1XECA

Dimeric bovine tissue-extracted decorin, crystal form 2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
305
structure length
305
Chain Sequence
GPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Decorin
publication title Crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
pubmed doi rcsb
molecule tags Structural protein
total genus 110
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xecA00
4J0MA 4GLPA 3ZYOA 3ZYIA 4Q3GA 2OMXA 5AWAA 4Y61B 1G9UA 1IO0A 2OMVA 3ZYNA 4R5CA 4AW4A 1OGQA 2V9SA 3WPIA 3ZYJA 4R58A 3C6OB 2WQXA 4V2CA 4C2BB 3RW7A 3W3GA 3WPEA 2OMWA 3P72A 4U7LA 4CC4C 4R09A 2BNHA 1FQVA 1K5GC 3W3JA 3WPFA 4TZHA 4BSUA 4CNCA 4L3FA 3CIYA 1SQ0B 4XSQA 2XOTA 1K5DC 4PKIG 4AY9X 5B4PA 4KXFB 1M10B 2RR6A 1YRGA 1M9SA 4FMZA 3C6PB 4LSXA 1JL5A 1M9LA 4U06A 4NKHA 1P8VA 3RGZA 3OJAB 4V2EA 3WPCA 2WQWA 4FCGA 1A9NA 3RIZA 3RGXA 2ASSB 5AWBA 4L3AA 4ECNA 4R07A 3CIGA 2ELLA 2Z7XA 4R6GA 4M7EC 5AWCA 1XWDC 3ULAA 2WQUA 1Z7XW 3RFEA 4MN8B 4FS7A 4RWTC 2Z64A 3E3ZA 4KT1A 1OTOA 3CVRA 1H6TA 4Z64C 3GOZA 4ARNA 5A5CA 4RCWA 1OTMA 4BSSA 2UZXA 4LI2A 2OMYA 1FO1A 3OGKB 3TSRE 5GS0A 3WPGA 3UL7A 4PEQB 4R08A 5FTTB 1O6SA 2P1MB 1KOHA 4R6AA 2P1NB 3VQ1A 4P8SA 3RJ0A 4U08A 3VQ2A 4Q3IA 1DS9A 2R9UA 3UN9A 1OOKG 2Z62A 2JE0A 4QBZA 2JQDA 1O6VA 3KJ4A 2BEXA 2ID5A 2Z82A 3WN4A 2Z65A 4YEBB 2O6RA 4ARRA 3E4GA 4RCAB 5GMHA 2V9TB 1XCDA 2JE1A 2OMTA 2P1QB 4C2AB 4BSRA 5GMFA 3W3NA 3O6NA 3UL9A 4LSXC 2Z7XB 1U0ND 4R0AA 4ECOA 2Y5QA 5HDHA 3E6JA 2RA8A 4LXSA 4Z94G 5GS2B 1KOOA 5CMPA 5B0NA 3SB4A 5AZ5A 1P9AG 3A79B 4FDWA 4H09A 2Q4GW 4QC0A 2Z66A 2WFHA 4PERA 3WPHA 1M0ZA 4CP6A 2FT3A 5IYXC 3W3MA 4U09A 1XEUA 1XECA 1LTXA 2OMUA 4M7EA 3ULUA 4WP6A 2O6SA 2A0ZA 3BZ5A 4R6JA 4J4LA 3RW6A 4XGOA 2P1OB 5HZLB 4EZGA 2O6QA 4OQTA 3WPBA 5D3IA 4PQ8A 5B0TA 1ZIWA 4LSCA 3RFSA 1D0BA 3O53A 4FHOA 5IJBA 2CA6A 4WYKA 4Z8GA 4HQ1A 3M19A 3E2JA 4CNMA 1FS2A 5IJDA 4KNGA 1P8TA 4I6JB 4Q62A 4GT6A 1W8AA 3REZA 3ULVA 4MQWX 1DCEA 1OTNA 1DFJI 1PGVA 1A4YA 3WPDA 2Z81A 3FXIA 2XWTC 2Z63A 4R5DA 4QXEA 3OGLB 4CC4A 4K17A 4G8AA 5AWDA 2V70A 5CMNA 4BV4R 3W3LA 1H6UA 4Z61C 1OZNA 5LFNA 3G06A 3JB9j 4LSAA 3M18A 5IJCA 3C6NB 5GQRK 3PMHG 2ASTB 2P1PB 4Z79A 4B8CD 3OGMB 4FD0A 3G3BA 4LXRA 4LI1A 3G04C 4IM6A 5GMGA 1QYYA 4PSJA 1WWLA 4V2DA 3DZEA 4XOSA 1FT8A 4R6FA 2WQVA 3G39A 4P91A 2IFGA 2UZYA 1XKUA 3OJAA 3UL8A 1GWBA 4CILA 4NKGA 2OMZA 4UFRA 3RFJA 3W3KA 1O6TA 3G3AA
chains in the Genus database with same CATH superfamily
4NZRM 4J0MA 4GLPA 3ZYOA 3ZYIA 4Q3GA 2OMXA 5AWAA 4Y61B 1G9UA 1IO0A 2OMVA 3ZYNA 4R5CA 4AW4A 1OGQA 2V9SA 3WPIA 3ZYJA 4R58A 3C6OB 2WQXA 4V2CA 4C2BB 3RW7A 3W3GA 3WPEA 2OMWA 3P72A 4U7LA 4CC4C 4R09A 2BNHA 1FQVA 1K5GC 3W3JA 3WPFA 4TZHA 4BSUA 4CNCA 4L3FA 3CIYA 1SQ0B 4XSQA 2XOTA 1K5DC 4PKIG 4AY9X 5B4PA 4KXFB 1M10B 2RR6A 1YRGA 1M9SA 4FMZA 3C6PB 4LSXA 1JL5A 1M9LA 4U06A 4NKHA 1P8VA 3RGZA 3OJAB 4V2EA 3WPCA 2WQWA 4FCGA 1A9NA 3RIZA 3RGXA 2ASSB 5AWBA 4L3AA 4ECNA 4R07A 3CIGA 2ELLA 2Z7XA 4R6GA 4M7EC 5AWCA 1XWDC 3ULAA 2WQUA 1Z7XW 3RFEA 4MN8B 4FS7A 4RWTC 2Z64A 3E3ZA 4KT1A 1OTOA 3CVRA 1H6TA 4Z64C 3GOZA 4ARNA 5A5CA 4RCWA 1OTMA 4BSSA 2UZXA 4LI2A 2OMYA 1FO1A 3OGKB 3TSRE 5GS0A 3WPGA 3UL7A 4PEQB 4R08A 5FTTB 1O6SA 2P1MB 1KOHA 4R6AA 2P1NB 3VQ1A 4P8SA 3RJ0A 4U08A 3VQ2A 4Q3IA 1DS9A 2R9UA 3UN9A 1OOKG 2Z62A 2JE0A 4QBZA 2JQDA 1O6VA 3KJ4A 2BEXA 2ID5A 2Z82A 3WN4A 2Z65A 4YEBB 2O6RA 4ARRA 3E4GA 4RCAB 5GMHA 2V9TB 1XCDA 2JE1A 2OMTA 2P1QB 4C2AB 4BSRA 4NZTM 5GMFA 3W3NA 3O6NA 3UL9A 4LSXC 2Z7XB 1U0ND 4R0AA 4ECOA 2Y5QA 5HDHA 3E6JA 2RA8A 4LXSA 4Z94G 5GS2B 1KOOA 5CMPA 5B0NA 3SB4A 5AZ5A 1P9AG 3A79B 4FDWA 4H09A 2Q4GW 4QC0A 2Z66A 2WFHA 4PERA 3WPHA 1M0ZA 4CP6A 2FT3A 5IYXC 3W3MA 4U09A 1XEUA 1XECA 1LTXA 2OMUA 4M7EA 3ULUA 4WP6A 2O6SA 2A0ZA 3BZ5A 4R6JA 4J4LA 3RW6A 4XGOA 2P1OB 5HZLB 4EZGA 2O6QA 4OQTA 3WPBA 5D3IA 4PQ8A 5B0TA 1ZIWA 4LSCA 3RFSA 1D0BA 3O53A 4FHOA 5IJBA 2CA6A 4WYKA 4Z8GA 4HQ1A 3M19A 3E2JA 4CNMA 1FS2A 5IJDA 4KNGA 1P8TA 4I6JB 4Q62A 4GT6A 1W8AA 3REZA 3ULVA 4MQWX 1DCEA 1OTNA 1DFJI 1PGVA 1A4YA 3WPDA 2Z81A 3FXIA 2XWTC 2Z63A 4R5DA 4QXEA 3OGLB 4CC4A 4K17A 4G8AA 5AWDA 2V70A 5CMNA 4BV4R 3W3LA 1H6UA 4Z61C 1OZNA 5LFNA 3G06A 3JB9j 4LSAA 3M18A 5IJCA 3C6NB 5GQRK 3PMHG 2ASTB 2P1PB 4Z79A 4B8CD 3OGMB 4FD0A 3G3BA 4LXRA 4LI1A 3G04C 4IM6A 5GMGA 1QYYA 4PSJA 1WWLA 4V2DA 3DZEA 4XOSA 1FT8A 4R6FA 2WQVA 3G39A 4P91A 2IFGA 2UZYA 1XKUA 3OJAA 3UL8A 1GWBA 4CILA 4NKGA 2OMZA 4UFRA 3RFJA 3W3KA 1O6TA 3G3AA
chains in the Genus database with same CATH topology
4J0MA 4GLPA 3ZYOA 3ZYIA 4Q3GA 2OMXA 5AWAA 4Y61B 1G9UA 1IO0A 2OMVA 3ZYNA 4R5CA 4AW4A 1OGQA 2V9SA 3WPIA 3ZYJA 4R58A 3C6OB 2WQXA 4V2CA 4C2BB 3RW7A 3W3GA 3WPEA 2OMWA 3P72A 4U7LA 4CC4C 4R09A 2BNHA 1FQVA 1K5GC 3W3JA 3WPFA 4TZHA 4BSUA 4CNCA 4L3FA 3CIYA 1SQ0B 4XSQA 2XOTA 1K5DC 4PKIG 4AY9X 5B4PA 4KXFB 1M10B 2RR6A 1YRGA 1M9SA 4FMZA 3C6PB 4LSXA 1JL5A 1M9LA 4U06A 4NKHA 1P8VA 3RGZA 3OJAB 4V2EA 3WPCA 2WQWA 4FCGA 1A9NA 3RIZA 3RGXA 2ASSB 5AWBA 4L3AA 4ECNA 4R07A 3CIGA 2ELLA 2Z7XA 4R6GA 4M7EC 5AWCA 1XWDC 3ULAA 2WQUA 1Z7XW 3RFEA 4MN8B 4FS7A 4RWTC 2Z64A 3E3ZA 4KT1A 1OTOA 3CVRA 1H6TA 4Z64C 3GOZA 4ARNA 5A5CA 4RCWA 1OTMA 4BSSA 2UZXA 4LI2A 2OMYA 1FO1A 3OGKB 3TSRE 5GS0A 3WPGA 3UL7A 4PEQB 4R08A 5FTTB 1O6SA 2P1MB 1KOHA 4R6AA 2P1NB 3VQ1A 4P8SA 3RJ0A 4U08A 3VQ2A 4Q3IA 1DS9A 2R9UA 3UN9A 1OOKG 2Z62A 2JE0A 4QBZA 2JQDA 1O6VA 3KJ4A 2BEXA 2ID5A 2Z82A 3WN4A 2Z65A 4YEBB 2O6RA 4ARRA 3E4GA 4RCAB 5GMHA 2V9TB 1XCDA 2JE1A 2OMTA 2P1QB 4C2AB 4BSRA 5GMFA 3W3NA 3O6NA 3UL9A 4LSXC 2Z7XB 1U0ND 4R0AA 4ECOA 2Y5QA 5HDHA 3E6JA 2RA8A 4LXSA 4Z94G 5GS2B 1KOOA 5CMPA 5B0NA 3SB4A 5AZ5A 1P9AG 3A79B 4FDWA 4H09A 2Q4GW 4QC0A 2Z66A 2WFHA 4PERA 3WPHA 1M0ZA 4CP6A 2FT3A 5IYXC 3W3MA 4U09A 1XEUA 1XECA 1LTXA 2OMUA 4M7EA 3ULUA 4WP6A 2O6SA 2A0ZA 3BZ5A 4R6JA 4J4LA 3RW6A 4XGOA 2P1OB 5HZLB 4EZGA 2O6QA 4OQTA 3WPBA 5D3IA 4PQ8A 5B0TA 1ZIWA 4LSCA 3RFSA 1D0BA 3O53A 4FHOA 5IJBA 2CA6A 4WYKA 4Z8GA 4HQ1A 3M19A 3E2JA 4CNMA 1FS2A 5IJDA 4KNGA 1P8TA 4I6JB 4Q62A 4GT6A 1W8AA 3REZA 3ULVA 4MQWX 1DCEA 1OTNA 1DFJI 1PGVA 1A4YA 3WPDA 2Z81A 3FXIA 2XWTC 2Z63A 4R5DA 4QXEA 3OGLB 4CC4A 4K17A 4G8AA 5AWDA 2V70A 5CMNA 4BV4R 3W3LA 1H6UA 4Z61C 1OZNA 5LFNA 3G06A 3JB9j 4LSAA 3M18A 5IJCA 3C6NB 5GQRK 3PMHG 2ASTB 2P1PB 4Z79A 4B8CD 3OGMB 4FD0A 3G3BA 4LXRA 4LI1A 3G04C 4IM6A 5GMGA 1QYYA 4PSJA 1WWLA 4V2DA 3DZEA 4XOSA 1FT8A 4R6FA 2WQVA 3G39A 4P91A 2IFGA 2UZYA 1XKUA 3OJAA 3UL8A 1GWBA 4CILA 4NKGA 2OMZA 4UFRA 3RFJA 3W3KA 1O6TA 3G3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0M A;  4GLP A;  3ZYO A;  3ZYI A;  4Q3G A;  2OMX A;  5AWA A;  4Y61 B;  1G9U A;  1IO0 A;  2OMV A;  3ZYN A;  4R5C A;  4AW4 A;  1OGQ A;  2V9S A;  3WPI A;  3ZYJ A;  4R58 A;  3C6O B;  2WQX A;  4V2C A;  4C2B B;  3RW7 A;  3W3G A;  3WPE A;  2OMW A;  3P72 A;  4U7L A;  4CC4 C;  4R09 A;  2BNH A;  1FQV A;  1K5G C;  3W3J A;  3WPF A;  4TZH A;  4BSU A;  4CNC A;  4L3F A;  3CIY A;  1SQ0 B;  4XSQ A;  2XOT A;  1K5D C;  4PKI G;  4AY9 X;  5B4P A;  4KXF B;  1M10 B;  2RR6 A;  1YRG A;  1M9S A;  4FMZ A;  3C6P B;  4LSX A;  1JL5 A;  1M9L A;  4U06 A;  4NKH A;  1P8V A;  3RGZ A;  3OJA B;  4V2E A;  3WPC A;  2WQW A;  4FCG A;  1A9N A;  3RIZ A;  3RGX A;  2ASS B;  5AWB A;  4L3A A;  4ECN A;  4R07 A;  3CIG A;  2ELL A;  2Z7X A;  4R6G A;  4M7E C;  5AWC A;  1XWD C;  3ULA A;  2WQU A;  1Z7X W;  3RFE A;  4MN8 B;  4FS7 A;  4RWT C;  2Z64 A;  3E3Z A;  4KT1 A;  1OTO A;  3CVR A;  1H6T A;  4Z64 C;  3GOZ A;  4ARN A;  5A5C A;  4RCW A;  1OTM A;  4BSS A;  2UZX A;  4LI2 A;  2OMY A;  1FO1 A;  3OGK B;  3TSR E;  5GS0 A;  3WPG A;  3UL7 A;  4PEQ B;  4R08 A;  5FTT B;  1O6S A;  2P1M B;  1KOH A;  4R6A A;  2P1N B;  3VQ1 A;  4P8S A;  3RJ0 A;  4U08 A;  3VQ2 A;  4Q3I A;  1DS9 A;  2R9U A;  3UN9 A;  1OOK G;  2Z62 A;  2JE0 A;  4QBZ A;  2JQD A;  1O6V A;  3KJ4 A;  2BEX A;  2ID5 A;  2Z82 A;  3WN4 A;  2Z65 A;  4YEB B;  2O6R A;  4ARR A;  3E4G A;  4RCA B;  5GMH A;  2V9T B;  1XCD A;  2JE1 A;  2OMT A;  2P1Q B;  4C2A B;  4BSR A;  5GMF A;  3W3N A;  3O6N A;  3UL9 A;  4LSX C;  2Z7X B;  1U0N D;  4R0A A;  4ECO A;  2Y5Q A;  5HDH A;  3E6J A;  2RA8 A;  4LXS A;  4Z94 G;  5GS2 B;  1KOO A;  5CMP A;  5B0N A;  3SB4 A;  5AZ5 A;  1P9A G;  3A79 B;  4FDW A;  4H09 A;  2Q4G W;  4QC0 A;  2Z66 A;  2WFH A;  4PER A;  3WPH A;  1M0Z A;  4CP6 A;  2FT3 A;  5IYX C;  3W3M A;  4U09 A;  1XEU A;  1XEC A;  1LTX A;  2OMU A;  4M7E A;  3ULU A;  4WP6 A;  2O6S A;  2A0Z A;  3BZ5 A;  4R6J A;  4J4L A;  3RW6 A;  4XGO A;  2P1O B;  5HZL B;  4EZG A;  2O6Q A;  4OQT A;  3WPB A;  5D3I A;  4PQ8 A;  5B0T A;  1ZIW A;  4LSC A;  3RFS A;  1D0B A;  3O53 A;  4FHO A;  5IJB A;  2CA6 A;  4WYK A;  4Z8G A;  4HQ1 A;  3M19 A;  3E2J A;  4CNM A;  1FS2 A;  5IJD A;  4KNG A;  1P8T A;  4I6J B;  4Q62 A;  4GT6 A;  1W8A A;  3REZ A;  3ULV A;  4MQW X;  1DCE A;  1OTN A;  1DFJ I;  1PGV A;  1A4Y A;  3WPD A;  2Z81 A;  3FXI A;  2XWT C;  2Z63 A;  4R5D A;  4QXE A;  3OGL B;  4CC4 A;  4K17 A;  4G8A A;  5AWD A;  2V70 A;  5CMN A;  4BV4 R;  3W3L A;  1H6U A;  4Z61 C;  1OZN A;  5LFN A;  3G06 A;  3JB9 j;  4LSA A;  3M18 A;  5IJC A;  3C6N B;  5GQR K;  3PMH G;  2AST B;  2P1P B;  4Z79 A;  4B8C D;  3OGM B;  4FD0 A;  3G3B A;  4LXR A;  4LI1 A;  3G04 C;  4IM6 A;  5GMG A;  1QYY A;  4PSJ A;  1WWL A;  4V2D A;  3DZE A;  4XOS A;  1FT8 A;  4R6F A;  2WQV A;  3G39 A;  4P91 A;  2IFG A;  2UZY A;  1XKU A;  3OJA A;  3UL8 A;  1GWB A;  4CIL A;  4NKG A;  2OMZ A;  4UFR A;  3RFJ A;  3W3K A;  1O6T A;  3G3A A; 
#chains in the Genus database with same CATH topology
 4NZR M;  4J0M A;  4GLP A;  3ZYO A;  3ZYI A;  4Q3G A;  2OMX A;  5AWA A;  4Y61 B;  1G9U A;  1IO0 A;  2OMV A;  3ZYN A;  4R5C A;  4AW4 A;  1OGQ A;  2V9S A;  3WPI A;  3ZYJ A;  4R58 A;  3C6O B;  2WQX A;  4V2C A;  4C2B B;  3RW7 A;  3W3G A;  3WPE A;  2OMW A;  3P72 A;  4U7L A;  4CC4 C;  4R09 A;  2BNH A;  1FQV A;  1K5G C;  3W3J A;  3WPF A;  4TZH A;  4BSU A;  4CNC A;  4L3F A;  3CIY A;  1SQ0 B;  4XSQ A;  2XOT A;  1K5D C;  4PKI G;  4AY9 X;  5B4P A;  4KXF B;  1M10 B;  2RR6 A;  1YRG A;  1M9S A;  4FMZ A;  3C6P B;  4LSX A;  1JL5 A;  1M9L A;  4U06 A;  4NKH A;  1P8V A;  3RGZ A;  3OJA B;  4V2E A;  3WPC A;  2WQW A;  4FCG A;  1A9N A;  3RIZ A;  3RGX A;  2ASS B;  5AWB A;  4L3A A;  4ECN A;  4R07 A;  3CIG A;  2ELL A;  2Z7X A;  4R6G A;  4M7E C;  5AWC A;  1XWD C;  3ULA A;  2WQU A;  1Z7X W;  3RFE A;  4MN8 B;  4FS7 A;  4RWT C;  2Z64 A;  3E3Z A;  4KT1 A;  1OTO A;  3CVR A;  1H6T A;  4Z64 C;  3GOZ A;  4ARN A;  5A5C A;  4RCW A;  1OTM A;  4BSS A;  2UZX A;  4LI2 A;  2OMY A;  1FO1 A;  3OGK B;  3TSR E;  5GS0 A;  3WPG A;  3UL7 A;  4PEQ B;  4R08 A;  5FTT B;  1O6S A;  2P1M B;  1KOH A;  4R6A A;  2P1N B;  3VQ1 A;  4P8S A;  3RJ0 A;  4U08 A;  3VQ2 A;  4Q3I A;  1DS9 A;  2R9U A;  3UN9 A;  1OOK G;  2Z62 A;  2JE0 A;  4QBZ A;  2JQD A;  1O6V A;  3KJ4 A;  2BEX A;  2ID5 A;  2Z82 A;  3WN4 A;  2Z65 A;  4YEB B;  2O6R A;  4ARR A;  3E4G A;  4RCA B;  5GMH A;  2V9T B;  1XCD A;  2JE1 A;  2OMT A;  2P1Q B;  4C2A B;  4BSR A;  4NZT M;  5GMF A;  3W3N A;  3O6N A;  3UL9 A;  4LSX C;  2Z7X B;  1U0N D;  4R0A A;  4ECO A;  2Y5Q A;  5HDH A;  3E6J A;  2RA8 A;  4LXS A;  4Z94 G;  5GS2 B;  1KOO A;  5CMP A;  5B0N A;  3SB4 A;  5AZ5 A;  1P9A G;  3A79 B;  4FDW A;  4H09 A;  2Q4G W;  4QC0 A;  2Z66 A;  2WFH A;  4PER A;  3WPH A;  1M0Z A;  4CP6 A;  2FT3 A;  5IYX C;  3W3M A;  4U09 A;  1XEU A;  1XEC A;  1LTX A;  2OMU A;  4M7E A;  3ULU A;  4WP6 A;  2O6S A;  2A0Z A;  3BZ5 A;  4R6J A;  4J4L A;  3RW6 A;  4XGO A;  2P1O B;  5HZL B;  4EZG A;  2O6Q A;  4OQT A;  3WPB A;  5D3I A;  4PQ8 A;  5B0T A;  1ZIW A;  4LSC A;  3RFS A;  1D0B A;  3O53 A;  4FHO A;  5IJB A;  2CA6 A;  4WYK A;  4Z8G A;  4HQ1 A;  3M19 A;  3E2J A;  4CNM A;  1FS2 A;  5IJD A;  4KNG A;  1P8T A;  4I6J B;  4Q62 A;  4GT6 A;  1W8A A;  3REZ A;  3ULV A;  4MQW X;  1DCE A;  1OTN A;  1DFJ I;  1PGV A;  1A4Y A;  3WPD A;  2Z81 A;  3FXI A;  2XWT C;  2Z63 A;  4R5D A;  4QXE A;  3OGL B;  4CC4 A;  4K17 A;  4G8A A;  5AWD A;  2V70 A;  5CMN A;  4BV4 R;  3W3L A;  1H6U A;  4Z61 C;  1OZN A;  5LFN A;  3G06 A;  3JB9 j;  4LSA A;  3M18 A;  5IJC A;  3C6N B;  5GQR K;  3PMH G;  2AST B;  2P1P B;  4Z79 A;  4B8C D;  3OGM B;  4FD0 A;  3G3B A;  4LXR A;  4LI1 A;  3G04 C;  4IM6 A;  5GMG A;  1QYY A;  4PSJ A;  1WWL A;  4V2D A;  3DZE A;  4XOS A;  1FT8 A;  4R6F A;  2WQV A;  3G39 A;  4P91 A;  2IFG A;  2UZY A;  1XKU A;  3OJA A;  3UL8 A;  1GWB A;  4CIL A;  4NKG A;  2OMZ A;  4UFR A;  3RFJ A;  3W3K A;  1O6T A;  3G3A A; 
#chains in the Genus database with same CATH homology
 4J0M A;  4GLP A;  3ZYO A;  3ZYI A;  4Q3G A;  2OMX A;  5AWA A;  4Y61 B;  1G9U A;  1IO0 A;  2OMV A;  3ZYN A;  4R5C A;  4AW4 A;  1OGQ A;  2V9S A;  3WPI A;  3ZYJ A;  4R58 A;  3C6O B;  2WQX A;  4V2C A;  4C2B B;  3RW7 A;  3W3G A;  3WPE A;  2OMW A;  3P72 A;  4U7L A;  4CC4 C;  4R09 A;  2BNH A;  1FQV A;  1K5G C;  3W3J A;  3WPF A;  4TZH A;  4BSU A;  4CNC A;  4L3F A;  3CIY A;  1SQ0 B;  4XSQ A;  2XOT A;  1K5D C;  4PKI G;  4AY9 X;  5B4P A;  4KXF B;  1M10 B;  2RR6 A;  1YRG A;  1M9S A;  4FMZ A;  3C6P B;  4LSX A;  1JL5 A;  1M9L A;  4U06 A;  4NKH A;  1P8V A;  3RGZ A;  3OJA B;  4V2E A;  3WPC A;  2WQW A;  4FCG A;  1A9N A;  3RIZ A;  3RGX A;  2ASS B;  5AWB A;  4L3A A;  4ECN A;  4R07 A;  3CIG A;  2ELL A;  2Z7X A;  4R6G A;  4M7E C;  5AWC A;  1XWD C;  3ULA A;  2WQU A;  1Z7X W;  3RFE A;  4MN8 B;  4FS7 A;  4RWT C;  2Z64 A;  3E3Z A;  4KT1 A;  1OTO A;  3CVR A;  1H6T A;  4Z64 C;  3GOZ A;  4ARN A;  5A5C A;  4RCW A;  1OTM A;  4BSS A;  2UZX A;  4LI2 A;  2OMY A;  1FO1 A;  3OGK B;  3TSR E;  5GS0 A;  3WPG A;  3UL7 A;  4PEQ B;  4R08 A;  5FTT B;  1O6S A;  2P1M B;  1KOH A;  4R6A A;  2P1N B;  3VQ1 A;  4P8S A;  3RJ0 A;  4U08 A;  3VQ2 A;  4Q3I A;  1DS9 A;  2R9U A;  3UN9 A;  1OOK G;  2Z62 A;  2JE0 A;  4QBZ A;  2JQD A;  1O6V A;  3KJ4 A;  2BEX A;  2ID5 A;  2Z82 A;  3WN4 A;  2Z65 A;  4YEB B;  2O6R A;  4ARR A;  3E4G A;  4RCA B;  5GMH A;  2V9T B;  1XCD A;  2JE1 A;  2OMT A;  2P1Q B;  4C2A B;  4BSR A;  5GMF A;  3W3N A;  3O6N A;  3UL9 A;  4LSX C;  2Z7X B;  1U0N D;  4R0A A;  4ECO A;  2Y5Q A;  5HDH A;  3E6J A;  2RA8 A;  4LXS A;  4Z94 G;  5GS2 B;  1KOO A;  5CMP A;  5B0N A;  3SB4 A;  5AZ5 A;  1P9A G;  3A79 B;  4FDW A;  4H09 A;  2Q4G W;  4QC0 A;  2Z66 A;  2WFH A;  4PER A;  3WPH A;  1M0Z A;  4CP6 A;  2FT3 A;  5IYX C;  3W3M A;  4U09 A;  1XEU A;  1XEC A;  1LTX A;  2OMU A;  4M7E A;  3ULU A;  4WP6 A;  2O6S A;  2A0Z A;  3BZ5 A;  4R6J A;  4J4L A;  3RW6 A;  4XGO A;  2P1O B;  5HZL B;  4EZG A;  2O6Q A;  4OQT A;  3WPB A;  5D3I A;  4PQ8 A;  5B0T A;  1ZIW A;  4LSC A;  3RFS A;  1D0B A;  3O53 A;  4FHO A;  5IJB A;  2CA6 A;  4WYK A;  4Z8G A;  4HQ1 A;  3M19 A;  3E2J A;  4CNM A;  1FS2 A;  5IJD A;  4KNG A;  1P8T A;  4I6J B;  4Q62 A;  4GT6 A;  1W8A A;  3REZ A;  3ULV A;  4MQW X;  1DCE A;  1OTN A;  1DFJ I;  1PGV A;  1A4Y A;  3WPD A;  2Z81 A;  3FXI A;  2XWT C;  2Z63 A;  4R5D A;  4QXE A;  3OGL B;  4CC4 A;  4K17 A;  4G8A A;  5AWD A;  2V70 A;  5CMN A;  4BV4 R;  3W3L A;  1H6U A;  4Z61 C;  1OZN A;  5LFN A;  3G06 A;  3JB9 j;  4LSA A;  3M18 A;  5IJC A;  3C6N B;  5GQR K;  3PMH G;  2AST B;  2P1P B;  4Z79 A;  4B8C D;  3OGM B;  4FD0 A;  3G3B A;  4LXR A;  4LI1 A;  3G04 C;  4IM6 A;  5GMG A;  1QYY A;  4PSJ A;  1WWL A;  4V2D A;  3DZE A;  4XOS A;  1FT8 A;  4R6F A;  2WQV A;  3G39 A;  4P91 A;  2IFG A;  2UZY A;  1XKU A;  3OJA A;  3UL8 A;  1GWB A;  4CIL A;  4NKG A;  2OMZ A;  4UFR A;  3RFJ A;  3W3K A;  1O6T A;  3G3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...