1XEXB

Structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
161
Chain Sequence
KKNVFMRTFEAISRNFSEIFAKLSPGGSARLILENPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALAFVFAIQKFKPAPFYLFDQIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANADKIIGVSMRDGVSKVVSLSLEKAMKILEEIRKKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural biochemistry of ATP-driven dimerization and DNA-stimulated activation of SMC ATPases
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
molecule keywords SMC protein
total genus 41
structure length 161
sequence length 164
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xexB00
4OI1A 1SKQA 2VP9A 2CCGA 3QF7A 1JJVA 4YMTA 2GETA 4NHOA 3THXA 2GVDC 1SVSA 1VMAA 5KDLA 4TLDA 4Z8YA 3R9WA 4B35A 4G5QA 2QNRA 2OSBA 3B6EA 4RKEA 2R65A 1G7RA 2PJZA 2QAGC 5FL7A 2IYLD 4KAXA 5DGXA 3KQHA 1S4QA 2ZSDA 3P32A 4FMDF 3HU1A 3QXXA 4M1MA 4LJ5A 1GZSA 2QSYA 3A6PC 4GRAA 1R0YA 3DM9B 1NN3A 1TTTA 4HB3A 2X1VA 4QOSA 1G6OA 5DH9A 5TARA 1NLFA 1NVUQ 2A5JA 2AK2A 4AIIA 2QM8A 4F91B 2VHTA 3EPJA 2XOKA 1CEEA 1XDBA 3U7EB 2GJAA 3BGWA 4PX9A 1OT3A 4EJSA 2IXFA 1KNQA 3PFIA 5KUTA 5LB2A 2QAGB 3TSOA 2A5GA 1VCIA 2BMFA 1R0XA 4UXIA 3K0SA 2HXSA 1RJ9A 4RD2A 2R6AA 1EFRA 1DADA 4C0HA 4WZBE 3WP1B 1E2EA 3BH7A 621PA 4D6PA 2ZRFA 4BEBA 3FWYA 4QM6A 4LJ9A 5CYOA 4DDUA 1F48A 2JIZD 1XU4A 2IYUA 2ZAOA 2CVHA 2QU8A 3EW9A 3GJ7A 1DAIA 3SJZA 2JJ1A 1ZU4A 5DI3B 2E1RA 4ZV4A 5F9FA 3ZIAD 2X77A 1KK2A 2G1JA 2ODNA 3EIQA 5BN5A 3FPAA 2QAJA 4TL7A 2P2LA 2ZPTX 3EZ2A 1MKYA 1RVDA 1KDTA 3NG1A 1RW4A 2PH1A 3TH5A 4C4PA 3U60B 2RGDA 3I4LA 2QTVB 3A8TA 2F43B 4DSOA 2P5SA 3X1YA 4GMDA 1KSHA 4WOPA 3S1AA 3ZIAA 1DBSA 1NY5A 1T8TA 4MRRA 4EUNA 4PAQA 4B3FX 4LSGA 4C2UA 1E1RD 4V0LA 3T1QA 1JECA 1X86B 2WICA 1P9WA 1OIXA 4GZLA 1MO3A 2NZ8A 2LWIA 4OI0A 4TMZA 1NMZA 4JLJA 2QQ0A 1CJKC 3VU9B 1QHXA 4OJKA 3K0FA 1NBMA 2W6JA 2EFGA 2A9KA 4IDQA 1PVOA 3SU8A 4PZYA 2QA5A 1R6BX 1ZM9A 5J5CA 2IS1A 2OV2A 4V0OA 1EG7A 3OEEA 5FR2A 1OXXK 5JEDA 2Z4RA 1VYVA 4JBXA 4OK5A 4MRNA 1SHKA 1VG1A 3AP3A 5JWHA 2AKAB 4DRZA 2GJSA 4TYWA 2AR7A 2GNOA 2WAYA 4YC7A 4NCIA 3QNUA 2W0MA 3FB4A 3QPVA 4RFSA 1ZNYA 1ZU5A 2GXUA 5FOVA 5FI1B 2C03A 3U3MA 3AF3A 2OLJA 4B2PA 2WMNB 2BWJA 5E3HA 3K70C 1U9IA 2F9MA 2ONKA 2ZSAA 4M21A 4DC9A 1DAGA 2YC4C 3OF5A 3GLFE 4V0KA 2B92A 4A36A 3HU3A 4HAVA 4HLQB 1F5NA 4JLPA 3LLMA 4M22A 3AVPA 2R6CA 3IIKA 3X1XA 1KI9A 1KI2A 4LJYA 2ZRJA 3OEHA 3RHFA 1P73A 1X8KA 4D4LA 3VR2A 1IQPA 1KO8A 2GZAA 1NBME 3VFDA 3GJXC 1SXJB 5BWMA 3LVRE 5C1BA 4LK2A 5E7JA 4DT1A 3FFAA 4YXWA 3DVLA 2EWWA 4Q9JA 2QT1A 3ASZA 1G19A 1H8HD 2FEOA 2WOOA 2J87A 1ZNWA 4XSGA 1GL7A 1CR2A 3LBNA 4QGAA 2DBYA 1EGAA 3CX6A 1XJCA 4URUR 2IWHA 3THXB 4BASA 4TL6A 2GEVA 2Q3MA 2FZLA 5TMPA 5HKKA 1D9ZA 5CLLA 2C98A 4P4UA 1OKKD 3EIHA 1TMKA 1ZAKA 1XTQA 3TQCA 5KO2A 4EPVA 4IDNA 4URZR 3T06B 4MGIR 1G18A 2VHCA 2C96A 1CULC 2ZYTX 2Q9AA 4B32A 4CT4B 1G41A 1HA3A 3CRMA 5L3RA 3O47A 4W5JA 2GAOA 2OAP1 1P72A 3MWYW 2G88A 1AKEA 5CIQA 1JQJC 3KTAB 4FCVA 3QXHA 4RD6A 2VO1A 3KZ1E 4RVCA 1HQYE 3CB4A 2R6FA 3VHXA 1E94E 4NCJA 4PPFA 1KO5A 2PL3A 5B58C 5EZ6B 1C4OA 3WNCA 1IXRC 1QF9A 2NO7A 4JBWA 5J47A 3U3OA 4OQMA 2NO1A 4DLWA 1WF3A 1GNPA 3ND8A 4MKIA 2J0QA 1I2MA 4KXFB 1E2KA 2DCUA 2D62A 1XMSA 1ZD9A 2XEXA 1J8MF 3OFNA 2CK3D 1VIAA 3M6AA 5FFMA 3B82A 2A78A 1E2NA 4TSFD 1QHIA 4WZAE 1W47A 2J7KA 4CEJA 4KV9A 3QKRB 1CP2A 2QI9C 1OKKA 1MH1A 3H1TA 4I1UA 1OFHA 2ZE7A 4HZIA 2ZR7A 3ZGXA 5K8TA 5EP1A 2VP0A 2ZJZA 5H70A 4PQRA 3HU2A 4HLUC 3VR4A 3UIEA 8OHMA 2B6HA 3AH8A 3T1TA 3AVTA 1KMHB 1KI4A 2CEAA 5EE3A 5JS8A 1Z6TA 1COWD 2GAAA 4FWIB 3WP0A 1ZINA 5FTNA 1DG3A 4TMWA 5CB6A 1OYWA 4F93B 2H8KA 4BFZA 4PC1A 3AQ4A 1FPMA 2K5UA 1TPZA 1DS6A 1IOZA 2CL0X 3DHWC 2IYSA 5TXGA 5C18A 3G0HA 3GLGB 3E1SA 1D9XA 3W9YA 5AUOB 2HJVA 5GJBA 1U8YA 3QXJA 1EK0A 4PHTA 3BB4A 2CHVA 5L3VA 1ZBDA 4GNKA 4LGMA 4CEJB 4QL3A 1A2BA 2AXPA 4R98A 4W9MC 4Q7LA 4BEJA 1NLZA 2DFLA 4URXR 5JSZB 1XF9A 1M7BA 5AK0A 3PQCA 3LW7A 4MKGA 4Z8XA 4U7DA 3WMGA 2FFBA 2HYDA 1XXHB 2ZE5A 3MJRA 1Z5ZA 1ZM7A 2ORVA 2BM1A 1F6BA 4Q4HA 4ZKEA 2G0TA 2WWFA 2WWWA 2GBLA 2JLYA 4XVUA 1E9BA 1FW6A 3RRYA 3QUSA 4D82A 1G5RA 3Q5DA 1G16A 1QRAA 1X8JA 1BIFA 2YV5A 4CYMA 2IYRA 1X3SA 4KBGA 1VG9B 3A1WA 221PA 4OK3A 1IHUA 5EXPA 1Z6YA 2JATA 3B9QA 3RYTC 1XMJA 3UATA 5JEEA 5DSZA 2CL7X 3NVAA 1OH5A 3B2EA 1HE1C 2GZHA 3LBIA 4NPHA 3GLIE 3MSXA 2XSZD 2YJTD 2W2VA 4K46A 4DLZA 1M8PA 2QRZA 3QKSA 1KO4A 1UBEA 1II8A 3K53A 1D2NA 1TF2A 3PVSA 4NP6A 4R2HA 2NIPA 5D3MA 4Z1MA 3SJCA 3U44A 1YVDA 2H1LA 3GFTA 2AN9A 4KYIB 2WWHA 3A1TA 1MO6A 3O8CA 5FUVA 3FMPB 5EQTA 3SN6A 5HZKA 4B6EA 3ZQ6A 3N2IA 3PG5A 3WHKA 3T15A 1QDEA 3GFPA 2RB4A 3K70B 4MITA 4HB4A 5GJWC 1G3IA 1QHHB 2FSHA 3RNLA 2OXCA 3LY5A 1DELA 2WJJA 4GPTA 1DAKA 1XCPA 2OG2A 2FSGA 3TGPA 1GNQA 2B21A 2Q3HA 3WMEA 4ESVA 3QI2A 2XNDA 3K0EA 4BRUA 1ZC4A 4A4DA 1GSIA 1VYTA 2DPXA 2G6BA 3SJBA 1D2MA 2HXYA 1UKEA 3AP1A 4LOAA 2DWPA 1DAHA 2EW1A 2XB4A 2RMKA 3NIBA 2AXNA 4Q9KA 3VU9A 3BXZA 1W0KD 1DOAA 1DO0A 4HLCA 3BH6A 1L4YA 3W90A 1DPFA 5JFGA 5D3MB 1VCNA 3PENA 1J7KA 1BMFD 2VH5R 1XD9A 2IYTA 4N0DA 1KNXA 4W5WA 3RANA 1LS1A 1KDPA 3ZH9B 4NZYA 4LJAA 3NTUA 1OYYA 2I1VB 4B44A 4E07A 3UG7A 4Q66C 1OXSC 1T3SA 3L0PA 3Q7QA 3FHCB 5TV2A 4QXAA 1H8EA 4XJXA 3OIWA 2J45A 1ZVQA 1FX0B 2ERYA 4P33A 4UNSA 2ZJAA 1J8YF 5F2EA 5A0FA 1KDRA 1A5TA 2N42A 4A1FA 3CPHA 4AKGA 1LY1A 3QBTA 4M9QA 2ZROA 1WBBA 2ZSEA 1TEXA 3DMDA 4J0QA 2Q9CA 2AFHE 1P2VA 2B7BA 4OYHA 3ZVRA 4Q9LA 3KQKA 2ZRGA 1KTVA 1HYQA 4ARZB 2GXQA 3WBKA 3O8DA 1A7JA 1NIPA 3KB2A 1P62B 2ZJYA 2FFQA 4C0LA 2X2EA 4M8NE 5JRJA 1LF0A 2C2HA 3JZAA 4XOIA 1W36D 3KXIA 2ZRAA 3PR1A 3KJGA 4FCWA 3SS8A 3OEED 1HT2E 4D0LB 1CBUA 4D4KA 6Q21A 5J4HA 5D3QA 2L0XA 4XTRA 4BLSA 4AYWA 3REFA 2QGNA 5CK5A 5AJVB 2O8FB 2P3SA 5FL7D 2O0JA 2CLSA 1E0AA 1QG2A 3AUXA 5GVRA 3RABA 4B75A 2VLIA 4QG7A 2O5VA 2H92A 4QGHA 2BKEA 1W44A 2CNWD 3PUZA 1US8A 4KBFA 3NBXX 1XTKA 4FMCF 4DDWA 4KITB 4YMWA 1NMYA 3RS3A 1NJFA 2GZDA 2X8AA 1W4RA 1YZTA 2I4IA 1MO4A 2WIBA 2XX3A 3W6NA 4IXNA 2RAPA 3PUVA 3LXXA 1N6NA 1Z28A 3MMPA 4FW9A 4UJ3A 3GJ4A 2OT3B 1N2CE 2VIIA 3KKQA 2FGKA 5TDHA 1ZUHA 3NWJA 3TMKA 4BLQA 2C5LA 1PZNA 1GKYA 4Q5IA 2BOVA 4HYYA 4ITRC 5P21A 4OI4A 4HSEA 1CR1A 4HLUA 4NBSA 5AWFC 1R5BA 2OILA 2ZR9A 1N6HA 2ZEJA 4DCNA 3W5JA 1VG0B 3RVBA 4F4JA 3GEIA 2GEUA 2V4ZA 1ZJ6A 2W6JD 1BMFA 4JBYA 3T61A 1IAQA 4D2IA 1PLJA 4M1TA 1MABB 1XMIA 4OHYA 4DUGD 2NMVA 4PSAA 3GQBA 4HUQB 4Q7KA 2ZI6A 4GL2A 1AS2A 1G8PA 3P20A 4MYTA 2YWGA 1I4TD 1QBKC 1E2JA 3OFND 2BHRA 3FKQA 3UWKA 5JSZA 1GDDA 1WB9A 3LA6A 5EE9A 1TEVA 5EE1A 4W7SA 3QPWA 4PTLA 3K9LA 4DLTA 1XTSA 3K1JA 3U7FB 1LVGA 4OI2A 1E9FA 2OESA 2VHJA 3PEWA 1DARA 4NCHA 2R62A 3ZVLA 1TQ4A 2ZVPX 4TQ9A 4Q4HB 1S9DA 3CONA 1ELOA 3LBHA 2XZLA 4S2EA 4DDVA 2A3RA 3FVQA 4AK9A 1PV4A 3N70A 1MRNA 2XNSA 1ZMXA 1RZ3A 5DHFA 5KTYA 4Q1EA 1Q20A 3DKPA 4Q1AA 3W6OA 1S0UA 3SOPA 1KJZA 3KKPA 2W6ID 3BB1A 3FTQA 2XTZA 1N5LA 4TZ6A 1P5ZB 4QHYA 3CNLA 4N0EA 4PSVA 4MYHA 1JBKA 3QKSB 3WYFA 4WAUA 1RKBA 4IJMA 2DR3A 2QPTA 4MYUA 5IK2A 4B3CA 1PUIA 1TADA 3LFUA 4GMXA 4Q03A 5G53C 4IOKA 5TVKA 3QF4A 4NTZA 1CRPA 1SZPA 3QPUA 5AJZA 4Q1BA 3NC1C 2QMEA 4V0NA 3Q3JB 3ADKA 2D06A 1IY0A 5HE9A 2O8FA 1K5GA 4YXWD 2QAGA 4B3DA 1W5SA 2IWRA 4OBEA 3AVUA 1P4SA 1N5IA 2WWGA 4DLUA 1RJ9B 3B78A 4BPBA 2ZI5A 4QNMA 1IJEA 1YQTA 1QHGA 5HPYB 2AHOA 1SGWA 2YZ2A 3LO5A 1G291 4KLNA 4H1UA 3CRRA 3TQFA 1EWRA 3QVVA 4LBWA 4MQBA 1VHLA 3B60A 3THYA 1TU4A 2EVWX 4JLNA 2XJ4A 2GA8A 4DVGA 1E2GA 2Z0MA 2QE7D 1YE8A 2EQBA 3U3KA 3FFBA 4CEIB 4JVNA 3TSZA 2V3CC 4GZMA 4LY6A 4L8GA 4L9SA 821PA 1XXHE 1GKUB 4KODA 2R6DA 4RCYA 1E4YA 4LYFA 4B74A 2BVNA 4JYBA 2BV3A 1CRQA 4JLBA 4PXAA 2FE4A 2ZREA 1A2KC 4HDQB 1TQ6A 4BFTA 3PCRB 5FTLA 1E1RA 3FGNA 2GK7A 4XVQA 3THOA 3BE4A 3EZ6A 2ZRHA 2OAQ1 1UKVY 4Q9IA 4DJTA 4XSHA 1RRPA 2W6IA 4Y0VA 4ZDWA 2HUPA 4MRPA 1OSNA 1KGDA 2XNDD 1X1RA 1QZXA 1FL9A 1VYUA 3DKVA 2EU8A 4UNQA 1AGPA 2OO7A 4QM7A 2O0KA 2IYZA 3K9GA 1IXSB 5L3QA 4B48A 2QP3A 5DN6D 2VA8A 3EC2A 4M0LA 2GK6A 2WM9B 5ANRB 2E9SA 4YMUA 2PCLA 2JLUA 4B76A 3PUXA 4RY2A 2IS2A 2VRWA 5CITA 2AWOA 4TMTA 1GKIA 1XMVA 1XD2B 4PC6A 1R2QA 2YC2C 4PZLA 2N1BA 1UM8A 2GHIA 3CNOA 1BKDR 3P4XA 1R4AA 4GOJA 4IDHA 1E0SA 3AF4A 2ATXA 3CO5A 3NBZC 2ZS9A 3EX7C 5H68A 3V9PA 5L3SB 2J7PD 3C4JA 2JJ2A 3I62A 2AK3A 2OCYC 4M9SA 3UK6A 1JNYA 2ANCA 3R9XA 2V6IA 1P9RA 4BFWA 4BLPA 1KOFA 1E2LA 4NYJQ 4LWZA 5EXXA 3REGA 2JEOA 4DLVA 2XGJA 3BOSA 2JJ2D 2QPOA 3TUIC 3A4MA 4OHWA 3G5UA 5DO9A 2F1IA 2P6NA 3KDSE 3RWMB 4Q1CA 4QHTA 1FMLA 5KPDA 2CE2X 1N6LA 1EX6A 2ZR0A 1E1QA 1XTIA 2LKCA 2ZANA 2ZM5A 2QBYB 4P4SB 3IO3A 2BJVA 1W1WA 3CF0A 1T91A 3CW2A 4MGYR 4A0HA 4EAQA 2KJQA 4QNRA 3EPLA 2PCJA 3B13B 4Q01A 2GXSA 2FPMA 1MOZA 4DCUA 1YR8A 1YR7A 3K8YA 2CHQA 4QBFA 4BECA 3OIVA 3EPKA 2FPKA 1U0JA 3L43A 1JI0A 4C2TA 2H16A 4BLTA 1U2RA 4YLGA 1Q1QA 2UVQA 3VX4A 2A5DA 2ZSBA 4JS0A 2NZJA 3RSLA 4JL5A 4EQ6A 2AD5A 1JR3D 1XWIA 4LDJA 3MCAA 3UPUA 3SQWA 4A92A 2B8TA 4DSTA 4TL8A 1NVWQ 4DLYA 1WRBA 2PT7A 2GCNA 3PEUA 4N3NA 4PC7A 3SBDA 4CF7A 3LD9A 2VBCA 2QMUA 4NL4H 5A4JA 4YMSA 3BD9A 2Z6VA 1ZW6A 2IYWA 2VP6A 4TT3A 4BFUA 2IEZA 3DZDA 1AJEA 2Z4SA 3AM1A 421PA 2PMDA 3PJRA 5KHOC 3AKEA 4EKDA 2ZE6A 4ILEA 2GF0A 2WJGA 3FDIA 3GFOA 4IRUB 4Q19A 3QSYA 2WPDD 4Q1FA 3ASYA 3QY0A 4LV6A 3NC0C 4JT4A 3V00A 1AS3A 2WWIA 4BWYA 1BH2A 4LRWA 3SYNA 1KZGB 4BZPA 3ZDQA 3CZPA 1FTNA 1SXJC 4IEIA 2IF0A 4Q18A 1JEEA 1FP7A 1YR9A 5GJCA 2F6RA 4KVAA 1JEDA 2XTNA 3MWLA 3ONWA 4PQFA 1Z07A 2FNAA 2OEPA 3LLUA 2ONJA 1YZUA 1FZQA 4UJ5A 2CLDX 1XXHA 2HLDA 2WBLC 1EWQA 1XPRA 4I1OA 1IN4A 3NHBA 2ZRIA 5IK2D 3RSOA 3ZVNA 1V43A 3I8XA 2FV8A 2WJVA 1I4LD 4DSUA 1EX7A 1G8GA 4JLMA 3LQRA 1N0WA 2REBA 3IDQA 4IVRA 3A4NA 3T35A 2GTPA 3EWAA 5JLJA 3WYGA 4YDHB 4QKQA 1S3SA 2OHFA 3E2IA 4PO1A 4OK6A 4QBGB 4A6PA 4PHGA 5EP4A 2G3YA 2JLQA 3RS5A 4MRVA 4BUJA 2WVJA 4OQNA 4X8MA 1JAIA 5J4VA 1OF1A 3F0TA 2GJKA 3EG5A 4NYIQ 2ZI7A 1N6IA 2BCGY 4AY2A 4KU4A 2XB2A 4LHXA 1ZNXA 2ERXA 3FMFA 4DZZA 3GLHA 4AD8A 1W4BA 3OESA 4URWR 1WXQA 3L8ZA 3AV0B 3NEJA 1W5TA 1CTQA 2CCKA 5BN3A 3PUYA 1E9RA 4Q4LA 3AVXA 3EIEA 3FE2A 1DAMA 3B1ZA 2ZJBA 2J46A 1T3LA 5BYKA 1N6OA 4HUTA 4WIAA 4JLDA 4DLXA 5DYGA 4B73A 2F3RA 1JJ7A 1FOEB 2V9PA 3TJZA 3X1ZA 4DCTA 2WWYA 3LVQE 5KNBA 3KKMA 2ZUBA 3DZ8A 3F3YA 1EFRD 2B8WA 3THYB 4ACBA 2IHYA 1GP2A 1M34E 2ZTSA 3BFVA 4TZ0A 1EFHA 2O8DB 5B2ZA 4O3MA 4OHZA 2WSSD 2BC9A 2YOFA 1KSGA 1GAJA 3CX8A 2BCJQ 2C9YA 5JS7A 3E5HA 5K8IA 4P4SA 2QE7A 4US1R 1ONBA 4PPGA 2H18A 2IHBA 2YINC 2NO0A 2UZ3A 3HYRA 4V0MA 4Q4JA 1GTVA 1XEFA 2OZEA 5SZKB 3AGPA 1KI6A 1DAEA 1PLKA 1GIAA 1G3QA 1N0VC 1QHYA 4GT1A 1GVNB 5FBRB 4ERNA 3P27A 1IY1A 1OFTA 4O2RA 1G64A 3MJHA 1OLOA 5DYIA 3W5IA 1SULA 2EFEB 1DO2A 1KO7A 3ZZ0A 4BGDA 3ETLA 1JR6A 2FSIA 5CM9C 4LZZA 3U6BA 2ZETA 3MWJA 2YYZA 3U7GA 1G4AE 2BEJA 3ZLJA 1II8B 5LBIA 3C41J 2GVZC 1T8UA 1YZKA 1R10A 1DTSA 2OBNA 1FX0A 1X6VA 1ZRHA 4L15A 1FNNA 3BK7A 3SFVA 2ZJ2A 4Q4AA 4M1YA 5AR1A 1T0JB 3HWSA 5FUYA 4B3XA 1CR0A 3VR1A 1GFIA 2RHMA 3TBKA 2QBYA 3OAAA 5E4FA 2AWNA 2YWHA 2QTHA 3AVQA 4OQFA 4M9ZA 1R8QA 1E0JA 1NL3A 5AJXA 1T5IA 4FMCB 4DKXA 4V02A 1E2IA 4NCKA 3KXKA 1FFHA 4TTQA 1GWNA 4EDHA 4EPWA 1F60A 2FFAA 4XIGS 3ECCA 3F8TA 2XTMA 1SVLA 4RD3A 1G8YA 2DFKB 2ZITA 4D81A 2AX4A 4F4IA 4US0R 1Y3AA 4OHVA 2IK8A 1UEJA 5EXTA 1RC8A 2CMKA 5C2JB 2QG6A 1SVWA 1Z6AA 3GJ5A 1MO5A 3U61B 1UF9A 2NTYC 3I73A 2ZRPA 1NP6A 5DLQC 3KQUA 3CPEA 2V54A 2G0NA 5TB5A 1N6KA 1IN6A 2F9LA 3TE6A 2RH5A 4UNNA 4XWAA 1E9CA 3A36A 2A7QA 3SC3A 3LX8A 1R0WA 2GF9A 2JDIA 3VR6A 1OFUX 4IW3B 4M53A 5FPKA 1Q57A 1S96A 1ZP6A 3OE7A 5H8WA 4A0GA 1KHTA 4LV5B 1N5KA 1D8TA 1W4AA 1TQDA 3S1AB 3VKGA 1VCOA 2WJIA 5FPSA 4MKFA 1G8HA 4HAZA 3IEUA 1UPTA 4TWZA 1VKJA 3AB3A 3K09C 3L82B 1SKYB 3GLHB 4B47A 2GBLC 2PZGA 5L3QB 5LDDC 3Q5EA 2JLRA 2C8VA 2JLSA 3I3SR 3GLIB 2XITA 3H86A 4JLOA 4BFSA 3C5HA 5KNDA 1G4UR 4TTRA 4RZUA 1D5CA 3GJ8A 2VP4A 3IQWA 4U00A 2HYIC 2BBWA 1VDZA 1SHZA 3IILA 4M2LA 1IY2A 1TQ2A 2YKGA 121PA 3WRYC 1GL9B 3GLFB 3L0OA 4I4LA 3CKLA 4RCZA 2BIFA 5CDFA 4X8HA 5TY0A 1UADA 3FYHA 4Q9HA 2CE7A 4G5OA 1H8HA 3QXCA 3QXSA 4NONA 1JAHA 2VL7A 1U8ZA 1DE0A 4FMBB 4NYIR 4B2LA 5E95A 1YR6A 1UJ2A 2VP2A 3QEJA 3AVVA 1YZNA 1LV7A 3N2EA 3KUCA 4DB2A 3SHFA 4C7OB 2D2FA 1JPJA 3E70C 2VSOA 4AYXA 1SQ5A 4G01B 1AZTA 3IHLA 4YDSA 1W48A 5SZIA 3VTKA 3NBFA 1HEIA 2WSMA 1FTSA 1KI7A 3NDBB 4LHZA 3OAAD 3VX3A 2PLFA 1SVKA 4WZ6A 5JHGB 3U7HB 4F7WA 2ZAMA 3BFKA 3T1VA 2ZS8A 2JDID 3LXRA 1NSFA 4ASUD 3AGQA 1W49A 4TQUS 2J5XA 3EARA 1OH8A 1ODFA 4JVSB 4AWXA 2OCBA 3UG6A 4B6FA 4R7ZA 4ARZA 3BERA 4EFMA 3W8NA 3ZD6A 5HKKD 1CF4A 4B43A 4XWOA 4LHYA 4Q7JB 4IKEA 3TAUA 5DNYB 1KY2A 5FBWB 1NG1A 2GJ9A 1DVRA 3D6TB 2CCJA 5FOTA 4IOJA 4UNPA 1E0KA 3MGCA 2B7CA 3B1XA 1ZD8A 4W5HA 1BYUA 2WJHA 2O8DA 1MT0A 2FU5C 2DB3A 1IXZA 1R0ZA 2QN6A 4MDEA 3ZS8A 5JHHB 1U81A 2CK3A 2GESA 2ODEA 1QG4A 4NCNA 3BB3A 1T3HA 2WAXA 2IXEA 3KQLA 2QEQA 1A4RA 4ZDKA 1XCGB 4HB2A 4UNRA 4R2IA 3HJNA 5H1YA 4O0MA 2EYQA 2RGNC 3EZFA 2Z83A 3K09A 4C9BA 1ZM2A 5DIFA 4IVQA 3LWNA 1XRJA 2IS4A 3ZJYA 1NMXA 1IN8A 1NVXQ 3K9NA 4RKFA 4PAOA 3WXMA 3I92A 1U9IC 1HH4A 2ZUCA 2WZQA 521PA 4WXRA 5CLQA 1RRGA 4Q48A 4TLCA 4ZCMA 5B64A 3A1UA 1CLUA 4ON9A 2RGGA 2ZRDA 5E7MA 4IXMA 2JJ1D 4IHQA 1EFUA 2EFHB 3TW4A 1NLYA 5B30A 3L0SA 2KE5A 3TVDA 1E98A 5KU1A 1MABA 2CJWB 4QGGA 4TMVA 4QBHA 2CHGA 2X2FA 5HCIA 2FN4A 4DUGA 3SE0A 2VSXA 2RGBA 1F2UB 4PAMA 2KBEA 2MSDB 2AL7A 2FX3A 1HE8B 5F9HA 3WNBA 4OQXA 1AS0A 1OXVA 3C14C 3Q85A 3QF4B 1M74A 1DEKA 2LKDA 5FOWA 1RYFA 2J0SA 2BKUA 1J90A 1E32A 5DE3A 1SXJA 3BRWD 3X1WA 4EJSC 1GNRA 2FSFA 3BC1A 4HAWA 4DHEA 5LD2B 2JGNA 2O52A 5JWOA 2BBOA 1Z0FA 3D3QA 2WKPA 5JRZA 4X8OA 1NIJA 2QMOA 2QP4A 4JYCA 4B3GA 3B7GA 1Z83A 1LTQA 4M1WA 2F1RA 3X2SA 2PLRA 3B85A 3BBPA 1Q1ZA 4QC2A 4Z1MD 3SR0A 3ADBA 1U94A 3H2YA 4EFNA 2GRJA 4DT1B 5JJIA 3AVYA 4GP7A 2F1HA 4BZXA 3WYAA 3WY9A 1G1MA 2JLVA 4DLRA 1XJQA 2VF7A 2F3TA 4XD7A 4D4JA 4TTPA 1ZC3A 1AM4D 3CF2A 1UFQA 3AF1A 1VIYA 4OHXA 3T5GA 1BO6A 1G7SA 1C9KA 3V4FA 3NH9A 3K0CC 1ZUIA 4JSTA 4E03A 3QBVA 2R8RA 3TNFA 2WSSA 3ZZTA 1XNJA 3A58B 1EFTA 2W00A 3EZ7A 5L3SA 1Q12A 1HURA 4DCVA 3KJEA 1N6PA 1IONA 1U0LA 3FHTA 3IIJA 4KSCA 1GRRA 4AKEA 5IT5A 1JPNA 2GCPA 3H0KA 1FP6A 3I8SA 4DIDA 4TYQA 4LYHA 1GG2A 2GILA 4AURA 2ZRCA 1AN0A 4WVFA 1G5PA 2GCOA 1KMHA 4E5UA 1G7CA 1CJMA 4I1VA 3QJYA 4QHSA 4U02A 3KJHA 4DEXA 5JECA 2JLWA 3FMOB 1ETUA 1L8QA 1E9AA 4POAA 3QQ5A 4PSKA 1GOTA 3VMFA 3QKRA 1COWA 1GRNA 2WKQA 4P0TA 2ECKA 4MRSA 4DCSA 4IOLA 3NXSA 4OJQA 2RGCA 1TUIA 1TNDA 1ZM3A 1ANKA 2BBSA 4L16A 4RZXA 1P6XA 2NPIA 3OE7D 1FNMA 4NYJR 1NKTA 4JKYA 4JT2A 4JLKA 1MV5A 3QE0A 3FKSD 1KI8A 4PPNA 4U5XA 2ATVA 3DO6A 4HEJA 1CXZA 3D8BA 1EFCA 3NH6A 1H65A 3RWOA 4V03A 4A8JC 1JXOA 4A6XA 2Q9BA 3U4QB 2J0UA 4MH0R 1PLLA 4PHHA 5AUNB 4RFVA 1RRCA 1QHSA 2GCOB 1A82A 1KI1A 4ACAA 2GWHA 4GFDA 3QG1A 1WMSA 3GLHE 5IDVA 5J40A 1WP9A 2I1QA 1JQLB 4TYNA 3JVUA 5F98A 3EC1A 4UKDA 4XH9B 721PA 5F3WB 2IYQA 3IKJA 1XCMA 3TSWA 2DFTA 3SZRA 2FPLA 2BMDA 5EXSA 2FZ4A 3CR8A 1JALA 2Z43A 2IEYA 1OPXA 5FUXA 3AVOA 2H17A 1D6JA 1XZPA 2TMKA 1SXJD 1E3MA 3A4LA 5EP3A 3VKHA 2QENA 2GXAA 5JMTA 1G20E 1NKSA 3LV8A 1OJLA 5JJLA 2VTKA 3CRVA 5IHPA 1OW3B 1XTRA 2PEYA 3TK1A 4CDGA 3CWZA 2C78A 2JIZA 1Q3HA 4AG6A 4HZUB 4IDOA 4PHFA 1F2UA 3IBGA 1Q1EA 2HEIA 2DWQA 3T5DA 2WPDA 3WHLA 2QP9X 3VKWA 2KI5A 1CJVC 3LX5A 3BFXA 4E09A 2V8OA 3AUYA 3FKSA 3R7WB 3U3JA 1F2TA 4JZKA 3UWOA 1ZM4A 5K8UA 1KZ7B 3C15C 1L4UA 1NSTA 2OCAA 4EJSB 3ICQB 4AI6A 1WE2A 3QG5A 3LAWA 4DEYA 1RE0A 2HCBA 1XTJA 3QENA 3GJ0A 1RPZA 3GLFA 1BOFA 4BLOA 2IUTA 4CEHB 5B57C 3H4MA 1KI3A 3GLGA 2MMCA 1AKYA 5AUPB 3I61A 1CKEA 1NY6A 4ZDIA 5DI9A 1U98A 1R7RA 3GLGE 2VYFA 4UXJA 3QKTA 3B8HA 5CK4A 5JZVA 1VTKA 3F5FA 4QJ5A 5KDOA 3UMFA 1WDTA 2PZFA 3MLEA 3UXMA 5J4YA 1KAOA 1CU1A 3GD7A 4F92B 2ZJ5A 2RKOA 3DMNA 2ZJOA 1OXTA 4BQSA 1N0UA 2BMEA 5A5GA 2RGEA 4KFTA 1W2HA 2PT5A 3Q72A 5FBQB 5FR1A 4PZZA 2PBRA 1ZUNB 2OXRA 3ND9A 2CLCX 5FL3A 4CVNA 1LW7A 1R5NA 4N1AA 3BORA 2QT0A 1Z8FA 3IPYA 5J4LA 3LNCA 3SBEA 1NBMD 1CIPA 2C77A 3NEYA 1II0A 4ZI3A 4Z51A 2JASA 1X8LA 1TX4B 4OL0A 3IGFA 2FMXA 2J1LA 1E96A 5SZHB 4O25A 2CJWA 4HI0E 4LI0A 3QKUA 3VR3A 4B3BA 2WIAA 3TR0A 3C8UA 1XEXA 1PUJA 1TF7A 3DL0A 4TL9A 3IIMA 4JLVA 1JR3E 4KFSA 1UBFA 2NQ2C 2REXB 4Y0AA 1M6NA 2FFHA 2NOAA 3BAFA 4DIEA 4RSGA 4JSYA 3RS7A 1NN1A 1YHNA 3MRSA 4TMKA 1P2TA 4MYCA 3FHOA 2P65A 2PMKA 3BWDD 1II9A 5HCNA 4S35A 5FOUA 2V1XA 4TYYA 4A9AA 2ZRNA 4AC9A 1Z2AA 4RD1A 5UKDA 1AQYA 1G8FA 1ZD1A 2OBLA 3RRNA 2G77B 2VP5A 4KYUA 4PO8A 3CH5A 3U4QA 5FTMA 4B33A 4R71A 3SDZA 3SI7A 2Q3FA 4DXAA 2UKDA 1G7TA 2ZRKA 4IDPA 1XEWY 2FG5A 4C30A 3VQTA 2F55A 1XFAA 2NO9A 3M4YA 1YZQA 1W36C 3QVUA 4O2LA 1P7CA 2WOJA 4KLZA 1HT1E 2E87A 2IUSA 1GILA 1N3BA 3CPJB 4LJ4A 5AJYA 3B1VA 1LNZA 2BEKA 3HR7A 1UEIA 1G3RA 2R6GA 1QHHA 2QQEA 3KX2A 3VHLB 2GDJA 2AKYA 3WRXC 4KJZA 1G9XA 2ZI4A 3GEHA 1ESNA 4ZIRB 3W6PA 1KKLA 3TKLA 3RRMA 1G17A 2OM2A 1E79A 1W36B 1F2TB 1Z3IX 1XBTA 3BIFA 4HATA 1M7HA 3X1DA 2V55B 3CRW1 2ZI3A 1P61B 1Z47A 5EE0A 4JL8A 3O8RA 4EPYA 5C4MA 1JR3A 2XOKD 4NYMR 4L4UA 4II7A 5CYPA 4EFLA 3RC3A 1ZCBA 4GDFA 2G83A 1SXJE 3CLVA 2IW3A 4ESHA 3KJIA 4QBIA 4GP6A 4CEHA 4BE7B 2DYKA 2ZJ8A 4X8LA 2A30A 1E9EA 2PX0A 1XJ0A 4OQLA 4BRWA 3GMTA 3DEFA 5EZ5A 2XAUA 3K70D 4LPKA 4D25A 1TU3A 4ASUA 1E2HA 2XSZA 2F43A 4TYPA 3LH5A 2CNWA 2G1KA 1PJRA 1W7AA 5KSYA 1KO1A 2ZS7A 3CRQA 3QIAA 3R7WA 2FEMA 1Z29A 1XB2A 3EXAA 4I99A 1Q1BA 2HT6A 1ZCAA 2ZXUA 2D7DA 4CEIA 2R44A 5KSPA 2IL1A 1KK1A 1K6MA 2ZSFA 2FH5B 2NGRA 3VR5A 1YRBA 5BQ5A 2H57A 2BDTA 5GVSA 4XWKA 3DPUA 3ZQJA 1A1VA 2G9NA 4QRHA 4A2PA 5JJKA 1G3MA 1S1MA 2Q21A 1OIWA 2JLXA 5CB8A 3M0EA 4LJ8A 1KSFX 3VNVA 1U90A 4B2IA 4D4MA 4Q02A 1OH6A 2KBFA 1S8FA 4US2R 2VEDA 2REOA 3B1WA 3KXLA 4Q4AB 3NHAA 4MGZR 5M04A 2Z5FA 4EPTA 1L7VC 2ZYUX 1XEWX 1KAGA 1S1CA 1WCV1 3GCGA 3KQNA 3CNNA 3THWB 4XD7D 3PEYA 4GOKA 3CZQA 1E9DA 2OUKA 3NDPA 3AF2A 2ZRMA 1IJFA 2VHUA 3C5CA 2EYUA 4IVPA 5CJ2A 5L8VA 1R8SA 4FCTA 1NI3A 4QJ3A 2YHSA 4JVMA 1NN5A 4BFVA 1LF5A 4FMDB 4UQOA 4A82A 1SVIA 4HAYA 4NH0A 2H7VA 1M2OB 1UKYA 1U0HC 3K0FB 3MFYA 3TR5A 4ZKDA 4EPRA 1OV4A 1YZGA 2ZI9A 2ZVQX 4ZCLA 2RHDA 4IOMA 3D7MA 1US8B 5LD2C 1HTWA 1P2SA 2D74A 4LV8B 3T34A 4TLAA 2ASEA 1GM5A 2ZQ5A 4Q1DA 4JKIA 5FBVB 3OIYA 3THWA 2DY1A 4P32A 3O8BA 2D2EA 4E22A 2WV9A 4MKHA 2IXGA 4DSNA 5KPJA 2IC5A 2IT1A 1TL7C 3V4RA 1NG9A 1BYIA 2QZ4A 5EP2A 1GITA 1W4CA 3IEVA 5CIWA 2D7CA 3RLFA 2V7QD 4B34A 3NKVA 4D0GA 5AJWA 5BN4A 5FPHA 4TMXA 4JIMA 1KK0A 2NO6A 1TF5A 1HV8A 2V7QA 4ZO4A 2FDCA 2QPAA 3FOZA 2MMGA 3QEOA 1YZLA 2P67A 5FTJA 5LPNA 4ABYA 5JI3E 3MUFA 5FI0B 1JB1A 4DLSA 4GI7A 2O8CA 3ZVMA 5DHAA 4RFSB 1T9HA 4QGFA 3HDTA 2V6JA 2QORA 2IYVA 4HUQA 4NU0A 1D2EA 3KKNA 2ZUDA 2EWVA 3RDPA 2GJ8A 1B23P 3P26A 1Y63A 3TAHA 4RZ3A 4BZQA 3G82C 3U2QA 2XXAB 1Q22A 2W2TA 3BJIC 2PX3A 3PIRA 3OEHD 2EFDB 2P0EA 3Q7PA 5KYKA 2EFCB 3CBQA 4Q47A 4A0RA 1S3GA 2ANBA 1LS6A 1XD8A 4ZCIA 1B0UA 1Z0JA 3CUEF 4KHZA 4AG5A 2ZYWX 1LFDB 4LX0A 1NVVR 3W3AA 2ZRBA 4ZPXA 2I3BA 3HP1A 3UMRA 4M9XA 1VG8A 4G0NA 1K8RA 3PEVA 4JMPA 1XPUA 1XEXB 5IRCD 4CGZA 5HR5A 1DG1G 3HPQA 2CXXA 2D3WA 3K0AA 1N25A 2J9RA 3CR7A 4FIDA 3RS4A 4R9UC 3FMIA 2PJRA 1KYIA 3Q9LA 3SNHA 2QSZA 4AYTA 2KB0A 4TT3D 4OKSA 5GADl 3H84A 3I5XA 5FOXA 4IFBA 3W34A 1YJ5A 3HR8A 2IS6A 5FTKA 4FN5A 4XTCS 4CT5A 4DBLC 1CS4C 2LCFA 4G5RA 3AVWA 4LBZA 2AD1A 2HV8A 1N6RA 1N5JA 3ADDA 1J70A 1JXMA 3B5JA 3M1IA 4GSYA 5HZHA 1Z63A 1P60A 5C46F 4AKIA 1J2JA 5LB4A 2UZIR 1XD2A 4M1KA 1RIFA 1U8AA 2QUZA 5FUWA 2HDNB 3KTAA 1FMJA 4H1VA 1M7GA 1AIPA 2F1JA 2HJGA 4WA7A 3RS0A 4HAXA 4A8JA 3ZS9A 1TUEA 5JWRA 3ZYCA 4GBMA 3KUDA 3SQXA 1W2GA 4B71A 1H8ED 1VCMA 1E2PA 1Z2CA 2W2XA 4NKRA 4LJ6A 5KDDA 1Q3TA 4MGKR 2GKSA 1E79D 1VPLA 4CZ2A 3CWQA 1XPOA 4M1OA 3EAQA 4QFMA 4I81A 4LYAA 4DB4A 1GL6A 1YKSA 5JCZA 1DAFA 3CIOA 1GRQA 5K8LA 1UAAA 1W0KA 4G5SA 1UBCA 3HYTA 2VF8A 2BM0A 4IEEA 4C0SA 1UDWA 3A37A 2ZYVX 1XP8A 1OHHA 3PXGA 3VAAA 3GJ3A 4P3YA 2O8EB 3J81k 3RRZA 1NNEA 1E99A 3JVVA 4LCBA 2P6UA 1T0HB 1Z0AA 1G5TA 4NE2A 3WNDA 4EPXA 2CDNA 4DWJA 1FQJA 4C7OA 1NRJB 1J99A 1UBGA 3ZZUA 3EA0A 1E4VA 1SVOA 2J7PA 2IYYA 4NDZA 1W0JD 2V1UA 3I72A 2XZPA 1KIMA 3U44B 1Z6XA 2CBZA 3IQXA 1W0JA 3IUYA 1O87A 4A2QA 3R20A 2JCSA 4L9WA 4URYR 5G3ZA 1OXUA 1NJGA 1T5LA 3C7KA 1CR4A 4K81B 4PO9A 2WMOB 2C99A 4V0ME 1Z06A 2A5YB 4RJLA 4D0NA 4KFRA 1AZSC 3HPRA 5CJPA 3DM5A 2C95A 2QL6A 4Q00A 2DWOA 4C3ZA 3IHWA 2FF7A 5DN6A 5HE8A 3SHWA 1OHHD 2JLZA 1Q21A 5GJVC 4JJKA 4C0JA 4LYJA 3TVTA 2A2ZA 3P4YA 2R9VA 2O8EA 2IBMA 2Y8EA 2O8CB 3GEEA 3SYLA 2BBTA 1L2TA 1P75A 1UKZA 1HUQA 4MUAA 4Q4JB 2RGNA 2XJ9A 4PC3A 2BMJA 2O8BA 4K8OA 1V5WA 4GOXA 2X19A 5JCPA 3CF6R 4WW0A 1KDOA 1KJWA 3K0AB 1MR3F 4HLDA 4YONB 3EWSA 2NG1A 5EUQB 1NVVQ 2GEDA 4URVR 3B9PA 1BS1A 1VHTA 3MWKA 3ADCA 1W46A 4CRWB 3U6KA 4LJ7A 2RCNA 2SHKA 3I1FA 1KSJA 2MSCB 3AKYA 2JA1A 2YWFA 1ESMA 4L5BA 5KSZA 5KNCA 4LPSA 1WBDA 1TAGA 3VNUA 1ZNZA 2J0UB 4CW7A 3RAPR 2WJYA 3WBJA 1G6HA 2N46A 5CM8B 2CVFA 1M1YE 3WMFA 3OHMA 4KI0A 2VHQA 4LC0A 3TLXA 3ICEA 1Z22A 3Q8XB 2ORWA 2IUUA 3W8RA 3RS2A 4C0BA 4RD0A 2VSFA 2OE2A 4LHWA 5DI3A 2RGXA 1Z0KA 3KKOA 1E6CA 2Q0HA 4HZUA 2ZU0C 1P9NA 5BXQC 3D31A 1KY3A 3UANA 1VECA 3LRPA 4PPQA 3QOFA 2HT1A 1YU9A 4PANA 1E9SA 3AP2A 4I1SA 3T12A 2QGZA 2MSEB 3AEZA 3JZMA 3EPHA 1P3JA 2RGAA 1GUAA 2FGJA 2J0VA 3BH0A 1S2MA 4LBVA 1CJUC 2OCPA 2W83A 4P31A 1XX6A 3P1JA 5C4GB 2IF2A 5EJEA 5ELXA 1ZIPA 1QVAA 1ZYUA 4TLEA 1SKYE 3TW8B 3I32A 3ZD7A 2IA5A 3UMSA 4EQ6B 2XXAA 2JJ8A 1AK2A 1FQKA 2ODBA 1I2DA 3A1VA 1FUUA 3L2OB 1LB1B 1G3UA 2QTFA 3C16C 4G3XA 1OFIA 4DDTA 4FWTA 4MA4A 4KFUA 1E2DA 3MG9A 2AFIE 4D26A 3GPLA 2DFNA 4HDCA 4TSFA 1WQ1R 4JLAA 1OH7A 2YOHA 1KJYA 4HB0A 1S9HA 4PC2A 4WBSA 1I4DD 2OFWA 3SYKA 1KI6B 4HAUA 1T6NA 3U3RA 4ZI2A 3MD0A 4D80A 5KSOA 2KSQA 2J41A 3L0IB 5CDFE 3IO5A 4G5GA 4LHVA 1IBRA 5BYJA 1IM2A 4QJ4A 2IX3A 5J4KA 3K9HA 3LW8A 2W0SA 1Q44A 4FD2A 4KVGA 3SFZA 3K0CA 1Z08A 1O3YA 4KSBA 4FXPA 4KO8A 4C0AC 1UDXA 5HTKA 3CH4B 3KFXA 2FA9A 4A15A 2QM7A 2QMHA 1HQCA 1EXMA 2C04A 3LDAA 1ZIOA 4NMMA 3AKCA 5G3YA 1T4GA 2OBMA 1SVMA 2J59A 4BFYA 4P4TA 3CM0A 4A8JB 1E2QA 1Q0UA 1EESA 4HDOB 5EE5B 2W58A 1CJTC 3SEAA 4TN1A 5FOSA 4UXHA 1Z0IA 4ZDJA 1OE0A 1C1YA 1KKMA 3L8YA 1KMQA 2H5EA 3BS4A 3OIUA 5BW8A 1F3OA 3U5ZB 3PUWA 4A0FA 3KFVA 2HLDD 1WA5A 3AF0A 3N5CA 4M4SA 2ZU6A 2OLKA 2PZEA 2QRNA 3OZXA 3W3ZB 4MDFA 2JAQA 2YVUA 5EUMA 1X1SA 5SZJA 2F7SA 2WKRA 3TIFA 1OB2A 3DOEA 2R2AA 2A5FA 2C9CA 2KWIA 5DISB 2Q6TA 4JL6A 3IBYA 1RYHA 1RFLA 4FINA 2XZOA 3R8CA 4Q7MB 4Q21A 4IFEA 4PFSA 3LQQA 4MUBA 2HF8A 5FH9A 1MRSA 4YMVA 1IN5A 4YQFA 2QROA 1AA9A 2O0HA 3EASA 1YRAA 3EA5A 2OFXA 3TUZC 4BFXA 1K5DA 2ODWA 3UKDA 2WHXA 2QY9A 5JI2E 3I5YA 2WWXA 1AQUA 1NF3A 3AKDA 1E2MA 1OIVA 4C0KA 4EIWA 2O8BB 2ZIAA 1E69A 2J3EA 4FI3C 4KCGA 3R9IA 1QVRA 2ZRLA 3A1SA 4C0QC 3SJAA 3GP8A 2BJWA 3IPXA 2HF9A 1P2UA 2YNMA 4A2WA 2P5TB 1QHNA 2D4HA 2FJUA 4PR0A 3RC8A 1U99A 3MAAC 4LUCA 5KOYA 4XVRA 5FPTA 2YOGA 4H9GA 1E1QD 5JBQA 1Z6GA 5AUQA 1AGRA 2P6RA 3TUJC 4BLRA 4NYMQ 5G41A 3GJ6A 4AKHA 2FWRA 4CIDA 3T1OA 2VPPA 4JJZA 4PQYA 3TRFA 2VQSA 1R5OA 2C9OA 2FOLA 4Z54A 4ZIRA 1NN0A 2PEZA 5E7IA 1E2FA 1RRFA 3DDCA 2NPFA 3B1YA 1FUKA 4G1UC 5IF9A 3NBYC 4F38A 3PITA 1HY3A 1IN7A 1KK3A 4TQAA 3R8FA 2CL6X 3CX7A 2ORIA 3DOFA 4JVLA 3KL4A 4TLBA 5G40A 2IYXA 2ZE8A 3EZ9A 1OB5A 3PV0A 4LC1A 4WXPA 2OFOA 4RD4A 1Z0DA 5FBLB 4RZ2A 1XZQA 1G21E 2WTUA 2DHRA 3KB1A 5FPYA 4LBYA 2YWEA 4F4CA 2HCJB 4M1SA 3GLIA
chains in the Genus database with same CATH superfamily
1DV1A 1RFGE 1UCFA 2VP9A 4IV8A 4L28A 3VU3A 2EX1A 1R8YA 2TMDA 3E9NA 4PF1A 5D85A 1QTRA 3IUJA 1P44A 3HB5X 3QE3A 4ED9A 4YMTA 3AWIA 4QPZA 3OOHA 2CYCA 2RI1A 4TLDA 3N87A 1YFZA 3R9WA 4LF5B 2QNRA 1YFLA 1L7AA 2O3UA 2NSJA 2QVYX 2PJZA 2IX9A 2QAGC 1THGA 1GAQA 2IYLD 2WD7B 5DW3A 4YQEA 3WTBA 1UBLS 3BJRA 1FJHA 1PGNA 3HVIA 2O6LA 1YIDA 3PL5A 1G20B 3WKEA 2VF4X 4HY3A 1WCIB 3L8DA 4QVIA 5JANA 1N5DA 3K1AA 2OHOA 3G3EA 1CQXA 3SE7A 4HHEA 3DSRA 4GG1A 4YRGA 4HB3A 1YACA 4GUDA 3ZNPA 1OQAA 4CW7A 2AK2A 3DAYA 3E35A 4N41A 3EPJA 5DM1A 2DTXA 4AF6A 5ALTA 1CFZA 3C5EA 3F3MA 1ISJA 1TLLA 1ZCJA 3EGEA 1KNQA 2CYBA 3TRKA 1PR5A 4TSRA 3UPDA 3MJTA 1R6TA 4IMRA 2RK3A 3CF4G 5THQA 1GG9A 2QD5A 4QO8A 4ROTA 1QCZA 3WX0A 3S8MA 3H05A 3L04A 3OSUA 4IQ8A 4WOCA 4AY5A 4DR6B 3TI7A 4K3VA 4KYVA 4MQUA 1V7PC 1A4IA 1MB9A 3BH7A 2ZRFA 1C9YA 5DYYA 1YE3A 5TRTA 3WL5A 4D6PA 1NT2A 2P7IA 3CN7A 1KJIA 3FWYA 4QM6A 4CG0A 1F48A 3BMQB 1P1HA 4I8DA 3RU3A 4MS1A 4F5ZA 5HGJA 3ZWYA 4ZV4A 4H4CA 5CA0F 4V0SA 3FPAA 2QAJA 4R8LA 3OLCX 5KOIA 1PZXA 2L18A 2GDZA 2TS1A 2Z2JA 1D6SA 5EKDA 5ELLA 3W04A 2PH1A 3JWHA 3MT0A 3UJAA 4C4PA 3N2NA 4F21A 2DUWA 2JGDA 3OVMA 4LDQA 2F43B 3TQSA 2FN9A 3QVSA 4EB8A 2IHUA 3JCZA 3BMOA 3WSVA 4IMIB 4W1QA 2DUJA 1BXKA 1U4OA 4Y30A 4EHBA 1T8TA 1FBTA 4FP9A 1ISMA 1VSBA 4MRRA 4QWMA 3D0QA 2J8ZA 3S40A 1X86B 1K8QA 1P9WA 2E0IA 2GN0A 2WF8A 4N5NA 1GU0A 4ZRNA 1CDDA 2X5NA 4OI0A 1EVYA 1VGQA 2MDTA 5FWYB 3OQ1A 4DARA 5KYYB 1JW9B 3VM6A 3TOSA 4DV3B 2HPZA 3K0FA 2A9KA 4IDQA 3U4AA 1A5SB 2H7YA 1PVOA 1JZSA 1SH7A 4BQRA 3MPOA 4QOFA 5J5CA 2Z56A 2IS1A 3DVSX 4XWWA 1OXXK 1FFXB 3Q6MA 2Z4RA 3LHIA 1P19A 5DWDA 3V7UA 4KIJA 3U3MA 1VG1A 2C58A 3NHKA 2AKAB 4TYWA 1QQTA 2AR7A 1M6VA 4AKSA 3D2AA 2WAYA 2Z57A 1RXVA 4OFXA 4C0XA 4BKRA 5K3BA 4QQKA 2W0MA 3QPVA 4PGAA 1ZU5A 1KWKA 1RC1A 2ZCVA 1NQXA 1CT9A 3AF3A 1O89A 3BE6A 3BXXA 4O4JB 4JYMA 3TDMA 4AJ9A 1W76A 2JAUA 3VPAA 5ECWA 1HDYA 8LDHA 2JGLA 3QH4A 2BFCB 2HGZA 2Q2QA 3H9EO 2I87A 3PRHA 4HN4B 2PGDA 1JDVA 4BKMA 3LGAA 4HAVA 1JHMA 1PW7A 1F5NA 2AXQA 1TYAE 3AVPA 1SFRA 3T3IA 3OJXA 2ZRJA 1M1YB 3JXEA 1P73A 3SZGA 4D4LA 4FQ7A 3VR2A 5DM4A 4JNKA 1VL6A 3I53A 3GJXC 3OLQA 1SXJB 4MVJH 3SJ7A 3VFDA 1JJBA 4Y2HA 2D59A 1CUWA 2WAOA 3HBMA 4HFRA 3AHDA 4DA8A 4NBNA 3NC4A 1U63A 2R6HA 3EGIA 4S1PA 3DVLA 3SEFA 3EMBA 3KT6A 4RVHA 1ZD5A 1GARA 2E7ZA 1BG6A 2J9ZB 1SQ6A 4DLBA 2FHPA 2PLAA 1B73A 1YB7A 1J2RA 3AUUA 1I4WA 1GL7A 3SD7A 3ZHXA 3L7MA 1DIOB 2IEBA 1Q91A 1EGAA 4KQHA 4LNHA 3CX6A 1R15A 4NESA 3VJMA 3E7DA 4NBTA 4N5IX 1X7YB 2IWHA 3PUIA 1XMXA 5I7OA 1CEQA 1FYFA 1NBWB 1SCBA 3L8EA 4BASA 1BJTA 2GEVA 5ALVA 1D9ZA 5CLLA 4YNBA 3W3AD 4JEIA 4BB9A 1E3EA 3PNLA 1C1HA 4P4UA 5AIBA 2JH9A 2IIQA 3UVEA 5H4GA 1JEOA 3UAVA 4MGIR 3NTVA 4IUYA 4JI5B 4C7KA 2G82A 4HRXA 4B32A 4TKUA 2I8AA 4PV7A 3L3BA 2LDBA 3V97A 2BSXA 1KEEB 2I99A 2OAP1 4X60A 1WB5A 1KS9A 4RL6A 3N8NA 1AKEA 2NU7B 3ZWNA 3KTAB 4JUAA 4W8HA 4R8KA 4KTTE 1HQYE 5FUBA 2GH1A 3TX6A 3VHXA 1L5HB 3LZDA 1ZL2A 3A4VA 5AHOA 4YCMA 5EZ6B 1C4OA 2PZMA 1E18A 1JE0A 3WNCA 4ZICA 5JNLA 4RA9A 4EG7A 2QRPA 3B53X 1DCFA 1G8JA 2NO1A 1IVSA 3BWMA 3NS7A 3I2KA 4EMSA 2H9IA 2WABA 3AO0B 1L5RA 3RVOA 1YAHA 4RHCA 2PGJA 3BTOA 5JSKA 2DCUA 4AQ7A 1XMSA 4BKPA 2REQB 1RYDA 2P4SA 5HS4A 2ZWVA 4B0PA 1VL2A 3B82A 1KU6A 2EQ5A 2RHHA 2ZJFA 5G0VA 4BE9A 1W47A 2TMYA 3CEPB 3C3YA 5EMNA 1F12A 1JUDA 4HEHA 2QI9C 1OFHA 4B82A 5H4HA 3GT3A 4J8PA 4AZ0B 4F56A 1NXQA 4PQRA 2O2HA 4QFBA 5H70A 3OPMA 5D5HA 3CZAA 3UIEA 5FBKA 2B6HA 8OHMA 3AH8A 2QN9A 3KC2A 1TW2A 5DB4A 3ZKWB 1IB0A 1J6UA 1YBAA 1IU9A 4RSRA 3FWHA 2RHJA 2W70A 4I50B 2CL5A 3C0KA 5JS8A 1BD4A 1N2ZA 3CSUA 1COWD 2GAAA 3DDOA 3KQPA 3WP0A 2W48A 4JQOA 9MHTA 2NU9A 2WAAA 3NW9A 2M9MA 4P34A 3ZLVA 1GUBA 1DTWA 1XMPA 2J08A 3AQ4A 1FPMA 1K68A 1Z39A 2ZYAA 3H2KA 4QAJA 4DV6B 1DBWA 1WF6A 3EXHC 1TPZA 3L7AA 5CPBA 4OAQA 5TXGA 3JTEA 4LE2A 1NW5A 3E1SA 1D9XA 3LPMA 4QX6A 5CLJA 1J8QA 3DOHA 3SWWA 1ZBDA 5LQNA 3DG9A 4GQAA 2ID9A 4NNOA 2ADMA 1P4JA 1RM3A 3C74A 2MYNA 4LGMA 4UMVA 4BP9A 2OCDA 4QL3A 1H23A 3DCNA 2AJ8A 3OJEA 4LNAA 5BN5B 1Y6FA 1X2EA 2PXHA 2ZSIA 4MV4A 5B3LA 4W9MC 1E3IA 4RZSA 3IIIA 3AFIA 1FS5A 1NLZA 2DFLA 5FV4A 5JSZB 3KALA 4PFKA 3BIXA 1XF9A 2OD2A 3HGMA 4Z2AA 5TT0A 3V7NA 2JIMA 2JI8A 1BMDA 1GAXA 1KZ1A 1Z5ZA 1ZM7A 1SG6A 2QR2A 2R7LA 1W85B 2R8PA 4J6EA 3D59A 3TW6A 1TFUA 4HOYA 1Y7TA 4I9NA 1JEAA 1VJRA 1F6BA 4Q4HA 4KNYA 2OMKA 3H5OA 2P9TA 3LM8A 2X6RA 1ZL0A 3A4IA 2JFXA 1WUTA 2D0DA 5TF0A 1PUXA 1OYOA 2H9YA 1X8XA 3QUSA 3LY7A 4EG8A 4OHKA 2O3QA 2FPGA 1FUEA 1YBMA 4L5CA 5AMXA 3V4PB 3WGNA 3SXUB 1X8JA 1NXSA 1ZJZA 1WW3A 3OTGA 4KBGA 1X3SA 1V3UA 4CYMA 2G0AA 1Z3CA 3KQSA 3NX4A 3TFWA 4E7PA 221PA 4ER3A 2ZBRA 1MXFA 5EXPA 3FTEA 1FMCA 1U5AA 4ZVLA 1Z6YA 1XMJA 3IDZA 3P9SA 5HBRA 5JEEA 3ZJVA 3N53A 3B2EA 1HE1C 2GZHA 4R3WA 4E30A 4C4RA 2YJTD 4LKRA 4OM7A 4GGMX 4BBAA 4DLZA 4ETNA 1M8PA 4WT7A 2G63A 3FLEA 2ICAA 1UBEA 3CSSA 2V58A 3RIHA 3K53A 1D2NA 1FTQA 1TF2A 1UK6A 3QEKA 5D3MA 3RAJA 1YVDA 1T2VA 2F00A 2AN9A 5IEJA 5JCJD 3EZLA 3QGMA 1JBQA 1VCHA 3SQLA 3SYTA 5BV0A 1Y81A 1D0SA 5CYFA 3N2IA 3PG5A 3WHKA 3WLOA 4EB3A 2ZSHA 2PBFA 4MITA 5GJWC 3RS9A 2JFFA 3RNLA 2OXCA 1JQ5A 1DELA 2H2IA 3KOOA 2WJJA 1XYVA 4GPTA 4Z9YA 1Y3BE 1O5TA 1XCPA 2OG2A 2FSGA 2CFRA 1GNQA 2B21A 3AM5A 3JYOA 3PKIA 2NO5A 1SBCA 1T0PA 2VDUE 4BRUA 1VRCA 1ZC4A 2FUG6 3K6KA 4YJFB 5IBPA 1I8TA 2CLHB 2G6BA 3ENVA 3HLKA 1LW6E 3NP7A 2HXYA 4IJQA 5IBQA 3X3HA 1PVVA 1LV8A 2HZ7A 2QRVA 4LOAA 2XB4A 2OORA 1T2NA 3H6KA 3LF1A 3FSGD 3BG5A 4CCWA 3RD5A 2NUTB 2A59A 1R0BA 3E7XA 3TG8A 3OT5A 1FTYA 1L4YA 3DEHA 4ALKA 1QE0A 5CXQA 4XDYA 5D3MB 2IIBA 1Z45A 2AI1A 3UFBA 5E1DA 3TEFA 2K2QB 2VH5R 1UFKA 4LQCA 4D96A 3ZIDA 4W5WA 1GCIA 3GVXA 4D3FA 2EHDA 3CHYA 4M55A 3GJSA 3SG0A 1LS1A 4PIPA 1E5TA 4PSDA 2R6JA 2J31A 4ROSA 3MGKA 1OYYA 2JBHA 5LMUB 3I9NA 2BF7A 4E07A 1JA0A 4GNRA 4F84A 5CA1A 2OD7A 5KTTA 2G8LA 5LQDA 5DCWA 4N7MA 4HDNA 5BMVA 2WF7A 4FILA 2OB2A 1XKTA 2HKIA 5LQRA 5TV2A 1L9KA 3LK7A 4NV0A 4QXAA 1H8EA 2ZUFA 4XJXA 1FX0B 2ERYA 4K9KA 4DQKA 4ZZ0A 5LP6F 4UNSA 1QU2A 2H07A 1CIVA 3JATA 3EVAA 5A0FA 2H7CA 2W5UA 4RZIA 5DM70 1LK0A 1ICIA 2IELA 3TSYA 3AYXB 2ZROA 4A8PA 2CLOB 1VXOA 1X0XA 2V7BA 1JIVA 4F45A 4J0QA 4GKAA 1P2VA 3WG9A 2DT8A 4EG6A 5ERGB 3RNOA 4RJIA 3O8DA 5BW4A 1RQ2A 1ZCZA 3AEQA 5EJIA 5C8YF 1JLLB 2I4OA 2ZJYA 3FAZA 4B3JA 2FFQA 3HDVA 3IVGA 1LF0A 5JRJA 2KPOA 1UWKA 3MNFA 4BGDA 4E2ZA 2VJMB 3LDGA 1CBUA 2VJBA 1DL5A 3FDXA 1HWYA 1LPBB 2OFPA 1U0EA 2NU7A 2XOEA 3A1CA 2L0XA 1IBSA 2AF4C 4XTRA 3U62A 4AYWA 4A5OA 4G0VA 5JVDA 1I3OA 2P3SA 1KZ4A 1T10A 2XCSB 3TXXA 1NPDA 1ZITA 3RVRA 4CG2A 4IJUA 1ACLA 2Y1GA 1NJ5A 3V7YA 4EUSA 3DF9A 4QG7A 3YASA 4EF5A 1X1AA 1BOOA 4P2GA 1SUEA 5K6AA 3MCTA 4K40A 3PUZA 4R1SA 3KB6A 1ECGA 1US8A 4M0PA 5IF3A 1FDTA 1ULBA 3LUHA 3ANXA 4FMCF 1CUSA 4LXXA 3V1LA 3OWXA 4DAEA 5A5EA 3RS3A 2E4VA 4QAQA 4B6SA 1X1TA 2X8AA 1GGEA 3GA7A 3TYXA 2WFLA 4V2IA 4IXNA 3UXYA 3LXXA 4W82A 2H00A 4CKZA 5A3QA 5C5EA 2I7VA 1KPGA 3GJ4A 2OT3B 4A10A 1QIKA 3GJTA 5IVHA 1IXKA 1IUPA 3L7YA 2Q2OA 2BUAA 3VTZA 1U02A 2PU7A 3EGCA 4BLQA 4KVFA 1T36B 1TA0A 1PZNA 4Q5IA 4UUNA 5P21A 5IAGA 5I9LA 4OI4A 5KJEA 3WGTA 3QU4A 4HLUA 2A0KA 2IV7A 5L7TA 4G2TA 2J0EA 4ZJZA 4TXJA 3AR2A 2QVGA 2XE8A 4WBNB 1I2CA 4F4JA 4I6GA 3PPWA 3UWSA 1WETA 3ITNA 2R1TB 2GEUA 4FYHA 2FCRA 3NTRA 2NVWA 2W6JD 5K51A 4EJ2A 3E82A 3EIUA 3L6CA 4IR7A 4JBYA 3JWGA 4EUKA 4KPYA 1PLJA 4MMZB 4M1TA 2ZGVA 4ZO7A 1XXLA 3PC3A 4GYWA 4TT8A 3AM3A 2JIPA 4HUQB 4Q7KA 3F1LA 3VRHA 3AHFA 3HYLA 4XFKA 3OCWA 1CD5A 3R7DA 4GL2A 1SUIA 5EWLB 4TTJA 1TJNA 3NHPA 1GPJA 3RT1A 1FS6A 2ZIFA 3OOJA 2H4FA 3WGJA 4HGZA 2YWGA 3DULA 3DT6A 3OPYI 1QO0A 4BO5A 1RE1A 3X1MA 5JSZA 1GDDA 3JQ8B 4HGQA 3ANLA 3LA6A 3GAAA 1BDIA 3KP1A 2HUNA 3HCDA 2O7NA 3NV9A 2IDJA 1K8YB 3P52A 3T7EA 4DLTA 1PGQA 3K1JA 4F8EA 1UBMS 1LVGA 2XQKA 1K08A 1M67A 2VHJA 2UAGA 4X62B 1U6KA 2A88A 1UZAA 1SQSA 4NCHA 5HKAA 4RTSA 1EIWA 1LTHR 2VNJA 3HMKA 4C43A 5BSGA 5LWHA 1J22A 5LKAA 2WG1A 2YCLA 4KLRA 4S2EA 1QH1B 3ANMA 3BJEA 3DFKA 4R51A 2DWUA 2YYSA 3M70A 4PRKA 4EHIA 3R0ZA 3CEHA 3DBLB 3O4FA 1CDOA 3LGXA 2XNSA 4FFMA 1ZMXA 1RZ3A 1AX9A 4NH4A 5DHFA 1FRFS 4IH9A 1Q20A 3RK1A 3W6OA 1TI7A 1XZEA 3KNZA 4H3VA 2W6ID 1EGQA 4I1RA 4XEHA 2C2OA 5FYQA 5AI6A 4BAGA 1EVKA 2GTHA 2I7TA 2XTZA 4K6HA 5KYUA 1FDIA 1EWVA 1H2AS 2G9QA 4GOOD 2BFDB 1JLRA 5H3HA 1QV6A 1NSYA 1XJWA 4N0EA 3P9YA 4MYHA 3WWCA 5LU9A 1Q77A 3L84A 3O92A 4BNTA 4DIOA 4YRQA 4MYUA 3L1HA 5E4YA 5IK2A 5CDGA 3KE8A 3OQ6A 1PUIA 3FXAA 4J4TA 3S7TA 16PKA 5ALFA 4IOKA 1XVAA 2QT9A 3NAZA 5E1MA 2NTNA 3O38A 4YUZA 2VBIA 2WYIA 3IUNA 3LDHA 1SZPA 3QPUA 4Y0NA 1CRPA 4QSMA 1Y6GA 2PSFA 2J5KA 5CFPA 3WNVA 2QY6A 1K7YA 2OQIA 5HE9A 5L3ZA 3V1KA 4F2HA 1ZXXA 1T8YA 3ZJ4A 4NDNE 5DX8A 5DWVA 1RWQA 2BR4A 2VHWA 3DCIA 2VH2A 3IR6A 2JAOA 4MYRA 3E22A 2IWRA 1P4SA 4NMLA 1N5IA 2WWGA 4WY5A 2PUGA 2F9FA 2V4UA 1QH0A 3PLNA 1DIRA 1IJEA 1YQTA 1AV7A 2C4WA 3R5KA 4H3KB 3GD5A 5HPYB 1SCQA 2HSWA 4K3UA 2PT9A 2XVXA 3DO5A 2IHVA 3GDGA 4U2BA 3CS3A 1HFEL 3TEMA 2IVZA 1WAMA 4Z4CA 2YZ2A 5CEEA 1TYBE 4GKBA 1SWVA 3VDQA 2JHFA 4KLNA 1QK5A 3NANA 1UANA 3CRRA 5DNCA 2WVHA 5DHPA 2QUKA 3G0CA 3THYA 4BAZA 2XKKA 1IHYA 4K0KB 2GA8A 1YI1A 1Y9ZA 4EK9A 5CD1A 1IBCA 2H54A 3ZHBA 2A6PA 2EQBA 1CRWG 1Z4NA 4JVNA 1R16A 5I9TA 3TSZA 3UB4A 2PRKA 3OSZA 4UM9D 2VYNA 2XXJA 2YZNA 3G49A 5DBFA 1XXHE 2FK7A 4U4AA 1R6VA 4UUOA 3UEOA 5KNLA 1H4SA 3UJDA 1MZPA 4RCYA 1E4YA 2NZXA 3MERA 1XRLA 2H3HA 3HG7A 4EA7A 4ATNA 3WZ2A 4EJFA 3G6KA 1R4ZA 1QBGA 1KEUA 3HM2A 5KOHB 3ORRA 1QYIA 2ZREA 4IXDA 4HDQB 4JP5A 4ZO8A 2EJTA 1V41E 5BMVB 3FZQA 1CX9B 3LPAA 4GWGA 1L4FA 4XVQA 2J3MA 2OSVA 4MIOA 1ZBQA 1EXDA 3IBCA 2OAQ1 4Q9IA 1T9AA 4RABA 3DE5X 3IV7A 1ADJA 2XBUA 4H6XA 4QPNA 4U5QA 3DAPA 2ZTVA 4MJLA 5YASA 3WMWA 5B1IA 5FQNA 1X1RA 4FJ0A 1F38A 1QZXA 3OFKA 2JANA 5D1NA 1FL9A 4PZPA 1GKKA 2IRWA 4IGAA 2OCGA 1B0AA 4QUKA 2A7XA 5K0SA 5L3QA 3X2FA 2Y3IA 2YYYA 4M0LA 2OL4A 2E9SA 4YGYA 1HMYA 4EI2A 2JGDB 2Q5IA 3PUXA 2QVLA 2PRIA 2WK1A 2GBIA 3DFMA 4FU0A 1U3WA 4QOJA 2IS2A 4K9MA 1CNMA 2YMPA 1GKIA 1Z0SA 1UBUS 1XMVA 2V5AA 3O5AA 1N2HA 3OJLA 1PQUA 1V8PA 4J1SA 1NKVA 1R0CA 2Q3JA 3TM4A 2GS9A 1J0AA 1UM8A 4GOJA 1UAGA 1R4AA 3AF4A 1VE5A 3QRWA 2ZS9A 4ZZIA 2EJBA 3ENQA 2FWNA 4QTUB 1YIOA 5CFNA 4FDVA 2PMBA 3P2IA 1THMA 2VQ3A 4PM4A 4Z3DA 3CLRC 2Y27A 2AK3A 2HWWA 3G8CA 1Z68A 4EHJA 2Y05A 3D7NA 1KEKA 1EBBA 1R8XA 1Z5GA 1SBIA 2V6IA 2GBFA 2RBKA 5AM1A 1LI4A 3EFOA 4IIFA 2WWVD 4BFWA 1KOFA 4KQFA 1VE1A 1IUNA 1E2LA 1OC4A 2JJQA 4R1UA 3HB4X 4NYJQ 3REGA 2PVPA 4J0CA 4TS1A 3BOSA 3P5SA 1F17A 2ZT8A 3TUIC 3P4UA 1MVLA 2BZ1A 2J3LA 4R40A 1XQ6A 2J3KA 3RWMB 3DOUA 5K05A 5F35A 3IB6A 1FMLA 1JIUA 1E4EA 4P3OA 2XCTB 2ZR0A 3X1KA 3I5UA 1HQDA 2G06A 4TKZA 4RH3A 1I2AA 5B6PA 4KR3A 3MJFA 2JBAA 5BW6B 1A7AA 2CF5A 2WYHA 1AK1A 2QD2A 5E4TA 5DW0A 2BJVA 4KN6A 4HLNA 1T91A 1QGOA 5BOSB 4KQGA 3ADDA 2B94A 2Z9BA 2KJQA 4P22A 3F5MA 3EPLA 1DU4A 1PFGA 2XF2A 2W98A 1E3WB 4G4IA 4DG5A 2INGX 3KK0A 4M8KA 5ITZB 3ZE0B 3LY8A 2PSJA 3L1KA 3L8GA 2DX7A 3KVVA 4I1YA 1OPRA 4P5DA 4BECA 2VI5A 4PLGA 2QAIA 1GZVA 4LCEA 5F64A 2X8LA 4B09A 3MJVA 4BMCA 2H16A 1CUIA 5EGSA 4BLTA 2BFMA 3EULA 3VX4A 4ZYTA 4BVAA 5LQKA 2NVOA 2JKYA 2NZJA 3STTA 3RSLA 3SQWA 1CY8A 3HB9A 1JR3D 3HWWA 1DJMA 3UPUA 2QN7A 2XNKA 4BHTA 1DUVG 2X2OA 1S2NA 1ULZA 1TFRA 1KDZA 1D7OA 2DM6A 4GDMA 4YFVA 3PEUA 4N3NA 2PH3A 4ZANA 3NHFA 3FHLA 5P8WA 4CF7A 1OAAA 2W90A 3DHNA 5K0LA 3JW8A 1TVKA 5CT9A 3BD9A 4DQDA 2Z6VA 1ZW6A 5JARA 4TT3A 4MV7A 4BFUA 2IEZA 5F78A 5ADUS 3DZDA 3AJEA 1TZKA 4UBJA 4PONA 3VISA 3RT7A 3ELDA 2CXQA 1FSPA 4EM6A 1GUZA 4KVZA 5KKCA 4EITA 1ZXLA 4I4TA 4LF8B 2WJGA 3FDIA 4IRUB 2V9CA 4ITUA 2HNAA 3OX1A 4Q19A 4WZZA 2GZRA 4RTOA 2YMQA 3ZWWA 4NVRA 4RGVA 3NC0C 4JT4A 1AS3A 2WWIA 4NOMA 1HTTA 2OQ2A 3SYNA 3TECE 3ZDQA 1FTNA 3C7TA 5EIHA 1K2WA 4HDKB 3HFJA 4FYKA 3NWPA 3BFJA 3V1UA 2XTNA 1GPKA 5K8JB 3DE6X 3HKCB 2QRHA 3MTIA 2QN8A 3KELA 1E3SA 1GA4A 5GPBA 4CCYA 1O0BA 2PX5A 1K2VN 1SZJG 3NHBA 1X42A 2MR5A 4QICA 3HCPA 3T5PA 2GKGA 1X1CA 3C3JA 1I4LD 4M0DA 4DSUA 1H0HA 4I4IA 1MIOA 4KX5A 4DQXA 1IWOA 3LQRA 3QUTA 5BV2P 1A9RA 1N0WA 2REBA 1GEEA 4IVRA 4ZEVA 4FKBA 2Q4DA 1U4SA 4JDUA 1YBVA 2GTPA 2MINA 2YASA 2ZVJA 3KV1A 3OPXA 3P2MA 3QMPA 3VC3A 5CB4F 3I0MA 3LIPA 4KUEA 3WYGA 4YDHB 5TNXA 3UH0A 5G0SA 2W8ZA 3LUGA 2CUZA 3M7IA 4H3SA 4GZ5A 3VYVA 5JJCA 1AUPA 1QAMA 3Q7IA 2JS7A 4EP1A 2X9VA 5EP4A 2VF5X 4BXOA 2JLQA 3KPYA 3W5HA 1I10A 2ODQA 1E3LA 4OQNA 5D87A 1J9ZA 2GJKA 3ZDZB 3MT8A 3E4CA 2BCGY 2V7XA 3PKZA 4PVDA 3RTEA 3TXAA 2XWBF 2UYCA 1SR8A 3WLJA 3UCFA 4DZZA 1P3Y1 1VL0A 2ISSD 3AV0B 2WZDA 3IP1A 2CCKA 4DG8A 4OLFA 4EJ6A 2VLBA 5M3BA 2H63A 3UY4A 5KZMB 4JC5A 1Y1TA 5C1OA 1KC3A 2J46A 2ZJBA 3A7EA 4CQLB 1N6OA 4H08A 2WIDA 2O6HA 3F67A 3E23A 3G8DA 2I3GA 2FW1A 3MPUA 2GGSA 4DLXA 3V2UA 4YPFA 5C18A 2V9PA 1FOEB 3ZWXA 4DCTA 1ECBA 3EGOA 3IPLA 2WWYA 4JUDX 3V48A 3GDHA 3IEKA 4KIWA 3HBNA 4DV2B 5EKSA 3PEEA 3U7RA 5ER9A 4QIHA 3BFVA 4LOJA 4BDSA 1YIAA 3IE1A 2C4KA 3FSGA 2K6GA 2D1SA 3FOFC 5B2ZA 4OHZA 2WSSD 2BC9A 2PRZA 5CNIA 2BCJQ 1HSZA 1GZUA 2CVOA 1XU7A 4FDLA 4HQ6A 2PY6A 4LY3A 2O05A 4G09A 1X19A 4GVXA 3FRJA 4FX2A 1GRVA 4R2XA 2IBSA 2OY0A 5K4GA 3QJ5A 4KDEA 5I8WA 3N05A 4V0MA 4YASA 3C1UA 1ORDA 2UZ3A 4XDHA 4Q4JA 1GTVA 2G40A 4HYQA 2OZEA 1MC8A 2QUJA 3OQPA 2PH7A 4YMHA 1V9SA 4LZPA 2GM9A 3O0DA 4YUVA 2CDRA 1Z7EA 2DLNA 1OFTA 5JXJA 5IDXA 3VBEA 1QO7A 5DYIA 5FNVF 4KQEA 1SULA 3EF0A 4DNFA 1ONPA 3A2NA 1SOVA 1KWGA 1ZESA 1JR6A 4EB0A 3DKIA 2ZETA 4HXYA 3U7GA 3H1FA 3ZCRA 1I7LA 4KPEC 3ZLJA 3FUCA 3WJAA 1II8B 1U80A 3SHFA 3WBBA 1T8UA 2CNLA 2ZIEA 1YZKA 1J0EA 4N9WA 2DERA 5JQGB 4FDAA 3CNHA 3S2UA 2C3UA 1FNNA 2Z2IA 1Y1RA 3HJUA 5AR1A 1T0JB 2VAXA 1BWRA 4TVSA 4GM0A 5JY1A 1GFIA 1Y98A 4ZXFA 4ZV9A 5I4CA 4V39A 3SMVA 1EVEA 4FDMA 4G65A 3CKMA 1R8QA 4PYRA 3C3KA 4DKXA 1X15A 2AFHB 4GKKB 5AESA 1XAJA 1TOAA 3AW8A 3C2QA 1L4HA 1P1RA 2GYVA 2OO5A 1CY6A 1GWNA 3M6IA 1RM5A 2BGJA 2FFAA 3LPLA 5CVDA 3V2GA 1I9CA 1SVLA 5IJ9A 1M1ZA 3L8HA 2ZITA 4Y2QA 1E7YA 1Q92A 3REOA 1GV1A 4L8LA 3JQ7B 5IUNC 2ST1A 2X7HA 4RSMA 3R75A 4XLZA 2IK8A 4DR5B 5EA2A 2R4QA 3ZW8A 4YRZA 3BM5A 2CMKA 3ROZA 3CG4A 2DBRA 3LOPA 4EA6A 1G42A 2C3YA 3U61B 4IIJA 1DFIA 2NTYC 3GROA 2ZRPA 1KF0A 1DDGA 3GIDA 1TRHA 2V54A 1S02A 1ZA1A 2G0NA 4PYNA 1USVA 3MIZA 1PJSA 3TE6A 4YYZA 2BT4A 2R2GA 4UNNA 1JG6A 2IPNA 1JU4A 3NTOA 1E9CA 2RGWA 3CFYA 1LK5A 3PHHA 4MI6A 4QDTA 4XWAA 5HQJA 2Q8PA 1Q57A 1WHSB 2G70A 3D5QA 3QBEA 4YBZA 3M3DA 4A0GA 5H8WA 1N5KA 3C3AA 4KHPB 1D8TA 4GX5A 4DY4A 1TQDA 2FXIA 3BMOB 1EFKA 2WJIA 3NPMA 5FPSA 4J9UE 1G9TA 2J67A 4MVXA 2FN7A 2W7TA 4TWZA 5FBZA 1YV9A 4PU0A 4B6GA 5K0FA 4QYWA 5JYEA 2OXEA 1X38A 2QDXA 3ROTA 3NGXA 3QMWA 4TV9B 5G1PA 1MTOA 1Y6RA 3QVTA 5L3QB 2PYDA 1UXIA 4GR5A 3Q5EA 2JLRA 4YRBA 4Y2TA 1XO1A 2RKBA 2ZYSA 4PE5B 4J1TC 2HV9A 3FNEA 4XPZA 2W2PA 3I3SR 2XDQA 2O0LA 3TIVA 4Q7QA 2XITA 5FWYA 3GLIB 4GWLA 3TEJA 5EPEA 2GD1O 4NMXB 2EGGA 5KOJA 3E0XA 5KNDA 3C87A 4U6NA 4IQ0A 2QTRA 2V98A 4M0MA 2XUPA 3ECSA 3JQCA 4RZUA 3GJ8A 2C7PA 1TKBA 4WPGA 2VZEA 3IUQA 4MVJE 2X0DA 3IILA 2BH2A 1E1CA 121PA 4M36A 4S04A 5ADWA 4HFMA 3JD1A 5E6UA 5CDFA 3KU1A 1XWFA 4X8HA 3FSEA 4Q9HA 4E51A 5ICGA 1Z5UA 2VCEA 5I7SA 3ANSA 1M2OA 4JU8A 1T25A 4NONA 3V8PA 2ZBPA 2VL7A 1GPDG 2OZLA 4RVOA 1PK9A 3PHLA 5HGXA 1D04A 4Y9SA 4B2LA 5E95A 3BULA 4LGYA 3AVVA 4BNGA 3N28A 2UXCB 3E9RA 3F7OA 2FJ0A 1SKMA 1F0YA 3CZMA 1LV7A 3N2EA 1MX1A 3KUCA 1LPPA 1IULA 1GU7A 1YZ3A 2ORED 4JUFA 1G4HA 1SJ9A 2QUIA 3FTPA 3INGA 4IXTA 3E70C 2XDQB 2VSOA 3JQFA 4FHCA 5GV7A 1ENZA 2WP8J 4ER7A 1B6TA 4L85A 1W48A 5LOVA 4HWGA 2YJ6A 4C01A 3NBFA 4MYSA 4EOGA 3OTIA 3TZCA 1FTSA 4MLCA 4N3GA 4CODB 4QUGA 4B6RA 3NDBB 4Z9XA 4LHZA 3JD0A 2ATIA 2PLFA 3AFNA 1NBHA 3L7KA 5JNVA 1J8FA 3EUEA 1KJJA 5CTAA 3FAKA 1GN9A 2ZS8A 3NZEA 3VR6D 1H6DA 4MW2A 2FWBA 3B6KA 3AGQA 2R5NA 2PKCA 1CJCA 3EARA 2HA2A 3TI9A 1TT5B 1Q1AA 4JVSB 2OCBA 3UG6A 4R7ZA 2CMGA 5DIZA 4ARZA 5IEBA 1FNCA 2XVYA 2HM7A 3DXFA 4B43A 3EFHA 1C3JA 2PZAA 2AE1A 2Q1UA 2A84A 3USES 2N75A 1PJLA 1YL6A 3CURA 5DNYB 1KY2A 1LUAA 3CUWA 1HFJA 1QGED 1OBFO 4M83A 2BUCA 2KS6A 3EVZA 4OA5A 3S28A 2QSJA 3B2NA 1JR4A 1V26A 2Q3BA 5T8KA 4UNPA 3VAYA 3HXQA 1E0KA 2JG3A 1VP3A 3MD9A 4WFJA 4HWRA 1TA4A 2B7CA 5JSHA 1FA9A 3B1XA 4RL4A 4TRMA 2B20A 4W5HA 3VR5D 3TL2A 4R2JA 5BV1A 3T5TA 5BVHA 3CUYA 3BWEA 1W25A 3ZWVA 1YI8A 1R0ZA 2O20A 1EE9A 3ZK9A 2CK3A 1DRUA 3KOXA 1NASA 5AHXA 3D2CA 3WADA 3BB3A 3R77A 1T3HA 3Q12A 1DUIA 1X39A 2MSLA 1NMEA 3DAOA 1A4RA 3ZWCA 5J4HA 3EY4A 1TJ4A 2C9ZA 2YBDA 3AFHA 2VAVA 3JQFC 4O0MA 4EEKA 5JNUA 2AN5A 1T1SA 3ZW7A 2Z83A 1XZAA 4C9BA 3T7IA 1PZGA 5K5EA 4OHFA 1MOSA 4E33A 5ALMA 4ECEA 4G9BA 5FI5A 4N76A 4LY0A 5AM4A 1SG9A 3H4VA 5I9SA 2ENUA 3ESAA 4KE8A 3RSZA 2C2ZA 5G0WA 4U7JA 2YW9A 4D3DA 4N9QA 3OIDA 3VXKA 1YOVA 1U7TA 2IS4A 2F8LA 4A03A 4X7BA 3FFWA 3RC1A 1PS9A 3EDOA 2CKMA 2VXBA 1D1SA 2WKSA 2NU8A 3TCNA 4PAOA 1OLSA 4W1PA 4YCLA 3JRNA 1IYZA 3A6JA 4IF4A 1ULUA 1HH4A 3OMLA 1P9OA 2ZJ3A 1XZMA 2FPUA 2MOKA 1MEOA 3F3KA 5I7VA 4TLCA 5THKA 2EZ9A 1RYEA 2X9LA 1CLUA 3A1UA 3HO8A 3MS7A 1LDYA 2RGGA 4OJYA 2IP4A 2A0FA 4REQA 2JJ1D 4H7HA 4UEOA 1QOPB 4L3OA 1EFUA 4LYYA 1M1YA 2FQWA 4OAOA 5FX2A 1GLGA 1H6AA 3JSXA 3B6MA 2FPIB 3HCEA 5DSTA 1MN6A 2Z09A 1U7PA 4O1MA 4KDFA 2Q8NA 4OIFA 2MYPA 2XTAA 2CJWB 4PLTA 4R8MA 4QBHA 1X7HA 3K1TA 4Y1RA 1H93A 4DRXA 3PTAA 4X65B 3KT3A 5CAEA 1I7NA 3WQRA 1BE8A 4RPKA 4DUGA 1UAYA 1QYCA 1J33A 2C2WA 2CWWA 3W9SA 4EBFA 5LKRA 2VSXA 3PDIB 2EW2A 1ZLYA 5JO0A 3DMGA 1PK7A 4KN9S 4PAMA 1KRWA 1HFKA 4RLSA 1ZN2A 3E7WA 1IUOA 5AKYA 4KL8S 4J0EA 1M74A 1DEKA 2WR8A 5EZYA 3RE1A 4J90A 5FOWA 3DD5A 1ZSYA 5JAOA 1J90A 1VKNA 2QI9F 3JY6A 1E32A 4G0YA 5DE3A 1Y5IA 3S3TA 5TR9A 5HW0A 3Q2OA 3Q9SA 1GNRA 1XAHA 5DFAA 4DHEA 4E0BA 2C83A 4JH0A 4AX8A 2BBOA 4ZAWA 3D3QA 2WKPA 5JRZA 1NIJA 2QP4A 3PWKA 1XQYA 4URHA 4JYCA 2E49A 1Q0LA 3B7GA 1Z83A 4B3GA 1VIDA 5JV5A 4YWHA 2IOHA 3L7DA 1CQPA 4NWIA 4E2FA 4Z1MD 2Y67A 3SR0A 1EK6A 2FUKA 4JCCA 4CWAA 2V0CA 1RS0A 5SICE 3FF1A 5FLYA 3H2YA 3HSYA 3JQRA 4O8CA 3FX2A 3MMSA 3AZOA 4IQ4A 3L02A 4GP7A 1Y9EA 4LMRA 4L6CA 2WVAA 4BZXA 3DB2A 3G88A 3WY9A 3KZXA 4LDPA 1GTZA 2PZ8A 3HEAA 5ICFA 2K87A 1W6RA 3RVSA 3NRCA 3DMPA 3D7LA 3BQNB 4ZGWA 1VIYA 3T5GA 5C32A 4WUTA 1EFPA 2E6KA 3Q6IA 4E03A 5JNRA 3ET5A 1CQWA 4HN9A 1SBNE 3ZZTA 2A9PA 3A58B 1EFTA 1ZX1A 1FF9A 1ATIA 4RQBA 4QARA 5L3SA 1Q12A 2ZKLA 4Z4F