA 3VBHA 4FQ4A 1RUC3 1OF3A 4FPJA 5KWRA 5FDBA 1MQTB 5KHJA 3WQBA 3WLUA 1RYYA 4S2DA 2GP5A 5LCWL 3WNKA 1ODNA 4JGZB 4M3CF 4DY3A 3W9AA 5JMCA 2D98A 1POQA 3HNMA 3WDTA 4Z2AA 1XNTA 4DPNA 3VD4A 1N3PA 2PAKA 1FMD3 3HNBM 1NXMA 2VOTA 4MO3M 2BFUL 1XQNA 4UFLA 2GDFA 1MQTA 4AEDB 4YZ2A 2FDFA 3Q8FA 1RUF2 4URTA 2WAAA 3H7YA 3IAPA 1MS3A 4DXZA 1N1SA 1W8WA 2F17A 3WY6A 4B1MA 4QHZA 1UCXA 5FY9A 1POV1 1BVVA 5FP8A 4COZA 1Q56A 1D4M3 4MXWB 5DAQA 4AEDA 3RZLA 1EPWA 2WINB 4MOAA 4DXRA 4NPLA 4Y1ZA 5A3UA 5AFBA 2EA7A 3VHRA 4DQAA 2WT2A 4INDA 2E31A 2JD4A 2DBIA 3U11A 2JDAA 3RZHA 3WG4A 2LRPA 1GFF2 3AKRA 2MNGA 2DVBA 3AZYA 3GCWA 3M7AA 4OMCA 1JYTA 4TN7A 4FFGA 3HQRA 2R061 4JDOA 4AI3A 5FYMA 4MXWA 3O1PA 4IEOA 2B8MA 4QT6A 1VBD1 1W8HA 2WZR3 4K40A 4EN8B 2BU9A 3DN7A 4Q2FA 3FL7A 3OTFA 4NRMA 3LOBA 1F5FA 3H0OA 2QUOA 3VHOA 1YQ5A 1HRI3 5L9RA 3GNEA 3E5UA 3KCYA 3DPRB 4CU8A 2VVDA 1A78A 2RS51 5IUQA 3RJ2X 3IMNA 4Y26A 3URFA 1U0AA 2FMYA 2I07B 3KT7A 1JOBA 4XDQA 4CUBA 4J1XA 4O65A 4AFMA 4M3CB 5I8TA 1QJY2 5FZ6A 5E1RA 2MPFA 3ZFEA 5IVYA 1H1IA 1ZYBA 1VMHA 1UZYA 5ACA3 3DPRA 3VKFC 1PGL1 4SLIA 2ET7A 1ZZCA 4JTOA 3VKLA 2CDOA 4K1YA 1RUH1 3F95A 1XBFA 2JG9C 3PURA 3HQXA 2ZX1A 1IKQA 4M3CA 2NZ9A 5JR2A 4OI1A 5JXJA 1BBT1 1QEXA 3J8F1 4Z2WA 2D3PA 3AXEA 3O0VA 2QZ3A 1IOAA 4LIVA 4DFSA 5IK7A 1IZ3A 2WN2A 1UYXA 2WL1A 3SISA 3VZMA 2DURA 4DOUA 1UW8A 1SLBA 1ZNPA 2RR13 1OPMA 4XQWA 4CDQB 5JSRA 1C8NA 2WN3A 1HXS1 3WDUA 3ROUA 2P6CA 4QX7A 3WF4A 4Y1XA 3KZ4C 1D7PM 5JLVA 4K7JA 1JZ5A 5FZ7A 3LA7A 3MDPA 5BY5A 1TEIA 1V6JA 1W0OA 3M3OA 4FFHA 2Z69A 2HYKA 3MFAA 4CDQA 5LEJA 1OLQA 3JCIA 3LSEA 3O0WA 2UY8A 2B46X 1NCRC 3U4XA 1NE4A 1LGCA 1W8TA 2R042 2YU1A 3HEIA 1F35A 2VMIA 5EJ1B 3VBSC 5IK5A 3VD5A 1RHI2 3GBGA 4EWAA 5GLZA 2DTYA 3OGSA 5GZDA 5A7QA 2YPJA 1ULEA 2AEZA 5SV8A 2ZGNA 3FJSA 2CGPA 4K8RB 4QKDA 5L19A 3HWJA 2XKPA 3SNMA 2ZS6B 1WMDA 3H1WA 1QOTA 1ND3C 1OFSA 4XDPA 4JRLA 3WT3A 4CPBA 2A7AA 2Y26A 2CSGA 1FOD3 1ZBA3 4YM1A 1FPN3 1UIJA 1APNA 4OLLA 3WR0A 1O91A 1Q3EA 1OXCA 1Q8OA 3OPWA 3WUCA 5F9TA 2BBVA 4NOTA 1GOGA 1V9U1 1W39A 2R0HA 2WWJA 2ZABA 2ZEWA 2GU9A 2PYTA 3OUIA 2FCTA 5F32A 1U5ZA 3NJVA 4QDRA 4AGVA 2YUEA 3POBA 5KXEA 1XC6A 3NVCA 3ZMNA 3KHCA 3HBZA 1RUI1 5FZ3A 2IFRA 2CU5A 4GB31 3K3OA 3N9NA 3ES1A 4M3CE 2WNOA 1S0CA 5I93A 1QDOA 1ULPA 2LTNA 4FFFA 4HVRA 3I2DA 4MGQA 3HNYM 1W3VA 3ZXJA 3K48A 1VB2A 5CFDB 4BQ2A 1C4RA 3UESA 4AI0A 3BTXA 4L0PA 3WF0A 2X05A 3AKSA 5AVPA 4MLOA 2GNDA 2HWC1 4ISQA 4MH0E 1UU5A 3I59B 1LECA 3LAGA 2WS92 3HN1A 2VNVA 5DUWA 4LMFA 4CDWA 3I97A 5CFDA 2RS13 1VJ2A 4Q0VA 3N7LA 1QHDA 2W0XA 2WFF3 4B4RA 2VOWA 3CIHA 4CU6A 1DQ4A 2AZ5A 1IPKA 2YXSA 2JENA 1SCSA 1PVXA 4FT8A 4PF5A 2HLEA 3I59A 4QB6A 3USUB 2QQUA 5FPXA 2I45A 1XU1A 1UMIA 3RQ0A 5GZGA 5JIUA 1QJFA 1EPZA 5KR7A 5DAPA 5F6LB 4LHLA 1PZ9A 3PTYA 2Y6FA 2ZGUA 4U2AA 2GP3A 2Y6KA 2NYYA 3OSDA 1DQ1A 2V4AA 5AC93 4LK7A 1YFXA 1BHGA 3MIDA 2W68A 1RVF3 4ONUA 1OQ1A 2VULA 2W1UA 4IV1B 4XF0A 4Y24A 2Y34A 2ES3A 4HONA 1LHNA 4BXFA 3IDBB 1VMFA 1W06A 3LZZA 1X8EA 2EAKA 1W9SA 2W47A 5KHHA 1VRBA 3OD0A 2X8KA 1QOSA 5LW9A 4KGGA 1C28A 2GC1A 1EV13 3AXDA 3LEIA 4IV1A 4CXYA 2VVFA 1O6UA 2VTXA 1KXGA 5C5TA 1U5YA 3FFQA 3I2IA 4BXSV 4EN9B 2W1SA 1MVEA 1PIV3 5ANNA 3ZYIB 3RZKA 4IETA 4JRAA 5H9QA 3VZLA 1YEWA 2A71A 3SQOA 5E89A 1JZ8A 4Y5SA 2VZTA 2FDIA 2A70A 1X9TA 2I2SA 2J1RA 1W0NA 3LDBA 1ZZ6A 2VZUA 1AF9A 3CO2A 3SKVA 1QU0A 4Q4V1 3WDXA 1G86A 2CGNA 3B69A 3WQ0A 5A7PA 1ASJ3 2ZAAA 2YBPA 1OMIA 3AYDA 1OUXA 3DV8A 4LO8A 4Q4Y2 4ZS3A 5GALA 3V0AB 5DDJ1 2JXAA 4NO4A 4CU9A 5FP4A 1PO13 2VD7A 1HLCA 4QXCA 3UJQA 4F8AA 2J22A 1W6NA 2CAUA 2SLIA 2VPVA 1JXNA 5GLVA 4QU2A 4IE0A 3QD6A 4HPKA 1J1LA 3V0AA 4ZZ8A 2MEV3 4GZ9A 1LOCA 3HBKA 1RUH2 3C7OA 2TEPA 3MLKA 4QMAA 3ACGA 4BQ4A 2JEMA 3BIEA 1TVGA 4ARYA 1GYKA 2AREA 2GC3A 5JI9A 4FI9A 3P3NA 3KVAA 1R1A3 2WBKA 3DXTA 2VCMA 2R6QA 3QCWA 3OEAA 3RNSA 3J7HA 2LROA 3M3IA 1E5SA 1LKNA 1RMU3 3FFZA 4TLGA 5FXXA 3FLPA 1X9PA 3IZOA 1QF3A 1HQWA 2NQYA 3R05A 2WZEA 1IS5A 4LE3A 3MUY1 3ZFFB 4Q26A 2UWBA 1NLQA 2VZSA 3BGAA 4FPOB 4XJAA 2BVVA 4C90A 1GU3A 3IDAA 4NAMA 3VDDC 4NVPA 1SBDA 3SKJE 4B4PA 4XF1A 2FDGA 5ABJB 2ORXA 2PHLA 1AR72 3NNMA 4QX3A 3AM2A 3RZJA 4FTBA 3VD3A 2QVSB 5A6ZA 4BHPA 5JR7B 1PK6C 3AL5A 1JTZX 5LASA 4DMIA 1OKOA 1UOGA 5C8WA 4BYYA 3ZR5A 1SLCA 2A3XA 1C1LA 1DP0A 4L11A 4CCOA 4QWNA 2WJSA 1VB4A 3KT4A 4Q1RA 1I9RA 4KNCA 4JGYC 4A6OA 5ABJA 5I0RA 2Z4FA 2O1QA 1FAYA 1TNRA 1DQ2A 2EVXA 3B01A 2XVLA 2ZKLA 1UMZA 3TEWA 2P34A 2ZGMA 3V65A 3W59A 3H3UA 1K3IA 1UOBA 4GH4C 3KT1A 4SBVA 3INAA 2FCVA 4LHSA 4QXKA 4FCAA 5GM0A 1ZRRA 3TNPB 4Q5OA 2QQNA 2D3RA 1KFXL 1OLRA 1XNDA 3PUHA 4IEPA 4XC9A 1V9U2 3U1XA 4CSWA 1RUNA 2TBVA 4KMQA 3PUSA 1WCSA 4WVWA 2DV9A 4YM0A 5J98B 3MHZA 5JSOA 1ND2C 1RUI2 1UF2C 4QPYA 3LPGA 4GB32 2ZGLA 3TAYA 5C70A 1XE7A 1EUUA 5C7GA 1KS5A 3MBWA 4BJ0A 4XUOA 4BQXA 2VM9A 1H8VA 2W5FA 2OXBA 4NHXA 3RYRA 3K2OA 3NKGA 4IE7A 3H1MA 5F2SA 1B35B 2PAMA 1JZ7A 1ENRA 1V6IA 1C8M1 1OQDA 2HWE2 5HI0A 3S5QA 3W21A 2HWC2 2YDEA 2C26A 2DTWA 4BQYA 1UQXA 4QXBA 4V1PA 1BMV1 3PLQA 4AVBA 3CF6E 1DGRN 3FE5A 3TN91 4HANA 3L2YA 2XQXA 4XEZA 5K0UC 4DY5A 1B35A 5F3CA 1QJU1 3AVRA 2R072 5FXZA 5L73A 3PMEA 1QJZA 3D5OA 4CCMA 2B9UA 4NIAA 2A6WA 4AHZA 1PGL2 2EALA 5A3PA 3ZN6B 1AYM1 2Y6LA 2IXCA 1W8NA 3MIHA 3SCGA 3QACA 1CPMA 4CEYC 5FPUA 3WCRA 1CGPA 2DUQA 4NIGA 1IKPA 3GM8A 5FYBA 5L9BA 4UI9L 3PL0A 5BNOB 3EHKA 4WVMB 2H0BA 2R063 2VY0A 4D94A 2E7TA 5EIYB 2WIIB 2BNOA 1JODA 3ZN6A 3J7MA 4QPGC 4A6SA 2WQZC 1VBD3 2B9VA 5FP3A 2K9ZA 3LB9A 4N43B 5E6HA 1GICA 2PHRA 2VR4A 3VBRA 4F83A 3T0DA 4XIOA 1SBFA 2KA3A 2XL7A 4OUEA 2IWGB 1RUJ3 2Y6JA 1TME2 3BODA 3NAPA 3TYJA 3T2QA 1OVPA 4FVVA 1GP6A 1YQ2A 4R8HA 3AZZA 4WVMA 5FCCA 1XPWA 2Q8DA 1VBE2 5D2AA 1FT9A 2Y6HA 4LO4B 1UXZA 4A2UA 2JD9A 1F5JA 2RS53 4LO5B 4N43A 5FZ9A 2VOKA 2FMDA 2Z42A 1LHOA 2C0ZA 1RJ7A 1JMUB 1H2NA 5JPNB 4JKLA 4K20A 2FDHA 4LBQB 1HRV3 4KG0A 4EN7B 4YM3A 2G9ZA 4XFHA 1J83A 1ZBE1 4J6GA 4J1WA 1YI9A 3GCXA 4JKKA 1NLSA 1VIWB 4FTEA 1GZCA 3POSA 2XOMA 2Y6GA 3LOIA 3UGFA 4P02B 1IPJA 3TB0A 3OJBA 4LBQA 3R0RA 5FKBA 5IFPA 1W99A 3AKTA 1JZ2A 1GUIA 3N3HA 1Y9MA 4XBLA 2P17A 5TSWA 4CUAA 1GP4A 4QDQA 3O1OA 1BBT3 4HKWA 1YWKA 3J8F3 4CDXC 2A75A 4XJWA 3ZLIA 5A7OA 4AK3A 1PM4A 5FZKA 4FOWA 5K7PA 1SQ4A 1GMMA 2Y38A 1AXKA 2RDNA 3GBWA 3AJZA 2A6VA 2EF6A 1HXS3 2PN5A 2WNUB 2F4LA 3OUHA 5D1IA 5CFCA 1N3QA 1XRUA 2C5DA 2VZ3A 1LOFC 5JMOA 2V4VA 2V72A 4QPWA 4XILA 2CWMA 1UXXX 2EIEA 3KB5A 1QMJA 1YC61 1O5LA 3RG0A 2YG0A 4ES8A 1J84A 3ZX7A 1RUF1 1LEDA 5H9PA 1N1YA 3SH5A 1OLMA 3KGZA 5A1AA 1V6OA 1E5IA 2D97A 3C3VA 3PJYA 4JTNA 1UKRA 1NZCA 4XIKA 3BU0A 4PLOA 1ZRFA 2B7YA 2FBEA 2J1UA 3ZDVA 1W2TA 4PI2A 3NNGA 2JICA 4CDUC 3AZXA 3FWEA 4L8QA 1XNBA 2BRTA 1E5RA 1VBC3 2ARAA 4QGMA 3DF0A 4AAPA 4JQTA 1QQP3 3N4MA 5CKQA 1MEC2 3ALQA 1RUD2 4QHOA 4ZONA 5HCBA 1W6QB 2PMWB 4BQ1A 4FBFA 4LOTA 4Q4W2 4A7YA 3LA2A 1CAXB 2BOIA 3O1UA 1V9U3 4XOGA 1DYOA 2WT0A 3I3QA 5DAWA 4I09A 2WNVC 5DAVA 3U37A 5FBZA 3JD72 5IATA 4DRRA 3I3BA 5IAXA 5J3UA 1CAXA 4UFIA 4B3NA 4C8DA 4MGKE 1L7LA 2RVAA 3MW4A 4MADA 2P6HA 1GWKA 2HEWF 2O8OA 3VBOC 2DVFA 5L36A 1O3RA 4E8CA 2Q5TA 3OF1A 3FUOA 3KCCA 4JHTA 1YLLA 3S57A 1ACCA 4QGNA 5C9AA 3GJBA 4HETA 4Q0QA 3HOBA 3BTAA 4AVTA 3FHQA 5F2WA 3KM5A 3GZAA 3ZXDA 2GC0A 4RHV2 2JG8B 4CRQA 1REEA 3I2HA 4C1WA 2BWCA 3IBMA 2AGSA 5DUXA 3VBUA 1OURA 2DWRA 1AXYA 4MGSA 3FHIB 2VW1A 4LXLA 1C3HA 1H4GA 3PMSA 4CP0A 1K45A 2OT7A 3P5BA 1ULOA 2C4XA 3KV5A 1CAWB 2ZGPA 5FXVA 3U14A 4COUA 5IHRA 2XVGA 3D3AA 2JG8A 4Q0PA 1Z7S2 2O14A 2VQAA 5J37A 1OLME 2VTXJ 2YY1A 4BWOA 4DIQA 4H14A 3LF7A 1JZ6A 1YHFA 3N7MA 4OFGA 4AWDA 4XPVA 2AYHA 1CAWA 2I74A 1DZRA 1DZQA 3I8TA 3RS6A 3I2GA 3TN92 5F37A 3RZGA 2R1BA 1V6MA 1YFYA 2JKXA 5A3OA 3BI3A 3HPNA 4IEUA 1IS4A 1ALYA 4FOQA 1BEV1 1QGLA 1QH6A 3FUQA 4LULA 1QJU2 1XB9A 4EJRA 5L7OB 1DQ5A 1J58A 1UY3A 2VZRA 2WNEA 4UFJA 5CZKA 2VQ0A 4N53B 2SBAA 3ZO0B 2VH9A 2BZDA 1BK0A 5IVCA 5A3TA 3LCPA 4XE9A 5A6XA 1SEFA 4YG0A 1XSQA 1R082 2R041 4KU8A 4LT5A 5FKCA 5C4WA 5L7OA 2IFWA 1RHI1 2PFWA 4IESA 3C7FA 4XFBA 1DDLA 2HEVF 3AP5A 1CVNA 4HSLA 4N53A 5FYCA 4E4DX 3LDRA 1UX7A 4QGLA 3PIGA 4W6WA 2CV6A 3ZSKA 3EXUA 3H50A 1C5IA 1K5MB 2YB7A 1SCRA 1LOGA 4I0BA 1F9KA 4Y20B 4YFZA 3DGTA 2ENRA 2RDRA 3N9PA 3SITA 4FP3A 2D93A 1CR7A 1W04A 3TRSB 1QDCA 1YIPA 2PHWA 3NV3A 5A3WA 2VXJA 3U07A 1PO21 1COV2 4YW7A 3VN4A 1NA1B 4Q4V3 2VMFA 1RUE2 3A0NA 2AENA 3O1MA 1K5MA 5IVFA 2C9KA 4A7ZA 5EHDA 4XZPA 1JYNA 1J3PA 3ZFEC 1WCUA 1FXZA 5DDJ3 2AH2A 4OZOA 4O61A 4NWVA 4KWJA 2C6SA 3AFGA 2YC4A 3LQCA 3MGUA 1O7FA 5C8CB 3H42B 3O0XA 4RR3C 1NA1A 5JVVA 1CWPA 2VOXA 4YYOA 1UN1A 2P3IA 2YU2A 1CZTA 3D8CA 4CCJA 5E16A 2FQPA 2H6BA 3ZXEA 1RJ8A 3B00A 4YGDA 1CESA 1JUHA 1O3SA 4Y3OA 4COYA 2GNMA 2YPDA 2E7AA 3AC0A 5DZFA 2VXRA 3POWA 3DXUA 3X29B 3DYMA 3P6BA 1YUDA 3ZSLA 5C8CA 1SBEA 1U5IA 3AMNA 3I2OA 3I4IA 2G4IA 5FIXA 3K4DA 3E6CC 1UY0A 1RXFA 2EIGA 2WS91 2ZEXA 4GJYA 5IW0A 1VPHA 2E9QA 2OUJA 3FLRA 5I8YA 3S5AA 4IW3A 4D6QA 4YVWB 4HVQA 1H4HA 3Q8EA 4OHVA 5C3RA 3NWKA 1W8FA 1TZOA 2ZOEB 5BNNA 2HWD3 3MEPA 4FPGA 3WEZA 1JYIA 2A6ZA 3BVCA 4H55A 5LA0A 4KBBA 2PAEA 4YW4A 2BOJA 5BPXA 3I49A 4IE4A 4YVWA 1LHVA 5FZ0A 2EAAA 1O4TA 1UPSA 1Q5OA 3VDBA 2W46A 2E32A 4JGZA 1W90A 3CQOA 1BK1A 1DGLA 2PQQA 3BCWA 1DIWA 2ZGRA 1N47A 1BXHA 3AZVA 4CZSA 4LKSA 1W6PB 1A8MA 4CYDA 5JCTA 3NJXA 5E88A 4RFRB 4UW4A 4XHXA 3T08A 2VMEA 4Q4X2 4QQLA 1X8MA 5C3SA 2BP6A 4XBNA 4FFIA 4E27A 1OD3A 1G9DA 3ILRA 2XUEA 3PTRB 4W6XA 1WMXA 4AEMA 4XABA 2PELA 3FBMA 5FMOS 2AUYA 3F2ZA 1CIYA 3I3MA 4EWEA 5CAZA 3U78A 3GZTB 2XWBB 3JBG2 4S2HA 4W8JA 4EZHA 1IG0A 1PHMA 2QFEA 3ACHA 2W52A 4R9CA 3BYWA 5FYIA 2YV8A 1HIXA 2W2IA 3RYKA 3W20A 4S2FA 1Z0HA 5HPOA 5EQUA 3MW2A 4G9SB 3MI8A 1YXWA 4YGCA 1DQ0A 1OA4A 2ZHKA 4P9LA 3ECQA 2W92A 4ZZ5A 2CDPA 1CN1A 3KQRA 4UFHA 3O1VA 1JYXA 3A0KA 3O14A 4AG4A 2UWAA 4PIYA 4OHXA 1EY2A 1NG0A 2GNTA 3N9MA 4MXVA 4GWJA 5T5PA 3WOGA 4UFKA 5L9VA 4OUMA 4XZUG 4YW3A 2PHXA 1LODA 1YIFA 1RUG2 1HV0A 1JW6A 1PVC3 3AMHA 5FZDA 4ZXEA 4CDWC 1C8M3 4FPHA 4QX1A 3NNFA 5GLUA 1FV2A 2YMZA 3PIJA 5FUNA 3WZ1A 1V6LA 3EBRA 4XDOA 3PUAA 5DUUA 1ZM1A 4PHZA 4BE3A 2WLQA 1NCQB 3VDAA 2BWAA 1RUOA 1E5HA 3BB6A 3UKTA 3ZXFA 2DCKA 3TN93 2X10A 2QQLA 4N7IA 2RJLA 4XCAA 5GZEA 1BJQA 5JOXA 3J4UH 2ZHNA 3MLJA 1ZREA 2VO5A 5A70A 3WHUA 2JX9A 2C1FA 1GQPA 3CU7A 4NPMA 1OOPC 5CNAA 1NCQA 3TWIA 1REDA 5GKAC 3CLPA 2BVBA 5GJ6A 1W9WA 1AYM3 2WC2A 4ISRA 1JH5A 1BEV2 3ACFA 3PJQA 3ETPA 1DLLA 3NSTA 5EZWA 1FNYA 1AR71 5DAXA 3ILFA 3PUIA 3LWCA 2A6XA 4XMAA 3MV11 2G9GA 3ZMOA 4D6RA 5J96B 3GALA 5LEKA 1R64A 3PNAA 3KF3A 4ZHNA 1M4WA 4IV1C 3LGRA 4E2QA 2BGCA 5LRRA 2WAOA 1N1VA 1LHUA 3R6SA 3KVBA 4NMIA 3SH4A 1JYVA 3VL9A 1RITA 4XJUA 5A3MA 1EAH2 2W87A 2W91A 2ZX3A 4QHBA 2BNNA 4MVTA 5IJRA 4D8MA 4COWA 1NZIA 2XJRA 5FMOL 1ZA4A 4YRDA 4Q8LA 1DYKA 2ZMNA 4PF1A 4D7SA 1ZBE3 1PO22 4XVHA 1LNSA 5B4XA 2OA2A 3EMRA 4QKNA 3N9LA 3MV01 5LBEA 5LA9A 4JVAA 2CAVA 1V6KA 1U5XA 2WSVA 3WG3A 1UIKA 2QDRA 4P9XA 2W1WA 4HN0A 4PBOA 2WWSA 4G3YC 4BH9A 1AX1A 1CD3G 2V5YA 5FZBA 4URAA 3ATGA 3OOXA 5EYYA 3ZYFA 3HR9A 3WQ1A 1I1EA 1R093 1MS0A 2D43A 4M0NA 1KS4A 4P9IA 3ZYBA 2ZX4A 5ANQA 5FUPA 4FOVA 2R0FA 5FO9B 4ES9A 3SLIA 4EE2A 1KITA 4I02A 2NN8A 2X29A 4TXWA 3LD8A 3K4AA 2HWE1 1BZWA 2GALA 1LULA 1W3XA 2IXKA 2HYXA 2NMNA 2OYZA 5JZGC 4XMIA 3AL6A 4IL7A 1N3OA 3NKTA 4AQ2A 1L7RA 5JUVA 2CHHA 1QNYA 1CZSA 3OGJA 1RUF3 1S2BA 4YG6A 3VKMA 2EXKA 4BMBA 1VRH2 2R071 1LOEA 2D6LX 2JECA 2XMLA 2WDBA 2CL2A 4U36A 2JDZA 4IEVA 1QOOA 3KS7A 3QH7A 2V09A 2VTFA 4XUPA 4AGGA 1US3A 5B2GB 1WLCA 3SEEA 4GALA 3RFRA 4NRPA 2Q30A 2VZ1A 4XF3A 5LBFA 1IS6A 2QNKA 4A7KA 4B8EA 1AR62 5J09A 3EYPA 1GQGA 2ID4A 4R52A 3USUA 1NXD1 1S0DA 1WUVA 3BOWA 2BJSA 2TUNA 4FPLA 2DBNA 2IVJA 3LPFA 4Q4Y1 3AB0A 3OCPA 3WCSA 2VMGA 3HQUA 3ZVXA 4DO0A 3O1SA 2A3YA 2EIDA 4I0AA 5JWPA 1NY72 3TEZA 1POV0 3A21A 3N7KA 1OF4A 3IAQA 1TME1 4FXKB 4MX3A 1XJAA 3ZN4A 1PMJX 3G6JB 1ST8A 1WW7A 2PTMA 5HXVA 3IN9A 1VBE1 3AYCA 1A8DA 4MUVA 5IK4A 2BGPA 4MHRA 1G9FA 4D69A 5FRAA 1NCRB 1F4AA 3V64A 1QJX2 1D4VB 1AL21 4OQ9A 3QLQA 3S30A 2XJPA 3AP6A 1QJY3 5KHKA 3VHPA 1WA4A 2VVEA 2EIBA 1PNFA 3ZYGA 4DEVA 1Y9GA 2CY6A 1GOHA 1WCQA 4NN0A 4PT6A 4Q29A 4AYUA 3POIA 1ND3B 1NCRA 1W6OB 2VMCA 4BCUA 1S55A 3N35A 5T3NA 2WFPA 4X6QB 1MS1A 1GZTA 2DUPA 2J1EA 2VZPA 3GZEA 3USSA 1GLHA 2RM22 3RMYA 1MZEA 3HD8B 3NNJA 3D0SA 4AF9A 3VHNA 3FMGA 4QX2A 1SDWA 3E97A 1UU6A 2GN3A 3POYA 4HMZA 4EN6B 2QQWA 4XETA 3M1HA 4YVSB 1ND3A 1V70A 1W6OA 1XNAA 3AMPA 4BLJA 5HV4A 3BTYA 3UGGA 4GAZA 4M4RA 2RS32 4YW6A 2XJUA 2JE8A 2BNMA 1AL0G 1SDDB 2ERFA 2PXJA 5HXMA 2HWF2 5A3NA 1BLZA 1ULFA 4XFFA 4YVSA 4AHYA 4YLZA 4XQ4A 5F1RA 1K5JA 4AAXA 5C3OA 2G1MA 1AR81 2N7GA 3A4UA 3ORJA 4LTAA 2K0GA 3J7LA 4EWDA 4AE2A 2R043 3N36A 2W1QA 3FZ3A 4QD2A 1WKYA 1RHI3 3ILNA 5BNPB 4HSJA 5FPVA 4CE8A 2ARXA 1JOJA 2ZGOA 4QB1A 3VBRC 4AFDA 4IV3B 4K1ZA 2UU8A 2Y64A 3ZFFA 1IQDC 1UKGA 4EV0A 3BKZA 3NAPC 4HVOA 3ASIA 1MEC1 3MPPG 3PUQA 1RUD1 1CPNA 4WM7B 2H0VA 3WNOA 3OYWB 3BALA 3JXSA 3RJRA 1RUC1 4ZKTB 5IVVA 4ASMB 2QDNA 1NE6A 4BDVB 1SFNA 4HXCA 2ZGKA 4Q4W1 5BNPA 1SHWB 1BVP1 5SV5A 2ZEYA 5FLIA 1HW5A 2ZHMA 4IV3A 4AZZA 2B42B 4L92A 3PDQA 3WF2A 4V2VA 2BTVC 5K9YA 2UYAA 3D82A 4WM7A 3ZYPA 5B4NA 4MGZE 3KF5A 3OYWA 3JD71 2CTVA 2VBPA 4I01A 5CEHA 3O5SA 3VBFC 2QKDA 1LGBA 4UF0B 2WUHA 4CA9A 5FY8A 1GNZA 1UO9A 4BQ3A 5FYVA 1O5UA 1BCXA 1CJPA 3MF6A 3WW4A 4BM8A 4LR4A 2XHNA 3M2MA 4Y5Z0 4YARA 1ZA7A 3VD7A 2GMMA 1S4CA 3ZPOA 4RHV1 2XB6C 4UF0A 5KXCA 4J25A 4TSVA 1LGNA 4BK4A 3OEBA 2HBUA 5BYNA 3GGLA 4JZRA 4W6YA 4A3XA 2BQPA 1KDKA 3FN9A 4CVUA 2A6YA 4D3WA 2JWPA 3JU9A 3SCFA 5CFCC 2WS93 1W6MB 5FZEA 4LJHA 1PMIA 4LBLA 3RRDA 1JOPA 5A32B 1Z7S1 2YBSA 4Y4RA 2VOVA 3QOPA 2UWCA 4LKEA 2AR6A 3UK9A 4AEJA 5JOZA 1OC1A 1TMF2 1D2QA 1HQNA 2BYVE 2D5HA 5A7NA 1VE0A 3AZWA 3LA3A 1G9BA 2ZKNA 1NOVA 1W6MA 1QXPA 4LLOA 3OPTA 4QQOA 1ULGA 2IC1A 4DRVA 5A32A 2IXLA 3D4KA 5IWFA 5F5QA 3OBAA 2JB8A 1CIWA 5I0UA 5G05L 4GKYA 1JU3A 1UWWA 1W05A 5EJ3A 2QQMA 2RJ2A 1HN1A 1IPSA 1X7NA 4Y33A 4AI2A 1VBA2 1POV3 3DECA 5FZOB 3VKNA 5ACA1 2XGXA 1OH3A 3OG2A 1H2KA 1R081 2O0OA 2PHFA 4HLTA 1NQDA 4LK6A 4EQVA 1D2SA 3WG2A 4XAEA 1H2MA 2ATFA 2XDVA 4EROA 4OYUA 2YBKA 3KD4A 3NV1A 1ZRDA 1KEXA 4XJ9A 3POFA 5D8AB 4GULA 4WM8C 1GWLA 5FZHA 4Y1UA 2D5FA 3T0BA 4UAPA 3K46A
chains in the Genus database with same CATH topology
5CU1A 5T54A 4B7EA 3GZUC 5DG1A 4F3JA 2RR11 2XHKA 1YJLA 3VDDB 3WP6A 3T1LA 5D8AA 5BNOA 5C9AC 4C0BA 1SACA 4IQPA 4XXPA 2ZX2A 4RGAA 1COV1 1XNCA 3I54A 1PK6B 1RUE1 1S2KA 5J36A 1IHMA 2D6PA 1H9WA 3WVJA 4FXGB 3VBUC 1E57A 1WLWA 4RS5B 3AMMA 3VDDA 1FI2A 1AL22 2E51A 5DZEA 2DFBA 4G4FA 5DUVA 1PK6A 2ZPXA 5HCAA 4GMP1 2XBO2 2JE7A 4GH4B 3K51A 4RS5A 5EWSA 1RUH3 2QQPA 5E8AA 2E63A 1HKDA 4PLMA 3PVNA 1F31A 1S0FA 1OPOA 1RL3A 1PZ7A 1ZBA1 1S0BA 3VLBB 3KCXA 1SLAA 4GH4A 3VZOA 1WLDA 4XQDA 4OHWA 4E4SA 5A33B 1ND2B 1WMFA 2XKOA 3JQXA 2VU9A 3U10A 3CJIB 2YC0A 1QKQA 3JZVA 4Y22B 1O3TA 4K9SA 2EXHA 1CX4A 1AR73 5C4WC 3M3EA 5L7OC 1C5HA 1EP0A 2HKXA 1F8VA 1AR82 1ND2A 2XL9A 4YM2A 5A33A 3V56A 4ATEA 1UPIA 1VBB2 2WNUA 4LHKA 3CJIA 1AYN2 1ZX5A 1YO8A 4DB5A 1GANA 3AYEA 3UKNA 2HWB2 1QWRA 4AFAA 1LR5A 3MFCA 3SH3A 1WW4A 1YJKA 1ZVFA 3AFKA 4LO7A 1MZFA 2PLV2 4MGYE 4RQPC 4FTSA 1YRZA 4Q4X1 5T5OA 4E2SA 4N7UA 1RUC2 1DU3D 2B45X 1K5MC 4GQ7A 4LBOA 2D6OX 2WFF1 2GZWA 4RA0A 2XLGA 4XJ8A 3JBG1 1J3RA 3GBFA 4OI0A 1FMD2 1Y7BA 1W6QA 3VKOA 1QH7A 3ST7A 4IERA 4K21A 1RUI3 2DCZA 4GB33 1LTEA 4BLIA 3D0JA 1H8TB 3M70A 1QXRA 3OBTA 1RVF1 4XYXA 3WV6A 4P9GA 4ZU7A 4YGBA 4AGRA 5CG9A 2Y0OA 2VW2A 2OZ6A 2X5IB 2XPJA 1CJDA 4COVA 1RUG1 3VBHC 3KMHA 1IS3A 2HEYF 1H8TA 1KD7A 2HWE3 1KQRA 2OZJA 2O8QA 4D7TA 2HWC3 4XFAA 5LRSA 1KJRA 2UURA 3MLLA 1VALA 2RHPA 3MW3A 4H7MA 1G9CA 1SLTA 4I3GA 5JSOA 3MIBA 2X5IA 3ZYRA 5BNNC 2RE9A 3DKWA 2WZR2 4XXAA 4M01A 5JOWA 2LALA 2ZX0A 4META 1WW5A 4YFWA 1MQTC 1GZWB 1N1TA 2R073 3RDIA 5BNQA 4R9AA 2DFCA 1HRI2 4JGZC 4K3UA 4BIOA 4AHXA 1LU1A 4BZ4A 2DYCA 4LEJA 1WCDJ 2RJKA 4OVEA 2ARBA 4AVSA 4AEDC 3H8UA 1GZWA 3RSJA 4CEWB 3ZYJB 1WBFA 3VUOA 3T1MA 4JC1A 4YZ1A 1ZZ9A 2X53S 3RWNA 3S6PA 1G9AA 1XU2A 1Q8PA 5ACA2 4UW3A 2YGMA 4N9HA 2MEV1 5T52A 1C57A 3APBA 4CEWA 2CWSA 2B5HA 4HT1T 1TME3 3UV9A 1UX6A 2UYBA 5KHIA 1OQEA 1R1A1 3VZJA 2WKKA 1EAH1 4XW3A 5JOYA 1VBE3 2UY9A 1RMU1 1V6NA 5T5LA 5FOJB 5GLWA 2WT1A 3DL3A 4LE4A 4GKXA 3H9AA 2RR12 5T50A 2YZ4A 1AL23 3MIGA 4AFCA 2EXIA 2XG3A 2GH2A 3PVOA 1KJLA 3HT2A 3ZIXA 4RGGA 2VUJA 2NMOA 3B7MA 3ZFGB 1Q8SA 4X8PA 4Y20A 3DPRC 3JQWA 4FOYA 5CVRA 4TZDA 1ONAA 1YFWA 5EV7A 5CADA 3MICA 2A5ZA 4FPYA 4I0WB 1MZ6A 1MS9A 3ZFGA 3ELNA 4B4QA 4UBGA 4GMP0 1OA2A 3VL8A 3V0BB 1NCQC 1FOD2 1ZBA2 1M06G 1FPN2 3VGIA 4JQRA 1YCIA 4Q8KA 1VAMA 4BA6A 1LJ7A 2BW8A 4QX5A 3ZDSA 1RINA 4YGEA 2K2SA 1H1MA 3BOPA 1ULDA 3V0BA 1L3JA 3ZXLA 1VRH1 4CDQC 2D3SA 3THPA 1BQPA 1KRIA 5F6KA 3CEWA 1AR61 1MEC3 4YNIA 1RUD3 2F4PA 4Z82A 3VZKA 5KXBA 1YI7A 2TNFA 2GNBA 5CIRA 3E5XA 3ZIWA 2QJVA 4Q4W3 3WINE 1J3QA 3L9JT 4N9IA 2Q8OA 5FREA 1GV9A 3MF9A 4FPEA 3WW3A 3AKPA 4AHWA 3R4UA 1RIRA 1NY71 2CYFA 4PDWB 4UXAA 4YW2A 3JD73 1LOAA 1AUYA 2RS12 1DGRA 3HAGA 4MV2A 3T2TA 2XUMA 3WHTA 2GAUA 1O3QA 1W6PA 2WFF2 3AJYA 3MPBA 3PHMA 3ENRA 4K8FA 4GWMA 3UKVA 2GH8A 2OVUA 4PDWA 1SLLA 3UL2A 4HK9A 3H7JA 4C1XA 1RC6A 1QJX1 2DUOA 2XVKA 5KHGA 3THTA 5DXDA 5LK7B 4RHV3 5CBLA 3CJXA 3AMQA 5AC92 3S7EA 1RVF2 2XWJB 4YW5A 3WD5A 1F2NA 5AFEA 4P9YA 3R4DB 5GLTA 2RM21 1Z7S3 1ZZ8A 5CFDC 1RUJ1 5HBAA 1ENQA 2NPIA 4I3PA 4RFT0 3SMHA 3G7DA 1EV12 1AR91 2D6KA 2V73A 4S2GA 2DF7A 3ZFEB 1Y43B 3RYPA 2RS31 4PQ9A 3B94A 5FO8B 4I30A 1PIV2 1X50A 2ZGTA 1QJU3 2HWF1 1HRV1 1AHSA 2VG9A 4RR3B 5HCFA 2QZ2A 4QPIB 3O12A 2ZZJA 3HIFA 1NLRA 1ZZBA 4QQ2A 4Q1PA 1ASJ2 2EXJA 1R083 4JDMA 3FBYA 3ETQA 4NHLA 4KG8A 1PO12 4Y1VA 4BMEA 4RR3A 5JSPA 1DYPA 2CNAA 3I7DA 3M4FA 4OULA 4QPIA 1WMEA 2XJVA 2VW0A 4OI2A 3IWZA 1Q8VA 1RB8G 2MEV2 1I5ZA 4AVAA 4PLNA 4XJZA 2Z79A 3JUUA 3NW4A 5FQ0B 5I0TA 2DVAA 5CG8A 1R1A2 4TYSA 2FZ2A 1MR5A 1COV3 5FTTC 5GZFA 4DZGA 1RUE3 1RMU2 1RTVA 3NJZA 4QQHA 3ZSEA 1PGSA 4XFCA 1Z78A 3O7OA 3B5LB 5FQ0A 2C9AA 2ZBJA 4OI4A 5KC5A 4GA9A 1LEMA 1JYCA 3OY8B 1A3KA 2LM3A 3NO8A 4GMP3 4GXLA 4Z92B 1HDKA 5FAXA 3WX5A 1U12A 1VBC1 3LSDA 4UW6A 1QQP1 4B29A 2ILMA 3NV2A 2F6BA 4QM9A 1S0IA 3RZZA 3OY8A 3EJKA 4WVZA 5I8SA 2FZ1A 1PGW2 1SMVA 4YVSC 3B3QE 4QM8A 3QBQA 5JAXA 5BXXA 4AVCA 1TMF1 4IEZA 4MYEA 4O9GA 1FNZA 1JN2P 2W39A 1S0EA 2YGLA 4HFSA 5GZCA 1Y9QA 2D6NA 3TBDA 4YZ4A 4YZ3A 1OKQA 2PA7A 4FPKA 3H3ZA 3ZFFC 3WDYA 4CDWB 4DINB 3GHNA 3MIEA 1VBA1 2Z5WA 5ABJC 1OI6A 2ZAHA 3ZSJA 5FLJA 5BNPC 2JG9B 1RGSA 4IV3C 4Q4X3 4BPZA 2RMU1 4AQTA 1SFYA 1TNFA 4WM7C 1OD5A 3D6EA 1OOPB 4JAAA 1TQ5A 1DFQA 2JG9A 2GMPA 4KH9A 3JBG3 1OA3A 1JBCA 1T6GC 1KFUL 2VECA 5JDBA 2OPKA 1XYNA 1ULCA 2P3JA 1MS5A 1OOPA 4OUSA 3BU7A 1D0GA 1UL9A 3JB8A 1S0JA 1SLIA 4ASLA 1QNWA 1WD3A 1LENA 2ETEA 2Q0AA 4IEWA 2GC2A 3VBSB 5C6CA 1JUIA 1G7YA 1IQAA 2ZMKA 3DUIA 3C2UA 4R4XA 1Y3TA 1RUG3 4Y1YA 4DNYA 1YFUA 1H0BA 2R16A 4CP2A 4C91A 2XBO1 1FATA 4L2NA 3VBSA 2R062 4RL7A 5DZGA 1FYUA 3LKJA 1ZZ7A 5EXOA 1A6CA 1EYBA 1OFNA 1VBD2 3WW1A 4DS0A 4LLFA 4NWWA 3GYDA 1YYNA 3AK0A 1RUJ2 4PIZA 1B35C 2WA4A 4CTEA 4JV4A 1AR92 2R49A 1W6NB 2ZGSA 1PM7A 5BUVA 3OPZA 4JCKA 2VGDA 1O4YA 2RS52 3H1YA 5H9RA 4HPKB 1BEV3 5KC6A 1HRV2 1H30A 1H9PA 3GF6A 4O9EA 4WZCA 4FP2A 4MZUA 2OW4A 4C0HA 1GZ9A 1VBB1 3AKQA 3BIWE 2W08A 1ZRCA 1AYN1 2ET1A 4LBMA 1B09A 3KSCA 1DGWX 4YSFA 1ENXA 3NL1A 3WUDA 4NHMA 5I0SA 5JPMB 2HWB1 1H1AA 4E4ZA 5JZGB 2Q1ZB 4P9WA 4HN1A 2WQ4A 1BBT2 3ZSMA 3J8F2 2PLV1 5D8AC 1EAH3 2A73B 2ZACA 5BNOC 4KWLA 1UAIA 3IKWA 1REFA 1WD4A 2ZTNA 2ZGQA 4N43C 5JZGA 1HXS2 3IDCB 1PO23 3QH6A 3RMXA 3ZXKA 5K0UB 4FO9A 4PIXA 3RI8A 2OUHA 4JDNA 2VNOA 2HWD1 4HBNA 1FMD1 2Z2SB 1X36A 4KGQA 2XJSA 2P2KA 3WDWA 4B7KA 3BPZA 4TWTA 3HT1A 4RS5C 5K0UA 2G9FA 5C33A 4P5HA 4ZXKA 4X6RB 4XHBA 4FPFA 4P14A 1D4M1 4XF4A 1VBC2 1FX5A 1QQP2 2E53A 1QXJA 1MACA 4N90A 3ES4A 3S0MA 1I3HA 3B02A 1CQ9A 2DVDA 5FFOC 1CONA 4LUMA 1JHNA 4I2OA 1WCKA 4AQ6A 4CP1A 4LO6B 4PCRA 3PVBB 2WZR1 3AP7A 2XJTA 1OSGA 4NPRA 1VRH3 4XTMA 2WNUC 2E6VA 2ZCWA 3CJIC 4AI1A 3WG1A 1HRI1 2VMHA 3ME2A 1XYPA 4QQPA 4M00A 1HQLA 3E6BA 1AR63 3M3QA 1Q8QA 3N7JA 4XFGA 3ZXAC 1NYWA 4KU7A 5LK5A 1AJOA 4WV8A 3IM0A 3WP5A 1PVC1 4OZXA 3FC0A 4MSVA 4AI8A 4L99A 3EO6A 1FV3A 3U0ZA 1XE8A 5K8SA 2JJ6A 5KXDA 4HZFA 2KM2A 5IT6A 2RMU2 1VLNA 1DF0A 3M8LA 4Z1VA 4WZFA 1PZ8A 2GN7A 3E6DA 3B93A 4KQ7A 3VZNA 2D40A 3ZXGA 1QJX3 2IXJA 3AP4A 2ZZQA 4UBHA 4AVVA 2D7FA 3VBRB 2BPA2 1G6NA 1WBLA 3NAPB 4Q27A 3FX3A 1H8TC 4AQSA 5JI7A 5FPZA 1HX6A 1LRHA 3B9CA 4ITCA 5CB7A 4JGYB 1CAVB 2XLFA 2RM23 3OBRA 2JG8C 2X5IC 3PVEA 4IEXA 1O4ZA 5BV6A 4Q0UA 1WLTA 4XFIA 2NLRA 1AR93 4Q0SA 4WVVA 3S7IA 4Z8BA 1MS4A 3OGGA 4Z07A 4JGYA 3P3PA 3VV1A 2QE3A 1CAVA 2RS33 3CL1A 4FQZA 4HKOA 5JIAA 3VBFB 4BOWA 4H3WA 5EFUA 1DZTA 1FOD1 4HK8A 1FPN1 4EN0A 2Q4SA 2HWF3 1XNKA 2R30A 1VR3A 4R9BA 4ORFA 3WP4A 2IXHA 2R1DA 1BKZA 2XJQA 4Q4V2 2NM1A 4XBQA 2ZJCA 3TOJA 3VBFA 3WDVA 2XH6A 5DDJ2 3RPQA 2B39A 3IIAA 1DHKB 2E7QA 3EQEA 2YHJA 4LA2A 4GIQA 5CFCB 4CEWC 1OHFA 4N53C 3Q9OA 1R091 2LUWA 3JB4C 3FLTA 4F7ZA 2IZWA 2Y0IA 1LB2A 1W0PA 4Y22A 4FPCA 1AJKA 2DU0A 4HL0A 2WSUA 3AYAA 1AX0A 3NV4A 4WBBA 4YZ5A 2JKBA 3SXWA 3WW2A 4PBPA 3L2HA 1X33A 3R4SA 4H7LA 4LHNA 4MGIE 3M3CA 3WQ7A 5I91A 2YYOA 2RS11 1MVQA 2A3WA 1URXA 1GQHA 3AX4A 2JE9A 4LBKA 1DG6A 3WP3A 2PHTA 3MYXA 2HJIA 4RSUA 1LCLA 2HWD2 2GSYA 1NA1C 1S0GA 4PJYA 4CEYB 3ZFGC 1GKBA 3IPVB 5KBFA 3CNAA 5J48A 5H9SA 5AC91 1LESA 4OHZA 3W58A 4WM8B 5T5JA 4R4ZA 1TE1B 3ZN5A 1D0HA 4NHKA 4ATFA 4LA3A 4QPGB 5C8CC 4KL1A 1D4M2 4OHYA 4CEYA 3IPVA 1AZDA 3KLSA 1G8WA 5IK8A 1H2LA 1IGOA 5C9AB 1LU2A 4WM8A 4XTPA 1CAUB 1NQJA 1TMF3 3UJOA 1DGWA 4QPGA 1AXZA 1EV11 1LOBA 2CGOA 2ZHLA 3TNQA 1PNGA 3VBUB 1GNHA 1C1FA 4LBJA 2ZA9A 1GSLA 1ENSA 4E9KA 1PIV1 1BYHA 2QCSB 2D6MA 4YVWC 1J1TA 2H6CA 4IEQA 1CAUA 4BIFA 4ZU4A 1QJY1 1VBA3 4LBNA 3MZHA 3ZPYA 4R9DA 1Q43A 4LNVA 1ASJ1 5A3LA 2DCTA 2XLAA 1I6XA 2D44A 1X82A 3ACLA 4IXLA 1PO11 2R32A 2RMU3 4CDXB 4L97A 3J9SA 1VAVA 1DBNA 4P9JA 1PVC2 5FLHA 1C8M2 1HV1A 1AX2A 1QY4A 1R1ZA 2DU1A 3GHMA 3WXPA 4Q4Y3 1GR3A 2WZPP 4L9BA 4UW5A 1BMV2 3B9IA 4CDXA 1XXNA 4M0HA 4PDWC 3HMYA 2IXIA 4D7YA 3IDEA 2OIIA 2YROA 2BFUS 3RI9A 2VUAA 4LBQD 5J7MA 2PHUA 2FHRA 2MHFA 2BUKA 1LOFA 5AVAA 2DVGA 1MZ5A 1AYM2 3E5QA 5FO7B 4CDUB 4K6BA 3KGLA 4XF9A 2XBO3 4FAHA 2P37A 4RQPB 1VP6A 4GWNA 3SHRA 4NR1A 2ZMLA 2DCYA 4IEYA 4TLFA 5DG2A 4HKLA 4W65A 4Y4YA 4CDUA 4FAGA 2VNRA 4FSJA 1GBGA 3WNXA 1YNAA 1MS8A 1WW6A 4RQPA 4E2GA 1PGW1 4LUKA 3MIFA 2WNVB 4AW7A 1KDMA 1WGPA 3SCHA 2WLPA 4KWKA 1DQ6A 1UD1A 4RD7A 4YW1A 2P3KA 3VBOB 5FOBB 3OD4A 2GMEA 4AEKA 1ZBE2 2WNVA 1AVBA 5T55A 4AFBA 1AR83 5EYXA 4ZU5A 1S1AA 1VBB3 1W2UA 2DCJA 4QPIC 1LHWA 1AYN3 1UU4A 1UZZA 4YG3A 3VBHB 3VBOA 1V00A 1XYOA 2HWB3 2PHDA 2WA3A 3J26N 2BEOA 3AP9A 4X8NA 2KXLA 2PLV3 1R092 2Q1MA 2VNGA 4AXOA 1J59A 5BNNB 3IT8A 1VAKA 3VBHA 4FQ4A 1RUC3 4FPJA 5KWRA 5FDBA 1MQTB 5KHJA 3WLUA 4S2DA 4JGZB 4M3CF 4DY3A 3W9AA 5JMCA 2D98A 3WDTA 4DPNA 1N3PA 2PAKA 1FMD3 1NXMA 2BFUL 1XQNA 2GDFA 1MQTA 4AEDB 4YZ2A 1RUF2 4URTA 3H7YA 1MS3A 4DXZA 1N1SA 3WY6A 1UCXA 1POV1 1BVVA 4COZA 1Q56A 1D4M3 4MXWB 4AEDA 1EPWA 2WINB 5AFBA 4Y1ZA 2EA7A 3VHRA 4DQAA 2WT2A 4INDA 2JD4A 3U11A 3WG4A 1GFF2 3AKRA 2MNGA 2DVBA 3AZYA 3M7AA 2R061 4JDOA 4AI3A 4MXWA 4IEOA 2B8MA 4QT6A 1VBD1 2WZR3 4K40A 4EN8B 3DN7A 4Q2FA 3OTFA 3LOBA 1F5FA 3H0OA 2QUOA 3VHOA 1HRI3 3GNEA 3E5UA 3KCYA 3DPRB 2VVDA 1A78A 2RS51 5IUQA 3RJ2X 3IMNA 4Y26A 3URFA 1U0AA 2FMYA 2I07B 3KT7A 4XDQA 4J1XA 4AFMA 4M3CB 5I8TA 1QJY2 5E1RA 2MPFA 3ZFEA 1H1IA 1ZYBA 1UZYA 5ACA3 3DPRA 3VKFC 4SLIA 2ET7A 1ZZCA 4JTOA 3VKLA 4K1YA 1RUH1 2JG9C 3HQXA 2ZX1A 1IKQA 4M3CA 2NZ9A 4OI1A 1BBT1 3J8F1 4Z2WA 2D3PA 3AXEA 3O0VA 2QZ3A 1IOAA 4DFSA 5IK7A 1IZ3A 2WL1A 3SISA 3VZMA 2DURA 4DOUA 1UW8A 1SLBA 1ZNPA 2RR13 1OPMA 4XQWA 4CDQB 5JSRA 1C8NA 1HXS1 3WDUA 3ROUA 4Y1XA 3KZ4C 5JLVA 4K7JA 3LA7A 3MDPA 5BY5A 1TEIA 1V6JA 1W0OA 3M3OA 5LEJA 2Z69A 2HYKA 3MFAA 4CDQA 1OLQA 3JCIA 3LSEA 3O0WA 2UY8A 2B46X 1NCRC 3U4XA 1NE4A 1LGCA 2R042 3VBSC 2VMIA 5IK5A 1RHI2 3GBGA 4EWAA 5GLZA 2DTYA 5GZDA 2YPJA 1ULEA 5SV8A 2ZGNA 3FJSA 2CGPA 5L19A 3HWJA 2XKPA 3SNMA 2ZS6B 1WMDA 3H1WA 1QOTA 1ND3C 1OFSA 4JRLA 3WT3A 2A7AA 2Y26A 1FOD3 1ZBA3 4YM1A 1FPN3 1UIJA 1APNA 4OLLA 3WR0A 1O91A 1Q3EA 1Q8OA 3WUCA 5F9TA 2BBVA 4NOTA 1V9U1 2ZABA 1W39A 2R0HA 2GU9A 2PYTA 1U5ZA 4AGVA 2YUEA 5KXEA 3NVCA 3ZMNA 3HBZA 1RUI1 2IFRA 4GB31 3ES1A 4M3CE 1S0CA 5I93A 1QDOA 2LTNA 4HVRA 3I2DA 3ZXJA 3K48A 1VB2A 5CFDB 1C4RA 4AI0A 3AKSA 5AVPA 4MLOA 2GNDA 2HWC1 4ISQA 4MH0E 1UU5A 3I59B 1LECA 3LAGA 2WS92 3HN1A 5DUWA 4CDWA 5CFDA