1XERA

Structure of ferredoxin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
102
Chain Sequence
b'GIDPNYRTNRQVVGEHSGHKVYGPVEPPVLGIHGTIVGVDFDLCIADGSCINACPVNVFQWYDTPGHPASEKKADPVNEQACIFCMACVNVCPVAAIDVKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Novel zinc-binding centre in thermoacidophilic archaeal ferredoxins.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 102
sequence length 103
ec nomenclature
pdb deposition date 1996-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xerA00
3IR7B 1R27B 1BD6A 1FRIA 1SIZA 3MMCB 1PC5A 3IR5B 3EXYA 1F2GA 1A6LA 1Y5LB 2WSEC 4YDDB 3OR1B 4AYBD 3MMAA 3HKZD 5FD1A 1PC4A 1FRKA 3EUNA 2ZVSA 1FRHA 1H7XA 2FJAB 2V4JA 1FF2A 1JNZB 4L6V3 2PMZD 1FTCA 1GTHA 3MMAB 1FDBA 1XERA 4XK8C 4OV1A 2WSFC 1D3WA 2V4JB 2O01C 3MM5A 3EGWB 2FJBB 4OMFG 2FJDB 1IR0A 1F5BA 6FDRA 3MM5B 2FD2A 2C3PA 2C3MA 5E7OB 1GAOA 2V2KA 2GMHA 3PNIA 3MMBA 1KQFB 2Z8QA 2VPWB 2VPZB 4XDCA 1Y5IB 3LW5C 1Y5NB 2FDNA 5BYSA 1C4AA 2WAQD 3GYXB 3MMBB 1JB0C 7FDRA 3IR6B 4Y28C 2C3OA 2IVFB 2VPXB 2FJEB 3MM7A 1VJWA 4DHVA 1ROFA 4KT0C 1BWEA 2WSCC 2C3UA 3MM6A 1JNRB 1SIWB 1FRMA 2C42A 5L8RC 3MM7B 4XDDA 2VKRA 3MM8A 2Y0SD 4CI0B 1Y4ZB 4ID8A 5CHCB 1B0TA 1FDAA 1FRLA 1Q16B 1FEHA 1DAXA 3OR2A 1BC6A 3MM6B 1DFDA 3MM8B 1IQZA 1KEKA 1H0HB 1RGVA 2UZAA 3OR2B 1WTFA 1C4CA 4RKUC 2XSJA 2PA8D 1BLUA 1G6BA 1GT8A 1FRXA 5BYQA 1DURA 1KQGB 1H7WA 3C8YA 1K0TA 1F5CA 1FDDA 2XSJB 1HFEL 1CLFA 1FRJA 3MM9A 1FDNA 2FGOA 1SJ1A 2C3YA 7FD1A 1AXQA 1B0PA 1B0VA 3MM9B 1GTEA 1FCAA 3MMCA 5BYRA 1FD2A 2GMJA 2WB1D 1FERA 1H98A 1FXDA 1BQXA 1FXRA 1G3OA 2VPYB 5CH7B 3OR1A 2PDAA 6FD1A
chains in the Genus database with same CATH superfamily
1S97A 1SPBP 3PIOQ 2HFOA 2IY5B 2A6OA 4DL5A 3MMAB 1VOMA 2V4JB 1REGX 2ASLA 4NLDA 1O5JA 3I6PA 3T1HJ 1D9FA 1LWFB 2RF2B 4FYWB 1RHMB 1ITPA 5K8OA 2LU1A 3IO1A 2QSFA 5T7LA 4P72A 4ZJQA 4BC9A 2CJXB 1NKEA 4CTAB 4M1KA 2E5LJ 5KFIA 2ZBPA 4O3SA 3VWSA 2VICA 5HVGA 2V34A 3PIPQ 1Q1KA 2VONA 5KOXA 1FK9A 3DDIA 2ZUGA 2IM2A 4JI7J 3HM9A 1LQ9A 5F0WA 1FE0A 2HFNA 2D9OA 3HK2A 3SDEB 2UV8G 5CQGA 3OD2A 4EYIB 1VC0A 1QAIA 2EFOA 2KKHA 3S6EA 2E29A 5CAAA 4OYXA 1TL7B 3IR7B 2EK1A 2DGSA 3HKZD 2KJWA 4QR0A 3UR0A 2CQ4A 3HF5A 3KDNA 1PYOB 3UN2A 3THVA 5DG8A 1S49A 1LNQA 3DMJB 3R6LB 1RWWB 4B9NA 4TY8B 1NSKL 2KRBA 3KHLA 2P9GA 1OSDA 3G8QA 4ZP9A 1D09B 2RDDA 1S9EA 4JI8J 4ANEA 4UT4A 2C3OA 4DFJA 2JRSA 2FY8A 2VKRA 4MK7A 4R0JA 5HMYA 2VQFJ 1DFDA 3DRRA 1W26A 2WCXA 2AF6A 4LF9J 2APOA 2B8PA 1N5VA 4ES1A 4LT6A 3D4JA 4LSZB 1RSCA 2DNPA 3P4UB 4U9RA 3T6JA 4YOEA 4BWJA 2C2OB 2AMCB 3EGVA 1RYSA 2GMLA 3DFEA 3D6MB 3K5LA 4ZHRA 2YQ1A 3G82B 3NNAA 3P5BP 1NHKL 2B4PA 1SKRA 2ZVIA 3MCMA 2A10A 1V6HA 1DQ8A 4CM2A 4P74A 1R8AA 2W2MP 3R5CA 2DTJA 2K1RB 1IR1A 2GA7A 4B9SA 3OL9A 3O5TB 2Y3YA 4J9VA 4BCAA 2BOAA 1TKDA 1FI4A 3R8YA 3B78A 2F9JA 4HTIA 2V6AA 5F3ZA 2W7AA 2QFJA 5GADU 4NXMJ 1NMEB 3PXGa 2LDYA 2FVQA 1FWKA 5IM0A 3HHLA 5DG9A 2B0GA 2GJFA 3ISND 4FYVB 1N5YB 4OX9F 4ZP6A 2B6AA 3MAAA 1W7WA 3MZIA 1NPPA 1KVIA 1MG7A 3WC2A 2X51A 1P8GA 4CLKA 1KTVA 1PILA 1FDNA 2E1RA 4C8NA 1N52B 4G1QA 4NLWA 1IBKF 5LSRA 3GJQB 1YIJS 1CJUA 1NK7A 3HP6A 2QO3A 4X4OA 1GFWB 4OHWA 1SIZA 1F2GA 2WVFA 4QWCA 4OYAA 2DRDA 5KFSA 2KDOA 2VDIA 4RW4B 3ILIA 2ROGA 4MIAA 3IM9A 4DR6J 4O4RA 2QYCA 4P71A 4QIGA 1S7IA 3DU5A 4CWBA 2RQ4A 1UKUA 4NPOA 4IKAA 2G1DA 5KFRA 2GVZB 3BKTA 1EP4B 3SYZA 4C7QA 4ANDA 1YBAA 4UF4A 1UJ4A 3FUYA 5KTQA 3QYYA 3KLVA 1JXLA 4CZCA 4WE1B 4PG6A 4OZ2A 1W25A 1R0CB 2V94A 2XM3A 1K9MT 4C8YA 1FRMA 2LEBA 1YJTA 4HACB 4DV2F 2I0XA 3BKFA 5A6PA 4OJHA 4FPRA 4FBTA 5BJRA 2DHXA 1IBLF 3VTIA 5C25B 1TK0A 4YEAA 2C3YA 1LV5A 3NNHA 2WK4A 2OPPB 2V69A 2AIRB 5L1JA 1UEVA 5AXNA 1UPMB 1IKXA 5LXYA 2M2BA 3HHKA 4WBFA 3I4HX 4PUOB 3GG0A 2WSEC 2DH7A 5J2MB 3KUEA 3PW5A 3CSKA 3BGRB 1X4FA 3M6WA 5DLGA 3DOLB 3CDWA 3W65A 1FVSA 3DRYA 2AV5A 1J27A 1SJRA 1Y5IB 2DGVA 1YKWA 5DGBA 2R8KA 4ELTA 2NYHA 2JLEA 3D3CJ 3HVWA 1LK7A 3GJRB 4NA1A 3AJDA 1DHMA 1NK5A 1RA7A 3MM7B 1BUXA 2XMKA 1OY6A 3PX0A 5DZ6A 1T9UA 4KV8A 3ZXWA 2SXLA 1HBMA 5HJXA 1BQNB 5IC4B 4FKYA 2GX8A 1WELA 3RAMA 2MKIA 3G6YA 1D0EA 1KRPA 3O1LA 4L76A 5KFVA 1HHQA 2ZKTA 3I82A 5JXSA 3W9IA 4K4YA 4X65F 2VC1A 1UVJA 4KHPJ 3BGFA 2CDRB 2K7JA 2UVUA 5L9XA 2H1YA 2HIYA 4QOTA 4HR2A 2OGUA 4YMEA 2V8HA 4HT7A 3H5YA 4DPOA 3JTOA 3GR0A 4CLZA 1RTZA 3LO3A 4UW2A 4YR0A 1P9YA 2R8JA 3J7Z5 4ZPDA 1RTDB 2AYGA 1RACB 3IBWA 2ZITA 1IBMF 4X84A 1NHVA 2G2YA 2UU9J 3ZTQA 1RU2A 3AXKA 2EXUA 1T02A 1HI0P 4B9UA 2HNZB 1S48A 3MEEA 5EWFA 2W1BA 3ELHA 4F26A 1NH7A 1M5PC 2MKCA 4HH0A 2QZ8A 5B0CA 3C15A 1S0NA 2PIIA 2HQDA 1T9TA 3I87A 1S9GA 3SXLA 1R8BA 2QLJB 4DR3J 2AP6A 3MOJB 2NPIA 2WB1D 3S8SA 3X1LB 3BR9A 1Y3KA 3PR4A 1GEHA 3EVMA 2Y1JA 3EWGA 1U1QA 1SKUB 2YKNA 3NGTA 2OFGX 4MIBA 3VAKA 4Z7CA 2YNGA 3CJ5A 1AZSB 2FJDB 3GR1A 1S0MA 2HNDA 4F4AA 2LA6A 3OXFA 3N79A 3AQPA 3FGVA 1GAOA 3BH6B 4A8OA 1IKWB 1OPIA 4DZ6A 4ZCMA 1SI9A 5IC6B 3HHDA 1Y5NB 2YNHA 2VBZA 4DQIA 2L08A 4DX5A 2CQ1A 2CJ9A 5CD4H 3M30A 3HFVA 3T19A 2DNNA 3CJ0A 5KG5A 4C0HA 3PVXA 4ZPVR 3JTPA 2LP4A 4OZ0A 1CBKA 3SCIE 1FKPA 3CDBA 4IR1A 4YB1P 3Q8VA 1YRXA 4Y2KA 2V0NA 1AYEA 4RNNA 4NLPA 1RT1B 1HPZA 2LCWA 3V81B 1R27B 2L41A 5HSPA 3KJVB 1EX8A 3KK2A 4B3MF 1U47A 4MKVA 3PW4A 4G6VB 3KG4A 1QE1A 2V67A 1XN9A 1FFGB 1YBTA 2FJBB 3CDEA 1VGYA 3BPDA 2HVEA 3A8IA 5G4DA 3D6HB 1HNZF 4IFYB 1HWIA 2H4YB 4PG4A 1ICEB 3Q8QB 5D3GA 4ECZA 4BBYA 1NEEA 3RB0A 3AB2B 4NE9C 2OHDA 4F0KA 3GFYA 2MY7A 4LF6F 2ZBCA 1CC8A 2QL9B 5C24B 2AGPA 1VFJA 5K8MA 5A8RB 3UD3P 2R2RA 3JSRA 3C46A 3FEXB 2RUGA 2VG7B 2D74B 3MR5A 1OYDA 3P6YC 3V6DB 4ELUA 1S1TA 4QW9A 4RW7A 4M5IA 2J7KA 2H54B 1F0XA 2HK2A 5E3QA 1VJQA 4DCOB 3O8WA 3P5TL 4AFFA 3GJTB 2RUSA 4WU2A 2Q6BA 1RHQB 4I7FB 3CUNA 2IC3A 4U67Q 4L3NA 4ZP7A 4NEYA 1R8CA 1IM4A 5F0UA 4URQU 3TNVA 1SC4B 4KB7A 4ALZA 4IO1A 2ZE2B 3E51A 3QGPA 2Q43A 1RAOA 3R7BB 1WI8A 3DRPB 4U7UK 1HHSA 2VG5B 2W9CA 3GIJA 1ULRA 1MROA 4JI5J 2H9ZA 1APSA 4IDKA 1CEZA 1WD6A 4DV6F 5KFCA 2M0GB 2HRUA 7AT1B 5ETOA 2BKPA 2E7VA 2ZM6F 1JIHA 2HNYA 3H2VE 5KFUA 2V63A 3OSPA 3TAMB 5KG1A 1HQEB 1KFSA 1QAYA 4I2PA 4RNFA 3BH7B 3ITHA 1WTBA 1I3OB 1ZM3A 4ECVA 1OS5A 2RD5C 2XSJA 1YTYA 2RRBA 1KFDA 3FBFA 4DX8H 1VQ9S 4F4YA 1HHTP 4LFCJ 3G4SS 4EZ6A 5GADI 4RUCA 3GMGA 2GVDB 3OTBA 4CLYA 5J2NB 2DNGA 1S10A 2L9NA 1JXVA 2ZC3A 3KNGA 1SJ3P 1C0UA 3I0SB 1S1UB 3QZ8A 4YB5A 4JI6F 2DO4A 3CCJS 3QWPA 4RW9A 4UTGA 4PR6A 2MMYA 5GVQA 1X4HA 2R42A 1SCJB 2NXCA 1ZPVA 3CCTA 1ZM4A 3HJFA 1S1WB 1RBOB 2KO1A 2HKEA 2DNKA 2ILYA 4NLVA 1YDLA 3GWCA 3MECA 1TKTA 2JEIA 2R2TA 3KKFA 3PY8A 4QR2A 4Q43A 3VCDA 2C3UA 3I5CA 4XDDA 1UFWA 3W64A 1UAWA 2EI5A 2DNLA 2LXIA 2M70A 2NSCA 3W60A 2KFYA 2DPIA 1WTFA 2JL9A 1D1UA 5KFFA 1RT4A 3UD4P 3POTB 4Q5VA 3NS5A 1SC1B 4Q45A 1F5CA 2NR0A 2BDPA 4LF7F 5DG7A 2KXFA 5A0YB 1Q81T 5D4LA 1CQNA 2B5JB 5GAHU 5IT9Y 3EVWA 3KLIA 3DI6B 1WEXA 4WK1A 1Z4UA 2XWXA 4KSEB 3BQ0A 1ZOTA 3MCOA 2GQCA 1UW9A 3PJ9A 1UZHA 3M6UA 4G3IA 2HHQA 4F0HA 5DLFA 4K4XA 3TA2A 1HNWF 1QJHA 3ETMA 1CSJA 4LMZA 2B9YA 2VIHA 3PG9A 1DY3A 1IBKJ 3A12A 5B0AA 2ZH9A 5I3UB 4FZVA 4O4GA 5CYJA 4KY3A 4OZNA 3F41A 4ZOSA 2JEFA 3KUHA 2HURA 4JI0F 3RBDA 4IRCA 3KG1A 5CYMA 3QRQA 3A8EA 4OYOA 5ETQA 2PGCA 4DR2F 2RHSB 3CJ4A 2ACYA 2FVSA 4IQMA 3OL7A 4QIVA 2R3VA 3EGNA 5J2QA 2KM8B 1HWKA 3R5JB 3RAQA 3TQ1A 3IS9B 1FHTA 5BYRA 1RWPB 4B3SF 1RTJB 6FD1A 3M2UB 2XYPB 3DGPA 5IZHA 2XO6A 3RBZA 4HI1A 1HBNB 3EUNA 4NRUA 1HNIB 3K2YA 5AXKA 3Q86A 4Y2IA 1RT7A 2IM3A 1DLOA 1K8AT 2QGFB 1IBLJ 4DR1F 3H25A 4B3OA 2VL1A 3CJRA 1LWCA 1N33J 2HBQB 4ZVTB 1DTQA 1LW0A 3QSIA 4GC7A 1Q16B 3DNCA 3W2WB 4TU9A 3UR3C 1VQKS 5K5MA 4ID5A 3DLEA 2NXJA 3DRXA 3TZXA 2A3JA 3L95X 3BS9A 1M5KC 2E44A 4ZIVA 2XMAA 5IT0A 2XNRA 1VI7A 2QL7B 4OJ1A 1K73T 1U1PA 2RS2A 1S4EA 3C2PA 2V9WA 1ZA1B 3GV8B 2IRXA 1BQXA 4OZ3A 1U25A 4TYAA 5MAOA 4YY3J 4DV0F 2CXEA 5GMEA 4DV7J 1YRUA 3FCVA 5F9LA 2B9XA 3L7PA 3T6BA 1RT6B 4DG1B 1CS4B 2M88A 3NY0A 3QBCA 2DHAA 3C6TB 3KTQA 2LECA 1C1BA 3UE2A 5LMNJ 1U1KA 4X65J 4KHMA 4DQPA 5K14B 4XDCA 2PEBA 4EWTA 2D3O1 4NEZA 1HD0A 4CM0A 4KJIA 2DR5A 4UUXA 4J9OA 4O3QA 3MURP 3JQJA 3G9CA 3MEKA 4DCJB 2GIQA 4CYUA 1S0OA 2HHTA 5IS2A 3NP5A 5BYQA 3L3CA 1IBMJ 2OO4A 5D6GA 4I56A 5KFWA 3M4XA 3NGKA 2DK2A 1Q0NA 4UOCA 3J81j 2U1AA 3MM9B 2ZJPQ 4OJ3A 1U0HB 3DM2B 3RR8A 1F2HA 5I42A 1M5OC 3I4PA 4A8FA 3KNAA 4ZLPA 1GXTA 1PIEA 2OEJA 3ICLA 2NSBA 2QFIA 3AA9A 4W92B 4OI3A 1JLQA 3HXMA 5DQIA 4H4MB 1RWNB 1Q4RA 1XMOJ 2PI5A 2ZUAA 1U6FA 2YKQA 2A6MA 2HBYB 2IBKA 5FDLB 4FKXA 3CVKA 3MPUB 5F8IA 3C14A 4NLXA 1DAXA 4HHHA 4DR5F 2LYVA 3DRSA 2XYGB 3CDAA 2JOQA 3BGUA 1IQZA 1RHKB 1H0HB 4MH8A 1L3UA 2DD8S 4KR0B 4MK9A 3M8PA 5KT5A 2GCFA 2WRMA 2PEHA 3HZGA 3J7A1 4PEOA 4IH6A 3CIMA 2LQ9A 1YJWS 4R25A 1X5TA 2CADA 1GXLA 1SBRA 2XI2A 2GHVC 1DQ9A 3MUTP 3G96A 4NMLA 2Q3PA 4ZIWA 3AOCA 3OUYA 4JI2J 3NKYA 3SCKE 1BXNA 1YJ9S 3NGRA 4M5MA 2GO9A 3KUGA 3EZ5A 1VBXA 1FVQA 3KK1B 4FXVA 4NWBA 2HZVA 5B08A 2GAGC 2FHJD 2ZH1A 1RWUA 3CD0A 2IA0A 4DUZF 5HP1A 3AOAA 3M05A 1S1XB 3OHBA 1UWBA 4J9KA 4DF4A 3QIPB 3BV8A 4OIXA 3TZWA 4AXIA 4UUWA 3K5OA 4LF4F 2MSSA 3RR7A 2GW8A 4KRWA 3T5HA 3CCVS 1NDCA 2W25A 8RUCA 2JDJA 2UV8A 3FRZA 1VS3A 1GT8A 3H2UB 1EQ0A 3M8RA 3M8SA 2IFXA 3RB3A 4ED2A 2LU2A 1NPRA 3E2EA 1WC3A 1E6YB 2H48B 4FF3A 2LEAA 1RA6A 3TVZA 3VQTA 1RCXB 5C2GA 1CJTA 3S1TA 2WW4A 2KZZA 1B64A 1NH8A 3BN7A 4UQGA 4ITSA 1Y5LB 3KLGB 3NAHA 3E01B 4DX6A 5AJ3J 3DHXA 4O3NA 2Y1RI 1RT2B 2MKJA 3C3LA 2J7WA 3HI9A 5CABA 3IRWP 4I6WA 1FNOA 1C1CB 2HHPA 4K5SA 1GNKA 1NSPA 4YB6A 3GQCA 1NPKA 1R7IA 2G2ZA 1JQGA 3H8YA 4L72B 2UUWA 2GO8A 2AGOA 1FNMA 3AD7C 1WHVA 2ZHAA 5H1SV 3BBCA 3TUZC 1JLGB 3N01A 2E5JA 2XYHB 1EARA 4P7TA 4PXEA 5KT6A 4K5RA 2Z30B 4X64F 1RWVB 3KOAA 4DV4F 1VIOA 5E2QA 1R6YA 1IBCB 4USWA 3KLHB 2IRUA 1WWHA 1VQLS 1RDRA 2ASYA 2J6UA 4A8XA 3WDOA 1RXOB 4DI6A 3HDSA 3PEHA 1DTTA 1PC4A 3LP0A 4LRDA 4YR3A 2QLFB 3IN5A 5RUBA 2UXCJ 1R0AB 2HMIA 2E1AA 3ZO7A 5MLCV 1NRKA 1VK8A 2MGZB 4X4QA 3LW5C 1T05A 1RTIB 1XQIA 4DHVA 4I68A 4AD6A 1KQKA 1MWZA 3VAFA 1MNEA 3DLGA 1JLBA 4LIRA 3N0VA 1KEKA 1M0SA 2UZAA 3EXCX 1NJYA 3M1VB 1NCLA 4W4MA 3CW2C 3ZZ0A 3VAIA 4F25A 2YBVA 2E1PA 4MFBA 3JB9k 2ZH6A 3FNNA 2CQBA 5LOQA 1ZPWX 4MTPA 3OFEA 4G1IA 4NLSA 3AHPA 3R1HA 4P52A 5J1EB 2GMJA 2LDIA 5D4NA 5J1PA 1NDPA 1X0PA 2W7OA 3IR5B 3QRPA 4DL6A 4BDPA 5DQHA 2W2NP 2CPXA 3UO0A 3EPIA 2V8VA 3RW6A 4WU3A 2YVSA 4QWEA 2CQCA 4LFAF 4LR9A 3H5XA 3AA8A 3HHEA 3EVOA 4WTYA 1S9FA 1UW4A 1VCTA 1WF1A 1CJVA 4WPAA 5ETKA 4LF7J 2WONA 4F36A 1S59A 3CO0P 8AT1B 3FQKA 3A1YG 2FJEB 1HBUB 4QBUA 3MPWA 2AEJA 2FPHX 2DIUA 4RNOA 5ADZA 3MD1A 4EO8A 4JOUA 3WQPA 4CO2A 4LF5F 5BR8F 2AJ2A 5F8LA 2CQIA 4IG3B 1ZAXA 2GC8A 2GZOA 1RTHB 3QO9B 1EKRA 1HNWJ 4ES3A 4N76A 4KIAA 3FK4A 1S6QA 5L46A 2PE8A 1KS2A 5A8WB 2RQMA 3SIPB 4Y2CA 2J7UA 4DL3A 1H98A 4CO3A 4OX6A 1J2VA 4DFKA 2VOOA 3MEGA 4N41A 1A6LA 4KO0A 3OR1B 4RUAA 1FDBA 5GAEU 2YH0A 4HI2A 2E5HA 2EFGA 1Q86T 3MPDA 4DR2J 2HRTA 2IBOA 3I5BA 1Z2ZA 2BJ9A 4F02A 1MW7A 2R8GA 4DXLA 5CD4A 4RUHA 1TKXA 2LXUA 4I6AA 4WP3A 3OL6A 1QVGR 5J2PA 4B3RJ 2WVBA 5T7LB 4QZVB 4J9MA 5L8RC 2XI3A 2AZ3A 2ZJQQ 4C97A 2YY3A 4EEYA 1OY9A 3TQEA 3RUBL 4B9VA 4CLUA 5M2RA 5KFDA 2XTJP 1M90T 1FK9B 5LT5A 4DR1J 1F1BB 1MMNA 3OSNA 3UW1A 2J5AA 3QT5A 4QCLA 3AODA 1QUPA 1NK6A 3SQOP 2AGQA 1BD6A 5D15A 3QFWA 1D9AA 4KGVB 3IFEA 4E8UA 2PI4A 5KFZA 2ALYB 1EQMA 1IKYA 1VR6A 2XY5A 4IG0A 3A8JA 5EUHA 3LTOA 2BOPA 3N9UC 5KFJA 1KHVA 1WI6A 4IRKA 3B6BA 4CLSA 3DOMA 3TX8A 2AZ1A 5D77A 1Q7LB 3DN9A 3QMQA 3IWXA 3DYAA 2ACMA 1S9EB 5HQMA 1UVIA 5C42A 2XMWA 1OY8A 3VALA 4RW8A 3PYEA 2CJYB 3MM8A 3K7RA 2HG4A 4DV0J 5C2CA 4EGLA 5HQLA 1N32J 3C6UA 1XIQA 1DZ5A 1TMJA 1KR4A 1GXUA 2XMMA 3DRRB 3MCNA 1HQ2A 2ZBQA 3MPVA 2YTCA 2Z2MA 5SUHA 3CDUA 4FVCA 4ICLA 5F41A 3I56S 3GIIA 3EZOA 2HQFA 4KKOA 4HEA9 2XQCA 1LWXA 1T0TV 1UTAA 2G13A 2NPFA 5IWAF 4WF9Q 1BQMB 1LW2A 2FJVA 5KG0A 2XCPA 2I38A 2VG6A 2RU3A 2KB2A 4ZHRB 1RP5A 1TL7A 2IDLA 4CLTA 1RT5A 2V2QA 4K2JA 4NLYA 4RW6A 3QIDA 3K57A 2XS7A 3R7NB 1ZZFA 3LP1A 4QIFA 3BREA 2F3JA 5KFQA 4NCGA 3R9LA 1JJCB 3UNGC 1I94F 1C2PA 1IWAA 2FQQB 2G2OA 1JK9B 4DWIA 1RQ0A 3PYFA 3BF4A 1N88A 1FRLA 4CO1A 1QTMA 4P2XA 3PJXA 2ZH8A 1KLMA 5IM0B 3HHLB 2OKQA 3EGZA 3QJJA 2NXUA 3M2RA 1UJ6A 3DLLQ 2BZ2A 4DU8A 2B6AB 2BVZA 3MAAB 2MQPA 4CO4A 4DJBA 2IRYA 1RI7A 4ZVFA 4E0DA 3VZHA 4RNMA 4G1QB 4C8MA 3GFXA 1CJUB 4P2SA 2KYXA 3GLJA 2NZCA 5LJ3Y 2YKOA 2UXBF 3ZZPA 4DR5J 3MF5A 4AUKA 4LIWA 3LF0A 2W8KA 2ZBRA 4HL9A 3TR5A 2HZAA 4ATNA 1RU1A 4USIA 4ED1A 3LGMA 4TU7A 2UUCJ 3VF0B 2VQEJ 3NEKA 4IFVA 4JYAF 4B3TF 3VR1A 3SSRA 2HRYA 4ECTA 2L3MA 3MCSA 2IYGA 2F9DA 4Q0BA 5KFXA 2OAUA 2DCLA 3OXLA 1FT8A 2C2ZB 1FA0A 3DLKA 5HANA 2HQIA 3NNCA 2HAFA 1LXNA 5M2PA 4DUZJ 2BV3A 3QFHA 7FD1A 2OPSA 3PX6A 1PJ7A 1ZH5A 2JHEA 4F3MA 1FERA 4LSNA 1XTZA 4ZVSB 2FVPA 3PO5A 4CT9A 3CE8A 4LF4J 1IKXB 3U02A 1V5IB 2YKPA 3FZ2A 3M6XA 1F60B 2BJ7A 3QGIA 3ZTSA 4D3HA 1RISA 3TUJC 2P8IA 4F2RA 3ONQA 1NK9A 4HH1A 3OQ2A 2W2QP 1FJEB 1MN7A 1KWMA 1PBUA 1X4BA 3W5XA 2N7CA 3RBXA 3QRRA 3QNWB 2YH1A 2E7XA 2LMIA 1NJXA 1R3NA 2UUBF 3BGLA 1NK8A 3W5ZA 2H5IB 5HROA 2AX0A 4ZCKA 4Y00A 2CPIA 5HN0A 4UQTA 4DQRA 3GCWP 2G0IA 2QJ3A 3DOKA 1M1KT 3QGHA 4Q2LA 5DJBA 1S5ZA 4EI2A 4KV8B 3PRVA 1HBMB 1A0OB 3AOBA 4ECWA 4OZLA 1BLUA 3HSGA 3K5NA 1R43A 1ELOA 2YNIA 2ZOFA 1UWAA 2ZDOA 3KHHA 2FGOA 2GJ2A 1FKOA 4DV1F 3C16A 2CIMA 1BGXT 5C25A 4ZLJA 3D5MA 4FNIA 5FD1A 1V3ZA 1U6BA 3N6LA 3VVUA 4OLPA 4YQWA 3G8SA 1UJ5A 1B7YB 3EE3A 4C11A 5HI7A 2W9AA 4BHQA 2V4QA 1XMBA 5KFTA 4QYZK 1CJKA 1RYRA 1VQ8S 1W2IA 4DPUA 5KFBA 1TL4A 2DH8A 3CC4S 4Y2MA 3TUPA 4U7UD 2BKNA 4NYPA 2B4UA 5DO2A 1M1HA 3HD1A 2BJDA 3MEEB 2VFRA 3KJQB 1S79A 2DEIA 2G9OA 3C15B 3PYGA 2R4FA 2HIQA 2BA9A 1S9GB 1RCOB 4RO0A 4A4JA 4DPTA 1X4DA 1NK4A 1MN9A 4XPEA 4CLPA 4ED4A 2AU0A 3PHEA 4OZJA 1GMWA 1WC5A 2CNLB 1RB0A 2JWNA 1HR0F 3PKMA 2YKNB 3K89A 1XMQJ 2YNGB 3HCXA 4CQ1A 2HNDB 4ECSA 1PYTA 2IA6A 5KFOA 4TU8A 4WIIA 3NRBA 3QPIA 2HVDA 1N56A 7FDRA 3T5KA 1CVJA 2YNHB 5DDOC 4W90B 3JSYA 1ZTTA 2KHDA 4GMKA 3M30B 3N4WA 1HI8A 3UI3A 4LFAJ 2W2OP 5E3PA 2EG2A 4J9SA 3QAEA 1UEUA 4OHYA 3W7BA 3PZPA 1KOOA 4K59A 1XK8A 4DR4F 5LMUF 5K8PA 1FKPB 2VBYA 1U8SA 4ETXA 2BRKA 4GVBA 1FD2A 4FP9A 4ED7A 4JP8A 5LSOA 1H74A 4KGKA 4EO6A 4LRCA 1HPZB 2N3OA 3DLBA 2ZZNA 1ACMB 1FJGF 4QWBA 2GV1A 1VQYA 2DHSA 4NZ6A 1X9SA 3KK2B 3IBFB 4JI4F 4WKYA 4LUBA 4LRAA 1T95A 1QE1B 3OTOF 2CJKA 2I2YA 3CWJA 2QA4S 3M8YA 2B8QA 4UOFA 3BO3A 1RE1B 2FDNA 1WUUA 2FZKB 2JEGA 4MMOA 2VPXB 2ADCA 5D3GB 3UCZP 3M32B 3M9OB 2C2MB 2B51A 5AE3A 4U95A 2HWIA 2VD3A 4ZPBA 3BDEA 5F8GA 1VBZA 5CZVA 3R3TA 2VU5A 3MR2A 3B54A 4AQYJ 1SH3A 3VHQA 1FFSB 4GO7X 1S1TB 3W2VA 4PABA 1S12A 3PW2A 2GGPA 2VBWA 4RR5A 2AJ4A 2LXFA 3OTDA 1JKHB 1M5HA 1T9XA 2Q6CA 1VK3A 2QIFA 1MWYA 2IC3B 4DSEA 4FPIA 4Z37A 4X4UA 1FF2A 1VQPS 2KT5A 1VQ6S 1D3WA 4P6QA 1JJHA 5F8MA 1WNEA 3D6FB 4BLGA 3H5UA 4ZK7M 2K06A 1SV5A 2VPWB 1KNZA 2YPZA 4FF4A 5ETRA 5AXMA 2W9CB 3HHLD 3TA1A 2BM0A 2O5DA 1F3VA 1MROB 4IDKB 2MB0B 3AAWB 4M5NA 3KDOA 1FESA 3FCWA 2MEWA 1FWPA 5JUMA 5B09A 2HNYB 1B0TA 1KHWA 4JV0A 3T9NA 5K8NA 4DL0C 2ZZMA 1JLEA 3EZUA 2QN6B 4I2PB 3ITHB 4DV5F 2YWWA 4H4OA 1SKWA 2X7IA 1F9HA 3KK3A 2VFVA 1WHXA 2XSJB 3CJQA 5L9NA 4ED5A 5DGAA 2CQ3A 1GTEA 2MQQA 4ERDA 1R89A 4B9LA 2PDAA 3BSCA 5SZTA 2Z0GA 2JFDA 2V8DA 1JJ4A 3T3FA 1HD1A 1C0UB 2MQLA 4QYRA 1CPZA 3CJ2A 3N5FA 3BQ1A 1YQHA 3ZZUA 2AJQA 4RW9B 1VDHA 4A8WA 2GMHA 5HMWA 2VFUA 2NCKL 4X4SA 4USMA 3OHAA 4KFBB 3WZ0A 3PX4A 4TYBA 3IR6B 3MECB 1TKTB 3OFFA 1BY9A 3PACA 4ZDNA 2QLBB 5IWAJ 1C0TA 1YJUA 3UWTA 2LLZA 1JMTA 3HVTA 3THTA 4DLEA 1RWOB 1RGVA 2FHOB 1XNQF 4QWDA 4R5PA 3I9ZA 1H2TZ 5K20B 4OYIA 1RT4B 3W63A 1NKBA 1XR6A 4XAKA 3B82A 4K7QA 1I94J 2BACA 2F5GA 2DH9A 1VQ7S 4DL2A 1N6QA 4DSFA 2JVOA 5GMKa 2MJNA 2GQQA 3KLIB 4TQRA 4JBCA 1S6PA 2IJNA 4J9LA 3TAPA 2AYBA 1RABB 4K2XA 3JAMU 2JH3A 2EFVA 1HNVA 3J7YU 1X0FA 1F5AA 1QVFR 1MU2A 3VQSA 4C8LA 2XLJA 3MFIA 3FBCA 1AUSL 1WORA 4I6YA 1ROFA 2GHPA 2RMLA 1K47A 4O4GB 2UXDF 2OSRA 4V1Ak 5HMZA 5EDWA 4J91A 5D0EA 5CCLA 4M5GA 2ZH7A 5CYMB 3QLHA 3BDPA 4QYZJ 4WIQA 1KN6A 4CLLA 2J9DE 3PO4A 3KLFA 3VVTA 2KXHA 5FIIA 2CPYA 3D66A 5G0RA 3V6KA 4X62F 3OFGA 2FC8A 1CULA 4NRTA 5J2QB 4HKQA 2W9BB 3QATA 2EC2A 5EX0A 4B3TJ 2K7KA 4OHVA 2IHR1 5HAOA 1N4LA 4GKKJ 2GFFA 3UDLA 3DGPB 3ENVA 2FYXA 2HFUA 3MUMP 1AROP 1SJ4P 4ZJOA 3NMAA 5IT9U 1U4BA 4M5DA 2PT0A 2BM1A 3OW2R 1RT7B 3UCGA 1J5EF 4PZVA 1XR7A 2RVJA 3US5A 4B3OB 4IOCQ 4USJC 1U02A 2DGWA 2KTQA 1LWCB 4I0WA 2DGQA 2X3GA 2OI2A 1U26A 1N34F 5A8KA 1OIAA 5DQGA 5F3TA 2UVRA 1DTQB 1LW0B 3T41A 2UVWA 2UUAF 5B0BA 4OYPA 1KONA 3K17A 4WFBQ 4DQSA 5KOWA 1ZAVA 2CZ9A 2P6SA 4I2QA 3DLEB 3T5LA 1FRXA 3CB4A 1U1LA 1NDLA 1A9NB 3PR5B 2K3IA 4RPFA 1IQTA 1OJ4A 2QA1A 3OVSA 5IFMA 4HYKA 2FLPA 1CC7A 4LF8J 1MLAA 2FGCA 3FMWA 4NI2A 2Z58B 2MLYA 1LFWA 4ZKAA 5D78A 2HQ3A 3O2IA 2L9DA 3OLBA 4ELVA 2BANA 1T11A 1KOHA 5DRKA 4C6AA 3LOUA 1IKVA 3EYZA 2VF3A 1GTHA 3HMJG 4TXSA 1WC6A 4M5JA 2GIFA 2NQPA 4EFAC 3NL0A 2WZ1A 2MKYA 1C1BB 3D1HA 2J6SA 1TFYA 4ZMMA 1ZZNA 1YK9A 4F3QA 2WAQD 1WG1A 2H51B 1FD8A 2IVFB 2CVIA 3P8BB 1VJWA 3SZ2A 1R0BG 4JI7F 3JSMA 2HVHA 3MM6A 5ETSA 3CEDA 2R9LA 3HPOA 5H9FK 3OR2A 4L74A 3EPGA 2BE2A 1KVKA 4JV5J 1VHIA 2CWXA 2WB4A 1K1SA 3RRHA 1JLAA 5L39A 1FX2A 4CYUB 2DXEA 5IOLA 4C48A 1WKJA 1EETA 4C3KA 5KFGA 2XZTB 1N5TA 3LH2S 1FCAA 1RT3A 1AT1B 1ZA2B 4J37A 2R7OA 1R8PA 4ZITA 3KWMA 1VRQC 2Y1LB 4P7VA 1FFWB 2AHOB 3V2UC 2JEJA 4WJBA 3LA0A 4DFPA 4TN2A 5I42B 2O01C 5HLFA 1SL0A 1N36F 4Z2XA 1VBYA 2QYGA 4KH0B 2YWGA 2J76E 4NMXA 1JLQB 3NCQA 4LF9F 3K58A 2IDEA 2G1HA 4IYQA 4OYMA 4UY85 4J9PA 1X9MA 2HK3A 1S0VA 1AFJA 1FO1A 3RRGA 2E7WA 5JMNA 3VAGA 4OI0A 3C14B 1V3SA 3PKYA 3DRSB 1ZM9A 4FN5A 4USKA 1DURA 3PM9A 3AB4B 1JLCA 1WACA 2GQ2A 5CA5A 1TAUA 1VBKA 2YKAA 2CPZA 3M8PB 3VAJA 2OH2A 4WXWA 3D6TB 2JC1A 2VHGA 1HQUA 1U45A 3OUYB 3W8GA 3W1YC 1N5QA 1DARA 2D9PA 3CPWR 3A3PB 2XG8A 2O66A 1RAGB 1RHRB 3UPFA 1QD1A 2IVYA 3PW0A 5FJ4A 3FC9A 1G7CB 3NBPA 1SKSA 4DR4J 2CQGA 5L38A 2GHWA 4RZRA 3NCPA 2CWKA 3TJ8A 2DKOB 2ABYA 5HP1B 1TKZA 2OD6A 4NCBA 3PYDA 2W01A 1TV6A 2W7PA 1TL1A 1Y3JA 1UWBB 2XHCA 2VKZG 3D0HE 1XJWB 1L3TA 2BW2A 4U6PA 1NSQA 1Q53A 1ZM2A 4AT1B 4KPCA 4JI4J 3JXOA 4ZJLA 4JI1J 2XHWA 3TI0A 4KTQA 4CRJA 3HFZB 3JSBA 4V19X 3BJYA 1IVZA 4CP5A 1YJVA 1B0PA 4DR6F 1UETA 4C3MA 5KT3A 2XGPA 4JI3F 3HJVA 1CJTB 3G2XA 4ZVUB 2IM0A 2ASDA 4ZCIA 3ZC4A 2MKKA 3T1YJ 4L6V3 1O0PA 2MYFA 1S1VA 3QT7A 1MMLA 1WG5A 2DJWA 5J1NA 3SSQA 2QEXS 5ETNA 4CH0S 1YITS 2A2DA 4M95A 3GCXP 3OFHA 4ANCA 5ETLA 3L7UA 3A4TA 2ZHBA 3KK1A 3LWLA 2FJXA 4USHA 4RBUA 9ATCB 2QT7A 4X4TA 2QE5A 1RAFB 1RWKB 4ZVPB 3W5YA 3H4BA 3Q0AA 4J7CA 2LEPA 2E9ZA 5JJBA 3NWGA 4AL6A 2XEXA 3OVBA 3S01A 2IVMA 3LGNA 4B17A 2B56A 3HKWA 3GIRA 3MMJA 3DGVA 1SUQA 5C7PA 1SH2A 2QC3A 3TZYA 2V4RA 3K59A 1H2VZ 2I5JA 2X1GA 1RKJA 4TKTA 1QSLA 4C2MA 1FRIA 4X66J 1PBAA 1PC5A 1IR2A 2D69A 3I5AA 2F4FA 2MY8A 3D3BJ 2FJAB 2R7QA 2BE7D 2XS2A 1DTTB 4DS5A 1S6UA 2E1CA 3G8TA 1Y00A 3GG1A 3LP0B 3QZ7A 1VC6A 1WKLA 1F9FA 1B70B 3KLGA 4QPXA 2C3MA 2WBMA 4LRBA 2XMTA 2V2VA 4DS4A 4DL4A 1KTQA 1PSDA 2HMIB 5ETMA 4NLOA 4HLBA 1YJNS 3G87A 2XO7A 3SFUA 1T05B 4YP3A 2IYIA 1Z2LA 4CNYA 5CHCB 1JLFB 5EN1A 3EMTA 2Y8YA 3R1LA 3DLGB 2EW9A 3RRKA 3J7YI 1JLBB 2RQCA 1NNDA 3NGSA 1XR5A 2F40A 4DN9A 2KYZA 1VQ4S 1GMUA 4PQUB 2VBXA 2R7XA 3I0RA 4MFBB 2CVEA 2BJ1A 3J80Y 1VQ5S 3VAHA 1UCNA 1FTRA 2ROPA 4O0IA 1UVMA 2HAIA 2CYYA 2CPJA 5KT7A 4N8NA 4OI6A 2HVZA 2CNNB 1WOPA 3FEYB 5CYQA 1YX2A 2DHGA 3BO4A 1NO8A 4IR9A 3NOCA 3FFIA 1X4CA 2HFSA 1CJVB 3D54A 3D9BA 3V4MA 5B0DA 1OYEA 2VH7A 3FKBA 2UP1A 4LR7A 2WONB 2XMUA 4L73A 2JNJA 3T1AA 2YX7A 2EKYA 3GU0A 2M7SA 2F8HA 4EBEA 2DITA 2ZOMA 4DR3F 1X60A 1L3VA 2PO4A 1ZS6A 2DHHA 3IAS9 4CO5A 3O6QA 3GZ7A 2F8MA 4IUFA 3T5JA 4LBIA 3JAMY 1TUWA 3LAMA 1L5UA 1S6QB 3FCHA 4LSLA 4TQSA 1F3FA 3QJLA 2ZOGA 3V4IA 4J9QA 3CC2S 1FRHA 1YG0A 3MEGB 4KO0B 5J1EA 5FLXU 3KLEA 3TYTA 3H4DA 4Q8EA 5B7WA 1HMVB 3QAUA 3FSYA 3K8VA 1HARA 1KLNA 2FD2A 4A8MP 1Q8KA 2JZ5A 2WVEA 4QU6A 2GS8A 1FWLA 4ER8A 2R7TA 2LVWA 4X62J 3GYXB 2YKMA 1TKXB 1NDKA 2CNOB 1V3RA 2DNHA 2HSEB 4FF1A 2HVIA 2RAQA 5J2PB 2OPRA 5BXIA 2Y0SD 3G6XA 2RIJA 2ZHOA 2NXEA 1X9WA 1IJFB 1SB6A 5E41A 1AUDA 3HHNB 3RJMB 2ADBA 4FXWA 4OX8A 1J5EJ 2V9KA 2VJVA 3CCLS 3J7AN 4XTTA 1NUEA 1GK8A 4I1TA 2YWEA 1NAQA 2MZRA 4OX9J 4CH1A 2RHQB 2J0QD 3UVJA 4K4WA 1KQSR 2J9DA 1HYSA 2RKIA 1RAJA 2D41A 3MR7A 3DU6A 3OPKA 3SQGB 1PG5B 1HWJA 1QSYA 2LQ5A 2OPQB 3OV7A 3KHRA 2C2DA 1T3OA 2XWYA 4C8OA 1IKYB 1S76D 2PC6A 2CG4A 4KGMA 4IG0B 4X4PA 4DBQA 5E33A 2DY1A 2CJQA 1KQFB 4OI4A 1C4AA 4Y2AA 1WSRA 4EUVA 3DOMB 2BBEA 4Y6IA 3ZZRA 1JXEA 1NXIA 4IOAQ 3L09A 3DYAB 4NX9A 3BQ2A 5C42B 1HW9A 3CC7S 4WYWA 4RW8B 2W2PP 5KT2A 3NS7B 4GVLA 3MM8B 2DY9A 2HWTA 3C6UB 3J81U 2CAJA 4FVMA 2EVZA 3F0NA 5KFLA 4CNZA 5E3CA 2C28A 3BYPA 3K5MA 5KG3A 4ICLB 4DV2J 3HT0A 1JWWA 3TJAA 2XMVA 1QUVA 3MMCA 4KKOB 1XEZA 2OMOA 4WP8A 2D1CA 1HBOA 2HHVA 2DBBA 1TELA 4R8UA 1Q8IA 3IXQA 5F8JA 2FLLA 1SL1A 4N56A 2FJWA 1RKIA 4NL5A 2CUYA 1KDNA 1LW2B 4JI5F 4LVNP 2VG6B 4F0MA 4DEZA 2P9EA 1U0SA 4K50A 1RT5B 5EHHA 4DPXA 3C66A 4RW6B 2PD1A 2VPZB 3IGNA 4O3RA 2XY7A 3LP1B 3KJNB 3FDSA 3MHYA 4ETZA 4NCGB 2N7YA 4LFBF 4PWDA 1X5PA 4DR7F 4LFCF 4LBPA 2KT3A 3SV4A 3UN5A 3BSNA 2FUG9 3IG1A 5DZ7A 3CD6S 2U2FA 1N36J 3W3SA 3M2VA 1KLMB 1LKZA 1N54B 2NS1B 3M2RB 3GILA 3CMAS 2OTJS 2XULA 1MMDA 4CIOA 1NBEB 4ZS6A 1PJ6A 1YZ6A 4WZQA 2MLZA 2EFQA 3BO2A 3F73A 3RW7A 3E8OA 4DCPB 3TOQA 3W61A 2OTLS 2B9EA 2HGLA 2RJZA 2IIHA 4USUA 4LQ9A 1U1RA 2EKNA 2ZJRQ 1BQMA 1QDUB 2FZGB 3W66A 4MIWA 5HBMA 1U1MA 2CRLA 3FZBA 4N77A 4K4UA 2X1FA 2DIVA 3GV5B 2N4CA 4WFYA 4URGA 5AE2A 4K4VA 2QSWA 1S99A 1U2CA 4IFVB 4QR1A 4Z7YA 3ZZTA 4JV1A 4CT8A 5KG2A 2AYEA 3EM1A 2WW8A 1K0VA 3I31A 2MQNA 2IAJA 3PW7A 4Q0BB 2HZCA 5B0EA 2JC0A 1VYAA 3ILLA 3BEGB 3DLKB 2PFDA 4ED0A 3ET6A 1QTNB 3TJ9A 2AKWB 2ZZTA 3NGUA 2OPSB 2EBGA 3Q22A 2ZBIA 2WOMA 2KN4A 3EXYA 4DMZA 4LSNB 4MYUA 4CO0A 2OFHX 3L7OA 2Z57B 2J9EA 4M63A 4F50A 3FJ2A 4AXJA 2VA3A 3MM5A 2CNKB 4HHJA 3CMES 4RU2A 3Q8PB 2A2CA 5KG7A 4D3GA 5E7OB 5T14A 2XLIA 1UP1A 3BYRA 3CF5Q 3D7SB 1YRTA 5BYSA 3FQLA 4C3LA 4JI3J 3CCMS 3NOGA 4KGZB 1UEKA 4FS1A 2EC0A 3I96A 5HROB 3IWNC 2BJ3A 1RLDA 3MOZA 3IA0A 1S6OA 1BHNA 2RRAA 4F7VA 2DGXA 3DOKB 2KI2A 4NA2A 1IUJA 4PRFA 1OSCA 2F4VF 1VRTB 1NK0A 2JJ4D 1ZAWA 1SJ1A 1PAUB 2YNIB 2FC9A 2K8GA 4ZPWR 2FHMA 3K5PA 2KU7A 1FKOB 4KPYA 2VPYB 3DCAA 2R2SA 3C16B 3GONA 3GPAA 3GYNA 1YWXA 1YVFA 2JLFA 4K8RA 5LJ5Y 1T94A 2ZDPA 1JNZB 2PMZD 5DM6Q 2Y8WA 3LPEA 4J5OA 5KFAA 1PJ5A 2VC0A 1N33F 4HVZA 4C11B 4EMDA 2EEYA 5HJYA 4B3MJ 4O44A 1CJKB 3PCOB 4J9RA 5D0GA 4ECYA 2MTLA 2RNEA 3LAKA 4O23A 4DPYA 4WTOB 1HNZJ 2JX2A 2P9CA 1XBWA 2O67A 4O3OA 4U8VA 3Q8RB 5KT4A 2W24A 4F4XA 1VLOA 1TL3A 3OJUA 2LQJA 3CGIA 4LF6J 2R7RA 4CLFA 3MWBA 1UFKA 2VFTA 4YY3F 1TP7A 1P1LA 4DV7F 2C1EB 4EK2A 3EDRB 3D1OA 2ZFHA 1PAEX 4OYZA 1J5OA 1QAJA 1RBAA 4B02A 2EWHA 2VDHA 5LMNF 4YDDB 2KFNA 2DR8A 3ILOA 1B7FA 4PXBA 4P2MA 1AFIA 2MZJA 3PV8A 1U8WA 2BXJA 3MEDB 4URSA 4KYZA 3HULA 5AXLA 4NXNF 3D68A 2QMWA 2WSCC 1SJFA 2MSTA 1A7GE 3Q24A 2YWHA 2HS4A 1T03A 2CPEA 2JSXA 4K4ZA 1DQAA 3EX7B 4DV6J 3CMQA 2QL5B 4JB8B 2ZM6J 2A1BA 3W9HA 2N4DA 4F2SA 2KVQE 3JQMA 2X3DA 3H2LA 1XWLA 3MPYA 4PYAA 4QIEA 4DFMA 3I32A 1TVRA 2HLTA 4A8YA 1IXKA 2VOPA 3IRXA 4CCHA 2I9SA 4GVBB 2H65B 3A13A 2P6TA 5GAHI 2DNZA 3A8KA 4DU7A 4FDFA 1XMOF 2OELA 3G86A 4FYDA 3R2CJ 2YNFA 1BE4A 2X1AA 1VRUA 3IBCB 3MUVP 2YX1A 4DDFA 2ATCB 4JI6J 2KG1A 3CJSA 2CG8A 1U7LA 2RILA 2R8IA 2XS5A 4ZPCA 4Y28C 1S4FA 4RL1A 4WKRA 2QLWA 5HMXA 5B0FA 2H5EA 1Q78A 1RHJB 4XO0A 5KG6A 3F56A 4A46A 5L1KA 2DPJA 4YHHF 4ID8A 5B0GA 3AFGA 2W4PA 5E5NA 4PPZA 3ENWA 3TUIC 1W2BR 2MKHA 1Q5YA 5FLXY 2Q66A 2E9TA 5KFKA 3PTWA 3ADAC 4EU0A 3JYTA 4Y34A 4JI2F 3IWLA 3U1MA 5D8HB 3BKUA 2K2PA 1D8ZA 1UL3A 3W2VB 4OQJA 2M52A 4UY8T 4RJVA 2CFXA 3RBEA 2AYMA 2XNQA 2GGPB 1NZAA 1HW8A 1TU0B 1Y0HA 2IPOB 2ZVSA 4U8YA 3B4DA 3VGTA 4RLEA 8ATCB 4E98A 4OV1A 4KGXB 2RT3A 2LQBA 2FHKA 4PG7A 4F04B 3KYLA 2RE1A 1S77D 1RHUB 2HHWA 4ILRA 5ETPA 3CJKA 3M6VA 1REVA 3CCZA 3B8HA 1SV5B 3TZZA 2G0JA 3Q2SC 1NLKL 2G4BA 5ITHA 1H38A 3UNYA 3RB6A 2YQ0A 1EIYB 3NLCA 1UFLA 3AJ2A 2VB6A 4J90A 2L9WA 1LEOA 2FVRA 3M32A 2HHHF 2XCAA 3NWRA 1JLEB 2D3UA 4MKBA 3HHLC 5ETTA 4PWUA 2XGQA 1Y9OA 1Q8BA 1M1GA 4JI0J 4H4OB 3PRBA 2BQ3A 1LWEA 4PAAA 2O3DA 3KK3B 3SSSA 2HBRB 2KL8A 1B0VA 5AJ3F 4C4WA 3QJPA 2B7BB 4Q2MA 2ZD1A 2MHEA 4ZCLA 2F8EX 3GSDA 4YUDA 2R7UA 4C8ZA 3GYGA 2Y0BB 2MPUA 3CCUS 4NCAA 3GIKA 4TY9A 2QX0A 1XERA 4K0KF 1JKHA 1S72S 4B3SJ 3NCRA 4G1PA 2COLA 4U96A 1SH0A 2CA9A 3J81Y 3Q8UA 1EZZB 2ZNYA 3MMBA 3SI8A 3QSYB 1E6VA 4L3KA 2PA3A 2CQDA 1JNRB 2NREA 1SXLA 3D0GE 3LP2A 3MTKA 3CXCR 1C0TB 2CQ0A 3CIZA 4RKUC 3HVTB 3N6MA 1G4CA 3CO9A 3SCLE 1H7WA 4R5PB 3GJSB 3M8QA 4PG8A 3IGVA 5IT4A 5I4MA 2AD9A 5L1LA 4UOHA 4NA3A 1UMJA 4X4VA 5DDPC 2UXCF 3S7RA 4LFBJ 3Q89A 2Z4PA 1HKAA 1N6QB 1LOUA 4L75A 3MMAA 4DX7A 2JLGA 4DR7J 2V4JA 2RDJA 2HLUA 1S6PB 5T41A 1LWFA 2RF2A 3PFOA 2VZ9A 5EGYA 1FE4A 4N8OA 4CTAA 2MXYA 3DHWC 1HNVB 2B3TB 1MU2B 2FB0A 2UUTA 2CKWA 3WX8A 4PCQA 2J0SD 2BE9B 1NJZA 3U1LA 2L48A 4KFBA 3MD3A 3SMZA 4YDXA 4MT1A 2YQ3A 2V8GA 3ENAA 3SDEA 4UZCA 3MI7X 4RU9A 4G65A 3QLHB 2ZH3A 3K0JA 1RAHB 1CLFA 1U09A 2HYIB 4WCEQ 3RG6A 3KLFB 2P5VA 5G0RB 4WYLA 1PCAA 1T7PA 2CPHA 1CULB 5LSLA 4ECQA 1IWGA 4E2FB 3DDNA 4ZLLA 3AH6A 1QM9A 1KSPA 4DV3F 3KMSA 1H3DA 1Y10A 5KFHA 3EGWB 1VIXA 4IRDA 3DMJA 1IR0A 4TY8A 2W4CA 3C19A 4M5DB 1MWQA 1EHWA 3CD7A 3FSXA 3AT1B 2CPDA 2FZCB 2OJ3A 5THWA 2HS3A 2M3DA 1H2UX 5KFNA 3CD5A 1LK5A 1BWVA 2M5YA 3FVYA 2DRAA 3DLHA 5A8KB 3HD2A 4YB7A 3ISNC 1G6BA 4QQBA 4HTJA 2V2ZA 2ZWPA 5IV4A 1U1NA 1ZETA 4I2QB 3VGVA 3UD5A 3GP9A 5A6WA 3ENQA 2CQHA 2M9KA 5C5JA 3ZTPA 1SC6A 2OD4A 4F4WA 1FJCA 1GMWD 5ETVA 3G82A 1KBRA 4GKJF 4NI2B 2HBZB 2J9CA 2AWZA 4RUBA 2F7VA 2ZH5A 4DL7A 2W9BA 2BANB 2WSFC 1YGYA 1IKVB 1CQMA 1URNA 2K1RA 4B3RF 3HT3A 5JVGQ 5AT1B 1WG4A 1YI2S 2F4VJ 5DS7A 1WOSA 2Z8QA 3BPSP 1SC3B 3GFHA 3JTNA 3H0PA 4X4RA 2PN6A 2JFKA 2J6TA 2Y1IA 2UVVA 3JSMB 3BBFA 3X3UA 3Q83A 1N5YA 3MM6B 5GAGU 1KD1T 2I6WA 1PGZA 1KP6A 2P2CB 3OR2B 4I64A 3CJ3A 2BE2B 3ZFVA 2PA8D 1D9DA 2FY1A 1KQGB 4ZN1A 2CJBA 2RSQA 3SCJE 1JLAB 4OYBA 1ZYQA 2AW0A 5A76A 1TUVA 1NM2A 1V9OA 2IMWP 2A0FB 1EETB 2NXNA 3PRDA 2MJUA 2FLNA 1FXRA 2F1FA 5CZXA 1RT3B 4RW4A 5KFPA 1RWMB 2RS8A 1Q8LA 1H7XA 3I55S 4DUYF 3H59A 1VQMS 2GVZA 2K3KA 2PSZA 1EP4A 1RZMA 2CPFA 2DCUB 2J8SA 4RNHA 2C3PA 5HLFB 1WSVA 2YX4A 2ILZA 2MLXA 2PMWA 2MDAA 4WE1A 3FRYA 1N32F 2EFNA 3B4MA 1FEEA 1LXJA 4S0MA 2XB2D 4M5HA 3SBMA 1BWEA 3THPA 3RGIA 4HACA 2HS0A 3OL8A 4PWWA 3M9MB 3I9V9 3R2DJ 4CH7A 4MKAA 2BR0A 5U47A 5KAKA 1C4CA 4A8KA 4K4SA 2VFSA 2OPPA 4LF1A 2J8AA 3UDVA 2QV6A 3TO8A 5IV3A 1JLCB 4NLGA 3IP0A 4PUOA 4NXNJ 4X64J 1SL2A 4DV4J 2ZC4A 5J2MA 3LANA 3BSAA 3BGRA 1EB0A 1X5OA 4IO9Q 3DDKA 1HQUB 3GSIA 3DOLA 4FXDA 4A47A 4WWSA 4U7CA 3OT9A 4NLUA 2WBRA 2GJIA 2YWKA 1SQFA 3FMBA 5E0OA 2V50A 2ATLA 3NBPB 3VGUA 4LVOP 1T9VA 2B9WA 3MM7A 4NOHA 2HGNA 1RADB 1TKZB 4ENOA 1U48A 2C22A 1TV6B 2Z56B 1BQNA 1TL1B 4TLRA 3R5DA 4N7TA 1X4EA 1TL5A 3RB4A 5KFYA 2JVRA 4QWAA 5F8HA 2BMBA 3VV2B 3H7HB 2Z2YB 4EBCA 3ZZZA 3UDCA 2ASJA 4ECRA 2CQ2A 2NUHA 1X5SA 3VZIA 2XY6A 3P49B 3MR6A 5DETA 4OX7A 4LRFA 3F44A 4Q8FA 1N48A 4YHHJ 3MR3A 3R7SB 3P3DA 1RTDA 4ZVHA 5EWEA 3QWUA 4NLQA 1NB2A 1S1VB 2UUCF 2VQEF 4RX6A 3VGSA 2R8HA 2NZ4A 5GAEI 4DQQA 1WF0A 5D4OA 5KFMA 1SJQA 2E5IA 2KHCA 4USVA 2M8DB 1YZ7A 4A48A 3PHTA 2HNZA 1NKCA 2R7VA 3CNQP 5HATA 1OMSA 2EG1A 4I69A 4ZP8A 3CULA 1YJ7A 3KXDA 2HW3A 2XSFA 5DDQC 1O6XA 2AX1A 4ZVGA 4OZ5A 5F9NA 4OL8A 3OTCA 4BS2A 3ZTRA 4RBVA 2KFZA 1SUQB 3K8WA 5BR8J 4LF5J 1GQEA 3GE9A 2R7SA 2FIUA 3FEZA 2BEFA 2I5JB 3EJMA 3PJWA 4OJGA 2DNQA 3UFCX 4C0OC 4LR8A 2DNMA 4AYBD 1R6VA 1HNXF 3R6GB 5LL6d 4KQZA 1AZSA 3TARA 3SFGA 2DR6A 2HHHJ 2BRLA 3A3OB 4P75A 1F5BA 3ZNUA 1IKWA 4ZLNA 1IM6A 1WJ9A 3TA0A 3DLJA 2RRNA 3H42A 3DKDA 3D2WA 2D3ZA 1SVDA 3BBBA 4X4NA 2H4WB 2ZNZA 4ILLA 3O3LA 3CCES 1IJEB 1SIWB 2RU9A 1FDAA 4HDHA 4RW7B 4K0KJ 1RAEB 3HSZA 2BABA 1VQSA 5I3QA 4ED6A 5HVHA 3NS6A 1RT1A 2EK6A 3V81A 2KVIA 3I0RB 3HSJA 1OPZA 2Z2LA 2HHUA 4OLOA 3KJVA 2KG0A 3N6NA 4Q7AA 4WK3A 4LJMA 1K1QA 4NZ0A 3BM7A 4MYTA 2DO0A 2EFPA 1NHUA 4FBUA 4IFYA 3G71S 4OYWA 1TQLA 6FDRA 1YBUA 3HSDA 4QW8A 1GX5A 3OJSA 4IOBA 1XNRF 1F9EB 5CYQB 3ISZA 3FFIB 1TZ0A 4CDIA 2J0XA 1JB0C 4M8LA 2BQUA 1PKUA 5C24A 2PFFB 4KT0C 5A8RA 3RU0A 1HL6A 4BC7A 2BYCA 4OI2A 2I1RA 2N3LA 1FEHA 2VG7A 1WC0A 1WOOA 5A2QU 1UVNA 2MKSA 3V6DA 2DYAA 2DNOA 1LFPA 4WXOA 4QPTA 1JLFA 1RUSA 3W62A 4JUZA 2DNYA 3TP2A 4KE5A 3TVYA 4I7FA 4YR2A 5I3PA 4NLTA 4LREA 1UPPA 4R0EA 4PQUA 3W8PA 4LSLB 1XMQF 2H3EB 3SEOA 2MZ1A 2ZH2A 3J80U 1SQEA 2R2UA 3OTEA 3V4IB 2ZE2A 3D28A 3KLEB 1NZ8A 2BJ8A 3DRPA 3VAMA 2VG5A 1I5OB 2DEJA 2EBEA 3R97A 4MAKA 3G6ES 5F8NA 2A18A 2DR9A 2DR7A 2OP5A 2FHJA 1QAXA 3W9JA 3Q8YA 3TAMA 1N5SA 1HQEA 1SQGA 2YKMB 2XMJA 1Y7PA 2AT1B 1U49A 5LXRA 4M94A 3KFWX 1T9YA 2OPRB 3NGDA 4DV3J 3P96A 2KRRA 2RQKA 1KVJA 4P73A 4EBDA 4H4KA 2F63A 3LWMA 2LA4A 2GVDA 3BB5A 1RLCL 1U6ZA 4O3PA 5J2NA 3R5BA 3M7VA 3J7ZT 2Z2ZA 1NB7A 1VQOS 2HQCA 3AXMA 3ZZOA 4LBHA 3I0SA 5GAGI 1S1UA 2GNKA 2RDIA 1RK8A 3HZEA 2BJEA 3QGGA 4DSJA 3CCSS 3NAIA 2WVCA 3RZAA 2OSQA 4ES2A 2VUGA 1G2EA 3UVJB 1D8YA 1I1GA 3TX0A 4Y0FA 1HYSB 2R7WA 3MGJA 2RKIB 4C9DA 2HHSA 4PXCA 4DPWA 4HHUA 2VODA 1S1WA 1RAIB 5E3RA 1HI1A 4TLQA 2M4MA 3U1NA 4OV6A 1UA1A 2UXBJ 4K4TA 3R5GA 1Q7YT 2ZEJA 1HMVA 5HQ8A 3MXHP 4A8QA 2DNRA 2IJRA 1FKAF 2WVDA 4DZDA 4PQAA 3AD8C 4GKJJ 2AJFE 4NZ7A 1EAYC 1NJWA 2DISA 5LM7E 1S7HA 3CT9A 4AQYF 4JV2A 1WHWA 4QJVA 1TTHB 1I51B 4A8SA 3GB0A 1VQNS 3MTJA 3POTA 1VC5A 3TEHB 4ZVRB 4JYAJ 2E9RX 1O51A 3BZQA 2NLWA 3IC1A 1WEZA 4WFAQ 4Q44A 2OEKA 5A0YA 3WC0A 3BSOA 2G0CA 3OLAA 2B5JA 3G6VA 1N0VC 4HT5A 3DI6A 2C2EA 2DGOA 3TANA 4J9NA 1M5SA 2DB1A 3M9NB 3HLUA 3MMCB 1DLOB 2XBPA 1WC1A 1HBOB 5H9EK 3MDFA 4R8UB 5M2UA 1P6TA 2XLKA 2C2KB 1L3SA 1URRA 4C0BA 4FYXB 1QLNA 2OLWA 3ETOA 3JQKA 1WDDA 3ILJA 3SQGA 2OPQA 2MZTA 5I3UA 2AEMA 4WFZA 3TEGA 2V8PA 2PMHA 4PG5A 2J0WA 4ID5B 4LF2A 4KHRA 2HHXA 4TNOA 5KFEA 3HO1A 3NG8A 3A3NB 2CDQA 3OXGA 4UOGA 1PO6A 5EWGA 2IMOA 4PWDB 4DUYJ 4GC6A 2OIHA 2UUBJ 4WZMA 1UVLA 4OHXA 1OO0B 3IG1B 2OMLA 3AD9C 3O44A 3T1HF 1FDDA 3M2VB 1JJ2R 3WBZA 3IS9A 2BKOA 1RTJA 1HWUA 1H73A 3M2UA 3KHGA 1VLYA 3U7JA 1TFWA 2E5LF 1QY7A 3GTYX 3WIUA 1HBNA 6AT1B 4NASA 2QMXA 4ILMA 1HNIA 1UVKA 4ED3A 1B3TA 4AL7A 4DV1J 3UQSA 4I4BA 3CCWA 4XK8C 4ZVQB 1ZTWA 2MZSA 2ERRA 3P45B 2B4VA 2B4OA 1OQ3A 2AJ0A 5HBMB 2E66A 2AQ4A 1T9WA 3W2WA 2ZKUA 1Y4ZB 2ZH4A 1B99A 1M5VC 1Q5VA 1HA1A 2IAJB 3BN4A 2X1BA 1BMQB 1K0TA 2Y9HA 1FRJA 2MZQA 1XC9A 1X31C 3D1QA 4XIUA 2HWHA 4JI8F 2HGMA 1FXLA 2MQ8A 3ZNJ1 2QTWA 4NLRA 3ET6B 4OHZA 2KT2A 1IN0A 1S57A 3UN3A 4F4ZA 2VA2A 2VQFF 1OQ6A 4RWXA 5IQQA 2WOMB 4DN0A 4USTA 1RT6A 2XZDB 1CS4A 4DG1A 2Q79A 3C6TA 2OEMA 5HK4A 4B9TA 2RB7A 3LGHA 4FS2A 1YJRA 3MM5B 3LUYA 5K14A 2GIRA 3N28A 4C98A 5JVHQ 2D7SA 3BR8A 1VMBA 2WHOA 2GAHC 3FBBA 1DBDA 1UA0A 1HR0J 9RUBA 1UZDA 2IJFA 2ROEA 1H6KX 4DUTA 2C42A 1F6TA 3QT8A 1TK5A 1Q95G 3CJTA 4AE5A 2VV5A 4DSIA 3CTRA 3AQOA 3IAM9 1KKHA 4PPDA 1YLXA 4YN3B 3MM9A 1T3NA 4MJKA 4NYOA 4GKKF 2DGTA 3RYLA 3PDNA 1U0HA 3DM2A 4C8KA 3WX4A 3Q23A 4NXMF 3H20A 2EPIA 4ZN3A 3FBEA 5LMUJ 4IH7A 3M8ZA 3NXZA 1FTCA 3TVKA 3E3XA 2MQMA 3WHIA 4F4KA 4AL5A 3TW0A 3TRGA 3UDEA 4H4MA 1PYSB 2V2KA 2C2RA 1FJGJ 1RBLA 4B9MA 1U1OA 4O44B 1MSWD 4TVAB 1WDTA 3OTOJ 5FDLA 4KH1B 4N47A 3RAXA 4FNHA 4WFNQ 2HQGA 5CXTA 4H4KC 5D0HA 1HNXJ 2DVIA 2LFVA 4MK8A 2NUUG 1WC4A 2ZWOA 4WFXA 3U27A 4LF8F 3UCUP 1RWXB 1TL3B 2XC9A 2DT9A 2H5JB 1GX6A 4FYYB 1TK8A 1HWLA 5E3AA 1HLWA 1Q79A 4ZPAA 1EKSA 1U2RA 4GRSA 3HVAA 1L3KA 2IM1A 4OI1A 1VRTA 3QT6A 4YS2A 3MAHA 1J5OB 1YHQS 1I6JA 2C2NA 2CZ4A 5DM7Q 2KZMA 1AA1B 1FX4A 1TR0A 3KMQA 1VHFA 3H5SA 4FF2A 5EX3A 2HFVA 4BWMA 3LQVA 2LQ8A 3KJFB 1S1XA 3PNIA 3ZZYA 3TWZA 5K9FA 3QIPA 2QA2A 4XPCA 1TMMA 4RWWA 4ZVOB 4LQ3A 3NMRA 4JV5F 2WTFA 5L1IA 1K44A 3OVAA 2O1PA 3OBIA 3CCRS 1ZBTA 4CI0B 3LPYA 2RH3A 3V6HA 1BC6A 4KBIA 4UZBA 3N5BA 1T03B 4EZ9A 4Y65A 1E6YA 1Q82T 1O8BA 4QIWD 3L9ZA 4ZA1A 4F3OA 1XNRJ 2AJ1A 2KJVA 1NJIT 2N82B 3PFEA 4P2FA 5CCMA 1TVRB 2DRBA 4DV5J 1FXDA 1G3OA 2I8EA 3E01A 2VASA 3IRXB 3HVRA 1KC8T 4V19J 3Q2TC 5KG4A 4DSLA 1YSJA 4PXDA 5D0RA 2E1MC 1RT2A 2QLXA 2BQRA 1DJ0A 2M8HA 5A2QY 5AE1A 3Q8SB 2D3OR 4B08A 1U24A 1X8DA 1VISA 2QMUB 1C1CA 2YNFB 2V5HG 3TAQA 1OWXA 1VRUB 2FLOA 1AB8A 2CZVC 4KHPF 3EDQB 3IMQJ 3WIVA 4W98A 2E5GA 4F8RA 3M8WA 4N5SA 1GH8A 3DXSX 4KAIA 5H9EJ 4EYHB 1U2FA 1R31A 1N0UA 3DXBA 3MEDA 1JLGA 3BGOP 1QSSA 3QQCD 1TUGB 1FJ7A 2DXDA 2KM8C 4F67A 1HIYA 1AW0A 1RAAB 1R8HA 1V5VA 3RTVA 5IXUA 3KLHA 2OUGA 3C8YA 1TAQA 5IQ6A 1HFEL 5HO4A 3L4BC 3JYTB 5HVFA 4RBTA 5HL7Q 1AXQA 2UU9F 4OZ1A 4DLGA 1XNQJ 2YXLA 4H54A 1P9QC 1B4SA 4IQXA 3R5AA 4M5LA 3V6JA 1JX4A 1FRKA 2KH9A 1EJ7L 3ULHA 4X2BA 2LKZA 3MAQA 3HFKA 1R0AA 3H90A 1G1XA 2BW7A 3DC2A 1T8EA 1FNXH 2MGZA 4ZPTR 4ECXA 2YWFA 2YPYA 2QRRA 2NYIA 1RTIA 4PYDA 2FVCA 3CCQS 2POKA 1P1TA 1NU4A 1X7VA 3JS9A 3EICA 5D4PA 1NSAA 3CJKB 2W8LA 1REVB 2V68A 1RJJA 4JI1F 2DXFA 2VJUA 3D0IE 5GMDA 3AJ1A 2BUNA 4GO5X 4P10A 2W4DA 3T9ZA 4P9SA 2XZWA 1X4GA 3M1VA 3FSIA 2ALZA 4MKYA 1WKKA 1H72C 3IM8A 5H9FJ 2UXDJ 2FTRA 2CJAA 3HX9A 3SV3A 1WF2A 1X4AA 3AY0A 3T1YF 4I67A 1P27B 1LWEB 2DGUA 3V5RA 3PEJA 5CH7B 2B7CB 2HFZA 2KXNB 4CLWA 4OFZA 2ZD1B 2F65A 4ECUA 2HEKA 3GFZA 4QU7A 4OMFG 3KG0A 1Z1ZA 1N8RT 1DRZA 2HPUA 2QA4G 4WP9A 4ZVEA 4IH5A 1CG2A 1Y11A 1HBUA 4DSKA 3MMBB 3GV7B 2AEFA 2MQOA 1E6VB 2Q1LA 4DF8A 1GMVA 4YFUA 4M5KA 1WEYA 3MFHA 2BX6A 5DDRC 4IG3A 1RTHA 2MHNA 3QO9A 2B43A 3LP2B 2CQPA 4HDGA 3ZTOA 4J9UE 3LALA 3H98A 4X66F 1N34J 3CJ8A 3H40A 5A8WA 4ED8A 3R27A 4Y3CA 2UUAJ 2QG9B 4NYZA 3M8QB 1WHYA 3GIMA 4O0NA 4PKDB 4KC5A 4DOZA 3D67A 3OR1A
chains in the Genus database with same CATH topology
1S97A 3HDSA 2HFOA 3PIOQ 4GKJF 2JC1A 3PEHA 1DTTA 1PC4A 1HQUA 2J9CA 3LP0A 1U45A 3OUYB 2AWZA 1N5QA 4DL5A 2F7VA 2ZH5A 1DARA 2D9PA 3MMAB 4YR3A 2W9BA 4DL7A 3IN5A 3CPWR 2BANB 2WSFC 1YGYA 1VOMA 2XG8A 2O66A 2V4JB 1IKVB 3UPFA 1CQMA 1R0AB 2IVYA 3PW0A 1URNA 5FJ4A 2K1RA 4B3RF 2ASLA 3HT3A 4NLDA 5JVGQ 1O5JA 1G7CB 1WG4A 1YI2S 2HMIA 2E1AA 5MLCV 3I6PA 3NBPA 1D9FA 1LWFB 1NRKA 2RF2B 1VK8A 1SKSA 2MGZB 5DS7A 2CQGA 5L38A 4X4QA 2Z8QA 2GHWA 2LU1A 5K8OA 3GFHA 4RZRA 3IO1A 2QSFA 3JTNA 3NCPA 3LW5C 5T7LA 1T05A 4BC9A 1RTIB 4X4RA 2ABYA 5HP1B 1TKZA 1NKEA 2OD6A 4CTAB 4NCBA 1TV6A 4M1KA 2W7PA 1TL1A 1Y3JA 1UWBB 2PN6A 4DHVA 2JFKA 5KFIA 4I68A 1KQKA 2J6TA 1MWZA 3VAFA 1MNEA 2Y1IA 4O3SA 3VWSA 2VKZG 3DLGA 2UVVA 3PIPQ 1Q1KA 3JSMB 2VONA 3D0HE 3X3UA 1N5YA 1JLBA 3MM6B 4LIRA 5GAGU 1L3TA 1KD1T 3N0VA 2BW2A 4U6PA 1PGZA 1Q53A 1ZM2A 5KOXA 1KEKA 1M0SA 1FK9A 2UZAA 3EXCX 3OR2B 1NJYA 4I64A 3M1VB 3CJ3A 2BE2B 2ZUGA 2IM2A 3ZZ0A 3VAIA 4F25A 3ZFVA 3HM9A 2PA8D 1LQ9A 2XHWA 5F0WA 3TI0A 1D9DA 4KTQA 2FY1A 4MFBA 1FE0A 1KQGB 3JSBA 3JB9k 4V19X 2HFNA 2D9OA 2CJBA 2RSQA 3SDEB 3SCJE 2UV8G 1JLAB 3FNNA 3BJYA 2ZH6A 2CQBA 5CQGA 1ZYQA 1ZPWX 4EYIB 2AW0A 1VC0A 4MTPA 1QAIA 1TUVA 2EFOA 3OFEA 1YJVA 1V9OA 2IMWP 1B0PA 4G1IA 4DR6F 4NLSA 3AHPA 1UETA 4C3MA 1EETB 2KKHA 3R1HA 3S6EA 3PRDA 2E29A 5KT3A 5J1EB 2XGPA 2GMJA 2MJUA 2FLNA 4JI3F 1FXRA 2LDIA 3IR7B 2F1FA 5CZXA 5D4NA 5J1PA 1RT3B 1X0PA 2W7OA 3IR5B 2EK1A 4RW4A 4DL6A 4BDPA 5KFPA 2DGSA 2IM0A 5DQHA 3HKZD 2CPXA 2RS8A 2KJWA 3EPIA 2V8VA 2ASDA 1Q8LA 3ZC4A 1H7XA 4ZCIA 2MKKA 3RW6A 4L6V3 1O0PA 4QR0A 3I55S 2MYFA 4WU3A 2YVSA 4DUYF 3UR0A 4QWEA 1S1VA 2CQ4A 2CQCA 4LFAF 3HF5A 3H5XA 3H59A 1MMLA 1WG5A 3AA8A 1VQMS 3HHEA 2DJWA 5J1NA 2K3KA 2PSZA 1EP4A 2CPFA 4WTYA 1S9FA 3SSQA 3THVA 2QEXS 5DG8A 1UW4A 2DCUB 1WF1A 1S49A 4RNHA 4CH0S 1YITS 2C3PA 5HLFB 3DMJB 4B9NA 2A2DA 4M95A 4TY8B 2WONA 2YX4A 2KRBA 3OFHA 3KHLA 2ILZA 2P9GA 1OSDA 3G8QA 4ZP9A 2MDAA 1S9EA 4WE1A 2ZHBA 3KK1A 3LWLA 2FJXA 3FRYA 1N32F 2EFNA 4USHA 4RBUA 3B4MA 1FEEA 1LXJA 2QT7A 4X4TA 3FQKA 2C3OA 3A1YG 2XB2D 2FJEB 1HBUB 4QBUA 3MPWA 4DFJA 1BWEA 2QE5A 2JRSA 3THPA 2FPHX 2DIUA 2HS0A 2VKRA 3H4BA 4RNOA 3Q0AA 4MK7A 4R0JA 5ADZA 5HMYA 2LEPA 3MD1A 3OL8A 3M9MB 2E9ZA 5JJBA 1DFDA 3I9V9 4EO8A 3NWGA 3DRRA 4AL6A 4JOUA 4CH7A 4MKAA 2XEXA 2BR0A 2WCXA 5U47A 4CO2A 4LF5F 5BR8F 3OVBA 2AF6A 3S01A 5F8LA 2IVMA 3LGNA 5KAKA 2CQIA 4IG3B 2APOA 1C4CA 4B17A 4A8KA 1ZAXA 4K4SA 1N5VA 2GC8A 2B56A 1RTHB 3HKWA 4ES1A 3QO9B 3MMJA 4LT6A 2VFSA 4ES3A 2OPPA 1SUQA 4N76A 2J8AA 4KIAA 2DNPA 1SH2A 4U9RA 1S6QA 3T6JA 2V4RA 2QV6A 1H2VZ 3K59A 3TO8A 2I5JA 2PE8A 1KS2A 5A8WB 1JLCB 2RQMA 4NLGA 4Y2CA 2J7UA 4YOEA 2X1GA 4BWJA 4DL3A 1RKJA 1H98A 4PUOA 1RYSA 4TKTA 1SL2A 2ZC4A 1QSLA 4C2MA 5J2MA 2GMLA 4CO3A 4OX6A 3LANA 1J2VA 1FRIA 3DFEA 3BSAA 4DFKA 1PC5A 3K5LA 3MEGA 2VOOA 4N41A 1A6LA 4ZHRA 4KO0A 3OR1B 3HK2A 3I5AA 2MY8A 3BGRA 3NNAA 1X5OA 2FJAB 2R7QA 4IO9Q 3DDKA 2XS2A 4RUAA 1DTTB 2B4PA 1SKRA 4DS5A 1S6UA 1FDBA 2E1CA 1HQUB 3G8TA 5GAEU 2A10A 2YH0A 1Y00A 3GG1A 1V6HA 3LP0B 3DOLA 3QZ7A 1VC6A 4FXDA 4HI2A 2E5HA 2EFGA 1Q86T 1DQ8A 1F9FA 4A47A 3KLGA 1R8AA 4U7CA 3R5CA 4QPXA 2IBOA 3I5BA 2C3MA 1Z2ZA 2WBMA 2XMTA 2DTJA 4F02A 4DS4A 4DL4A 2K1RB 1MW7A 2WBRA 4NLUA 1KTQA 2R8GA 2GJIA 1PSDA 2YWKA 4RUHA 3FMBA 2GA7A 2HMIB 1TKXA 4NLOA 5E0OA 4HLBA 4B9SA 3OL9A 2ATLA 2LXUA 3NBPB 3O5TB 1YJNS 4I6AA 4BCAA 3OL6A 1QVGR 1TKDA 4LVOP 2XO7A 3SFUA 2B9WA 5J2PA 3MM7A 4NOHA 5T7LB 3B78A 1T05B 2F9JA 4YP3A 2HGNA 4HTIA 5F3ZA 2W7AA 2QFJA 1TKZB 4QZVB 4J9MA 1U48A 2C22A 5GADU 1TV6B 5L8RC 1BQNA 2IYIA 1TL1B 1Z2LA 2LDYA 3PXGa 4CNYA 2XI3A 2FVQA 2ZJQQ 5CHCB 4C97A 2YY3A 4TLRA 1JLFB 3R5DA 5IM0A 3HHLA 5DG9A 5EN1A 4EEYA 1X4EA 2B0GA 1TL5A 3RB4A 3R1LA 4B9VA 3DLGB 2EW9A 5KFYA 3RRKA 5M2RA 3ISND 2JVRA 5KFDA 3J7YI 1JLBB 4OX9F 1N5YB 2RQCA 4ZP6A 4QWAA 1NNDA 2B6AA 5F8HA 3MZIA 1M90T 1XR5A 2F40A 1KVIA 1FK9B 4DN9A 5LT5A 3WC2A 2KYZA 1VQ4S 1MMNA 4PQUB 2X51A 3OSNA 1P8GA 1KTVA 2VBXA 2R7XA 1PILA 1FDNA 2E1RA 4EBCA 3I0RA 4MFBB 4C8NA 2CVEA 3UDCA 3UW1A 3ZZZA 4ECRA 1N52B 4G1QA 2J5AA 2CQ2A 2NUHA 4NLWA 3J80Y 2ASJA 3VAHA 1IBKF 5LSRA 1VQ5S 4QCLA 1X5SA 3VZIA 2XY6A 1YIJS 3P49B 3MR6A 1NK7A 1FTRA 1QUPA 2ROPA 3HP6A 1NK6A 4O0IA 2QO3A 5DETA 4X4OA 4OX7A 2AGQA 1BD6A 1UVMA 3F44A 4OHWA 1SIZA 2HAIA 2CYYA 4Q8FA 1F2GA 1D9AA 1N48A 3IFEA 4E8UA 4QWCA 3MR3A 2PI4A 5KFZA 5KFSA 3P3DA 2KDOA 2CPJA 4RW4B 1RTDA 2ROGA 4MIAA 1IKYA 4ZVHA 4N8NA 4OI6A 5KT7A 4O4RA 2QYCA 5EWEA 2HVZA 4QIGA 2XY5A 3DU5A 3QWUA 2RQ4A 4IG0A 4NLQA 5EUHA 1UKUA 1S1VB 2UUCF 2VQEF 4RX6A 2R8HA 3FEYB 4NPOA 5CYQA 5GAEI 2DHGA 3BO4A 4DQQA 2NZ4A 2BOPA 1NO8A 4IKAA 4IR9A 2G1DA 3N9UC 5KFRA 3FFIA 5KFJA 1KHVA 1EP4B 1WF0A 1WI6A 3SYZA 4C7QA 5D4OA 4IRKA 1X4CA 5KFMA 1SJQA 2E5IA 1YBAA 2KHCA 3D54A 1UJ4A 3V4MA 2M8DB 5KTQA 3QYYA 4A48A 2VH7A 5B0DA 3DOMA 3TX8A 2UP1A 2WONB 2HNZA 1NKCA 5D77A 1Q7LB 3KLVA 1JXLA 3DN9A 3QMQA 2R7VA 3IWXA 3DYAA 2XMUA 1S9EB 4CZCA 4WE1B 4PG6A 1UVIA 5C42A 2XMWA 3VALA 1W25A 4RW8A 2V94A 1K9MT 4C8YA 1FRMA 2EG1A 3MM8A 3K7RA 2HG4A 3T1AA 2YX7A 2LEBA 2EKYA 4I69A 1YJTA 2M7SA 2F8HA 4ZP8A 4EBEA 3CULA 4EGLA 4DV2F 2I0XA 3C6UA 1DZ5A 2DITA 2ZOMA 5A6PA 4DR3F 2HW3A 2XSFA 4OJHA 5DDQC 1KR4A 1GXUA 2XMMA 1L3VA 2AX1A 4FPRA 4FBTA 5BJRA 3DRRB 4ZVGA 2PO4A 2DHXA 1IBLF 3MPVA 2YTCA 2Z2MA 4OZ5A 5SUHA 5F9NA 3CDUA 3IAS9 4FVCA 4CO5A 3VTIA 3O6QA 4ICLA 5C25B 4OL8A 1TK0A 3OTCA 3GZ7A 2F8MA 4IUFA 4BS2A 5F41A 3I56S 3T5JA 4YEAA 3GIIA 4RBVA 2C3YA 1LV5A 3NNHA 3JAMY 2WK4A 4KKOA 2OPPB 3LAMA 1SUQB 2KFZA 1L5UA 4HEA9 3K8WA 1GQEA 3GE9A 1S6QB 2R7SA 2FIUA 3FEZA 5L1JA 1UEVA 5AXNA 3FCHA 2I5JB 3PJWA 2G13A 4LSLA 4OJGA 1IKXA 5LXYA 2NPFA 2DNQA 2M2BA 3UFCX 4C0OC 4TQSA 2DNMA 3HHKA 3QJLA 3I4HX 4PUOB 3GG0A 2WSEC 2ZOGA 5IWAF 4WF9Q 4AYBD 3V4IA 1BQMB 2DH7A 5J2MB 1LW2A 4J9QA 2FJVA 5KG0A 2XCPA 2I38A 3CC2S 1HNXF 1FRHA 2VG6A 1YG0A 3MEGB 5LL6d 2KB2A 2RU3A 4KQZA 4ZHRB 4KO0B 5J1EA 3PW5A 3CSKA 1RP5A 3TARA 3KLEA 3TYTA 3BGRB 3H4DA 3SFGA 4Q8EA 1X4FA 2BRLA 5B7WA 3M6WA 1HMVB 1RT5A 3FSYA 3QAUA 3K8VA 1HARA 4RW6A 4NLYA 1F5BA 5DLGA 3DOLB 1IKWA 1KLNA 2FD2A 3CDWA 3QIDA 4A8MP 1FVSA 3K57A 2XS7A 1ZZFA 3DRYA 3LP1A 3TA0A 3DLJA 2JZ5A 4QIFA 4QU6A 2RRNA 3BREA 2AV5A 2F3JA 5KFQA 4NCGA 2R7TA 2LVWA 1SJRA 1Y5IB 2DGVA 3D2WA 3UNGC 5DGBA 1I94F 2D3ZA 2R8KA 3GYXB 1C2PA 4ELTA 2YKMA 4X4NA 1TKXB 2JLEA 3HVWA 1JK9B 2ZNZA 1LK7A 1V3RA 4NA1A 4DWIA 1RQ0A 2DNHA 4FF1A 4ILLA 2HVIA 3O3LA 1DHMA 3CCES 1NK5A 1RA7A 1IJEB 1SIWB 5J2PB 3MM7B 2OPRA 2RU9A 2Y0SD 3G6XA 3BF4A 2XMKA 2RIJA 3PX0A 1N88A 1FDAA 1FRLA 2ZHOA 4KV8A 2SXLA 4CO1A 1HBMA 4HDHA 1X9WA 1QTMA 1BQNB 4RW7B 1IJFB 1SB6A 5E41A 3PJXA 2ZH8A 1KLMA 1AUDA 5IM0B 2GX8A 3HHLB 1WELA 3RAMA 2OKQA 2MKIA 3G6YA 3EGZA 3HHNB 3QJJA 2NXUA 1D0EA 1KRPA 3O1LA 3M2RA 2ADBA 4FXWA 5KFVA 4OX8A 1UJ6A 3DLLQ 2ZKTA 3I82A 2BABA 2BZ2A 1VQSA 2B6AB 2BVZA 2V9KA 5JXSA 5I3QA 4K4YA 2MQPA 3CCLS 4ED6A 4CO4A 4X65F 4DJBA 2VC1A 1UVJA 3NS6A 4I1TA 2IRYA 2YWEA 1RI7A 1RT1A 2EK6A 4ZVFA 4E0DA 3VZHA 1NAQA 3BGFA 3V81A 2MZRA 2K7JA 2KVIA 5L9XA 2UVUA 4RNMA 3I0RB 4CH1A 4QOTA 1OPZA 4G1QB 2Z2LA 4C8MA 2HHUA 3GFXA 4OLOA 2J0QD 4YMEA 3KJVA 2V8HA 4P2SA 4HT7A 3N6NA 4Q7AA 2KG0A 4DPOA 3H5YA 4K4WA 3JTOA 2KYXA 3GR0A 4WK3A 1KQSR 2J9DA 4LJMA 1K1QA 4NZ0A 1HYSA 3BM7A 2RKIA 1RAJA 2D41A 5LJ3Y 3DU6A 2YKOA 3OPKA 4MYTA 3LO3A 4UW2A 3SQGB 4YR0A 2UXBF 3ZZPA 1HWJA 1QSYA 2DO0A 2EFPA 2LQ5A 3MF5A 2OPQB 3OV7A 3KHRA 4AUKA 2C2DA 1T3OA 4LIWA 2R8JA 3J7Z5 3LF0A 1NHUA 4ZPDA 2W8KA 2XWYA 1RTDB 2AYGA 4C8OA 4IFYA 4FBUA 3G71S 1IKYB 1S76D 3IBWA 1TQLA 6FDRA 2PC6A 2CG4A 2ZITA 4KGMA 4IG0B 4QW8A 1IBMF 4X84A 1GX5A 4X4PA 4DBQA 3OJSA 4IOBA 1XNRF 5CYQB 5E33A 4HL9A 1NHVA 2CJQA 1KQFB 3ISZA 3FFIB 3TR5A 1TZ0A 4OI4A 4ATNA 1C4AA 2J0XA 1JB0C 4M8LA 4Y2AA 4USIA 2BQUA 4ED1A 3LGMA 5C24A 4EUVA 2PFFB 4TU7A