1XEBA

Crystal structure of an acyl-coa n-acyltransferase from pseudomonas aeruginosa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
149
structure length
149
Chain Sequence
b'SLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLDLVGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQAAERLWLDTPVYLSAQAHLQAYYGRYGFVAVTEVYLEDDIPHIGMRRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA0115
publication title The crystal structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 39
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1xebA00
3V8IA 4PK3A 1KZFA 4H6UA 1N71A 1XEBA 4MBUA 4L8AA 2RC4A 2P0WA 2IL4A 2ATRA 3I9SA 2QIRA 4OLLA 1VKCA 5F49A 2C27A 4UA3A 2R8VA 5GCNA 3CXSA 4F0YA 4KOSA 5F47A 5E96A 2NMTA 3R95A 4J3GA 4X5KA 3W6SA 5KTCA 1M4IA 3GKRA 3LD2A 1S7NA 3TO6A 4KOXA 2HUZA 3BJ8A 3QB8A 2JLMA 2FL4A 2B3VA 3DNSA 3G8WA 1S3ZA 2B4DB 4R57A 4H6ZA 2Q4VA 2I79A 4ZBGA 1VHSA 4ONUA 2VI7A 3H4QA 2P6EA 4CRZB 2VQYA 1PU9A 2JDDA 1M1DA 1GHEA 1YK3A 4OADA 5KTAA 1U6MA 4CAXA 4ORFA 5F48A 3E0KA 4H89A 3P2HA 1NE9A 4NCZA 3EY5A 3TO7A 4FD4A 3ZJ0A 3P2FA 4Y49C 1Z4EA 3TT2A 4F6AA 5J8FA 5DWMA 2BUEA 4QBJA 4FD7A 4AB7A 4NEXA 3S6KA 1I1DA 1TIQA 1WWZA 5I0CA 4PV6A 3I3GA 2J8RA 3R1KA 4XPKA 1QSOA 1K4JA 1WK4A 4AG7A 2CNTA 2GIVA 2FXFA 4AVAA 4JWPA 4M3SA 1BOBA 3SHPA 2FCKA 2FSRA 3EO4A 2I00A 3T9YA 2ZW6A 3F0AA 5HH1A 1IICA 4LX9A 4OAEA 4B5OA 4E2AA 1RXTA 3TTHA 3VWDA 1OZPA 3NE7A 2G0BA 2EVNA 1P0HA 2R7HA 1CJWA 1IB1E 3OWCA 4DNCA 1S7LA 3F5BA 1YR0A 4BMHA 4EVYA 5CNPA 2A4NA 1BO4A 1IYLA 4PSWA 3PP9A 5IV0A 4YRHA 3W6XA 3SXNA 4FD6A 2FIWA 1MJ9A 3KKWA 4KLWA 3TE4A 4KUAA 2ARHA 4KOVA 5JQ4A 2ZW4A 2Y0MA 2OZGA 1MJAA 4CRYB 4KVOE 3R9FA 1Y7RA 4PK2A 2D4PA 2WPXA 3FB3A 5C88A 3SXOA 3IGRA 5EC4A 3GYAA 1XE4A 4RI1A 4JJXA 5EBVA 3K9UA 2VZYA 4MJ8A 4XPDC 3D3SA 3DSBA 1KUXA 3FNCA 1XIXA 3W91A 5H84A 2DXQA 3TOBA 1IIDA 2R98A 2B4BA 1M4GA 2B4DA 5KTDA 4XNHC 2BEIA 3R96A 5C82A 1YVKA 4HNWB 3UY5A 1ON0A 1B87A 2P6FA 2GE3A 1QSNA 4B5PB 1KUVA 4GS4A 4L89A 4E0AA 2CNMA 2VBQA 3EXNA 2BL1A 1Y9WA 4XPDB 3FXTA 4II9A 1RO5A 1NMTA 3FIXA 5HMNA 2B3UA 1Y9KA 2FE7A 4HNXB 2PQ8A 3C26A 4IF5A 1Z9UA 4NXYA 3FRMA 2VZZA 2ZW5A 4KUBA 3R9GA 4KVME 5H86A 2CY2A 3D2MA 1FY7A 2G3AA 4XNHB 1Q2DA 3QAHA 3JUWA 1KUYA 1S5KA 2X7BA 3EC4A 3IWGA 4UWJA 4KZTA 2GANA 4MY3A 2K5TA 1Z4RA 3PGPA 2JDCA 4R3KA 1QSMA 2AE6A 1SQHA 3DR6A 1Q2YA 5IB0A 2B5GA 4LUAA 2PR8A 2J8NA 2QMLA 5F46A 3FYNA 1MK4A 3S6FA 5ISVA 4YFJA 2REEA 1P4NA 2BSWA 2H5MA 4XPLA 2Q7BA 3LODA 4KVXA 4QC6A 4AG9A 1M44A 2G3TA 1UFHA 3TO9A 1QSTA 4FD5A 1XF8A 1Q2CA 2Z0ZA 4KOYA 4JLYA 4CS0B 2ZW7A 2FT0A 3B8GA 2Q44A 3DR8A 4E8OA 3TFYA 1B6BA 2P6GA 4I49A 4RS2A 4R87A 4KORA 4MY0A 4PSXA 2CNSA 4U5YA 3MGDA 3EFAA 3WR7A 4IUSA 1NSLA 4U9YA 2QECA 4YGOA 5FVJA 4KLVA 1MJBA 1PUAA 3CXPA 4HKFA 2PC1A 2KCWA 2PSWA 3N7ZA 2JEVA 1LRZA 2HQYA 4KOUA 3S6GA 2Q0YA 2HV2A 4UBRA 2J8MA 4CAVA 1R57A 1QSRA 4QVTA 4NF1A 2OU2A 4JD6A 4KOTA 3F8KA 2OB0A 5J8CA 4JXRA 3FBUA 1J4JA 5IX3A 5JPHA 4CAWA 3D8PA 1S60A 2AJ6A 1YGHA 3ZZIA 4MI4A 2PR1A 2FIAA 4QB9A 1I21A 2VEZA 1IYKA 5DWNA 2OZUA 4AVCA 1YVOA 4JXQA 2O28A 2Q04A 3DDDA 2ZXVA 2D4OA 2PRBA 4QUSA 1M4DA 3BLNA 3TOAA 4B5PA 2F5IA 1YX0A 1I12A 1YREA 1S7FA 3G3SA 4NSQA 4HNYB 2ZPAA 4MHDA 3R9EA 2REFA 1XMTA 1L0CA 3RYOA 2Q4YA 1V0CA 4KOWA 1S7KA 3PZJA 4AVBA 3TCVA 4K30A 2B5GB 2Z10A 2EUIA 3JVNA 2PDOA 2WPWA 4UWIA 2Z11A 3T90A 3BJ7A 1YLEA 4M85A 4R9MA 2OZHA 4Y49B 4R3LA 2OH1A 2R1IA 3S6HA 4U9ZA 2FS5A 1CM0A 3GY9A 3CXQA 3D2PA 2VXKA 2B58A 3VWEA
chains in the Genus database with same CATH superfamily
1R43A 3V8IA 4PK3A 1KZFA 4H6UA 1N71A 3FH4A 1XEBA 4MBUA 3KR5A 4NJQA 4L8AA 2C6PA 1VGYA 4P4DA 2RC4A 2P0WA 2IL4A 3RZAA 5AG4A 1TF8A 3KHXA 3VATA 2ATRA 3I9SA 3JRUA 1YW6A 3SJGA 2QIRA 2ZEOA 4OLLA 4R6TA 1VKCA 2PCUA 5F49A 2C27A 4UA3A 2R8VA 5GCNA 1DTDA 2DEAA 3CXSA 1PYTB 4KOSA 5F47A 4F0YA 4H2KA 3PBBA 5DS0A 5E96A 5LRKA 2NMTA 4A39A 3R95A 6CPAA 2Z3KA 4J3GA 3BXMA 4X5KA 5LYDA 3W6SA 5KTCA 1CG2A 1YMEA 1M4IA 3GKRA 3LWUA 1Z8WA 4MRIA 4P44A 4M6HA 3LD2A 4MCSA 2PJ0A 5IB9A 1S7NA 2EK8A 3TO6A 4KOXA 3WC5A 3K9TA 2HUZA 3BJ8A 4CGLA 4C2ZA 3KQXA 3QB8A 4KSAA 2JLMA 4EWTA 1VHEA 2YGWA 2FL4A 2B3VA 4CAEA 3B3TA 3BHXA 4CGNA 3DNSA 3G8WA 1S3ZA 2B4DB 3KR4A 4R57A 4NGQA 3H8FA 2YNCA 4H6ZA 1LOKA 2Q4VA 4F0XA 2I79A 5G22A 4ZBGA 1VHSA 4ONUA 1CX8A 2XEFA 5A28A 5I4MA 3IWWA 2VI7A 2V77A 4ZY1A 3H4QA 2P6EA 2BCOA 4CRZB 2PJ6A 4UCMA 2VQYA 3WABA 1PU9A 3D7FA 2JDDA 1M1DA 2JBJA 1UWYA 3KGQA 1GHEA 3B3WA 1YK3A 4OADA 4MCQA 5KTAA 1U6MA 4CAXA 4ORFA 5F48A 3E0KA 4C2YA 5HVGA 3S9NA 2V8HA 3I1UA 4H89A 3P2HA 1NE9A 4PQAA 5JGFA 3B3CA 4NCZA 3EY5A 4PXDA 2Z3OA 3TO7A 4FAIA 4FD4A 3ZJ0A 3P2FA 1ARLA 4Y49C 1Z4EA 1CPSA 3TT2A 4F6AA 4C7IA 4NGTA 5DWMA 5J8FA 2BUEA 3V38A 3MN8A 4QBJA 2PJ2A 2PVVA 4FD7A 4AB7A 4NEXA 3S6KA 3CPXA 3PEIA 4A30A 3GLJA 1I1DA 1TIQA 2PJCA 2ZEMA 4R7MA 1WWZA 5I0CA 4FBEA 4BD9A 4PV6A 1ARMA 1IY7A 1YSJA 3I3GA 1QQ9A 2J8RA 4MFPA 4MCPA 1AMPA 3PBEA 4A38A 4ZX8A 4OC4A 1CP7A 3R1KA 4XPKA 1QSOA 1K4JA 1WK4A 3T8WA 2AFUA 4OIDA 1JWQA 3SJEA 3SI1A 4AG7A 3IFEA 4A2ZA 3KZWA 2CNTA 2GIVA 2HB6A 2FXFA 5JH9A 2CIJA 4AVAA 4JWPA 4M3SA 1BOBA 3HUVA 3SHPA 2FCKA 2FSRA 3EO4A 3IU2A 2I00A 4OMEA 3T9YA 2ZW6A 5HXDA 1DE4C 3F0AA 5HH1A 4NJRA 1IICA 4LX9A 4OAEA 2IMOA 1ZG7A 4B5OA 4C7HA 1RXTA 2WYRA 2BO9A 4E2AA 1LCPA 2XEIA 3TTHA 3VWDA 1OZPA 3NE7A 4R8FA 2G0BA 3NA6A 2EVNA 2GLFA 3V7ZA 1P0HA 2R7HA 1YW4A 1KWMA 4RN7A 1NSAA 1OBRA 1CJWA 1IB1E 3B7IA 4DJLA 3OWCA 4DNCA 1S7LA 3F5BA 1YR0A 4BMHA 4EVYA 3IJ3A 1FNOA 5CNPA 1YLOA 3BI0A 2A4NA 1BO4A 1IYLA 3D7HA 4MFZA 1XFOA 4OC0A 3FF3A 4P6YA 4PSWA 5J1QA 3NH5A 5JM6A 3FEEA 3PP9A 5LYLA 2QVPA 4WWVA 5IV0A 4MFLA 4YRHA 1JQGA 3W6XA 3SXNA 1Y7EA 4FD6A 2FIWA 1MJ9A 2WSAA 3KKWA 2G9DA 4KLWA 4KUAA 3H5ZA 3TE4A 2ARHA 1FT7A 4KOVA 4FUUA 5JQ4A 2ZW4A 1ZG9A 2Y0MA 1HEEA 4UIAA 2OZGA 3SJFA 4BINA 1MJAA 4CRYB 4A95A 4KVOE 5ELYA 1Y7RA 3R9FA 4PK2A 2AFXA 5CBMA 2PE3A 2D4PA 2V8DA 2WPXA 1Z8LA 2Q4ZA 3FB3A 4KS9A 2YNEA 5C88A 1F2PA 3IEHA 5LYIA 4M6IA 7CPAA 3SXOA 5CPAA 4UEZA 3IGRA 3B3SA 4NFRA 5EC4A 3GYAA 3PRTA 1XE4A 4UIBA 3N5FA 5G1ZA 4NGPA 4RI1A 2PJ3A 2WZNA 4CGPA 4JJXA 3FX6A 5EBVA 3NFZA 2PJ1A 4OKOA 3K9UA 3S9LA 2VZYA 2ZENA 3SI2A 2ZOFA 2F8HA 4MJ8A 4XPDC 3D3SA 3D4UA 3DSBA 1KUXA 2AFZA 4MXUA 3FNCA 1XOVA 1XRYA 3KHZA 1XIXA 4BBHA 3W91A 2Z3PA 4B11A 1Y0RA 3GUXA 5H84A 1A2ZA 3RNZA 2DXQA 3TOBA 1IIDA 3FJUA 4IAVA 5HVHA 2R98A 2RFHA 2CF4A 1R3NA 2PJ5A 3BI1A 2B4BA 4HPSA 1ELLP 4P10A 1M4GA 3B3VA 5AG7A 1F2OA 2B4DA 5KTDA 2AFOA 4XNHC 1AUGA 2BEIA 4UEFA 3R96A 4A32A 5C82A 1YVKA 1LAMA 4LQGA 2ABZA 2AFWA 2IJZA 3NE8A 2C1CA 2DPSA 4P4BA 4HNWB 3UY5A 4B10A 4DYOA 4JZ0A 1ON0A 1ZG8A 1B87A 3ISXA 2P6FA 2GE3A 1QSNA 3IO1A 3D67A 1X10A 4KSFA 4B5PB 3H8EA 4MFQA 4Q38A 2ZEFA 1KUVA 1IOFA 2NSMA 3ISZA 4GS4A 4L89A 2CNMA 4P4EA 1HDUA 4E0AA 4P4FA 2AFSA 2Q7SA 2VBQA 3EXNA 3D68A 1EE3P 1Z2LA 2BL1A 1Y9WA 3NH8A 4XPDB 3FXTA 3IIBA 1RO5A 3PFOA 1NMTA 4M6GA 4MFJA 4II9A 3FIXA 5HMNA 3K2KA 2B3UA 1Y9KA 2FE7A 4CYQA 4HNXB 2PQ8A 3PB7X 3RAMA 3C26A 2CTBA 4IF5A 2PVWA 1Z9UA 4WJBA 4NXYA 3FRMA 1Z5RA 2PJBA 2VZZA 2ZW5A 4KUBA 2IQ6A 4B13A 3IWEA 4GXHA 3RBUA 3R9GA 4KVME 5H86A 1Q7LA 3HLPA 2CY2A 1BAVA 4KSIA 3D2MA 1TXRA 1FY7A 3TX8A 3IC1A 5ISVA 2G3AA 1TKFA 4XNHB 4CGMA 1ZO0A 1Q2DA 2GU2A 3QAHA 5K8OA 2XEJA 3JUWA 3PB4X 1KUYA 3WC7A 2ZEPA 4B6ZA 1S5KA 2O53A 4MHYA 2YNCC 2CTCA 2X7BA 5HVFA 3EC4A 3IWGA 4UWJA 4KZTA 2GANA 4OIWA 2PJ8A 1CPXA 4W9YA 4OC2A 4FWUA 4ZGYB 4MY3A 4LQ6A 5AGEA 4Q7AA 1LAPA 2K5TA 3VARA 2Z3MA 1PCAA 1Z4RA 3PGPA 2JDCA 2PRQA 1AYEA 4R3KA 1QSMA 2AE6A 3TC8A 3A9LA 1SQHA 2PIYA 1Q2YA 3DR6A 4G1PA 5IB0A 2B5GA 4LUAA 3VH9A 3WC6A 2PR8A 1F57A 2J8NA 2OOTA 4CYOA 2QMLA 5F46A 3FYNA 1MK4A 1ELMP 1QMUA 3S6FA 2Z3NA 3PB9X 3WT4A 5K8NA 3NH4A 5D29A 1CBXA 4PXCA 3H8GA 4YFJA 4P4IA 2REEA 5F09A 1TKJA 1P4NA 4PXEA 5EMIA 2BSWA 2H5MA 4XPLA 2Q7BA 3L2NA 4IK2A 3GIUA 3LODA 1RTQA 2Q51A 3KQZA 4KVXA 4QC6A 4AG9A 4AXVA 1M44A 2G3TA 2RB7A 1UFHA 2GREA 1QSTA 3D66A 3KI9A 4FD5A 2ZOGA 1XF8A 3TO9A 4B5PA 1Q2CA 1VHOA 2Z0ZA 1Z8XA 3FVLA 2AFMA 4JLYA 4KOYA 2ZW7A 4CS0B 1X12A 2FT0A 4C2XA 1XJOA 3LMSA 3B8GA 2Q44A 5AG5A 3RO0A 3DR8A 4E8OA 2EO8A 2V8GA 3TFYA 1B6BA 2P6GA 4I49A 4MHNA 4RS2A 4DUKA 2GLJA 4NGNA 4F9UA 4R87A 4KORA 4MY0A 1GYTA 5G20A 2V8VA 5THWA 4A33A 4C68A 4PSXA 2CNSA 2PJ9A 4U5YA 4UFXA 4UEEA 4A37A 2EBJA 2Z3LA 3CPAA 3MGDA 4A94A 3EFAA 1TF9A 3WR7A 4IUSA 5A27A 1NSLA 4U9YA 2GFQA 2QECA 1BPMA 2ZEEA 4K3NA 2PJ7A 4YGOA 5FVJA 4NGRA 2PIZA 3CZXA 1H8LA 4KLVA 4R76A 1MJBA 1TKHA 3CT9A 2O4HA 1PUAA 1CP6A 3CXPA 4HKFA 2PC1A 4ZY0A 2KCWA 2PSWA 3N7ZA 2JEVA 1LRZA 3PFEA 4P4JA 2HQYA 4KOUA 3S6GA 2Q0YA 1LFWA 2HV2A 3QNVA 4UBRA 2J8MA 1ZLHA 3D7DA 3SI0A 4CAVA 1R57A 4ZY2A 1QSRA 4QVTA 2EWBA 2ZEHA 4NF1A 4ZI6A 2OU2A 4JD6A 4KOTA 4YU9A 3F8KA 2OB0A 5J8CA 4GM5A 4JXRA 4EMEA 4Q36A 4MFKA 5G21A 3FMCA 3FBUA 1J4JA 2CXAA 5IX3A 3D7GA 5BWAB 4B14A 3IU1A 5JPHA 1Z8TA 4CAWA 1LANA 1M4LA 2ZELA 3D8PA 4CGOA 2J9AA 2OR4A 1S60A 1BPNA 2AJ6A 3DLJA 1YGHA 3ZZIA 4F8ZA 4MI4A 2PR1A 2FIAA 4ONWA 3PB6X 4QB9A 5LYFA 1I21A 2VEZA 2ANPA 1IYKA 5DWNA 1IU8A 4YWYA 2OZUA 3CDXA 1YVOA 4AVCA 3FEDA 3SJXA 5LRJA 4PPZA 4UCNA 2PJ4A 1HDQA 4TWEA 4JXQA 2O28A 2NYQA 4MHZA 2DPTA 4NGMA 2JBKA 2Q04A 3DDDA 4CAFA 2ZXVA 2D4OA 2PRBA 4QUSA 4IHMA 1M4DA 3BLNA 4MCRA 4P45A 3DGVA 3TOAA 5LRGA 2PJAA 1IOIA 1ZLIA 2F5IA 4MMOA 1YX0A 3KASA 4O23A 4A31A 1I12A 1YREA 2Q43A 3JTKA 1S7FA 1YQEA 3G3SA 3B35A 2C6GA 5K8PA 4NSQA 4Z65A 4HNYB 4ZYQA 2ZPAA 4MHDA 4X3RA 3R9EA 2REFA 4MHPA 5K8MA 1XMTA 2POKA 4CPAA 8CPAA 3MRUA 2WUUA 2XEGA 1L0CA 3RYOA 4PXBA 2Q4YA 3QAYA 1V0CA 3GB0A 4KOWA 1BLLE 1IGBA 4UFVA 1S7KA 3PZJA 4X2TA 2EK9A 4UCPA 4AVBA 2VL1A 2DF5A 4OC5A 4X8IA 3TCVA 4K30A 2B5GB 2Z10A 2EUIA 5AG6A 2QYVA 3JVNA 2PDOA 2WPWA 4UWIA 5D8NA 2I3CA 2Z11A 4NGSA 4CYNA 4F9VA 3KL9A 3LACA 4OP4A 3T90A 3FECA 4OC1A 4CYPA 3BJ7A 1YLEA 2ZEGA 4UFWA 4EFDA 4M85A 4R9MA 2OZHA 3S9MA 4Y49B 4R3LA 2ODFA 2OH1A 2ZEDA 1XMBA 4JYWA 2R1IA 4TNUA 3S6HA 4U9ZA 2JEWA 2FS5A 1Y0YA 2QJ8A 2F7VA 2FVGA 1CM0A 4OC3A 1XBUA 4UF4A 3GY9A 2C6CA 3CXQA 3PB8X 1VIXA 2HC9A 2BOAA 3B2YA 4RUHA 3D2PA 2VXKA 2B58A 4ZX9A 4B12A 3VWEA 2YNDA
chains in the Genus database with same CATH topology
3V8IA 4PK3A 1KZFA 4H6UA 1N71A 1XEBA 4MBUA 4L8AA 2RC4A 2P0WA 2IL4A 5AG4A 2ATRA 3I9SA 2QIRA 4OLLA 1VKCA 5F49A 2C27A 4UA3A 2R8VA 5GCNA 3CXSA 4F0YA 4KOSA 5F47A 5E96A 2NMTA 3R95A 2Z3KA 4J3GA 4X5KA 3W6SA 5KTCA 1M4IA 3GKRA 3LD2A 1S7NA 3TO6A 4KOXA 2HUZA 3BJ8A 4CGLA 4C2ZA 3QB8A 4KSAA 2JLMA 2YGWA 2FL4A 2B3VA 4CAEA 4CGNA 3DNSA 3G8WA 1S3ZA 2B4DB 4R57A 2YNCA 4H6ZA 2Q4VA 4F0XA 2I79A 5G22A 4ZBGA 1VHSA 4ONUA 5A28A 2VI7A 3H4QA 2P6EA 4CRZB 4UCMA 2VQYA 1PU9A 2JDDA 1M1DA 1GHEA 1YK3A 4OADA 5KTAA 1U6MA 4CAXA 4ORFA 5F48A 3E0KA 4C2YA 4H89A 3P2HA 1NE9A 4NCZA 3EY5A 2Z3OA 3TO7A 4FD4A 3ZJ0A 3P2FA 4Y49C 1Z4EA 3TT2A 4F6AA 4C7IA 5J8FA 5DWMA 2BUEA 4QBJA 4FD7A 4AB7A 4NEXA 3S6KA 4A30A 1I1DA 1TIQA 1WWZA 5I0CA 4PV6A 3I3GA 2J8RA 4MFPA 3R1KA 4XPKA 1QSOA 1K4JA 1WK4A 4AG7A 4A2ZA 2CNTA 2GIVA 2FXFA 4AVAA 4JWPA 4M3SA 1BOBA 3SHPA 2FCKA 2FSRA 3EO4A 3IU2A 2I00A 3T9YA 2ZW6A 3F0AA 5HH1A 1IICA 4LX9A 4OAEA 4B5OA 4C7HA 4E2AA 1RXTA 3TTHA 3VWDA 1OZPA 3NE7A 2G0BA 2EVNA 1P0HA 2R7HA 1CJWA 1IB1E 3OWCA 4DNCA 1S7LA 3F5BA 1YR0A 4BMHA 4EVYA 5CNPA 2A4NA 1BO4A 1IYLA 4MFZA 4PSWA 3PP9A 5IV0A 4MFLA 4YRHA 3W6XA 3SXNA 4FD6A 2FIWA 1MJ9A 2WSAA 3KKWA 4KLWA 3TE4A 4KUAA 3H5ZA 2ARHA 4KOVA 5JQ4A 2ZW4A 2Y0MA 2OZGA 1MJAA 4CRYB 4A95A 4KVOE 3R9FA 1Y7RA 4PK2A 2D4PA 2WPXA 3FB3A 4KS9A 2YNEA 5C88A 3SXOA 3IGRA 5EC4A 3GYAA 1XE4A 5G1ZA 4RI1A 4CGPA 4JJXA 5EBVA 3K9UA 2VZYA 4MJ8A 4XPDC 3D3SA 3DSBA 1KUXA 3FNCA 1XIXA 4BBHA 3W91A 2Z3PA 4B11A 5H84A 2DXQA 3TOBA 1IIDA 2R98A 2B4BA 1M4GA 5AG7A 2B4DA 5KTDA 4XNHC 2BEIA 3R96A 4A32A 5C82A 1YVKA 2DPSA 4HNWB 3UY5A 4B10A 1ON0A 1B87A 2P6FA 2GE3A 1QSNA 4KSFA 4B5PB 4MFQA 4Q38A 1KUVA 4GS4A 4L89A 4E0AA 2CNMA 2VBQA 3EXNA 2BL1A 1Y9WA 4XPDB 3FXTA 4II9A 1RO5A 4MFJA 1NMTA 3FIXA 5HMNA 2B3UA 1Y9KA 2FE7A 4CYQA 4HNXB 2PQ8A 3C26A 4IF5A 1Z9UA 4NXYA 3FRMA 2VZZA 2ZW5A 4KUBA 4B13A 3IWEA 3R9GA 4KVME 5H86A 2CY2A 3D2MA 1FY7A 2G3AA 4CGMA 4XNHB 1ZO0A 1Q2DA 3QAHA 3JUWA 1KUYA 1S5KA 2YNCC 2X7BA 3EC4A 3IWGA 4UWJA 4KZTA 2GANA 4ZGYB 4MY3A 5AGEA 2K5TA 2Z3MA 1Z4RA 3PGPA 2JDCA 4R3KA 1QSMA 2AE6A 3A9LA 1SQHA 3DR6A 1Q2YA 5IB0A 2B5GA 4LUAA 2PR8A 2J8NA 4CYOA 2QMLA 5F46A 3FYNA 1MK4A 3S6FA 5ISVA 2Z3NA 4YFJA 2REEA 1P4NA 2BSWA 2H5MA 4XPLA 2Q7BA 3LODA 4KVXA 4QC6A 4AG9A 1M44A 2G3TA 1UFHA 3TO9A 1QSTA 4FD5A 1XF8A 1Q2CA 2Z0ZA 4KOYA 4JLYA 4CS0B 2ZW7A 2FT0A 4C2XA 3B8GA 2Q44A 5AG5A 3DR8A 4E8OA 3TFYA 1B6BA 2P6GA 4I49A 4RS2A 4R87A 4KORA 4MY0A 5G20A 4A33A 4C68A 4PSXA 2CNSA 4U5YA 4UFXA 2Z3LA 3MGDA 3EFAA 3WR7A 4IUSA 5A27A 1NSLA 4U9YA 2QECA 4YGOA 5FVJA 4KLVA 1MJBA 1PUAA 3CXPA 4HKFA 2PC1A 2KCWA 2PSWA 3N7ZA 2JEVA 1LRZA 2HQYA 4KOUA 3S6GA 2Q0YA 2HV2A 4UBRA 2J8MA 4CAVA 1R57A 1QSRA 4QVTA 4NF1A 2OU2A 4JD6A 4KOTA 3F8KA 2OB0A 5J8CA 4JXRA 4Q36A 4MFKA 5G21A 3FBUA 1J4JA 2CXAA 5IX3A 5BWAB 4B14A 3IU1A 5JPHA 4CAWA 3D8PA 4CGOA 1S60A 2AJ6A 1YGHA 3ZZIA 4MI4A 2PR1A 2FIAA 4QB9A 1I21A 2VEZA 1IYKA 5DWNA 2OZUA 4AVCA 1YVOA 4UCNA 4JXQA 2O28A 2DPTA 2Q04A 3DDDA 4CAFA 2ZXVA 2D4OA 2PRBA 4QUSA 1M4DA 3BLNA 3TOAA 4B5PA 2F5IA 1YX0A 4A31A 1I12A 1YREA 3JTKA 1S7FA 3G3SA 4NSQA 4HNYB 2ZPAA 4MHDA 3R9EA 2REFA 1XMTA 2WUUA 1L0CA 3RYOA 2Q4YA 1V0CA 4KOWA 4UFVA 1S7KA 3PZJA 4UCPA 4AVBA 3TCVA 4K30A 2B5GB 2Z10A 2EUIA 5AG6A 3JVNA 2PDOA 2WPWA 4UWIA 2Z11A 4CYNA 3T90A 4CYPA 3BJ7A 1YLEA 4UFWA 4M85A 4R9MA 2OZHA 4Y49B 4R3LA 2OH1A 2R1IA 3S6HA 4U9ZA 2FS5A 1CM0A 3GY9A 3CXQA 3D2PA 2VXKA 2B58A 4B12A 3VWEA 2YNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8I A;  4PK3 A;  1KZF A;  4H6U A;  1N71 A;  1XEB A;  4MBU A;  4L8A A;  2RC4 A;  2P0W A;  2IL4 A;  2ATR A;  3I9S A;  2QIR A;  4OLL A;  1VKC A;  5F49 A;  2C27 A;  4UA3 A;  2R8V A;  5GCN A;  3CXS A;  4F0Y A;  4KOS A;  5F47 A;  5E96 A;  2NMT A;  3R95 A;  4J3G A;  4X5K A;  3W6S A;  5KTC A;  1M4I A;  3GKR A;  3LD2 A;  1S7N A;  3TO6 A;  4KOX A;  2HUZ A;  3BJ8 A;  3QB8 A;  2JLM A;  2FL4 A;  2B3V A;  3DNS A;  3G8W A;  1S3Z A;  2B4D B;  4R57 A;  4H6Z A;  2Q4V A;  2I79 A;  4ZBG A;  1VHS A;  4ONU A;  2VI7 A;  3H4Q A;  2P6E A;  4CRZ B;  2VQY A;  1PU9 A;  2JDD A;  1M1D A;  1GHE A;  1YK3 A;  4OAD A;  5KTA A;  1U6M A;  4CAX A;  4ORF A;  5F48 A;  3E0K A;  4H89 A;  3P2H A;  1NE9 A;  4NCZ A;  3EY5 A;  3TO7 A;  4FD4 A;  3ZJ0 A;  3P2F A;  4Y49 C;  1Z4E A;  3TT2 A;  4F6A A;  5J8F A;  5DWM A;  2BUE A;  4QBJ A;  4FD7 A;  4AB7 A;  4NEX A;  3S6K A;  1I1D A;  1TIQ A;  1WWZ A;  5I0C A;  4PV6 A;  3I3G A;  2J8R A;  3R1K A;  4XPK A;  1QSO A;  1K4J A;  1WK4 A;  4AG7 A;  2CNT A;  2GIV A;  2FXF A;  4AVA A;  4JWP A;  4M3S A;  1BOB A;  3SHP A;  2FCK A;  2FSR A;  3EO4 A;  2I00 A;  3T9Y A;  2ZW6 A;  3F0A A;  5HH1 A;  1IIC A;  4LX9 A;  4OAE A;  4B5O A;  4E2A A;  1RXT A;  3TTH A;  3VWD A;  1OZP A;  3NE7 A;  2G0B A;  2EVN A;  1P0H A;  2R7H A;  1CJW A;  1IB1 E;  3OWC A;  4DNC A;  1S7L A;  3F5B A;  1YR0 A;  4BMH A;  4EVY A;  5CNP A;  2A4N A;  1BO4 A;  1IYL A;  4PSW A;  3PP9 A;  5IV0 A;  4YRH A;  3W6X A;  3SXN A;  4FD6 A;  2FIW A;  1MJ9 A;  3KKW A;  4KLW A;  3TE4 A;  4KUA A;  2ARH A;  4KOV A;  5JQ4 A;  2ZW4 A;  2Y0M A;  2OZG A;  1MJA A;  4CRY B;  4KVO E;  3R9F A;  1Y7R A;  4PK2 A;  2D4P A;  2WPX A;  3FB3 A;  5C88 A;  3SXO A;  3IGR A;  5EC4 A;  3GYA A;  1XE4 A;  4RI1 A;  4JJX A;  5EBV A;  3K9U A;  2VZY A;  4MJ8 A;  4XPD C;  3D3S A;  3DSB A;  1KUX A;  3FNC A;  1XIX A;  3W91 A;  5H84 A;  2DXQ A;  3TOB A;  1IID A;  2R98 A;  2B4B A;  1M4G A;  2B4D A;  5KTD A;  4XNH C;  2BEI A;  3R96 A;  5C82 A;  1YVK A;  4HNW B;  3UY5 A;  1ON0 A;  1B87 A;  2P6F A;  2GE3 A;  1QSN A;  4B5P B;  1KUV A;  4GS4 A;  4L89 A;  4E0A A;  2CNM A;  2VBQ A;  3EXN A;  2BL1 A;  1Y9W A;  4XPD B;  3FXT A;  4II9 A;  1RO5 A;  1NMT A;  3FIX A;  5HMN A;  2B3U A;  1Y9K A;  2FE7 A;  4HNX B;  2PQ8 A;  3C26 A;  4IF5 A;  1Z9U A;  4NXY A;  3FRM A;  2VZZ A;  2ZW5 A;  4KUB A;  3R9G A;  4KVM E;  5H86 A;  2CY2 A;  3D2M A;  1FY7 A;  2G3A A;  4XNH B;  1Q2D A;  3QAH A;  3JUW A;  1KUY A;  1S5K A;  2X7B A;  3EC4 A;  3IWG A;  4UWJ A;  4KZT A;  2GAN A;  4MY3 A;  2K5T A;  1Z4R A;  3PGP A;  2JDC A;  4R3K A;  1QSM A;  2AE6 A;  1SQH A;  3DR6 A;  1Q2Y A;  5IB0 A;  2B5G A;  4LUA A;  2PR8 A;  2J8N A;  2QML A;  5F46 A;  3FYN A;  1MK4 A;  3S6F A;  5ISV A;  4YFJ A;  2REE A;  1P4N A;  2BSW A;  2H5M A;  4XPL A;  2Q7B A;  3LOD A;  4KVX A;  4QC6 A;  4AG9 A;  1M44 A;  2G3T A;  1UFH A;  3TO9 A;  1QST A;  4FD5 A;  1XF8 A;  1Q2C A;  2Z0Z A;  4KOY A;  4JLY A;  4CS0 B;  2ZW7 A;  2FT0 A;  3B8G A;  2Q44 A;  3DR8 A;  4E8O A;  3TFY A;  1B6B A;  2P6G A;  4I49 A;  4RS2 A;  4R87 A;  4KOR A;  4MY0 A;  4PSX A;  2CNS A;  4U5Y A;  3MGD A;  3EFA A;  3WR7 A;  4IUS A;  1NSL A;  4U9Y A;  2QEC A;  4YGO A;  5FVJ A;  4KLV A;  1MJB A;  1PUA A;  3CXP A;  4HKF A;  2PC1 A;  2KCW A;  2PSW A;  3N7Z A;  2JEV A;  1LRZ A;  2HQY A;  4KOU A;  3S6G A;  2Q0Y A;  2HV2 A;  4UBR A;  2J8M A;  4CAV A;  1R57 A;  1QSR A;  4QVT A;  4NF1 A;  2OU2 A;  4JD6 A;  4KOT A;  3F8K A;  2OB0 A;  5J8C A;  4JXR A;  3FBU A;  1J4J A;  5IX3 A;  5JPH A;  4CAW A;  3D8P A;  1S60 A;  2AJ6 A;  1YGH A;  3ZZI A;  4MI4 A;  2PR1 A;  2FIA A;  4QB9 A;  1I21 A;  2VEZ A;  1IYK A;  5DWN A;  2OZU A;  4AVC A;  1YVO A;  4JXQ A;  2O28 A;  2Q04 A;  3DDD A;  2ZXV A;  2D4O A;  2PRB A;  4QUS A;  1M4D A;  3BLN A;  3TOA A;  4B5P A;  2F5I A;  1YX0 A;  1I12 A;  1YRE A;  1S7F A;  3G3S A;  4NSQ A;  4HNY B;  2ZPA A;  4MHD A;  3R9E A;  2REF A;  1XMT A;  1L0C A;  3RYO A;  2Q4Y A;  1V0C A;  4KOW A;  1S7K A;  3PZJ A;  4AVB A;  3TCV A;  4K30 A;  2B5G B;  2Z10 A;  2EUI A;  3JVN A;  2PDO A;  2WPW A;  4UWI A;  2Z11 A;  3T90 A;  3BJ7 A;  1YLE A;  4M85 A;  4R9M A;  2OZH A;  4Y49 B;  4R3L A;  2OH1 A;  2R1I A;  3S6H A;  4U9Z A;  2FS5 A;  1CM0 A;  3GY9 A;  3CXQ A;  3D2P A;  2VXK A;  2B58 A;  3VWE A; 
#chains in the Genus database with same CATH topology
 1R43 A;  3V8I A;  4PK3 A;  1KZF A;  4H6U A;  1N71 A;  3FH4 A;  1XEB A;  4MBU A;  3KR5 A;  4NJQ A;  4L8A A;  2C6P A;  1VGY A;  4P4D A;  2RC4 A;  2P0W A;  2IL4 A;  3RZA A;  5AG4 A;  1TF8 A;  3KHX A;  3VAT A;  2ATR A;  3I9S A;  3JRU A;  1YW6 A;  3SJG A;  2QIR A;  2ZEO A;  4OLL A;  4R6T A;  1VKC A;  2PCU A;  5F49 A;  2C27 A;  4UA3 A;  2R8V A;  5GCN A;  1DTD A;  2DEA A;  3CXS A;  1PYT B;  4KOS A;  5F47 A;  4F0Y A;  4H2K A;  3PBB A;  5DS0 A;  5E96 A;  5LRK A;  2NMT A;  4A39 A;  3R95 A;  6CPA A;  2Z3K A;  4J3G A;  3BXM A;  4X5K A;  5LYD A;  3W6S A;  5KTC A;  1CG2 A;  1YME A;  1M4I A;  3GKR A;  3LWU A;  1Z8W A;  4MRI A;  4P44 A;  4M6H A;  3LD2 A;  4MCS A;  2PJ0 A;  5IB9 A;  1S7N A;  2EK8 A;  3TO6 A;  4KOX A;  3WC5 A;  3K9T A;  2HUZ A;  3BJ8 A;  4CGL A;  4C2Z A;  3KQX A;  3QB8 A;  4KSA A;  2JLM A;  4EWT A;  1VHE A;  2YGW A;  2FL4 A;  2B3V A;  4CAE A;  3B3T A;  3BHX A;  4CGN A;  3DNS A;  3G8W A;  1S3Z A;  2B4D B;  3KR4 A;  4R57 A;  4NGQ A;  3H8F A;  2YNC A;  4H6Z A;  1LOK A;  2Q4V A;  4F0X A;  2I79 A;  5G22 A;  4ZBG A;  1VHS A;  4ONU A;  1CX8 A;  2XEF A;  5A28 A;  5I4M A;  3IWW A;  2VI7 A;  2V77 A;  4ZY1 A;  3H4Q A;  2P6E A;  2BCO A;  4CRZ B;  2PJ6 A;  4UCM A;  2VQY A;  3WAB A;  1PU9 A;  3D7F A;  2JDD A;  1M1D A;  2JBJ A;  1UWY A;  3KGQ A;  1GHE A;  3B3W A;  1YK3 A;  4OAD A;  4MCQ A;  5KTA A;  1U6M A;  4CAX A;  4ORF A;  5F48 A;  3E0K A;  4C2Y A;  5HVG A;  3S9N A;  2V8H A;  3I1U A;  4H89 A;  3P2H A;  1NE9 A;  4PQA A;  5JGF A;  3B3C A;  4NCZ A;  3EY5 A;  4PXD A;  2Z3O A;  3TO7 A;  4FAI A;  4FD4 A;  3ZJ0 A;  3P2F A;  1ARL A;  4Y49 C;  1Z4E A;  1CPS A;  3TT2 A;  4F6A A;  4C7I A;  4NGT A;  5DWM A;  5J8F A;  2BUE A;  3V38 A;  3MN8 A;  4QBJ A;  2PJ2 A;  2PVV A;  4FD7 A;  4AB7 A;  4NEX A;  3S6K A;  3CPX A;  3PEI A;  4A30 A;  3GLJ A;  1I1D A;  1TIQ A;  2PJC A;  2ZEM A;  4R7M A;  1WWZ A;  5I0C A;  4FBE A;  4BD9 A;  4PV6 A;  1ARM A;  1IY7 A;  1YSJ A;  3I3G A;  1QQ9 A;  2J8R A;  4MFP A;  4MCP A;  1AMP A;  3PBE A;  4A38 A;  4ZX8 A;  4OC4 A;  1CP7 A;  3R1K A;  4XPK A;  1QSO A;  1K4J A;  1WK4 A;  3T8W A;  2AFU A;  4OID A;  1JWQ A;  3SJE A;  3SI1 A;  4AG7 A;  3IFE A;  4A2Z A;  3KZW A;  2CNT A;  2GIV A;  2HB6 A;  2FXF A;  5JH9 A;  2CIJ A;  4AVA A;  4JWP A;  4M3S A;  1BOB A;  3HUV A;  3SHP A;  2FCK A;  2FSR A;  3EO4 A;  3IU2 A;  2I00 A;  4OME A;  3T9Y A;  2ZW6 A;  5HXD A;  1DE4 C;  3F0A A;  5HH1 A;  4NJR A;  1IIC A;  4LX9 A;  4OAE A;  2IMO A;  1ZG7 A;  4B5O A;  4C7H A;  1RXT A;  2WYR A;  2BO9 A;  4E2A A;  1LCP A;  2XEI A;  3TTH A;  3VWD A;  1OZP A;  3NE7 A;  4R8F A;  2G0B A;  3NA6 A;  2EVN A;  2GLF A;  3V7Z A;  1P0H A;  2R7H A;  1YW4 A;  1KWM A;  4RN7 A;  1NSA A;  1OBR A;  1CJW A;  1IB1 E;  3B7I A;  4DJL A;  3OWC A;  4DNC A;  1S7L A;  3F5B A;  1YR0 A;  4BMH A;  4EVY A;  3IJ3 A;  1FNO A;  5CNP A;  1YLO A;  3BI0 A;  2A4N A;  1BO4 A;  1IYL A;  3D7H A;  4MFZ A;  1XFO A;  4OC0 A;  3FF3 A;  4P6Y A;  4PSW A;  5J1Q A;  3NH5 A;  5JM6 A;  3FEE A;  3PP9 A;  5LYL A;  2QVP A;  4WWV A;  5IV0 A;  4MFL A;  4YRH A;  1JQG A;  3W6X A;  3SXN A;  1Y7E A;  4FD6 A;  2FIW A;  1MJ9 A;  2WSA A;  3KKW A;  2G9D A;  4KLW A;  4KUA A;  3H5Z A;  3TE4 A;  2ARH A;  1FT7 A;  4KOV A;  4FUU A;  5JQ4 A;  2ZW4 A;  1ZG9 A;  2Y0M A;  1HEE A;  4UIA A;  2OZG A;  3SJF A;  4BIN A;  1MJA A;  4CRY B;  4A95 A;  4KVO E;  5ELY A;  1Y7R A;  3R9F A;  4PK2 A;  2AFX A;  5CBM A;  2PE3 A;  2D4P A;  2V8D A;  2WPX A;  1Z8L A;  2Q4Z A;  3FB3 A;  4KS9 A;  2YNE A;  5C88 A;  1F2P A;  3IEH A;  5LYI A;  4M6I A;  7CPA A;  3SXO A;  5CPA A;  4UEZ A;  3IGR A;  3B3S A;  4NFR A;  5EC4 A;  3GYA A;  3PRT A;  1XE4 A;  4UIB A;  3N5F A;  5G1Z A;  4NGP A;  4RI1 A;  2PJ3 A;  2WZN A;  4CGP A;  4JJX A;  3FX6 A;  5EBV A;  3NFZ A;  2PJ1 A;  4OKO A;  3K9U A;  3S9L A;  2VZY A;  2ZEN A;  3SI2 A;  2ZOF A;  2F8H A;  4MJ8 A;  4XPD C;  3D3S A;  3D4U A;  3DSB A;  1KUX A;  2AFZ A;  4MXU A;  3FNC A;  1XOV A;  1XRY A;  3KHZ A;  1XIX A;  4BBH A;  3W91 A;  2Z3P A;  4B11 A;  1Y0R A;  3GUX A;  5H84 A;  1A2Z A;  3RNZ A;  2DXQ A;  3TOB A;  1IID A;  3FJU A;  4IAV A;  5HVH A;  2R98 A;  2RFH A;  2CF4 A;  1R3N A;  2PJ5 A;  3BI1 A;  2B4B A;  4HPS A;  1ELL P;  4P10 A;  1M4G A;  3B3V A;  5AG7 A;  1F2O A;  2B4D A;  5KTD A;  2AFO A;  4XNH C;  1AUG A;  2BEI A;  4UEF A;  3R96 A;  4A32 A;  5C82 A;  1YVK A;  1LAM A;  4LQG A;  2ABZ A;  2AFW A;  2IJZ A;  3NE8 A;  2C1C A;  2DPS A;  4P4B A;  4HNW B;  3UY5 A;  4B10 A;  4DYO A;  4JZ0 A;  1ON0 A;  1ZG8 A;  1B87 A;  3ISX A;  2P6F A;  2GE3 A;  1QSN A;  3IO1 A;  3D67 A;  1X10 A;  4KSF A;  4B5P B;  3H8E A;  4MFQ A;  4Q38 A;  2ZEF A;  1KUV A;  1IOF A;  2NSM A;  3ISZ A;  4GS4 A;  4L89 A;  2CNM A;  4P4E A;  1HDU A;  4E0A A;  4P4F A;  2AFS A;  2Q7S A;  2VBQ A;  3EXN A;  3D68 A;  1EE3 P;  1Z2L A;  2BL1 A;  1Y9W A;  3NH8 A;  4XPD B;  3FXT A;  3IIB A;  1RO5 A;  3PFO A;  1NMT A;  4M6G A;  4MFJ A;  4II9 A;  3FIX A;  5HMN A;  3K2K A;  2B3U A;  1Y9K A;  2FE7 A;  4CYQ A;  4HNX B;  2PQ8 A;  3PB7 X;  3RAM A;  3C26 A;  2CTB A;  4IF5 A;  2PVW A;  1Z9U A;  4WJB A;  4NXY A;  3FRM A;  1Z5R A;  2PJB A;  2VZZ A;  2ZW5 A;  4KUB A;  2IQ6 A;  4B13 A;  3IWE A;  4GXH A;  3RBU A;  3R9G A;  4KVM E;  5H86 A;  1Q7L A;  3HLP A;  2CY2 A;  1BAV A;  4KSI A;  3D2M A;  1TXR A;  1FY7 A;  3TX8 A;  3IC1 A;  5ISV A;  2G3A A;  1TKF A;  4XNH B;  4CGM A;  1ZO0 A;  1Q2D A;  2GU2 A;  3QAH A;  5K8O A;  2XEJ A;  3JUW A;  3PB4 X;  1KUY A;  3WC7 A;  2ZEP A;  4B6Z A;  1S5K A;  2O53 A;  4MHY A;  2YNC C;  2CTC A;  2X7B A;  5HVF A;  3EC4 A;  3IWG A;  4UWJ A;  4KZT A;  2GAN A;  4OIW A;  2PJ8 A;  1CPX A;  4W9Y A;  4OC2 A;  4FWU A;  4ZGY B;  4MY3 A;  4LQ6 A;  5AGE A;  4Q7A A;  1LAP A;  2K5T A;  3VAR A;  2Z3M A;  1PCA A;  1Z4R A;  3PGP A;  2JDC A;  2PRQ A;  1AYE A;  4R3K A;  1QSM A;  2AE6 A;  3TC8 A;  3A9L A;  1SQH A;  2PIY A;  1Q2Y A;  3DR6 A;  4G1P A;  5IB0 A;  2B5G A;  4LUA A;  3VH9 A;  3WC6 A;  2PR8 A;  1F57 A;  2J8N A;  2OOT A;  4CYO A;  2QML A;  5F46 A;  3FYN A;  1MK4 A;  1ELM P;  1QMU A;  3S6F A;  2Z3N A;  3PB9 X;  3WT4 A;  5K8N A;  3NH4 A;  5D29 A;  1CBX A;  4PXC A;  3H8G A;  4YFJ A;  4P4I A;  2REE A;  5F09 A;  1TKJ A;  1P4N A;  4PXE A;  5EMI A;  2BSW A;  2H5M A;  4XPL A;  2Q7B A;  3L2N A;  4IK2 A;  3GIU A;  3LOD A;  1RTQ A;  2Q51 A;  3KQZ A;  4KVX A;  4QC6 A;  4AG9 A;  4AXV A;  1M44 A;  2G3T A;  2RB7 A;  1UFH A;  2GRE A;  1QST A;  3D66 A;  3KI9 A;  4FD5 A;  2ZOG A;  1XF8 A;  3TO9 A;  4B5P A;  1Q2C A;  1VHO A;  2Z0Z A;  1Z8X A;  3FVL A;  2AFM A;  4JLY A;  4KOY A;  2ZW7 A;  4CS0 B;  1X12 A;  2FT0 A;  4C2X A;  1XJO A;  3LMS A;  3B8G A;  2Q44 A;  5AG5 A;  3RO0 A;  3DR8 A;  4E8O A;  2EO8 A;  2V8G A;  3TFY A;  1B6B A;  2P6G A;  4I49 A;  4MHN A;  4RS2 A;  4DUK A;  2GLJ A;  4NGN A;  4F9U A;  4R87 A;  4KOR A;  4MY0 A;  1GYT A;  5G20 A;  2V8V A;  5THW A;  4A33 A;  4C68 A;  4PSX A;  2CNS A;  2PJ9 A;  4U5Y A;  4UFX A;  4UEE A;  4A37 A;  2EBJ A;  2Z3L A;  3CPA A;  3MGD A;  4A94 A;  3EFA A;  1TF9 A;  3WR7 A;  4IUS A;  5A27 A;  1NSL A;  4U9Y A;  2GFQ A;  2QEC A;  1BPM A;  2ZEE A;  4K3N A;  2PJ7 A;  4YGO A;  5FVJ A;  4NGR A;  2PIZ A;  3CZX A;  1H8L A;  4KLV A;  4R76 A;  1MJB A;  1TKH A;  3CT9 A;  2O4H A;  1PUA A;  1CP6 A;  3CXP A;  4HKF A;  2PC1 A;  4ZY0 A;  2KCW A;  2PSW A;  3N7Z A;  2JEV A;  1LRZ A;  3PFE A;  4P4J A;  2HQY A;  4KOU A;  3S6G A;  2Q0Y A;  1LFW A;  2HV2 A;  3QNV A;  4UBR A;  2J8M A;  1ZLH A;  3D7D A;  3SI0 A;  4CAV A;  1R57 A;  4ZY2 A;  1QSR A;  4QVT A;  2EWB A;  2ZEH A;  4NF1 A;  4ZI6 A;  2OU2 A;  4JD6 A;  4KOT A;  4YU9 A;  3F8K A;  2OB0 A;  5J8C A;  4GM5 A;  4JXR A;  4EME A;  4Q36 A;  4MFK A;  5G21 A;  3FMC A;  3FBU A;  1J4J A;  2CXA A;  5IX3 A;  3D7G A;  5BWA B;  4B14 A;  3IU1 A;  5JPH A;  1Z8T A;  4CAW A;  1LAN A;  1M4L A;  2ZEL A;  3D8P A;  4CGO A;  2J9A A;  2OR4 A;  1S60 A;  1BPN A;  2AJ6 A;  3DLJ A;  1YGH A;  3ZZI A;  4F8Z A;  4MI4 A;  2PR1 A;  2FIA A;  4ONW A;  3PB6 X;  4QB9 A;  5LYF A;  1I21 A;  2VEZ A;  2ANP A;  1IYK A;  5DWN A;  1IU8 A;  4YWY A;  2OZU A;  3CDX A;  1YVO A;  4AVC A;  3FED A;  3SJX A;  5LRJ A;  4PPZ A;  4UCN A;  2PJ4 A;  1HDQ A;  4TWE A;  4JXQ A;  2O28 A;  2NYQ A;  4MHZ A;  2DPT A;  4NGM A;  2JBK A;  2Q04 A;  3DDD A;  4CAF A;  2ZXV A;  2D4O A;  2PRB A;  4QUS A;  4IHM A;  1M4D A;  3BLN A;  4MCR A;  4P45 A;  3DGV A;  3TOA A;  5LRG A;  2PJA A;  1IOI A;  1ZLI A;  2F5I A;  4MMO A;  1YX0 A;  3KAS A;  4O23 A;  4A31 A;  1I12 A;  1YRE A;  2Q43 A;  3JTK A;  1S7F A;  1YQE A;  3G3S A;  3B35 A;  2C6G A;  5K8P A;  4NSQ A;  4Z65 A;  4HNY B;  4ZYQ A;  2ZPA A;  4MHD A;  4X3R A;  3R9E A;  2REF A;  4MHP A;  5K8M A;  1XMT A;  2POK A;  4CPA A;  8CPA A;  3MRU A;  2WUU A;  2XEG A;  1L0C A;  3RYO A;  4PXB A;  2Q4Y A;  3QAY A;  1V0C A;  3GB0 A;  4KOW A;  1BLL E;  1IGB A;  4UFV A;  1S7K A;  3PZJ A;  4X2T A;  2EK9 A;  4UCP A;  4AVB A;  2VL1 A;  2DF5 A;  4OC5 A;  4X8I A;  3TCV A;  4K30 A;  2B5G B;  2Z10 A;  2EUI A;  5AG6 A;  2QYV A;  3JVN A;  2PDO A;  2WPW A;  4UWI A;  5D8N A;  2I3C A;  2Z11 A;  4NGS A;  4CYN A;  4F9V A;  3KL9 A;  3LAC A;  4OP4 A;  3T90 A;  3FEC A;  4OC1 A;  4CYP A;  3BJ7 A;  1YLE A;  2ZEG A;  4UFW A;  4EFD A;  4M85 A;  4R9M A;  2OZH A;  3S9M A;  4Y49 B;  4R3L A;  2ODF A;  2OH1 A;  2ZED A;  1XMB A;  4JYW A;  2R1I A;  4TNU A;  3S6H A;  4U9Z A;  2JEW A;  2FS5 A;  1Y0Y A;  2QJ8 A;  2F7V A;  2FVG A;  1CM0 A;  4OC3 A;  1XBU A;  4UF4 A;  3GY9 A;  2C6C A;  3CXQ A;  3PB8 X;  1VIX A;  2HC9 A;  2BOA A;  3B2Y A;  4RUH A;  3D2P A;  2VXK A;  2B58 A;  4ZX9 A;  4B12 A;  3VWE A;  2YND A; 
#chains in the Genus database with same CATH homology
 3V8I A;  4PK3 A;  1KZF A;  4H6U A;  1N71 A;  1XEB A;  4MBU A;  4L8A A;  2RC4 A;  2P0W A;  2IL4 A;  5AG4 A;  2ATR A;  3I9S A;  2QIR A;  4OLL A;  1VKC A;  5F49 A;  2C27 A;  4UA3 A;  2R8V A;  5GCN A;  3CXS A;  4F0Y A;  4KOS A;  5F47 A;  5E96 A;  2NMT A;  3R95 A;  2Z3K A;  4J3G A;  4X5K A;  3W6S A;  5KTC A;  1M4I A;  3GKR A;  3LD2 A;  1S7N A;  3TO6 A;  4KOX A;  2HUZ A;  3BJ8 A;  4CGL A;  4C2Z A;  3QB8 A;  4KSA A;  2JLM A;  2YGW A;  2FL4 A;  2B3V A;  4CAE A;  4CGN A;  3DNS A;  3G8W A;  1S3Z A;  2B4D B;  4R57 A;  2YNC A;  4H6Z A;  2Q4V A;  4F0X A;  2I79 A;  5G22 A;  4ZBG A;  1VHS A;  4ONU A;  5A28 A;  2VI7 A;  3H4Q A;  2P6E A;  4CRZ B;  4UCM A;  2VQY A;  1PU9 A;  2JDD A;  1M1D A;  1GHE A;  1YK3 A;  4OAD A;  5KTA A;  1U6M A;  4CAX A;  4ORF A;  5F48 A;  3E0K A;  4C2Y A;  4H89 A;  3P2H A;  1NE9 A;  4NCZ A;  3EY5 A;  2Z3O A;  3TO7 A;  4FD4 A;  3ZJ0 A;  3P2F A;  4Y49 C;  1Z4E A;  3TT2 A;  4F6A A;  4C7I A;  5J8F A;  5DWM A;  2BUE A;  4QBJ A;  4FD7 A;  4AB7 A;  4NEX A;  3S6K A;  4A30 A;  1I1D A;  1TIQ A;  1WWZ A;  5I0C A;  4PV6 A;  3I3G A;  2J8R A;  4MFP A;  3R1K A;  4XPK A;  1QSO A;  1K4J A;  1WK4 A;  4AG7 A;  4A2Z A;  2CNT A;  2GIV A;  2FXF A;  4AVA A;  4JWP A;  4M3S A;  1BOB A;  3SHP A;  2FCK A;  2FSR A;  3EO4 A;  3IU2 A;  2I00 A;  3T9Y A;  2ZW6 A;  3F0A A;  5HH1 A;  1IIC A;  4LX9 A;  4OAE A;  4B5O A;  4C7H A;  4E2A A;  1RXT A;  3TTH A;  3VWD A;  1OZP A;  3NE7 A;  2G0B A;  2EVN A;  1P0H A;  2R7H A;  1CJW A;  1IB1 E;  3OWC A;  4DNC A;  1S7L A;  3F5B A;  1YR0 A;  4BMH A;  4EVY A;  5CNP A;  2A4N A;  1BO4 A;  1IYL A;  4MFZ A;  4PSW A;  3PP9 A;  5IV0 A;  4MFL A;  4YRH A;  3W6X A;  3SXN A;  4FD6 A;  2FIW A;  1MJ9 A;  2WSA A;  3KKW A;  4KLW A;  3TE4 A;  4KUA A;  3H5Z A;  2ARH A;  4KOV A;  5JQ4 A;  2ZW4 A;  2Y0M A;  2OZG A;  1MJA A;  4CRY B;  4A95 A;  4KVO E;  3R9F A;  1Y7R A;  4PK2 A;  2D4P A;  2WPX A;  3FB3 A;  4KS9 A;  2YNE A;  5C88 A;  3SXO A;  3IGR A;  5EC4 A;  3GYA A;  1XE4 A;  5G1Z A;  4RI1 A;  4CGP A;  4JJX A;  5EBV A;  3K9U A;  2VZY A;  4MJ8 A;  4XPD C;  3D3S A;  3DSB A;  1KUX A;  3FNC A;  1XIX A;  4BBH A;  3W91 A;  2Z3P A;  4B11 A;  5H84 A;  2DXQ A;  3TOB A;  1IID A;  2R98 A;  2B4B A;  1M4G A;  5AG7 A;  2B4D A;  5KTD A;  4XNH C;  2BEI A;  3R96 A;  4A32 A;  5C82 A;  1YVK A;  2DPS A;  4HNW B;  3UY5 A;  4B10 A;  1ON0 A;  1B87 A;  2P6F A;  2GE3 A;  1QSN A;  4KSF A;  4B5P B;  4MFQ A;  4Q38 A;  1KUV A;  4GS4 A;  4L89 A;  4E0A A;  2CNM A;  2VBQ A;  3EXN A;  2BL1 A;  1Y9W A;  4XPD B;  3FXT A;  4II9 A;  1RO5 A;  4MFJ A;  1NMT A;  3FIX A;  5HMN A;  2B3U A;  1Y9K A;  2FE7 A;  4CYQ A;  4HNX B;  2PQ8 A;  3C26 A;  4IF5 A;  1Z9U A;  4NXY A;  3FRM A;  2VZZ A;  2ZW5 A;  4KUB A;  4B13 A;  3IWE A;  3R9G A;  4KVM E;  5H86 A;  2CY2 A;  3D2M A;  1FY7 A;  2G3A A;  4CGM A;  4XNH B;  1ZO0 A;  1Q2D A;  3QAH A;  3JUW A;  1KUY A;  1S5K A;  2YNC C;  2X7B A;  3EC4 A;  3IWG A;  4UWJ A;  4KZT A;  2GAN A;  4ZGY B;  4MY3 A;  5AGE A;  2K5T A;  2Z3M A;  1Z4R A;  3PGP A;  2JDC A;  4R3K A;  1QSM A;  2AE6 A;  3A9L A;  1SQH A;  3DR6 A;  1Q2Y A;  5IB0 A;  2B5G A;  4LUA A;  2PR8 A;  2J8N A;  4CYO A;  2QML A;  5F46 A;  3FYN A;  1MK4 A;  3S6F A;  5ISV A;  2Z3N A;  4YFJ A;  2REE A;  1P4N A;  2BSW A;  2H5M A;  4XPL A;  2Q7B A;  3LOD A;  4KVX A;  4QC6 A;  4AG9 A;  1M44 A;  2G3T A;  1UFH A;  3TO9 A;  1QST A;  4FD5 A;  1XF8 A;  1Q2C A;  2Z0Z A;  4KOY A;  4JLY A;  4CS0 B;  2ZW7 A;  2FT0 A;  4C2X A;  3B8G A;  2Q44 A;  5AG5 A;  3DR8 A;  4E8O A;  3TFY A;  1B6B A;  2P6G A;  4I49 A;  4RS2 A;  4R87 A;  4KOR A;  4MY0 A;  5G20 A;  4A33 A;  4C68 A;  4PSX A;  2CNS A;  4U5Y A;  4UFX A;  2Z3L A;  3MGD A;  3EFA A;  3WR7 A;  4IUS A;  5A27 A;  1NSL A;  4U9Y A;  2QEC A;  4YGO A;  5FVJ A;  4KLV A;  1MJB A;  1PUA A;  3CXP A;  4HKF A;  2PC1 A;  2KCW A;  2PSW A;  3N7Z A;  2JEV A;  1LRZ A;  2HQY A;  4KOU A;  3S6G A;  2Q0Y A;  2HV2 A;  4UBR A;  2J8M A;  4CAV A;  1R57 A;  1QSR A;  4QVT A;  4NF1 A;  2OU2 A;  4JD6 A;  4KOT A;  3F8K A;  2OB0 A;  5J8C A;  4JXR A;  4Q36 A;  4MFK A;  5G21 A;  3FBU A;  1J4J A;  2CXA A;  5IX3 A;  5BWA B;  4B14 A;  3IU1 A;  5JPH A;  4CAW A;  3D8P A;  4CGO A;  1S60 A;  2AJ6 A;  1YGH A;  3ZZI A;  4MI4 A;  2PR1 A;  2FIA A;  4QB9 A;  1I21 A;  2VEZ A;  1IYK A;  5DWN A;  2OZU A;  4AVC A;  1YVO A;  4UCN A;  4JXQ A;  2O28 A;  2DPT A;  2Q04 A;  3DDD A;  4CAF A;  2ZXV A;  2D4O A;  2PRB A;  4QUS A;  1M4D A;  3BLN A;  3TOA A;  4B5P A;  2F5I A;  1YX0 A;  4A31 A;  1I12 A;  1YRE A;  3JTK A;  1S7F A;  3G3S A;  4NSQ A;  4HNY B;  2ZPA A;  4MHD A;  3R9E A;  2REF A;  1XMT A;  2WUU A;  1L0C A;  3RYO A;  2Q4Y A;  1V0C A;  4KOW A;  4UFV A;  1S7K A;  3PZJ A;  4UCP A;  4AVB A;  3TCV A;  4K30 A;  2B5G B;  2Z10 A;  2EUI A;  5AG6 A;  3JVN A;  2PDO A;  2WPW A;  4UWI A;  2Z11 A;  4CYN A;  3T90 A;  4CYP A;  3BJ7 A;  1YLE A;  4UFW A;  4M85 A;  4R9M A;  2OZH A;  4Y49 B;  4R3L A;  2OH1 A;  2R1I A;  3S6H A;  4U9Z A;  2FS5 A;  1CM0 A;  3GY9 A;  3CXQ A;  3D2P A;  2VXK A;  2B58 A;  4B12 A;  3VWE A;  2YND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...