1XEBA

Crystal structure of an acyl-coa n-acyltransferase from pseudomonas aeruginosa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
149
structure length
149
Chain Sequence
SLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLDLVGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQAAERLWLDTPVYLSAQAHLQAYYGRYGFVAVTEVYLEDDIPHIGMRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA0115
publication title The crystal structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 39
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1xebA00
4U9YA 1FY7A 1SQHA 4JLYA 4KUBA 2Q04A 3IGRA 2QMLA 2PC1A 3MGDA 2FSRA 2ATRA 2ZXVA 3NE7A 1K4JA 2K5TA 1M4DA 2B3UA 1P0HA 2O28A 2X7BA 3TO6A 4XNHC 3I9SA 4BMHA 4U5YA 2QIRA 3S6FA 1WK4A 1M44A 4PK3A 4KLVA 2VZZA 3EXNA 3D8PA 3BJ7A 4HNXB 1QSMA 4QUSA 3PZJA 3DSBA 5E96A 2KCWA 4MI4A 1NMTA 1MK4A 2PRBA 2P6FA 3DR8A 3JUWA 2GE3A 1YGHA 4YRHA 2B3VA 5HMNA 1MJBA 4RS2A 5F49A 1S3ZA 2NMTA 2QECA 4AVAA 1LRZA 3VWDA 5KTAA 2JLMA 4UA3A 1MJ9A 4KOWA 2ZPAA 1IICA 1UFHA 3TCVA 2ARHA 1YVKA 3R9EA 2Y0MA 2R1IA 4AG9A 1RO5A 4GS4A 3FNCA 3GY9A 2G3AA 4JXQA 2G0BA 2VZYA 4MJ8A 4XPDC 4XPLA 3PGPA 4QC6A 2PQ8A 3DR6A 4XPKA 2B4BA 1YX0A 2DXQA 4H6ZA 3R9FA 4X5KA 2FS5A 3IWGA 1IYLA 1CM0A 2I79A 1J4JA 3S6HA 3R9GA 2OZHA 2Q4VA 4ORFA 4HNWB 2Q44A 3TOBA 1XF8A 4L8AA 4YFJA 4FD5A 1Y9WA 4NF1A 3TTHA 1YLEA 1S7NA 4CAWA 4KVME 1Y9KA 4PSWA 5F48A 5JPHA 2Q0YA 3FYNA 5F47A 2EUIA 2CY2A 2R98A 1XE4A 2VBQA 1KUVA 1BO4A 2I00A 5H84A 4R3LA 4OLLA 3TOAA 2VI7A 4PK2A 2WPXA 3P2HA 4JJXA 2REFA 3TT2A 1B87A 5C88A 1PU9A 2BUEA 2Q4YA 2B5GA 2B5GB 2B4DA 1YVOA 2B4DB 3CXSA 4M3SA 4JXRA 3R96A 2FIWA 1L0CA 3PP9A 1U6MA 1XIXA 3V8IA 3D2MA 2WPWA 1XEBA 2JDDA 4AVCA 3W6XA 4AG7A 1IIDA 1XMTA 1Q2DA 2VXKA 4FD6A 2JEVA 5IV0A 4I49A 5GCNA 1QSTA 2RC4A 3N7ZA 4KOTA 1NSLA 2Z0ZA 3G3SA 4R3KA 1Q2YA 4IUSA 2HQYA 1B6BA 3SXNA 1ON0A 2R8VA 4QB9A 4FD4A 1S7LA 2HV2A 3S6KA 4NCZA 4MBUA 2GANA 4CRZB 2C27A 4QBJA 3D2PA 3R95A 4R87A 1I12A 5EBVA 4YGOA 2AJ6A 4LX9A 5C82A 2BEIA 2BSWA 4KOVA 1OZPA 3P2FA 5IX3A 3W6SA 4JWPA 2B58A 1YK3A 4UWJA 4H6UA 3S6GA 3OWCA 2A4NA 4R57A 1VKCA 1QSNA 4NSQA 4KOUA 2OZGA 4RI1A 2ZW5A 3SHPA 2BL1A 4XNHB 5IB0A 1RXTA 3F0AA 4HKFA 2Z11A 2J8NA 1IB1E 4OAEA 5DWNA 2REEA 2OZUA 1KUYA 4UBRA 3G8WA 2Z10A 4NEXA 1WWZA 4IF5A 3TO7A 3ZZIA 5I0CA 3FXTA 1S5KA 3F5BA 4KUAA 3R1KA 2G3TA 3CXPA 4UWIA 5KTDA 3T90A 1KZFA 3T9YA 3H4QA 2FE7A 2GIVA 4E0AA 2PR8A 4B5PA 4KZTA 2OU2A 1Q2CA 4R9MA 4B5PB 2P0WA 3RYOA 2R7HA 2IL4A 2AE6A 5KTCA 4ONUA 2P6GA 3VWEA 4E2AA 4J3GA 1IYKA 2PSWA 2ZW4A 5EC4A 4KOXA 4CAVA 3F8KA 2VEZA 4Y49C 2OB0A 4XPDB 5ISVA 4E8OA 2FCKA 1Z9UA 4MY0A 1S7FA 2VQYA 2PR1A 3LODA 4DNCA 1GHEA 3FRMA 2J8RA 1PUAA 3K9UA 1I21A 3EC4A 1MJAA 4CS0B 4MY3A 4L89A 1YR0A 1R57A 4CAXA 4EVYA 2F5IA 1VHSA 4OADA 3WR7A 2D4PA 3TE4A 3BLNA 4F6AA 1Y7RA 3E0KA 2CNTA 2JDCA 3JVNA 3TO9A 1QSRA 2ZW7A 3I3GA 4HNYB 4CRYB 1Z4EA 2FT0A 3QB8A 4H89A 4ZBGA 3GKRA 1YREA 4KLWA 4AVBA 3GYAA 5DWMA 5FVJA 4NXYA 1M4GA 4KOSA 1CJWA 1V0CA 2HUZA 4KVOE 3EY5A 1Z4RA 3W91A 2J8MA 4K30A 5HH1A 1S7KA 5H86A 2D4OA 2P6EA 4M85A 4KORA 3FIXA 4MHDA 1P4NA 2PDOA 2H5MA 4LUAA 4KVXA 3C26A 3SXOA 3DDDA 2CNSA 3D3SA 5JQ4A 4Y49B 2FIAA 1BOBA 5J8CA 3BJ8A 3B8GA 3UY5A 2Q7BA 3EO4A 2OH1A 2EVNA 1S60A 4AB7A 3DNSA 3EFAA 4PSXA 1M1DA 4U9ZA 4II9A 1TIQA 2CNMA 1I1DA 2ZW6A 1KUXA 5CNPA 1M4IA 4JD6A 4KOYA 5J8FA 3QAHA 2FXFA 3TFYA 3LD2A 4FD7A 1QSOA 3KKWA 4QVTA 4F0YA 3CXQA 2FL4A 4PV6A 4B5OA 1N71A 3FB3A 3ZJ0A 3FBUA 1NE9A 5F46A
chains in the Genus database with same CATH superfamily
3KASA 2EK8A 4U9YA 1FY7A 1SQHA 4JLYA 4KUBA 4MHYA 2Q04A 2J9AA 3IGRA 2QMLA 3MRUA 5G21A 3PFEA 4CGMA 2PC1A 3MGDA 4MFZA 2FSRA 1H8LA 2ATRA 2ZXVA 3NE7A 1YW6A 4XPDC 1K4JA 4PXCA 2K5TA 3B3WA 1M4DA 2WYRA 4UFVA 1F57A 3PB9X 2B3UA 1P0HA 2V8VA 2O28A 1Z5RA 2X7BA 4OC4A 4NGSA 4RN7A 3TO6A 1JWQA 4CGLA 2AFWA 3NA6A 4K3NA 2Q51A 4XNHC 3I9SA 4BMHA 4MFQA 2Z3NA 4U5YA 2Z3MA 1QMUA 2QIRA 2JEWA 1WK4A 4IAVA 1LAMA 5EMIA 1M44A 3S6FA 4OKOA 2RB7A 5K8PA 2PJAA 4PXEA 4F9VA 4P4JA 2POKA 2ZEMA 5IX3A 3PEIA 4PK3A 4KLVA 5JGFA 2O53A 2VZZA 2PJ4A 3D8PA 3EXNA 1TKHA 2ZOFA 2CTCA 4CPAA 5J1QA 5CBMA 1IOFA 2GREA 4MFPA 3BJ7A 3CPXA 2NYQA 1QSMA 4HNXB 4A31A 4QUSA 1IU8A 3PZJA 4OIWA 4ONWA 3DSBA 1IOIA 1LCPA 2KCWA 3D4UA 5E96A 4MI4A 4Q36A 5JH9A 2FVGA 2PJBA 1LFWA 1VGYA 1BAVA 1FT7A 1NMTA 1MK4A 2PRBA 3SJXA 2P6FA 3DR8A 4NJRA 3JUWA 1Z8LA 5K8NA 2GE3A 3KI9A 1YGHA 3BXMA 4P4BA 4YRHA 2OOTA 1XBUA 2B3VA 2V8GA 1MJBA 2PIZA 5HMNA 5LYLA 3H8GA 4RS2A 5F49A 1S3ZA 3PFOA 4YWYA 2NMTA 4A2ZA 4CYQA 2QECA 4AVAA 1LRZA 3HLPA 3KQXA 3VWDA 3WC6A 5KTAA 5BWAB 4MFJA 2JLMA 2PE3A 4UA3A 1MJ9A 2PVVA 4KOWA 3KL9A 2ZPAA 2YGWA 4B11A 5G22A 1IICA 1CPXA 1UFHA 3TCVA 2ARHA 1YVKA 3R9EA 4P10A 1LAPA 2R1IA 2Y0MA 4MFLA 4NGPA 4AG9A 3H5ZA 1RO5A 4UFWA 1Z8XA 3PB4X 2QJ8A 2ODFA 4GS4A 1CP6A 4LQ6A 3FNCA 4PXBA 3RO0A 3GY9A 4MHPA 3VH9A 2G3AA 5HXDA 4JXQA 5AG7A 2G0BA 4UEZA 4NGNA 2C6GA 1QQ9A 1TF8A 2BO9A 2VZYA 3D66A 1Z8TA 3D7HA 3PGPA 4MJ8A 2DPTA 2PJ7A 4P4EA 4QC6A 2CXAA 2PQ8A 3DR6A 3SI2A 2ABZA 4XPKA 3RBUA 2B4BA 3PB7X 1YX0A 2DXQA 4H6ZA 3R9FA 4BBHA 2Z3PA 4PQAA 4UIAA 4X5KA 4A33A 4UEEA 2FS5A 4OC1A 3IWGA 1IYLA 2GLJA 1CM0A 2GFQA 4KSIA 2I79A 4YU9A 4P4IA 1J4JA 3S6HA 3R9GA 4Q7AA 1XJOA 4XPLA 2OZHA 2Q4VA 4ORFA 4HNWB 4A95A 2Q44A 4OMEA 5F09A 3N5FA 3TOBA 1XF8A 4X3RA 4L8AA 4P6YA 4ZX9A 4YFJA 4FD5A 1Y9WA 4NF1A 3TTHA 4UEFA 1LANA 1YLEA 3SI0A 2ZEDA 1S7NA 2XEFA 4P44A 4CAWA 4CGPA 4KVME 1Y9KA 3SJGA 4PSWA 4UCNA 5F48A 5JPHA 4A39A 2Q0YA 2PJ0A 3K9TA 4A30A 3FYNA 5F47A 2RFHA 3DLJA 4MMOA 1Y0YA 5K8MA 2EWBA 4ZX8A 3IWEA 4MCSA 3JRUA 3NH4A 2EUIA 2CY2A 2R98A 2F7VA 3IFEA 1XE4A 2JBKA 1KUVA 2VBQA 2PRQA 1BO4A 4MCRA 4ZY1A 4OC5A 4B10A 2I00A 5H84A 2AFOA 4OLLA 4R3LA 2PJ5A 2DPSA 3TOAA 4F9UA 3WC7A 1IGBA 2HC9A 5LRJA 2PCUA 2CIJA 1TXRA 2VI7A 3PRTA 3ISZA 4MCPA 4PK2A 4B12A 3I1UA 2YNCC 2WPXA 3P2HA 4FBEA 3D7FA 4JJXA 2REFA 2ZOGA 5AGEA 1B87A 3TT2A 5C88A 1PU9A 2V77A 2BUEA 4CAEA 4B6ZA 2Q4YA 2B5GA 3S9MA 4MRIA 4CYOA 2B5GB 4HPSA 4C7HA 2B4DA 3QAYA 1CBXA 1YVOA 2AFSA 2B4DB 3CXSA 1YSJA 3B3TA 4M3SA 3FEEA 4JXRA 2ZEEA 3NE8A 4ZY0A 3R96A 3S9NA 2FIWA 1L0CA 3PP9A 1U6MA 1XIXA 3V8IA 3D2MA 3FF3A 2JBJA 2WPWA 2NSMA 1XEBA 1Y7EA 3B3CA 2JDDA 3D67A 3LACA 1AUGA 3W6XA 4AG7A 4AVCA 4ZYQA 1IIDA 3ISXA 5IB9A 3IC1A 1PCAA 1XMTA 1M4LA 1Q2DA 5D8NA 2VXKA 4FD6A 2JEVA 3H8EA 2QVPA 5IV0A 4I49A 4TNUA 5GCNA 1QSTA 1YMEA 1ZLHA 3IO1A 2RC4A 3N7ZA 4IHMA 3QNVA 4FWUA 4KOTA 3IEHA 1Z2LA 1NSLA 3B3VA 1F2OA 3RAMA 5K8OA 5AG6A 4B14A 2Z0ZA 1Y0RA 3CZXA 1GYTA 3G3SA 4R3KA 5LRGA 1Q2YA 2HQYA 2XEJA 4IUSA 1B6BA 4ZY2A 3SXNA 1ON0A 5G20A 5HVHA 4UFXA 2R8VA 2Z3KA 2V8HA 4QB9A 4FD4A 1IY7A 1S7LA 2HV2A 3B2YA 4Q38A 3S6KA 4NCZA 4Z65A 4MBUA 6CPAA 2GANA 3KQZA 4CRZB 2C27A 4OC0A 1YLOA 4C2ZA 4UCMA 1CPSA 4QBJA 2XEIA 3D2PA 2V8DA 3R95A 4R87A 4CGNA 1I12A 2AFZA 3D7GA 5EBVA 4YGOA 2AJ6A 5AG4A 3GUXA 2Z3OA 3LMSA 4LX9A 5C82A 2PJ6A 4LQGA 2BEIA 2BSWA 4KOVA 4R6TA 2GLFA 4PPZA 1OZPA 3P2FA 2PJ3A 2C1CA 3CDXA 1BLLE 3A9LA 3MN8A 4JWPA 3V7ZA 4M6IA 3FMCA 4NGTA 3W6SA 2B58A 2PJ8A 4BD9A 1YK3A 4UWJA 4H6UA 4R7MA 3S6GA 3HUVA 3OWCA 5AG5A 2A4NA 4R57A 1ARMA 1VKCA 1QSNA 4NSQA 4NGQA 3SI1A 1R43A 4IK2A 4KOUA 2OZGA 2DF5A 4RUHA 1EE3P 4EFDA 4RI1A 2ZW5A 2DEAA 4NJQA 2C6CA 3SHPA 2BL1A 2YNDA 1BPNA 4MHNA 4XNHB 2HB6A 5IB0A 2G9DA 2IMOA 4CAFA 3WT4A 3VATA 1RXTA 5I4MA 2ANPA 2PJCA 1ZG8A 3F0AA 4HKFA 2Z11A 2I3CA 3K2KA 3PBBA 1JQGA 2J8NA 3TC8A 1CP7A 1IB1E 2CF4A 3CT9A 4OAEA 3LWUA 2OR4A 2AFUA 5DWNA 4JZ0A 4W9YA 2REEA 2OZUA 1KUYA 1CG2A 1VHEA 3PB6X 4UBRA 3G8WA 2Z10A 4NEXA 3RNZA 1WWZA 1Q7LA 3TX8A 8CPAA 4IF5A 3TO7A 3ZZIA 5I0CA 1X12A 5DS0A 3FXTA 3GIUA 1OBRA 4AXVA 2ZEHA 1S5KA 3F5BA 2F8HA 2ZEFA 4GXHA 3R1KA 4KUAA 4P4FA 3D7DA 2G3TA 3CXPA 4PXDA 4UWIA 4BINA 5KTDA 1ARLA 2AFXA 3T90A 1ELLP 2WZNA 1KZFA 3T9YA 3H4QA 2FE7A 2GIVA 4KSFA 4R76A 4MCQA 3VARA 4P45A 2Z3LA 4E0AA 2PR8A 4B5PA 2XEGA 4KZTA 2OU2A 2BOAA 4OP4A 1Q2CA 4R9MA 4B5PB 1TKFA 2P0WA 3RYOA 2GU2A 5HVGA 4KS9A 3PBEA 2R7HA 4C68A 2IL4A 2AE6A 4CYNA 1VHOA 5KTCA 5LRKA 3B7IA 4ONUA 3D68A 2P6GA 3VWEA 4E2AA 4J3GA 2PJ9A 1IYKA 3IJ3A 1XRYA 2PSWA 2IQ6A 3KR5A 2PVWA 1RTQA 2ZW4A 5EC4A 4WJBA 4KOXA 4CAVA 3S9LA 3F8KA 2VEZA 4Y49C 2OB0A 4XPDB 5ISVA 1VIXA 4E8OA 4X2TA 2FCKA 1Z9UA 2AFMA 4MY0A 1S7FA 2VQYA 4H2KA 2PR1A 4FAIA 3LODA 4ZGYB 2YNEA 4DNCA 1GHEA 3B35A 4A32A 2WUUA 3FRMA 2J8RA 1PUAA 3K9UA 4UIBA 1I21A 3EC4A 1MJAA 4F8ZA 2IJZA 5A28A 4CS0B 4MY3A 4UCPA 4L89A 1YR0A 1R57A 3KGQA 4CAXA 4EVYA 3CPAA 4C7IA 2Q4ZA 4ZI6A 2F5IA 1VHSA 4MXUA 1X10A 4OADA 3WR7A 1ELMP 4NGMA 2D4PA 3BI1A 5LYDA 3SJEA 1HEEA 3TE4A 3BLNA 4MFKA 4NGRA 4F6AA 4A38A 4C2YA 1Y7RA 3E0KA 3L2NA 2CNTA 2BCOA 2JDCA 3JVNA 3RZAA 3TO9A 3BI0A 4MHZA 1QSRA 2Q43A 2ZW7A 3I3GA 2Q7SA 1YW4A 4HNYB 3SJFA 1XOVA 4CRYB 1XFOA 5LYFA 1Z4EA 1NSAA 2FT0A 3GB0A 3QB8A 4H89A 4KSAA 4ZBGA 3GKRA 4P4DA 1YREA 4KLWA 4M6GA 3GYAA 3WABA 4AVBA 4DYOA 1FNOA 5DWMA 5A27A 4GM5A 4B13A 2C6PA 1DTDA 5FVJA 4C2XA 4NXYA 1M4GA 4KOSA 2PJ1A 1CJWA 1V0CA 1PYTB 1XMBA 1ZG7A 1DE4C 1ZG9A 2HUZA 4KVOE 3EY5A 3GLJA 2YNCA 4O23A 1Z4RA 3W91A 2O4HA 1LOKA 2J8MA 2QYVA 5F46A 3DGVA 3KZWA 1TKJA 4K30A 5HH1A 1S7KA 5H86A 2D4OA 4CYPA 2P6EA 4G1PA 4M85A 3IU1A 3NH5A 4KORA 2ZEGA 3FIXA 1P4NA 4MHDA 4UF4A 1YQEA 2PDOA 5D29A 3IU2A 2H5MA 1ZLIA 4LUAA 4OC2A 4DUKA 4KVXA 2ZELA 3C26A 3NFZA 2EK9A 4JYWA 5JM6A 3SXOA 3DDDA 4TWEA 2CNSA 2ZEOA 4NFRA 1R3NA 3T8WA 4DJLA 3D3SA 5JQ4A 1HDQA 3IWWA 3H8FA 3B3SA 5THWA 4EWTA 4Y49B 3PB8X 4EMEA 2FIAA 1A2ZA 4M6HA 1BOBA 5J8CA 3BJ8A 3B8GA 1KWMA 5HVFA 3UY5A 2Q7BA 3FECA 3EO4A 2CTBA 3BHXA 2OH1A 3V38A 1AYEA 2EVNA 1S60A 4AB7A 3DNSA 3EFAA 7CPAA 4PSXA 1HDUA 1M1DA 4A37A 2VL1A 4U9ZA 4II9A 4F0XA 3WC5A 4X8IA 4FUUA 1TIQA 2CNMA 1F2PA 2PIYA 4CGOA 1Z8WA 3FJUA 1I1DA 2ZW6A 3FH4A 3FEDA 1KUXA 2PJ2A 3FX6A 4R8FA 5CNPA 1M4IA 4JD6A 5G1ZA 3KHXA 3KR4A 2ZEPA 4OC3A 4KOYA 1UWYA 3KHZA 5LYIA 5J8FA 2ZENA 1TF9A 3QAHA 2FXFA 3TFYA 3LD2A 3NH8A 1QSOA 3KKWA 4FD7A 4QVTA 3CXQA 4F0YA 2EO8A 2FL4A 4PV6A 4B5OA 1N71A 3FVLA 3IIBA 3FB3A 3ZJ0A 1ZO0A 3FBUA 1NE9A 2WSAA 4A94A 4OIDA 5ELYA 3JTKA 2EBJA 1CX8A 1AMPA 5CPAA 1BPMA 4WWVA
chains in the Genus database with same CATH topology
4U9YA 1FY7A 1SQHA 4JLYA 4KUBA 2Q04A 3IGRA 2QMLA 5G21A 4CGMA 2PC1A 3MGDA 4MFZA 2FSRA 2ATRA 2ZXVA 3NE7A 1K4JA 2K5TA 4UFVA 1M4DA 2B3UA 1P0HA 2O28A 2X7BA 3TO6A 4CGLA 4XNHC 3I9SA 4BMHA 4MFQA 2Z3NA 4U5YA 2Z3MA 2QIRA 3S6FA 1WK4A 1M44A 4PK3A 4KLVA 2VZZA 3EXNA 3D8PA 4MFPA 3BJ7A 4HNXB 1QSMA 4A31A 4QUSA 3PZJA 3DSBA 5E96A 2KCWA 4MI4A 4Q36A 1NMTA 1MK4A 2PRBA 2P6FA 3DR8A 3JUWA 2GE3A 1YGHA 4YRHA 2B3VA 5HMNA 1MJBA 4RS2A 5F49A 1S3ZA 4A2ZA 2NMTA 4CYQA 2QECA 4AVAA 1LRZA 3VWDA 5KTAA 5BWAB 4MFJA 2JLMA 4UA3A 1MJ9A 4KOWA 2ZPAA 2YGWA 4B11A 5G22A 1IICA 1UFHA 3TCVA 2ARHA 1YVKA 3R9EA 2Y0MA 2R1IA 4MFLA 4AG9A 3H5ZA 1RO5A 4UFWA 4GS4A 3FNCA 3GY9A 2G3AA 4JXQA 5AG7A 2G0BA 2VZYA 4MJ8A 4XPDC 4XPLA 3PGPA 2DPTA 4QC6A 2CXAA 2PQ8A 3DR6A 4XPKA 2B4BA 1YX0A 2DXQA 4H6ZA 3R9FA 4BBHA 2Z3PA 4X5KA 4A33A 2FS5A 3IWGA 1IYLA 1CM0A 2I79A 1J4JA 3S6HA 3R9GA 2OZHA 2Q4VA 4ORFA 4HNWB 4A95A 2Q44A 3TOBA 1XF8A 4L8AA 4YFJA 4FD5A 1Y9WA 4NF1A 3TTHA 1YLEA 1S7NA 4CAWA 4CGPA 4KVME 1Y9KA 4PSWA 4UCNA 5F48A 5JPHA 2Q0YA 4A30A 3FYNA 5F47A 3IWEA 2EUIA 2CY2A 2R98A 1XE4A 2VBQA 1KUVA 1BO4A 4B10A 2I00A 5H84A 4R3LA 4OLLA 3TOAA 2DPSA 2VI7A 4PK2A 4B12A 2YNCC 2WPXA 3P2HA 4JJXA 2REFA 5AGEA 1B87A 3TT2A 5C88A 1PU9A 2BUEA 4CAEA 2Q4YA 2B5GA 4CYOA 2B5GB 4C7HA 2B4DA 1YVOA 2B4DB 3CXSA 4M3SA 4JXRA 3R96A 2FIWA 1L0CA 3PP9A 1U6MA 1XIXA 3V8IA 3D2MA 2WPWA 1XEBA 2JDDA 4AVCA 3W6XA 4AG7A 1IIDA 1XMTA 1Q2DA 2VXKA 4FD6A 2JEVA 5IV0A 4I49A 5GCNA 1QSTA 2RC4A 3N7ZA 4KOTA 1NSLA 5AG6A 4B14A 2Z0ZA 3G3SA 4R3KA 1Q2YA 4IUSA 2HQYA 1B6BA 3SXNA 1ON0A 5G20A 4UFXA 2R8VA 2Z3KA 4QB9A 4FD4A 1S7LA 2HV2A 4Q38A 3S6KA 4NCZA 4MBUA 2GANA 4CRZB 2C27A 4C2ZA 4UCMA 4QBJA 3D2PA 3R95A 4R87A 4CGNA 1I12A 5EBVA 4YGOA 2AJ6A 5AG4A 2Z3OA 4LX9A 5C82A 2BEIA 2BSWA 4KOVA 1OZPA 3P2FA 5IX3A 3W6SA 3A9LA 4JWPA 2B58A 1YK3A 4UWJA 4H6UA 3S6GA 3OWCA 5AG5A 2A4NA 4R57A 1VKCA 1QSNA 4NSQA 4KOUA 2OZGA 4RI1A 2ZW5A 3SHPA 2BL1A 2YNDA 4XNHB 5IB0A 4CAFA 1RXTA 3F0AA 4HKFA 2Z11A 2J8NA 1IB1E 4OAEA 5DWNA 2REEA 2OZUA 1KUYA 4UBRA 3G8WA 2Z10A 4NEXA 1WWZA 4IF5A 3TO7A 3ZZIA 5I0CA 3FXTA 1S5KA 3F5BA 3R1KA 4KUAA 2G3TA 3CXPA 4UWIA 5KTDA 3T90A 1KZFA 3T9YA 3H4QA 2FE7A 2GIVA 4KSFA 2Z3LA 4E0AA 2PR8A 4B5PA 4KZTA 2OU2A 1Q2CA 4R9MA 4B5PB 2P0WA 3RYOA 4KS9A 4C68A 2R7HA 4CYNA 2IL4A 2AE6A 5KTCA 4ONUA 2P6GA 3VWEA 4E2AA 4J3GA 1IYKA 2PSWA 2ZW4A 5EC4A 4KOXA 4CAVA 3F8KA 2VEZA 4Y49C 2OB0A 4XPDB 5ISVA 4E8OA 2FCKA 1Z9UA 4MY0A 1S7FA 2VQYA 2PR1A 3LODA 4ZGYB 2YNEA 4DNCA 1GHEA 4A32A 2WUUA 3FRMA 2J8RA 1PUAA 3K9UA 1I21A 3EC4A 1MJAA 5A28A 4CS0B 4MY3A 4UCPA 4L89A 1YR0A 1R57A 4CAXA 4EVYA 4C7IA 2F5IA 1VHSA 4OADA 3WR7A 2D4PA 3TE4A 3BLNA 4MFKA 4F6AA 4C2YA 1Y7RA 3E0KA 2CNTA 2JDCA 3JVNA 3TO9A 1QSRA 2ZW7A 3I3GA 4HNYB 4CRYB 1Z4EA 2FT0A 3QB8A 4H89A 4KSAA 4ZBGA 3GKRA 1YREA 4KLWA 4AVBA 3GYAA 5DWMA 5A27A 4B13A 5FVJA 4C2XA 4NXYA 1M4GA 4KOSA 1CJWA 1V0CA 2HUZA 4KVOE 3EY5A 2YNCA 1Z4RA 3W91A 2J8MA 4K30A 5HH1A 1S7KA 5H86A 2D4OA 4CYPA 2P6EA 4M85A 3IU1A 4KORA 3FIXA 4MHDA 1P4NA 2PDOA 3IU2A 2H5MA 4LUAA 4KVXA 3C26A 3SXOA 3DDDA 2CNSA 3D3SA 5JQ4A 4Y49B 2FIAA 1BOBA 5J8CA 3BJ8A 3B8GA 3UY5A 2Q7BA 3EO4A 2OH1A 2EVNA 1S60A 4AB7A 3DNSA 3EFAA 4PSXA 1M1DA 4U9ZA 4II9A 4F0XA 1TIQA 2CNMA 4CGOA 1I1DA 2ZW6A 1KUXA 5CNPA 1M4IA 4JD6A 5G1ZA 4KOYA 5J8FA 3QAHA 2FXFA 3TFYA 3LD2A 4FD7A 1QSOA 3KKWA 4QVTA 4F0YA 3CXQA 2FL4A 4PV6A 4B5OA 1N71A 3FB3A 3ZJ0A 1ZO0A 3FBUA 1NE9A 2WSAA 3JTKA 5F46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9Y A;  1FY7 A;  1SQH A;  4JLY A;  4KUB A;  2Q04 A;  3IGR A;  2QML A;  2PC1 A;  3MGD A;  2FSR A;  2ATR A;  2ZXV A;  3NE7 A;  1K4J A;  2K5T A;  1M4D A;  2B3U A;  1P0H A;  2O28 A;  2X7B A;  3TO6 A;  4XNH C;  3I9S A;  4BMH A;  4U5Y A;  2QIR A;  3S6F A;  1WK4 A;  1M44 A;  4PK3 A;  4KLV A;  2VZZ A;  3EXN A;  3D8P A;  3BJ7 A;  4HNX B;  1QSM A;  4QUS A;  3PZJ A;  3DSB A;  5E96 A;  2KCW A;  4MI4 A;  1NMT A;  1MK4 A;  2PRB A;  2P6F A;  3DR8 A;  3JUW A;  2GE3 A;  1YGH A;  4YRH A;  2B3V A;  5HMN A;  1MJB A;  4RS2 A;  5F49 A;  1S3Z A;  2NMT A;  2QEC A;  4AVA A;  1LRZ A;  3VWD A;  5KTA A;  2JLM A;  4UA3 A;  1MJ9 A;  4KOW A;  2ZPA A;  1IIC A;  1UFH A;  3TCV A;  2ARH A;  1YVK A;  3R9E A;  2Y0M A;  2R1I A;  4AG9 A;  1RO5 A;  4GS4 A;  3FNC A;  3GY9 A;  2G3A A;  4JXQ A;  2G0B A;  2VZY A;  4MJ8 A;  4XPD C;  4XPL A;  3PGP A;  4QC6 A;  2PQ8 A;  3DR6 A;  4XPK A;  2B4B A;  1YX0 A;  2DXQ A;  4H6Z A;  3R9F A;  4X5K A;  2FS5 A;  3IWG A;  1IYL A;  1CM0 A;  2I79 A;  1J4J A;  3S6H A;  3R9G A;  2OZH A;  2Q4V A;  4ORF A;  4HNW B;  2Q44 A;  3TOB A;  1XF8 A;  4L8A A;  4YFJ A;  4FD5 A;  1Y9W A;  4NF1 A;  3TTH A;  1YLE A;  1S7N A;  4CAW A;  4KVM E;  1Y9K A;  4PSW A;  5F48 A;  5JPH A;  2Q0Y A;  3FYN A;  5F47 A;  2EUI A;  2CY2 A;  2R98 A;  1XE4 A;  2VBQ A;  1KUV A;  1BO4 A;  2I00 A;  5H84 A;  4R3L A;  4OLL A;  3TOA A;  2VI7 A;  4PK2 A;  2WPX A;  3P2H A;  4JJX A;  2REF A;  3TT2 A;  1B87 A;  5C88 A;  1PU9 A;  2BUE A;  2Q4Y A;  2B5G A;  2B5G B;  2B4D A;  1YVO A;  2B4D B;  3CXS A;  4M3S A;  4JXR A;  3R96 A;  2FIW A;  1L0C A;  3PP9 A;  1U6M A;  1XIX A;  3V8I A;  3D2M A;  2WPW A;  1XEB A;  2JDD A;  4AVC A;  3W6X A;  4AG7 A;  1IID A;  1XMT A;  1Q2D A;  2VXK A;  4FD6 A;  2JEV A;  5IV0 A;  4I49 A;  5GCN A;  1QST A;  2RC4 A;  3N7Z A;  4KOT A;  1NSL A;  2Z0Z A;  3G3S A;  4R3K A;  1Q2Y A;  4IUS A;  2HQY A;  1B6B A;  3SXN A;  1ON0 A;  2R8V A;  4QB9 A;  4FD4 A;  1S7L A;  2HV2 A;  3S6K A;  4NCZ A;  4MBU A;  2GAN A;  4CRZ B;  2C27 A;  4QBJ A;  3D2P A;  3R95 A;  4R87 A;  1I12 A;  5EBV A;  4YGO A;  2AJ6 A;  4LX9 A;  5C82 A;  2BEI A;  2BSW A;  4KOV A;  1OZP A;  3P2F A;  5IX3 A;  3W6S A;  4JWP A;  2B58 A;  1YK3 A;  4UWJ A;  4H6U A;  3S6G A;  3OWC A;  2A4N A;  4R57 A;  1VKC A;  1QSN A;  4NSQ A;  4KOU A;  2OZG A;  4RI1 A;  2ZW5 A;  3SHP A;  2BL1 A;  4XNH B;  5IB0 A;  1RXT A;  3F0A A;  4HKF A;  2Z11 A;  2J8N A;  1IB1 E;  4OAE A;  5DWN A;  2REE A;  2OZU A;  1KUY A;  4UBR A;  3G8W A;  2Z10 A;  4NEX A;  1WWZ A;  4IF5 A;  3TO7 A;  3ZZI A;  5I0C A;  3FXT A;  1S5K A;  3F5B A;  4KUA A;  3R1K A;  2G3T A;  3CXP A;  4UWI A;  5KTD A;  3T90 A;  1KZF A;  3T9Y A;  3H4Q A;  2FE7 A;  2GIV A;  4E0A A;  2PR8 A;  4B5P A;  4KZT A;  2OU2 A;  1Q2C A;  4R9M A;  4B5P B;  2P0W A;  3RYO A;  2R7H A;  2IL4 A;  2AE6 A;  5KTC A;  4ONU A;  2P6G A;  3VWE A;  4E2A A;  4J3G A;  1IYK A;  2PSW A;  2ZW4 A;  5EC4 A;  4KOX A;  4CAV A;  3F8K A;  2VEZ A;  4Y49 C;  2OB0 A;  4XPD B;  5ISV A;  4E8O A;  2FCK A;  1Z9U A;  4MY0 A;  1S7F A;  2VQY A;  2PR1 A;  3LOD A;  4DNC A;  1GHE A;  3FRM A;  2J8R A;  1PUA A;  3K9U A;  1I21 A;  3EC4 A;  1MJA A;  4CS0 B;  4MY3 A;  4L89 A;  1YR0 A;  1R57 A;  4CAX A;  4EVY A;  2F5I A;  1VHS A;  4OAD A;  3WR7 A;  2D4P A;  3TE4 A;  3BLN A;  4F6A A;  1Y7R A;  3E0K A;  2CNT A;  2JDC A;  3JVN A;  3TO9 A;  1QSR A;  2ZW7 A;  3I3G A;  4HNY B;  4CRY B;  1Z4E A;  2FT0 A;  3QB8 A;  4H89 A;  4ZBG A;  3GKR A;  1YRE A;  4KLW A;  4AVB A;  3GYA A;  5DWM A;  5FVJ A;  4NXY A;  1M4G A;  4KOS A;  1CJW A;  1V0C A;  2HUZ A;  4KVO E;  3EY5 A;  1Z4R A;  3W91 A;  2J8M A;  4K30 A;  5HH1 A;  1S7K A;  5H86 A;  2D4O A;  2P6E A;  4M85 A;  4KOR A;  3FIX A;  4MHD A;  1P4N A;  2PDO A;  2H5M A;  4LUA A;  4KVX A;  3C26 A;  3SXO A;  3DDD A;  2CNS A;  3D3S A;  5JQ4 A;  4Y49 B;  2FIA A;  1BOB A;  5J8C A;  3BJ8 A;  3B8G A;  3UY5 A;  2Q7B A;  3EO4 A;  2OH1 A;  2EVN A;  1S60 A;  4AB7 A;  3DNS A;  3EFA A;  4PSX A;  1M1D A;  4U9Z A;  4II9 A;  1TIQ A;  2CNM A;  1I1D A;  2ZW6 A;  1KUX A;  5CNP A;  1M4I A;  4JD6 A;  4KOY A;  5J8F A;  3QAH A;  2FXF A;  3TFY A;  3LD2 A;  4FD7 A;  1QSO A;  3KKW A;  4QVT A;  4F0Y A;  3CXQ A;  2FL4 A;  4PV6 A;  4B5O A;  1N71 A;  3FB3 A;  3ZJ0 A;  3FBU A;  1NE9 A;  5F46 A; 
#chains in the Genus database with same CATH topology
 3KAS A;  2EK8 A;  4U9Y A;  1FY7 A;  1SQH A;  4JLY A;  4KUB A;  4MHY A;  2Q04 A;  2J9A A;  3IGR A;  2QML A;  3MRU A;  5G21 A;  3PFE A;  4CGM A;  2PC1 A;  3MGD A;  4MFZ A;  2FSR A;  1H8L A;  2ATR A;  2ZXV A;  3NE7 A;  1YW6 A;  4XPD C;  1K4J A;  4PXC A;  2K5T A;  3B3W A;  1M4D A;  2WYR A;  4UFV A;  1F57 A;  3PB9 X;  2B3U A;  1P0H A;  2V8V A;  2O28 A;  1Z5R A;  2X7B A;  4OC4 A;  4NGS A;  4RN7 A;  3TO6 A;  1JWQ A;  4CGL A;  2AFW A;  3NA6 A;  4K3N A;  2Q51 A;  4XNH C;  3I9S A;  4BMH A;  4MFQ A;  2Z3N A;  4U5Y A;  2Z3M A;  1QMU A;  2QIR A;  2JEW A;  1WK4 A;  4IAV A;  1LAM A;  5EMI A;  1M44 A;  3S6F A;  4OKO A;  2RB7 A;  5K8P A;  2PJA A;  4PXE A;  4F9V A;  4P4J A;  2POK A;  2ZEM A;  5IX3 A;  3PEI A;  4PK3 A;  4KLV A;  5JGF A;  2O53 A;  2VZZ A;  2PJ4 A;  3D8P A;  3EXN A;  1TKH A;  2ZOF A;  2CTC A;  4CPA A;  5J1Q A;  5CBM A;  1IOF A;  2GRE A;  4MFP A;  3BJ7 A;  3CPX A;  2NYQ A;  1QSM A;  4HNX B;  4A31 A;  4QUS A;  1IU8 A;  3PZJ A;  4OIW A;  4ONW A;  3DSB A;  1IOI A;  1LCP A;  2KCW A;  3D4U A;  5E96 A;  4MI4 A;  4Q36 A;  5JH9 A;  2FVG A;  2PJB A;  1LFW A;  1VGY A;  1BAV A;  1FT7 A;  1NMT A;  1MK4 A;  2PRB A;  3SJX A;  2P6F A;  3DR8 A;  4NJR A;  3JUW A;  1Z8L A;  5K8N A;  2GE3 A;  3KI9 A;  1YGH A;  3BXM A;  4P4B A;  4YRH A;  2OOT A;  1XBU A;  2B3V A;  2V8G A;  1MJB A;  2PIZ A;  5HMN A;  5LYL A;  3H8G A;  4RS2 A;  5F49 A;  1S3Z A;  3PFO A;  4YWY A;  2NMT A;  4A2Z A;  4CYQ A;  2QEC A;  4AVA A;  1LRZ A;  3HLP A;  3KQX A;  3VWD A;  3WC6 A;  5KTA A;  5BWA B;  4MFJ A;  2JLM A;  2PE3 A;  4UA3 A;  1MJ9 A;  2PVV A;  4KOW A;  3KL9 A;  2ZPA A;  2YGW A;  4B11 A;  5G22 A;  1IIC A;  1CPX A;  1UFH A;  3TCV A;  2ARH A;  1YVK A;  3R9E A;  4P10 A;  1LAP A;  2R1I A;  2Y0M A;  4MFL A;  4NGP A;  4AG9 A;  3H5Z A;  1RO5 A;  4UFW A;  1Z8X A;  3PB4 X;  2QJ8 A;  2ODF A;  4GS4 A;  1CP6 A;  4LQ6 A;  3FNC A;  4PXB A;  3RO0 A;  3GY9 A;  4MHP A;  3VH9 A;  2G3A A;  5HXD A;  4JXQ A;  5AG7 A;  2G0B A;  4UEZ A;  4NGN A;  2C6G A;  1QQ9 A;  1TF8 A;  2BO9 A;  2VZY A;  3D66 A;  1Z8T A;  3D7H A;  3PGP A;  4MJ8 A;  2DPT A;  2PJ7 A;  4P4E A;  4QC6 A;  2CXA A;  2PQ8 A;  3DR6 A;  3SI2 A;  2ABZ A;  4XPK A;  3RBU A;  2B4B A;  3PB7 X;  1YX0 A;  2DXQ A;  4H6Z A;  3R9F A;  4BBH A;  2Z3P A;  4PQA A;  4UIA A;  4X5K A;  4A33 A;  4UEE A;  2FS5 A;  4OC1 A;  3IWG A;  1IYL A;  2GLJ A;  1CM0 A;  2GFQ A;  4KSI A;  2I79 A;  4YU9 A;  4P4I A;  1J4J A;  3S6H A;  3R9G A;  4Q7A A;  1XJO A;  4XPL A;  2OZH A;  2Q4V A;  4ORF A;  4HNW B;  4A95 A;  2Q44 A;  4OME A;  5F09 A;  3N5F A;  3TOB A;  1XF8 A;  4X3R A;  4L8A A;  4P6Y A;  4ZX9 A;  4YFJ A;  4FD5 A;  1Y9W A;  4NF1 A;  3TTH A;  4UEF A;  1LAN A;  1YLE A;  3SI0 A;  2ZED A;  1S7N A;  2XEF A;  4P44 A;  4CAW A;  4CGP A;  4KVM E;  1Y9K A;  3SJG A;  4PSW A;  4UCN A;  5F48 A;  5JPH A;  4A39 A;  2Q0Y A;  2PJ0 A;  3K9T A;  4A30 A;  3FYN A;  5F47 A;  2RFH A;  3DLJ A;  4MMO A;  1Y0Y A;  5K8M A;  2EWB A;  4ZX8 A;  3IWE A;  4MCS A;  3JRU A;  3NH4 A;  2EUI A;  2CY2 A;  2R98 A;  2F7V A;  3IFE A;  1XE4 A;  2JBK A;  1KUV A;  2VBQ A;  2PRQ A;  1BO4 A;  4MCR A;  4ZY1 A;  4OC5 A;  4B10 A;  2I00 A;  5H84 A;  2AFO A;  4OLL A;  4R3L A;  2PJ5 A;  2DPS A;  3TOA A;  4F9U A;  3WC7 A;  1IGB A;  2HC9 A;  5LRJ A;  2PCU A;  2CIJ A;  1TXR A;  2VI7 A;  3PRT A;  3ISZ A;  4MCP A;  4PK2 A;  4B12 A;  3I1U A;  2YNC C;  2WPX A;  3P2H A;  4FBE A;  3D7F A;  4JJX A;  2REF A;  2ZOG A;  5AGE A;  1B87 A;  3TT2 A;  5C88 A;  1PU9 A;  2V77 A;  2BUE A;  4CAE A;  4B6Z A;  2Q4Y A;  2B5G A;  3S9M A;  4MRI A;  4CYO A;  2B5G B;  4HPS A;  4C7H A;  2B4D A;  3QAY A;  1CBX A;  1YVO A;  2AFS A;  2B4D B;  3CXS A;  1YSJ A;  3B3T A;  4M3S A;  3FEE A;  4JXR A;  2ZEE A;  3NE8 A;  4ZY0 A;  3R96 A;  3S9N A;  2FIW A;  1L0C A;  3PP9 A;  1U6M A;  1XIX A;  3V8I A;  3D2M A;  3FF3 A;  2JBJ A;  2WPW A;  2NSM A;  1XEB A;  1Y7E A;  3B3C A;  2JDD A;  3D67 A;  3LAC A;  1AUG A;  3W6X A;  4AG7 A;  4AVC A;  4ZYQ A;  1IID A;  3ISX A;  5IB9 A;  3IC1 A;  1PCA A;  1XMT A;  1M4L A;  1Q2D A;  5D8N A;  2VXK A;  4FD6 A;  2JEV A;  3H8E A;  2QVP A;  5IV0 A;  4I49 A;  4TNU A;  5GCN A;  1QST A;  1YME A;  1ZLH A;  3IO1 A;  2RC4 A;  3N7Z A;  4IHM A;  3QNV A;  4FWU A;  4KOT A;  3IEH A;  1Z2L A;  1NSL A;  3B3V A;  1F2O A;  3RAM A;  5K8O A;  5AG6 A;  4B14 A;  2Z0Z A;  1Y0R A;  3CZX A;  1GYT A;  3G3S A;  4R3K A;  5LRG A;  1Q2Y A;  2HQY A;  2XEJ A;  4IUS A;  1B6B A;  4ZY2 A;  3SXN A;  1ON0 A;  5G20 A;  5HVH A;  4UFX A;  2R8V A;  2Z3K A;  2V8H A;  4QB9 A;  4FD4 A;  1IY7 A;  1S7L A;  2HV2 A;  3B2Y A;  4Q38 A;  3S6K A;  4NCZ A;  4Z65 A;  4MBU A;  6CPA A;  2GAN A;  3KQZ A;  4CRZ B;  2C27 A;  4OC0 A;  1YLO A;  4C2Z A;  4UCM A;  1CPS A;  4QBJ A;  2XEI A;  3D2P A;  2V8D A;  3R95 A;  4R87 A;  4CGN A;  1I12 A;  2AFZ A;  3D7G A;  5EBV A;  4YGO A;  2AJ6 A;  5AG4 A;  3GUX A;  2Z3O A;  3LMS A;  4LX9 A;  5C82 A;  2PJ6 A;  4LQG A;  2BEI A;  2BSW A;  4KOV A;  4R6T A;  2GLF A;  4PPZ A;  1OZP A;  3P2F A;  2PJ3 A;  2C1C A;  3CDX A;  1BLL E;  3A9L A;  3MN8 A;  4JWP A;  3V7Z A;  4M6I A;  3FMC A;  4NGT A;  3W6S A;  2B58 A;  2PJ8 A;  4BD9 A;  1YK3 A;  4UWJ A;  4H6U A;  4R7M A;  3S6G A;  3HUV A;  3OWC A;  5AG5 A;  2A4N A;  4R57 A;  1ARM A;  1VKC A;  1QSN A;  4NSQ A;  4NGQ A;  3SI1 A;  1R43 A;  4IK2 A;  4KOU A;  2OZG A;  2DF5 A;  4RUH A;  1EE3 P;  4EFD A;  4RI1 A;  2ZW5 A;  2DEA A;  4NJQ A;  2C6C A;  3SHP A;  2BL1 A;  2YND A;  1BPN A;  4MHN A;  4XNH B;  2HB6 A;  5IB0 A;  2G9D A;  2IMO A;  4CAF A;  3WT4 A;  3VAT A;  1RXT A;  5I4M A;  2ANP A;  2PJC A;  1ZG8 A;  3F0A A;  4HKF A;  2Z11 A;  2I3C A;  3K2K A;  3PBB A;  1JQG A;  2J8N A;  3TC8 A;  1CP7 A;  1IB1 E;  2CF4 A;  3CT9 A;  4OAE A;  3LWU A;  2OR4 A;  2AFU A;  5DWN A;  4JZ0 A;  4W9Y A;  2REE A;  2OZU A;  1KUY A;  1CG2 A;  1VHE A;  3PB6 X;  4UBR A;  3G8W A;  2Z10 A;  4NEX A;  3RNZ A;  1WWZ A;  1Q7L A;  3TX8 A;  8CPA A;  4IF5 A;  3TO7 A;  3ZZI A;  5I0C A;  1X12 A;  5DS0 A;  3FXT A;  3GIU A;  1OBR A;  4AXV A;  2ZEH A;  1S5K A;  3F5B A;  2F8H A;  2ZEF A;  4GXH A;  3R1K A;  4KUA A;  4P4F A;  3D7D A;  2G3T A;  3CXP A;  4PXD A;  4UWI A;  4BIN A;  5KTD A;  1ARL A;  2AFX A;  3T90 A;  1ELL P;  2WZN A;  1KZF A;  3T9Y A;  3H4Q A;  2FE7 A;  2GIV A;  4KSF A;  4R76 A;  4MCQ A;  3VAR A;  4P45 A;  2Z3L A;  4E0A A;  2PR8 A;  4B5P A;  2XEG A;  4KZT A;  2OU2 A;  2BOA A;  4OP4 A;  1Q2C A;  4R9M A;  4B5P B;  1TKF A;  2P0W A;  3RYO A;  2GU2 A;  5HVG A;  4KS9 A;  3PBE A;  2R7H A;  4C68 A;  2IL4 A;  2AE6 A;  4CYN A;  1VHO A;  5KTC A;  5LRK A;  3B7I A;  4ONU A;  3D68 A;  2P6G A;  3VWE A;  4E2A A;  4J3G A;  2PJ9 A;  1IYK A;  3IJ3 A;  1XRY A;  2PSW A;  2IQ6 A;  3KR5 A;  2PVW A;  1RTQ A;  2ZW4 A;  5EC4 A;  4WJB A;  4KOX A;  4CAV A;  3S9L A;  3F8K A;  2VEZ A;  4Y49 C;  2OB0 A;  4XPD B;  5ISV A;  1VIX A;  4E8O A;  4X2T A;  2FCK A;  1Z9U A;  2AFM A;  4MY0 A;  1S7F A;  2VQY A;  4H2K A;  2PR1 A;  4FAI A;  3LOD A;  4ZGY B;  2YNE A;  4DNC A;  1GHE A;  3B35 A;  4A32 A;  2WUU A;  3FRM A;  2J8R A;  1PUA A;  3K9U A;  4UIB A;  1I21 A;  3EC4 A;  1MJA A;  4F8Z A;  2IJZ A;  5A28 A;  4CS0 B;  4MY3 A;  4UCP A;  4L89 A;  1YR0 A;  1R57 A;  3KGQ A;  4CAX A;  4EVY A;  3CPA A;  4C7I A;  2Q4Z A;  4ZI6 A;  2F5I A;  1VHS A;  4MXU A;  1X10 A;  4OAD A;  3WR7 A;  1ELM P;  4NGM A;  2D4P A;  3BI1 A;  5LYD A;  3SJE A;  1HEE A;  3TE4 A;  3BLN A;  4MFK A;  4NGR A;  4F6A A;  4A38 A;  4C2Y A;  1Y7R A;  3E0K A;  3L2N A;  2CNT A;  2BCO A;  2JDC A;  3JVN A;  3RZA A;  3TO9 A;  3BI0 A;  4MHZ A;  1QSR A;  2Q43 A;  2ZW7 A;  3I3G A;  2Q7S A;  1YW4 A;  4HNY B;  3SJF A;  1XOV A;  4CRY B;  1XFO A;  5LYF A;  1Z4E A;  1NSA A;  2FT0 A;  3GB0 A;  3QB8 A;  4H89 A;  4KSA A;  4ZBG A;  3GKR A;  4P4D A;  1YRE A;  4KLW A;  4M6G A;  3GYA A;  3WAB A;  4AVB A;  4DYO A;  1FNO A;  5DWM A;  5A27 A;  4GM5 A;  4B13 A;  2C6P A;  1DTD A;  5FVJ A;  4C2X A;  4NXY A;  1M4G A;  4KOS A;  2PJ1 A;  1CJW A;  1V0C A;  1PYT B;  1XMB A;  1ZG7 A;  1DE4 C;  1ZG9 A;  2HUZ A;  4KVO E;  3EY5 A;  3GLJ A;  2YNC A;  4O23 A;  1Z4R A;  3W91 A;  2O4H A;  1LOK A;  2J8M A;  2QYV A;  5F46 A;  3DGV A;  3KZW A;  1TKJ A;  4K30 A;  5HH1 A;  1S7K A;  5H86 A;  2D4O A;  4CYP A;  2P6E A;  4G1P A;  4M85 A;  3IU1 A;  3NH5 A;  4KOR A;  2ZEG A;  3FIX A;  1P4N A;  4MHD A;  4UF4 A;  1YQE A;  2PDO A;  5D29 A;  3IU2 A;  2H5M A;  1ZLI A;  4LUA A;  4OC2 A;  4DUK A;  4KVX A;  2ZEL A;  3C26 A;  3NFZ A;  2EK9 A;  4JYW A;  5JM6 A;  3SXO A;  3DDD A;  4TWE A;  2CNS A;  2ZEO A;  4NFR A;  1R3N A;  3T8W A;  4DJL A;  3D3S A;  5JQ4 A;  1HDQ A;  3IWW A;  3H8F A;  3B3S A;  5THW A;  4EWT A;  4Y49 B;  3PB8 X;  4EME A;  2FIA A;  1A2Z A;  4M6H A;  1BOB A;  5J8C A;  3BJ8 A;  3B8G A;  1KWM A;  5HVF A;  3UY5 A;  2Q7B A;  3FEC A;  3EO4 A;  2CTB A;  3BHX A;  2OH1 A;  3V38 A;  1AYE A;  2EVN A;  1S60 A;  4AB7 A;  3DNS A;  3EFA A;  7CPA A;  4PSX A;  1HDU A;  1M1D A;  4A37 A;  2VL1 A;  4U9Z A;  4II9 A;  4F0X A;  3WC5 A;  4X8I A;  4FUU A;  1TIQ A;  2CNM A;  1F2P A;  2PIY A;  4CGO A;  1Z8W A;  3FJU A;  1I1D A;  2ZW6 A;  3FH4 A;  3FED A;  1KUX A;  2PJ2 A;  3FX6 A;  4R8F A;  5CNP A;  1M4I A;  4JD6 A;  5G1Z A;  3KHX A;  3KR4 A;  2ZEP A;  4OC3 A;  4KOY A;  1UWY A;  3KHZ A;  5LYI A;  5J8F A;  2ZEN A;  1TF9 A;  3QAH A;  2FXF A;  3TFY A;  3LD2 A;  3NH8 A;  1QSO A;  3KKW A;  4FD7 A;  4QVT A;  3CXQ A;  4F0Y A;  2EO8 A;  2FL4 A;  4PV6 A;  4B5O A;  1N71 A;  3FVL A;  3IIB A;  3FB3 A;  3ZJ0 A;  1ZO0 A;  3FBU A;  1NE9 A;  2WSA A;  4A94 A;  4OID A;  5ELY A;  3JTK A;  2EBJ A;  1CX8 A;  1AMP A;  5CPA A;  1BPM A;  4WWV A; 
#chains in the Genus database with same CATH homology
 4U9Y A;  1FY7 A;  1SQH A;  4JLY A;  4KUB A;  2Q04 A;  3IGR A;  2QML A;  5G21 A;  4CGM A;  2PC1 A;  3MGD A;  4MFZ A;  2FSR A;  2ATR A;  2ZXV A;  3NE7 A;  1K4J A;  2K5T A;  4UFV A;  1M4D A;  2B3U A;  1P0H A;  2O28 A;  2X7B A;  3TO6 A;  4CGL A;  4XNH C;  3I9S A;  4BMH A;  4MFQ A;  2Z3N A;  4U5Y A;  2Z3M A;  2QIR A;  3S6F A;  1WK4 A;  1M44 A;  4PK3 A;  4KLV A;  2VZZ A;  3EXN A;  3D8P A;  4MFP A;  3BJ7 A;  4HNX B;  1QSM A;  4A31 A;  4QUS A;  3PZJ A;  3DSB A;  5E96 A;  2KCW A;  4MI4 A;  4Q36 A;  1NMT A;  1MK4 A;  2PRB A;  2P6F A;  3DR8 A;  3JUW A;  2GE3 A;  1YGH A;  4YRH A;  2B3V A;  5HMN A;  1MJB A;  4RS2 A;  5F49 A;  1S3Z A;  4A2Z A;  2NMT A;  4CYQ A;  2QEC A;  4AVA A;  1LRZ A;  3VWD A;  5KTA A;  5BWA B;  4MFJ A;  2JLM A;  4UA3 A;  1MJ9 A;  4KOW A;  2ZPA A;  2YGW A;  4B11 A;  5G22 A;  1IIC A;  1UFH A;  3TCV A;  2ARH A;  1YVK A;  3R9E A;  2Y0M A;  2R1I A;  4MFL A;  4AG9 A;  3H5Z A;  1RO5 A;  4UFW A;  4GS4 A;  3FNC A;  3GY9 A;  2G3A A;  4JXQ A;  5AG7 A;  2G0B A;  2VZY A;  4MJ8 A;  4XPD C;  4XPL A;  3PGP A;  2DPT A;  4QC6 A;  2CXA A;  2PQ8 A;  3DR6 A;  4XPK A;  2B4B A;  1YX0 A;  2DXQ A;  4H6Z A;  3R9F A;  4BBH A;  2Z3P A;  4X5K A;  4A33 A;  2FS5 A;  3IWG A;  1IYL A;  1CM0 A;  2I79 A;  1J4J A;  3S6H A;  3R9G A;  2OZH A;  2Q4V A;  4ORF A;  4HNW B;  4A95 A;  2Q44 A;  3TOB A;  1XF8 A;  4L8A A;  4YFJ A;  4FD5 A;  1Y9W A;  4NF1 A;  3TTH A;  1YLE A;  1S7N A;  4CAW A;  4CGP A;  4KVM E;  1Y9K A;  4PSW A;  4UCN A;  5F48 A;  5JPH A;  2Q0Y A;  4A30 A;  3FYN A;  5F47 A;  3IWE A;  2EUI A;  2CY2 A;  2R98 A;  1XE4 A;  2VBQ A;  1KUV A;  1BO4 A;  4B10 A;  2I00 A;  5H84 A;  4R3L A;  4OLL A;  3TOA A;  2DPS A;  2VI7 A;  4PK2 A;  4B12 A;  2YNC C;  2WPX A;  3P2H A;  4JJX A;  2REF A;  5AGE A;  1B87 A;  3TT2 A;  5C88 A;  1PU9 A;  2BUE A;  4CAE A;  2Q4Y A;  2B5G A;  4CYO A;  2B5G B;  4C7H A;  2B4D A;  1YVO A;  2B4D B;  3CXS A;  4M3S A;  4JXR A;  3R96 A;  2FIW A;  1L0C A;  3PP9 A;  1U6M A;  1XIX A;  3V8I A;  3D2M A;  2WPW A;  1XEB A;  2JDD A;  4AVC A;  3W6X A;  4AG7 A;  1IID A;  1XMT A;  1Q2D A;  2VXK A;  4FD6 A;  2JEV A;  5IV0 A;  4I49 A;  5GCN A;  1QST A;  2RC4 A;  3N7Z A;  4KOT A;  1NSL A;  5AG6 A;  4B14 A;  2Z0Z A;  3G3S A;  4R3K A;  1Q2Y A;  4IUS A;  2HQY A;  1B6B A;  3SXN A;  1ON0 A;  5G20 A;  4UFX A;  2R8V A;  2Z3K A;  4QB9 A;  4FD4 A;  1S7L A;  2HV2 A;  4Q38 A;  3S6K A;  4NCZ A;  4MBU A;  2GAN A;  4CRZ B;  2C27 A;  4C2Z A;  4UCM A;  4QBJ A;  3D2P A;  3R95 A;  4R87 A;  4CGN A;  1I12 A;  5EBV A;  4YGO A;  2AJ6 A;  5AG4 A;  2Z3O A;  4LX9 A;  5C82 A;  2BEI A;  2BSW A;  4KOV A;  1OZP A;  3P2F A;  5IX3 A;  3W6S A;  3A9L A;  4JWP A;  2B58 A;  1YK3 A;  4UWJ A;  4H6U A;  3S6G A;  3OWC A;  5AG5 A;  2A4N A;  4R57 A;  1VKC A;  1QSN A;  4NSQ A;  4KOU A;  2OZG A;  4RI1 A;  2ZW5 A;  3SHP A;  2BL1 A;  2YND A;  4XNH B;  5IB0 A;  4CAF A;  1RXT A;  3F0A A;  4HKF A;  2Z11 A;  2J8N A;  1IB1 E;  4OAE A;  5DWN A;  2REE A;  2OZU A;  1KUY A;  4UBR A;  3G8W A;  2Z10 A;  4NEX A;  1WWZ A;  4IF5 A;  3TO7 A;  3ZZI A;  5I0C A;  3FXT A;  1S5K A;  3F5B A;  3R1K A;  4KUA A;  2G3T A;  3CXP A;  4UWI A;  5KTD A;  3T90 A;  1KZF A;  3T9Y A;  3H4Q A;  2FE7 A;  2GIV A;  4KSF A;  2Z3L A;  4E0A A;  2PR8 A;  4B5P A;  4KZT A;  2OU2 A;  1Q2C A;  4R9M A;  4B5P B;  2P0W A;  3RYO A;  4KS9 A;  4C68 A;  2R7H A;  4CYN A;  2IL4 A;  2AE6 A;  5KTC A;  4ONU A;  2P6G A;  3VWE A;  4E2A A;  4J3G A;  1IYK A;  2PSW A;  2ZW4 A;  5EC4 A;  4KOX A;  4CAV A;  3F8K A;  2VEZ A;  4Y49 C;  2OB0 A;  4XPD B;  5ISV A;  4E8O A;  2FCK A;  1Z9U A;  4MY0 A;  1S7F A;  2VQY A;  2PR1 A;  3LOD A;  4ZGY B;  2YNE A;  4DNC A;  1GHE A;  4A32 A;  2WUU A;  3FRM A;  2J8R A;  1PUA A;  3K9U A;  1I21 A;  3EC4 A;  1MJA A;  5A28 A;  4CS0 B;  4MY3 A;  4UCP A;  4L89 A;  1YR0 A;  1R57 A;  4CAX A;  4EVY A;  4C7I A;  2F5I A;  1VHS A;  4OAD A;  3WR7 A;  2D4P A;  3TE4 A;  3BLN A;  4MFK A;  4F6A A;  4C2Y A;  1Y7R A;  3E0K A;  2CNT A;  2JDC A;  3JVN A;  3TO9 A;  1QSR A;  2ZW7 A;  3I3G A;  4HNY B;  4CRY B;  1Z4E A;  2FT0 A;  3QB8 A;  4H89 A;  4KSA A;  4ZBG A;  3GKR A;  1YRE A;  4KLW A;  4AVB A;  3GYA A;  5DWM A;  5A27 A;  4B13 A;  5FVJ A;  4C2X A;  4NXY A;  1M4G A;  4KOS A;  1CJW A;  1V0C A;  2HUZ A;  4KVO E;  3EY5 A;  2YNC A;  1Z4R A;  3W91 A;  2J8M A;  4K30 A;  5HH1 A;  1S7K A;  5H86 A;  2D4O A;  4CYP A;  2P6E A;  4M85 A;  3IU1 A;  4KOR A;  3FIX A;  4MHD A;  1P4N A;  2PDO A;  3IU2 A;  2H5M A;  4LUA A;  4KVX A;  3C26 A;  3SXO A;  3DDD A;  2CNS A;  3D3S A;  5JQ4 A;  4Y49 B;  2FIA A;  1BOB A;  5J8C A;  3BJ8 A;  3B8G A;  3UY5 A;  2Q7B A;  3EO4 A;  2OH1 A;  2EVN A;  1S60 A;  4AB7 A;  3DNS A;  3EFA A;  4PSX A;  1M1D A;  4U9Z A;  4II9 A;  4F0X A;  1TIQ A;  2CNM A;  4CGO A;  1I1D A;  2ZW6 A;  1KUX A;  5CNP A;  1M4I A;  4JD6 A;  5G1Z A;  4KOY A;  5J8F A;  3QAH A;  2FXF A;  3TFY A;  3LD2 A;  4FD7 A;  1QSO A;  3KKW A;  4QVT A;  4F0Y A;  3CXQ A;  2FL4 A;  4PV6 A;  4B5O A;  1N71 A;  3FB3 A;  3ZJ0 A;  1ZO0 A;  3FBU A;  1NE9 A;  2WSA A;  3JTK A;  5F46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...