1XEXB

Structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
161
Chain Sequence
KKNVFMRTFEAISRNFSEIFAKLSPGGSARLILENPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALAFVFAIQKFKPAPFYLFDQIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANADKIIGVSMRDGVSKVVSLSLEKAMKILEEIRKKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural biochemistry of ATP-driven dimerization and DNA-stimulated activation of SMC ATPases
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
molecule keywords SMC protein
total genus 41
structure length 161
sequence length 164
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xexB00
2IYQA 2AHOA 3OIUA 1FX0A 2DFTA 3NEJA 3W8RA 1CKEA 5HPYB 4AKGA 1L7VC 2AD5A 2GCOB 4S35A 5L3VA 3W3AA 3BC1A 2JIZD 3KTAA 4XWAA 2F9LA 4ZCMA 3NWJA 2J0SA 5FUVA 4Q03A 3AV0B 3SNHA 3EPJA 2H7VA 2HUPA 1ZD8A 5GJBA 3IQXA 1EFUA 4MKGA 3ZGXA 1K6MA 1AK2A 5G40A 4RD6A 4MDFA 2CLSA 3RYTC 5DI9A 4ZDWA 2DWQA 3OEED 1YR9A 2NZJA 2ZRMA 3I1FA 3E70C 3SN6A 4Q02A 3BB4A 3QBTA 2QGNA 1FNMA 2Q9AA 1HA3A 4TSFA 4IJMA 2PX3A 4WZBE 1VKJA 1KI4A 4JVNA 3K0EA 5JLJA 3QXXA 1S9HA 1S3GA 2XSZA 1U81A 4HB4A 1KIMA 4L9WA 4QBHA 1M34E 1KSJA 2R65A 1P73A 4KO8A 1TTTA 2ZSBA 1E2QA 1P4SA 4GP7A 5B57C 4GZLA 1UJ2A 4F93B 1GM5A 4HSEA 5FI0B 5C18A 5DNYB 3K70C 1BYIA 1D9ZA 1OXTA 1X6VA 5L8VA 2PLRA 2O5VA 3WBJA 4FMCB 1VYVA 4IDHA 3V00A 4C30A 5BYKA 3MLEA 1XDBA 1UF9A 2J46A 3HWSA 3BJIC 2O8DA 2AX4A 2E9SA 4QL3A 3UPUA 3A6PC 3WRYC 4PZYA 3GD7A 1UFQA 1X1SA 4QM7A 1IY2A 4TT3D 3MWKA 3OHMA 4M2LA 1VYUA 3R9XA 2IXEA 3EAQA 5TY0A 3FFBA 1JR3D 1LF0A 1TF2A 4PTLA 5EUMA 1E9RA 1E1QA 4TQAA 2G1JA 5DI3A 3T1QA 4DSTA 3I62A 1XEFA 2IYTA 2FZ4A 4Z8YA 2PBRA 5IF9A 3KJGA 1G41A 4ZIRA 2YVUA 3NH9A 2QEQA 1XFAA 5H8WA 4C0AC 1ZNZA 2W2TA 1UPTA 1YZGA 2YV5A 4DCTA 1U98A 3DKVA 1NMXA 2IX3A 4URWR 1M2OB 2XEXA 1RC8A 1S96A 1E0SA 4C0SA 4ZDJA 2G88A 3NEYA 3K0CC 4Q47A 3U44A 1XTSA 2DYKA 1NJGA 4CGZA 1GILA 1AZSC 3CX7A 1HQCA 1ZUIA 4M8NE 4FMCF 3FHTA 5JRJA 4TQ9A 4TWZA 1D8TA 3PUZA 2GXAA 3AVPA 4O25A 5EE5B 2H57A 2A5JA 4F4CA 2VP9A 2IYRA 5JWOA 2CL0X 3D8BA 1YZUA 2V9PA 5LB2A 2PZEA 2P6RA 4LBZA 2ORWA 1RJ9B 1GRRA 4URUR 2OBNA 1SZPA 4XVQA 1KAGA 1W5SA 3K8YA 4JLPA 4RD0A 1FUKA 1KI8A 1XPRA 4CVNA 4TMVA 2CHGA 2DY1A 1DG3A 1U0LA 3GEHA 3C14C 4Q9KA 2ZRHA 4GZMA 2CE7A 5TV2A 4E03A 3CF6R 4JJKA 4KFRA 3L8YA 1K5GA 4TT3A 1A2KC 1WB9A 2ZSAA 1NG1A 3ASYA 4A6XA 2R8RA 2YYZA 4GL2A 2BJWA 5HTKA 3AVUA 2HCJB 2JLRA 4J0QA 4UQOA 3OIVA 3THXA 4Q9IA 1OPXA 4CYMA 1XF9A 2PX0A 1L2TA 3R8CA 1O87A 3H86A 5GADl 3I61A 3VR2A 2WWWA 4UNNA 2G3YA 1EFCA 1Z06A 1YR6A 4WXRA 4BQSA 3I92A 3BFVA 4LJYA 3U3OA 4LK2A 4LPKA 2ZQ5A 5GJCA 2ONKA 3AVQA 5IT5A 3T15A 1E32A 2MMCA 3VQTA 4OBEA 4I1SA 3ONWA 4QNMA 3SE0A 4W5HA 3B78A 2BM1A 4PAMA 4ZPXA 1Z2CA 2VQSA 3CBQA 1XXHA 2F7SA 2ZROA 1G3IA 3H4MA 4WIAA 2PCLA 4M9SA 221PA 1VECA 4ON9A 2RGAA 4Q01A 5H70A 4MGKR 4GDFA 1ZUNB 4OI2A 4KVGA 4KODA 2MSDB 3OEEA 5JJIA 3K9NA 1FOEB 1Z0JA 4JZKA 5FBWB 3C4JA 4QHTA 1GZSA 3BS4A 2YC2C 4NCHA 4M1SA 3C7KA 1MKYA 2CXXA 4FMDF 3CF0A 3NG1A 2ZRKA 4LHXA 2EWWA 2AKYA 4PQRA 2A30A 3QJYA 3AP2A 4U5XA 4C0BA 1NL3A 4RSGA 2QP9X 2AXPA 4YDHB 3U61B 4BGDA 2IA5A 1NSTA 4FN5A 4TZ6A 1T9HA 2B7CA 1XCPA 5BQ5A 3DKPA 4IEEA 4O2RA 3PG5A 2ZREA 3A4MA 2AXNA 1OE0A 3RVBA 4K81B 4QBGB 4ASUA 2WBLC 3CZPA 1ZBDA 1YR7A 3HDTA 1COWD 4PPFA 4QG7A 3WNDA 3TSZA 4F91B 4A8JC 4M1KA 1N5LA 2BMFA 2QP3A 4LYHA 4MUAA 1U9IC 1N6RA 1TU4A 1R8QA 4US0R 2QMUA 4B3XA 4MGZR 2CCJA 2CK3A 4FCWA 1Z47A 4IRUB 1ZP6A 3UMRA 1N2CE 4MDEA 3L0PA 4QM6A 4FD2A 1P9WA 3QPWA 4BFZA 1OT3A 2G83A 2CL6X 1UBFA 3CNOA 4GMXA 3TSWA 1XTQA 1J99A 1J90A 4G5OA 1KO7A 3NHBA 4NBSA 2IYYA 1CR4A 1G5TA 1LF5A 2GTPA 2WKPA 2CNWD 4XOIA 4IVQA 3DMNA 4HLDA 2HLDA 3BAFA 4LV8B 2A2ZA 4BFTA 2ZIAA 4Y0VA 2IWRA 3LV8A 3KXLA 1E2DA 1VHLA 4FMDB 2HJGA 4A0FA 4LBYA 4A0RA 4Q9HA 1DEKA 1MO6A 2PEZA 3BFKA 3BBPA 4Q7KA 1N5JA 4B2IA 2GZAA 3EA0A 3TJZA 2REXB 2QPOA 5TARA 3TRFA 1V43A 3C8UA 5AUQA 4DKXA 2RGBA 1Q22A 1GL7A 2KBEA 2YZ2A 1ZM2A 2VP2A 2EFDB 1NY5A 1OHHD 4A2PA 1TNDA 4Q7LA 4NCNA 4OYHA 1DPFA 3QKRA 1COWA 1YHNA 2ZRFA 3CRQA 3LQRA 1UBGA 2GAAA 1KHTA 5FOSA 1WRBA 1W2HA 2R9VA 1N0UA 4HDCA 2ODNA 2BIFA 4PO9A 4KLZA 3CPHA 3PUXA 4LJ4A 1RRPA 4A8JB 3KJIA 2R2AA 1KAOA 1ZRHA 1EFRA 1ETUA 1NVXQ 3SS8A 2BV3A 3QOFA 1JBKA 5FPYA 2XXAA 4NYMR 1G7RA 1IQPA 1KO4A 1ESNA 1YU9A 4P33A 5CM8B 2D62A 3RWOA 2XJ4A 3K70D 2GXQA 5DE3A 3QKRB 5JCZA 2ZE7A 1SKYB 4LJ9A 3VX4A 3A1TA 1I4LD 2KB0A 3PFIA 2VH5R 1E2NA 3VR3A 1F60A 3PEVA 1DAMA 1WMSA 3B1ZA 1HYQA 5SZKB 2J3EA 4G0NA 5FBLB 5JI2E 421PA 1CRPA 1G7SA 3L8ZA 4Q18A 3UKDA 3ADDA 5AK0A 3IKJA 4C9BA 3RAPR 2RHDA 2VHUA 5CDFA 1IN4A 3BRWD 3MUFA 2FE4A 4Q9JA 5F98A 1E79A 3WHLA 4NCIA 3AF2A 2OCBA 2D3WA 1GG2A 1D9XA 1CJVC 2ZM5A 4Q48A 3UG6A 1MABA 2JLUA 3VNUA 3BK7A 5HZKA 1LW7A 4CEHA 5JWHA 3LVQE 2J0VA 2VRWA 1OIWA 1S1MA 3AF3A 3DZ8A 3FMPB 1UDWA 2O8BB 4MRVA 3EASA 3GJ3A 1E9BA 2CE2X 3CLVA 3IPXA 3O8BA 3KQLA 4XH9B 3DMDA 5EE9A 1HV8A 3GLHB 4P31A 1EESA 4M1WA 2QZ4A 4DHEA 2OM2A 5J4VA 1E4YA 1OXVA 5IK2A 4QJ3A 1CLUA 4E22A 2P67A 5GJWC 2KBFA 1N6OA 5BN5A 4EFMA 1C1YA 1IXRC 5FOWA 3A58B 3K09C 4PPNA 2QORA 3S1AB 5EE3A 1PLJA 3RSOA 1GKIA 2QAGC 3TAUA 4C4PA 3GLGB 4NCJA 2IEYA 5EZ5A 4TMWA 5IDVA 5KNBA 2PCJA 3MWLA 1HTWA 1WDTA 1UEJA 1DAKA 2C03A 5CB6A 1TADA 4A4DA 2ZITA 1IHUA 2OSBA 3DZDA 2G0NA 3ZD6A 3PENA 4TLDA 4YMUA 4QGGA 2AFIE 1SXJB 5J40A 1XX6A 3KQHA 5SZHB 1N0WA 2BMJA 1XD8A 4ESVA 4GP6A 4WA7A 2OXCA 5B58C 1P5ZB 1F2UA 2BKEA 2WKRA 4M9QA 2WWFA 3KXKA 3K9GA 2L0XA 3B1YA 3IPYA 3GLFB 2QBYB 4P4UA 4NYJQ 2OAP1 4OJQA 4RD2A 2QENA 4TLEA 2BM0A 2O8DB 3DO6A 2JLVA 4PAOA 2WJIA 2B6HA 2JJ8A 4MKFA 3SU8A 3I3SR 4C7OB 2F6RA 1XTRA 2NOAA 3UATA 2YJTD 1KKMA 2GF9A 2BBWA 2W6JA 4M53A 4UJ5A 3VHXA 4PPGA 2OAQ1 1W7AA 1M7HA 2OLKA 3AF1A 1JJVA 1G18A 2VHCA 3M1IA 4W5WA 3X1DA 4H9GA 2YINC 5DSZA 3FFAA 1M74A 4BPBA 1WQ1R 5AWFC 1JXMA 1JJ7A 1RJ9A 1VYTA 2ZVPX 3NBXX 3PIRA 1U9IA 4XVRA 2CBZA 1L4YA 1N6IA 2O0KA 1QG2A 3QBVA 2N42A 2ZRJA 1NBMD 1DAEA 4RY2A 1VMAA 1NJFA 2GETA 1AS2A 3DHWC 1RYHA 2HT6A 1CRQA 3GJ5A 1XWIA 2DWPA 2ZE5A 3M0EA 4B44A 3TQFA 4G5SA 3AVVA 2RGDA 5D3MA 4GNKA 3SQXA 1WF3A 1LS1A 3RRNA 5JCPA 3THXB 1N0VC 2A5GA 4YDSA 1GAJA 2XOKA 1E0JA 3NC0C 3BWDD 3BGWA 3THOA 4DBLC 1Z83A 2GXUA 2GKSA 2IL1A 4BUJA 3R9WA 2ZVQX 3CX6A 5CLLA 3KFVA 3ND8A 4KVAA 1A82A 3G0HA 1XD2A 3SQWA 1P72A 2NTYC 3B8HA 1KDOA 3QG5A 3L2OB 2QRNA 2G6BA 2JATA 5CYPA 1V5WA 2JAQA 1IY0A 2A9KA 2C96A 3PEUA 3ASZA 3C15C 3OAAA 2P5TB 4KLNA 4OQFA 5EXSA 4D80A 2V3CC 1ZMXA 5FTJA 4C0LA 4Q1DA 4DDVA 1SXJE 4B73A 2RGGA 4DLWA 3EX7C 3VU9B 2V7QD 1DE0A 4Q5IA 2A5FA 4JLJA 2F55A 3MWJA 4LUCA 5JS8A 1J70A 2AL7A 2FPMA 1G20E 2OFOA 3PR1A 4D0NA 3T06B 1TF7A 2YHSA 3CO5A 1S1CA 1DOAA 1KZ7B 2ONJA 2IS6A 3K0SA 1JPJA 4UXJA 2GEUA 3FTQA 4Q1EA 1Z28A 1NVUQ 3QEOA 4HUTA 2WJVA 4KYUA 5EZ6B 1CU1A 2ZYTX 2V4ZA 1VHTA 2IC5A 4HUQB 4M9ZA 4JVSB 4M1YA 2GJ9A 2MSEB 1NMYA 4O3MA 3GJXC 3CH4B 2CDNA 3DPUA 4DB4A 3CNNA 2QAJA 4K46A 2ZRBA 3M4YA 1KDTA 3WYAA 2IUUA 4DUGD 3AB3A 1IY1A 2PL3A 2GVDC 5EP1A 4C0KA 3WMEA 2NPFA 3NHAA 4JKYA 5FPKA 3KKNA 3LNCA 4PQYA 3VAAA 3BH7A 1KI3A 1SQ5A 2IYVA 2NO7A 1QVRA 5B64A 3L82B 2Q9BA 4OHYA 3EPHA 1AQYA 1PZNA 2XB4A 3D7MA 1AN0A 2JLZA 5K8LA 5C4MA 2FSIA 5HE8A 5JHGB 4QBFA 3P1JA 2LKCA 2OCYC 3BB1A 4O2LA 2ZRNA 3VR1A 2QTFA 2QSZA 1JPNA 2W0SA 3V4FA 4NZYA 4N1AA 4BFYA 4NU0A 1LB1B 3CWZA 2HV8A 4F4JA 4D81A 2O8EB 4ZKDA 4LRWA 2CLDX 3BE4A 5JI3E 5L3SA 2J0UA 2I3BA 2I1VB 3SC3A 4YLGA 5M04A 4B3BA 4A6PA 4Z51A 2QY9A 1NLFA 4OI0A 5G3ZA 3ZVNA 5AJVB 1MR3F 1RYFA 4DWJA 1EK0A 1JEDA 1M7BA 3GPLA 2HF8A 2RB4A 4Z1MD 4M1MA 3QUSA 2FMXA 2QL6A 4D26A 1P6XA 1AS3A 2Z0MA 3LO5A 1FZQA 3JZAA 3AVXA 4LHYA 4A8JA 1W36D 5AR1A 4HLUC 2ZPTX 4EUNA 1XD9A 4EFNA 1XEXB 2VIIA 4PC7A 5J4YA 2PZFA 4WZAE 3TAHA 2A78A 2J59A 5CYOA 4KAXA 5K8IA 4FCTA 4URZR 5FBVB 3IIKA 3CW2A 5FH9A 1TEVA 1HE8B 1OXSC 4D0GA 4KITB 2ANCA 2ZR9A 1W0KA 2BEJA 1E2JA 1HUQA 2XITA 3CONA 4GSYA 5CLQA 3B6EA 1CS4C 2JLQA 4BRWA 2DBYA 3WYFA 2YOFA 2ZSFA 3R8FA 2AFHE 3RWMB 1CJMA 4PX9A 1P61B 5F2EA 2ZJBA 3RS0A 3FB4A 3U7EB 5KU1A 1T0JB 1SKQA 1S8FA 2Q3HA 4XVUA 2QROA 3FMOB 4PC2A 1YZQA 1A1VA 4IOKA 4B43A 1SXJC 2BJVA 5JECA 1CJKC 2OCAA 1ZD1A 3GCGA 3LX5A 3ZDQA 3F3YA 2XB2A 3P4XA 5FTKA 1N25A 1OYYA 1ZJ6A 4TYYA 1P9RA 3V9PA 5FPTA 2CCGA 2ERYA 4RFSB 2XTNA 1LTQA 1D2MA 2JDIA 4Q4HA 1VDZA 4RD3A 4ABYA 3AM1A 1XRJA 5LBIA 4Q1CA 3U6BA 4L8GA 4AWXA 1N6KA 2ZR7A 3CRMA 2V6IA 3EG5A 4JLKA 4AYTA 5F9HA 3THWB 2ATXA 1KMHB 4A9AA 3FPAA 3IHWA 1HT2E 1II9A 3WNBA 4HLQB 3WMFA 5FL7D 1E1RD 4BEJA 3LW8A 3AVOA 2AN9A 4OK3A 2J7PA 4XSGA 1DAHA 2UZ3A 4LJ6A 1US8A 1A7JA 2KWIA 5JWRA 3IIMA 4NL4H 3QI2A 1VG1A 4FIDA 3LAWA 2RH5A 2GJ8A 4YMVA 5AUOB 1U90A 4JS0A 4LJ5A 2ZJAA 4OI1A 4RKEA 2NO1A 4IW3B 3F0TA 3R20A 2XAUA 1G8YA 3OIYA 1KSGA 3T61A 5FOXA 5HR5A 3FE2A 3GEEA 1UEIA 2KI5A 3ZIAA 1NIPA 2VSXA 1CEEA 4B2PA 4M22A 4B75A 1KMQA 4B33A 1Z0FA 1KK2A 4M1TA 4MH0R 1QHXA 4HI0E 3EXAA 2FF7A 2FSGA 4P4SB 2GK7A 4B6FA 3U4QA 5A5GA 2WWHA 4WAUA 1X8KA 2VSOA 4HB0A 1AZTA 2V8OA 2QRZA 4UKDA 1FP7A 4ZDIA 1MO4A 3REFA 2G1KA 1AIPA 4WXPA 1II8A 1W47A 2ATVA 4R2IA 4BZQA 3IEVA 2CMKA 2FV8A 2W0MA 2QG6A 1F2TA 4DVGA 1OH7A 3LBNA 5FPSA 4FINA 4HZIA 3W6PA 1KO5A 4BLSA 2C2HA 4R7ZA 1EXMA 3IGFA 3L0OA 4IXMA 1ZIOA 2CVHA 5KHOC 1R5NA 1SVWA 1TQ4A 3CX8A 4XTRA 4NYIR 1Q57A 3GLIB 1U99A 2ZAMA 2JDID 1OFIA 1OB2A 2QMHA 1OB5A 4ZI3A 1US8B 2ZUBA 5J4HA 1F2UB 4MYCA 2CJWB 4U00A 1QF9A 3QXCA 1AQUA 2VF7A 3N2EA 4R2HA 4C2UA 1SVKA 4XSHA 2FSFA 2NIPA 2OUKA 1NVVR 3RRZA 4A15A 4DXAA 4JMPA 2CVFA 4JT4A 3TR5A 4G5RA 3CUEF 2QT0A 4CRWB 1UAAA 1XBTA 4OJKA 3B9QA 1OIXA 4JSTA 4M0LA 4DLRA 3H84A 3U7FB 5GVRA 3X1YA 3OIWA 2ZE6A 4US2R 2WIBA 1I4TD 5KSYA 3H1TA 1WBBA 5JJLA 3ZYCA 2SHKA 3UXMA 1H8HA 1VIYA 2YWFA 4MRPA 5D3QA 1LY1A 4DT1A 2IK8A 1MO5A 3RS2A 3PITA 2ZRGA 1TQ2A 3KJHA 3PUWA 1QHIA 3Q5EA 4L9SA 1VTKA 2QPTA 2ZRDA 3LDAA 3ZQJA 1JAIA 2R6CA 4BFXA 1ZIPA 4F92B 4DLTA 3U44B 1CR0A 1OFUX 4AYWA 1MOZA 1GTVA 4QXAA 4DCUA 5BN3A 4LBWA 1UKYA 2JEOA 4G3XA 4A0HA 2QUZA 2P6NA 1N5IA 1C4OA 1ZUHA 2WSMA 1QHYA 3IBGA 3LBIA 4MGYR 1PUIA 1UM8A 2VPPA 3BD9A 2A3RA 4CT5A 2IS4A 3RHFA 2YWHA 4Z1MA 2X2EA 4MGIR 2JLYA 2DHRA 2F3RA 4H1UA 2R62A 2CHVA 4W7SA 1KI6A 1VIAA 4BWYA 2KSQA 1D2EA 5E7MA 2ZANA 3UANA 5FL3A 3AP1A 1S4QA 4EKDA 4LYJA 3K70B 5FL7A 1XMIA 4LC0A 2QGZA 2IHBA 1Z3IX 1OHHA 3I5XA 3DEFA 3GP8A 2OLJA 1R8SA 1XEXA 5IK2D 3GFOA 1YQTA 4P4TA 4B35A 1OJLA 4TLCA 2WMNB 1E9CA 2JCSA 1W4AA 2F9MA 2ZE8A 2DPXA 2G9NA 1NVWQ 5C4GB 1ZAKA 2OILA 4DSOA 2Q3MA 3PUYA 2VP5A 1FW6A 1B0UA 2Q9CA 1F6BA 3WY9A 3W5IA 2OT3B 4EPYA 2WJYA 2GAOA 1EWQA 4UNPA 1OH8A 1U8AA 3BFXA 3ADBA 1ZINA 2YC4C 2ODWA 1E79D 3B7GA 2C78A 4LHVA 4ZDKA 4URXR 3QF4B 1KDRA 5IHPA 1TU3A 2WJJA 5CDFE 4X8MA 1YZLA 4P4SA 3UIEA 1IXZA 3VKWA 3U4QB 4MRSA 1GSIA 2F1JA 2WOJA 4IDPA 4A92A 2WJGA 3QVVA 1KOFA 4TYPA 1W36C 2RGNA 2O52A 3RS3A 3R7WA 5HCIA 2HF9A 4CEIB 2J5XA 2EVWX 3U3MA 3ZS8A 3TSOA 1MRSA 3RS7A 2HYDA 1J2JA 4ASUD 4A2WA 1YZTA 2FFHA 4URYR 3IUYA 5KTYA 4ARZA 1Z6GA 2OFWA 4TN1A 3X1WA 3T1OA 1PV4A 4HLCA 4QGFA 3IO5A 3SBEA 2HYIC 3KDSE 4N3NA 4NONA 2ZYUX 2RKOA 4Q4AA 4A0GA 4EDHA 1F48A 1U8ZA 2P3SA 2C04A 1QDEA 1EFRD 4UNQA 2GDJA 3SBDA 3TUIC 4AG5A 4DDWA 2RMKA 1GNRA 3CNLA 1X1RA 3TW4A 1G6HA 1WE2A 2OESA 2GEDA 2VA8A 3LRPA 3ZZUA 3Q5DA 3X1ZA 3I8SA 3I8XA 4LSGA 1UKEA 2JASA 2GILA 3UK6A 1E98A 3D31A 5EXXA 1NLYA 1XU4A 2AK2A 1HURA 1OKKA 1SXJD 4B6EA 1KSFX 4Q19A 5DIFA 4HAWA 5JZVA 1E2MA 1U2RA 3THYB 3LQQA 1PJRA 3TKLA 3QSYA 4EPRA 4MA4A 5E4FA 2HT1A 4NYJR 5DYIA 1KDPA 3U60B 1NN3A 4WOPA 3VX3A 1NVVQ 1ONBA 3AKDA 1T6NA 3BOSA 2WMOB 1G8HA 4F38A 4DZZA 3AKCA 4B32A 3O8RA 4ZIRB 3DL0A 5G3YA 5FOUA 5BYJA 1G19A 2OV2A 1GNQA 3H0KA 3NVAA 1D6JA 2Q3FA 1JB1A 4AG6A 1BYUA 1X3SA 4MRRA 1QHNA 2QSYA 2VTKA 3SFVA 2WSSD 3W3ZB 4E5UA 3ADKA 2GHIA 3BB3A 1NKTA 2EFGA 4KU4A 2XXAB 3SR0A 4YMTA 3P4YA 4RKFA 2O8CB 1N6HA 4EPVA 1GRNA 1CIPA 2G77B 4HAVA 4AIIA 5TVKA 3M6AA 4W9MC 1FMLA 2BMEA 3NTUA 4W5JA 3VKHA 1BIFA 2QTVB 3E1SA 2Z6VA 4RD4A 1G3QA 1DVRA 2HXYA 3KQKA 4TZ0A 4DLZA 3E2IA 2Y8EA 2FNAA 1NSFA 1OH5A 3J81k 3WHKA 5SZJA 2EYUA 4FMBB 1G3RA 2PMKA 3JZMA 2A5DA 4MYTA 5DLQC 4YXWA 2F43A 4D2IA 3QE0A 3MCAA 2C8VA 2VHQA 4PC6A 5KDLA 3KL4A 1NMZA 4HB2A 5HE9A 2XNDD 2NO9A 2FG5A 3EARA 3N2IA 4AK9A 4DDUA 1P60A 2V7QA 3MJHA 4HZUB 4XD7D 4DC9A 1U8YA 3VR5A 4DIEA 3RLFA 2QP4A 2HXSA 1IN7A 1JQLB 1RW4A 1T8UA 1TEXA 5K8TA 1FP6A 2NMVA 5AUPB 4DLVA 4Q7MB 2R6FA 4G5GA 3CPEA 1YZNA 3EPKA 2GJSA 2YWEA 3OFNA 1Q1BA 1E99A 2P6UA 2FOLA 4HEJA 5CK4A 5BW8A 1Q3TA 4JT2A 3VTKA 3HPRA 5HCNA 1JI0A 3I5YA 1R0XA 2ODBA 3HYTA 4TYWA 3KB1A 1BMFA 5CM9C 1HH4A 5EJEA 4LPSA 1G6OA 2IF0A 3EWAA 4IHQA 5AJZA 1U0JA 3KTAB 2XZOA 2ZJOA 4KYIB 2FFQA 4V0ME 4B76A 3FDIA 3C41J 1E2FA 3KKMA 3Q8XB 3GMTA 1BS1A 1OW3B 4MUBA 3GLFE 1T5IA 2GBLC 3LLUA 3TW8B 4BFUA 3EZFA 3UWKA 4NDZA 1E4VA 2J7KA 1AKYA 4F7WA 2IW3A 4CEJB 5KYKA 3LFUA 5E95A 3SOPA 4EJSC 3QY0A 1W48A 5J47A 4L15A 1P3JA 1KYIA 4QGAA 3LW7A 4Q1BA 5K8UA 1JR6A 1OSNA 2X77A 4Z8XA 1XZQA 2PLFA 5JEEA 4HATA 3TUJC 1ZNYA 2C98A 4Q1FA 5H1YA 4HUQA 2A5YB 2IYLD 1T8TA 1XCGB 1R10A 2FX3A 5B30A 4LGMA 2EYQA 2GCPA 4TL9A 3T5DA 1GL9B 4D25A 3HYRA 5DI3B 1ZM9A 4QC2A 4JL5A 4GT1A 4NP6A 1LNZA 3TLXA 1R6BX 1UBCA 1ZC3A 2PEYA 3I72A 2XSZD 2OBMA 3SYLA 2O0HA 4IXNA 4KJZA 3HR8A 521PA 3KQUA 1OV4A 2FH5B 1LV7A 2GZHA 1Z2AA 4AURA 3X2SA 3UG7A 3AH8A 3CRW1 3F5FA 4BEBA 1EG7A 1GWNA 2WV9A 3QKSA 2CLCX 1T5LA 2QMEA 1FFHA 2HJVA 4U02A 4C0HA 2ZRIA 2WVJA 1KO8A 3W34A 3OFND 3TVDA 3ZZTA 3T35A 4GBMA 3SJAA 2JGNA 1C9KA 4QBIA 3IHLA 2G0TA 1E9AA 2WAYA 3ZD7A 3NH6A 4JIMA 2O8FA 1NP6A 3EWSA 4XD7A 1A2BA 1KI6B 2GRJA 3K0AA 3K0FA 2D2EA 4HAYA 4LV5B 3FOZA 3LY5A 4KFSA 2ASEA 3AF0A 3A36A 4I1OA 3W9YA 1OF1A 3B60A 5FUWA 4V0NA 3SEAA 3BERA 2O0JA 3B1WA 3RC3A 1P62B 2XGJA 1OFHA 1W36B 1XJCA 2H92A 5D3MB 4ITRC 1X8LA 2H18A 1J8YF 4POAA 1N3BA 2ZYWX 1OH6A 4TYQA 4EPWA 3FGNA 4OHZA 3NXSA 4Q1AA 1E1QD 2GA8A 2QU8A 5FBQB 1A5TA 1Z0AA 3T5GA 2RGXA 4JBYA 1RZ3A 5LPNA 2JA1A 3PVSA 2REBA 4V0OA 1Z07A 4JYCA 4DRZA 5C1BA 1GITA 4DB2A 1UADA 2PT7A 3PQCA 4Q21A 2ZS8A 3AGQA 4OHVA 1JALA 2ZRPA 1T91A 1Q0UA 5KSZA 4FXPA 1FQJA 1T3SA 3OF5A 5EP4A 3SI7A 4FI3C 4AI6A 4D4KA 2OO7A 2WICA 4Q9LA 3W6NA 1E6CA 2WJHA 3RANA 2HCBA 1ELOA 5JFGA 1KI9A 1BO6A 3BORA 5P21A 2D7CA 1N6PA 3RNLA 2J45A 4OQLA 4E09A 4C7OA 2BBOA 1DG1G 4JL8A 4PQFA 1XMVA 2WOOA 4DSNA 5J4KA 3GQBA 4V02A 3U7GA 5CJPA 3UMSA 2W58A 1PLKA 3AKEA 3RABA 1GUAA 2UKDA 4TSFD 2GJKA 2GCOA 5FR2A 4OQNA 1F3OA 1NI3A 3VHLB 1OXUA 1QG4A 3JVVA 2ZI9A 4NYMQ 1NN0A 2QTHA 3LX8A 5F9FA 3QXHA 4IFBA 2F3TA 4PO1A 1SULA 1E9FA 5KOYA 5G53C 4G5QA 1XPOA 1L8QA 4YMSA 1IBRA 1DADA 1G9XA 4PSVA 2P5SA 4JBWA 1JAHA 4PPQA 1P2UA 1SVSA 2WM9B 2D7DA 4NPHA 1D5CA 2J1LA 1JEEA 1QZXA 3L43A 3K9LA 3SZRA 2YOHA 4CIDA 1W4RA 4QJ5A 2I4IA 4TTPA 3FHCB 4P0TA 2XNDA 1GIAA 1IONA 1IOZA 2ZJ2A 3VR4A 2A7QA 4PC1A 2FDCA 2ZI7A 2GWHA 1ZD9A 3OEHD 1QHHA 4D6PA 4V0KA 3QKTA 3SHFA 3THYA 2QT1A 3CRVA 2NG1A 1W44A 2IS2A 1OLOA 1H8EA 1S9DA 1M1YE 4B3CA 4DLSA 4X8LA 5DYGA 2XJ9A 3ETLA 1Q21A 1G64A 1W4CA 3EZ9A 3NC1C 4D4LA 2PT5A 1RFLA 2NO0A 4HLUA 4URVR 3U5ZB 1XB2A 5ANRB 1SHKA 3G82C 1Z5ZA 4FWTA 3ZQ6A 1G3MA 4QRHA 1MV5A 2J41A 2X19A 1TL7C 2FGJA 4GI7A 5C2JB 5JEDA 5L3QB 4IVPA 4FW9A 1P2TA 3B82A 2QM8A 3IILA 1TQ6A 5DGXA 1MABB 4QKQA 4DIDA 1CTQA 3PXGA 1UDXA 2IF2A 2K5UA 3QXSA 4ARZB 4RD1A 2IYZA 1II0A 2NQ2C 4RZUA 4EJSB 2ZS9A 4JVMA 3HPQA 5CITA 4PHFA 1E0AA 1VG8A 1II8B 3DM9B 5LD2B 3AVWA 4RZ3A 3N70A 4P3YA 2VP0A 4V0LA 4BLRA 1GOTA 2CCKA 4PHGA 3ZVLA 4XWKA 3ND9A 1S3SA 3ADCA 3JVUA 4GOXA 3WP0A 2ZUCA 5E3HA 1EFHA 3B2EA 1KJZA 2E87A 5DHAA 3TH5A 1G7TA 2V6JA 2GCNA 1AM4D 4IDOA 4PC3A 5BWMA 3GLIA 4P32A 1VG0B 2N46A 2AR7A 4RZ2A 5E7IA 1SXJA 4QFMA 1OKKD 3ZH9B 1U0HC 2J87A 1AKEA 1Q3HA 2XZLA 5FR1A 3EW9A 5EE1A 4DDTA 1G291 3KKQA 4E07A 1KNQA 1RKBA 5SZIA 1E2KA 5E7JA 2OXRA 4IEIA 2EU8A 3FKQA 4PFSA 4WW0A 3RRYA 2GK6A 4OK6A 3VR6A 1FUUA 4ZV4A 4LHZA 2FPKA 4C2TA 3QF4A 1R0WA 2QAGA 4B74A 4LWZA 4M21A 1Z6AA 2WIAA 4IVRA 1FL9A 1T3LA 1WP9A 4PAQA 1TAGA 1E9DA 2BVNA 3CR7A 2WWIA 5EXTA 4HYYA 2RGCA 3IBYA 1H8HD 2ZS7A 1OYWA 3AQ4A 4L5BA 2QM7A 1Q44A 3WBKA 2I1QA 2ORVA 1E9EA 5KUTA 3R9IA 3AUYA 2C9OA 2PMDA 4LCBA 4Q4JB 1AS0A 4O0MA 2OHFA 2OCPA 2DB3A 3K0FB 3K0AB 2QNRA 1CP2A 1W1WA 2D4HA 1G17A 3OZXA 1ZCBA 2ZAOA 3K1JA 1KY2A 3O47A 4XTCS 4QHSA 2V54A 2BOVA 1P9NA 1MRNA 1JQJC 2ZJYA 4I1UA 1YRBA 2FU5C 1T4GA 2XX3A 3EZ7A 4N0DA 4RCZA 1XMSA 4C0JA 2ZYVX 4NCKA 2NZ8A 4OKSA 1Z08A 1KK3A 4ACBA 1K8RA 1T0HB 2EQBA 4I4LA 4JYBA 3Q72A 1G3UA 4YONB 3ZZ0A 2ZRAA 1NN5A 1FX0B 1ZNWA 1I2DA 2AWNA 2EFEB 2RHMA 1Q20A 2B7BA 2GZDA 1M8PA 1DO0A 1IN6A 4JLBA 1K5DA 3WNCA 3THWA 3HU2A 3K53A 4ILEA 4ZI2A 3VMFA 1RRGA 3TE6A 3MMPA 1CJUC 1KO1A 4L16A 1G21E 3WMGA 5DISB 3KB2A 3KKOA 4D4JA 1E9SA 2ZSDA 1Q1EA 3NBZC 4HB3A 3T12A 3B9PA 4HAZA 5FUXA 2YNMA 4PO8A 3WXMA 5KNCA 3SJBA 4DJTA 4F4IA 4NE2A 2X2FA 4XIGS 1ZM4A 1BMFD 1R5OA 2C95A 2UZIR 4RJLA 3Q9LA 4TTQA 1E2GA 3SYKA 2OEPA 1YRAA 2BCJQ 2DFKB 4BZPA 3B5JA 3A4NA 3CWQA 1O3YA 2D2FA 2Q0HA 4I1VA 5FOTA 1RRFA 2C77A 1XJ0A 2DWOA 2C5LA 2Q6TA 2GEVA 4JKIA 2VLIA 2QPAA 4OK5A 4RFVA 3KJEA 1QHHB 3P20A 4PANA 3IQWA 2BBSA 4A2QA 1E2LA 3HR7A 1TQDA 3CIOA 3FWYA 3AVYA 1DTSA 4BLOA 1YR8A 1E2PA 4IDNA 3QPVA 4S2EA 5CK5A 1OFTA 4HAUA 2R44A 3UMFA 3AEZA 2B8TA 2QE7D 4A1FA 3KX2A 2XNSA 1IM2A 3OE7A 3QF7A 1XPUA 3RC8A 4D0LB 4IFEA 1BKDR 1NRJB 1R0ZA 3CPJB 3SYNA 2JLXA 2QN6A 2Z4RA 2ZRCA 2NGRA 1JR3A 3C5HA 3DM5A 1XXHB 5L3QA 2O8EA 1SVIA 3KQNA 2BC9A 4B3GA 2P2LA 2V1UA 3NDBB 2UVQA 4AKIA 2ZI4A 4ZKEA 1Z6XA 3MWYW 2FA9A 1DAIA 2FSHA 4NH0A 4CT4B 1P2VA 3CB4A 3RDPA 4TLAA 1F5NA 1Z29A 1UBEA 1J7KA 2X1VA 2WSSA 3K9HA 1FPMA 1ANKA 1XZPA 5A4JA 1W4BA 3K09A 1PUJA 3U3RA 3Q7QA 4JLOA 4DLYA 4NKRA 1GKYA 5JS7A 3GJ8A 4DSUA 1R5BA 2IYWA 3MFYA 1HEIA 1H65A 4NTZA 3VNVA 4D82A 3L0SA 2D74A 1VCNA 3GJ6A 2IHYA 3W90A 3N5CA 5C46F 4QGHA 1D2NA 3E5HA 4BLPA 1E2EA 3AF4A 4JL6A 1W0JA 2H16A 1U94A 2QMOA 4B3DA 2AKAB 1Y3AA 3LH5A 3O8DA 4B34A 1W49A 3W6OA 3I4LA 1IAQA 1GNPA 2DCUA 1XEWX 1Z8FA 4Q4HB 4OHXA 4C3ZA 4LI0A 4JSYA 4MITA 5DN6A 3QEJA 4MYHA 2JIZA 2J9RA 3FMIA 5TXGA 3U3JA 2FPLA 2VO1A 3LXXA 5J5CA 4U7DA 2QI9C 3LA6A 3NBFA 1Z63A 1IJEA 1IXSB 4YXWD 4TMTA 5J4LA 2IYUA 1MH1A 1Q1QA 2VEDA 4B48A 1F2TB 2AD1A 3SHWA 2P0EA 5FI1B 5FUYA 3T34A 1JXOA 4JLMA 1Z22A 3NBYC 2OFXA 1AJEA 1B23P 2JJ2A 3VU9A 1Z6YA 3P32A 2J0QA 1VCOA 1I4DD 2PZGA 1G16A 2W6IA 3MD0A 3X1XA 1NLZA 3AVTA 3NIBA 2O8BA 4Y0AA 3KZ1E 3BH6A 2ZTSA 3TK1A 1NBME 4Q4AB 4JLVA 4LX0A 4TL8A 3T1TA 2OG2A 3GLIE 2Z5FA 5DH9A 4Q4LA 2ZU6A 4IOMA 4JLAA 4JJZA 3QPUA 2J0UB 4LJ7A 1UKVY 2GJAA 2V55B 1Q1ZA 2JJ1D 3EIHA 3FKSA 2GNOA 4PHHA 4DUGA 3HU1A 1EWRA 4DLUA 2YKGA 4ZCLA 1XTKA 4MYUA 4PXAA 1HY3A 1LFDB 3GFTA 2P65A 3HJNA 4Q00A 1XNJA 1G8GA 5DHFA 1N6LA 3PEWA 2IBMA 1Z0DA 1Z0IA 2FWRA 4JVLA 1JR3E 1E2HA 4TQUS 5FTLA 3PUVA 4NHOA 4RVCA 1W0KD 4Q66C 4MRNA 3A1UA 4AC9A 3IEUA 1NNEA 1ZNXA 4A36A 4ZCIA 3CKLA 1XJQA 3MRSA 2JLSA 2KE5A 4R71A 1VCIA 2NPIA 2N1BA 2WAXA 5AJWA 2BCGY 3AP3A 2ORIA 2LWIA 4IOJA 1RRCA 4BZXA 2QAGB 3T1VA 2ZJ8A 5JRZA 2CJWA 1NG9A 1G1MA 5KNDA 4G1UC 5DN6D 1VCMA 4RFSA 2ZETA 3ZVRA 4BFWA 2V1XA 5JSZA 1JECA 3I32A 2IYSA 3MGCA 3GLFA 2QBYA 4Z54A 4XWOA 621PA 1ZW6A 4DCVA 1WA5A 1XXHE 2RAPA 2W83A 2WPDA 2O8CA 4V0MA 1KNXA 2Q21A 5G41A 1KJYA 1GP2A 1W0JD 3S1AA 2IS1A 3TNFA 5CB8A 1AGPA 2EW1A 3HP1A 3TIFA 4Q7JB 1ZC4A 2WWYA 5GVSA 2ODEA 1XTIA 4DEXA 2B8WA 1GKUB 5CIQA 2FEOA 3NKVA 2HEIA 4LV6A 1WXQA 4BE7B 4LJ8A 5KPJA 3FVQA 4AYXA 4IKEA 4B2LA 3P26A 4L4UA 2VL7A 3QKUA 4LY6A 4TL7A 4KHZA 1IN8A 4UXHA 5KDDA 1R2QA 3VKGA 2D06A 4DCSA 1GRQA 1DO2A 3A37A 4OI4A 3QIAA 3KKPA 1SVOA 4R9UC 3KUCA 4NMMA 1SVLA 2FZLA 4B47A 4PHTA 2VP6A 1XD2B 1NBMA 3O8CA 4X8OA 3LD9A 3TUZC 2FJUA 2GXSA 1EX6A 4EFLA 1M6NA 1NN1A 1TUIA 1TX4B 1GVNB 4AKEA 721PA 1ZYUA 1OIVA 4UNRA 3GLHA 2W00A 4JBXA 2FGKA 3GJ0A 3QENA 4WZ6A 2JJ2D 5HZHA 1UKZA 2F1HA 2OZEA 4LC1A 3GLGA 4KV9A 1G5PA 2Z83A 821PA 3IIJA 4M9XA 1N6NA 4RCYA 4PSKA 3TBKA 3LBHA 4EQ6B 2Z4SA 1NIJA 1KMHA 4XJXA 1VPLA 2BHRA 4M4SA 2DFNA 1GFIA 2HDNB 1QVAA 2ZJ5A 1EFTA 1OXXK 1CR2A 2H8KA 3KXIA 4HZUA 4EIWA 3MG9A 3TQCA 3BXZA 3GJ4A 3R7WB 3A4LA 2ZU0C 6Q21A 5LDDC 3PEYA 4TMZA 1ZCAA 1DARA 3FYHA 4EPXA 1FMJA 1RVDA 5AJYA 3VFDA 1PVOA 3L0IB 1EX7A 1XTJA 2C9YA 3F8TA 5B2ZA 2C9CA 2IUTA 1ODFA 2ZRLA 4BLTA 4PZLA 1LVGA 5BN4A 3QNUA 1XCMA 4TLBA 3I73A 2VHTA 2YWGA 4GPTA 4HDQB 5EXPA 5DO9A 1AA9A 4LYFA 2OBLA 2IEZA 2VF8A 3GJ7A 1CR1A 3WP1B 4KBGA 1J8MF 1Z0KA 1DS6A 1X86B 2VP4A 1IN5A 3BIFA 3A1WA 1YJ5A 2J7PD 3LWNA 2XOKD 4ERNA 4BASA 2PH1A 2F1IA 1ZVQA 5FTNA 4YQFA 4UXIA 1RIFA 1BOFA 2VHJA 3G5UA 1SGWA 2MSCB 2QQEA 1TPZA 3MAAC 3ICEA 1MT0A 1KY3A 1G7CA 2GBLA 5HKKD 4RZXA 5H68A 1AGRA 3QXJA 4AKHA 2ZXUA 3C16C 3IO3A 2PJRA 1IJFA 1CBUA 4KXFB 1SKYE 1DBSA 3REGA 1VG9B 3Q7PA 1X8JA 1M7GA 4DCNA 4TL6A 4X8HA 3GEIA 121PA 2LCFA 4BLQA 2BKUA 1BH2A 2EFCB 4YMWA 3SDZA 5EUQB 1FNNA 1E94E 4OHWA 3LVRE 2AWOA 2ERXA 5HKKA 5CIWA 3D3QA 4TTRA 2GF0A 5L3SB 1MO3A 3OE7D 3B1XA 3B13B 4V03A 3B1VA 2XZPA 1KGDA 2DR3A 3UWOA 3W8NA 5KDOA 3ICQB 1QHGA 1R4AA 1L4UA 3AKYA 4CDGA 2ZSEA 3LLMA 3U2QA 2ECKA 3LXRA 5LD2C 5CJ2A 5FFMA 2ZJZA 4FWIB 1G4AE 4CF7A 1HE1C 1KK0A 4WBSA 3RSLA 4QJ4A 3A1SA 3CZQA 4KSCA 1G4UR 2FEMA 4GMDA 4N0EA 3QG1A 1W5TA 5KPDA 3U3KA 3RS5A 5JHHB 1W46A 3PCRB 1YVDA 3WRXC 2XTMA 2WZQA 3ZIAD 2WKQA 2QQ0A 4AD8A 3WYGA 5AUNB 2CHQA 5ELXA 1TF5A 3QQ5A 4PR0A 1SHZA 2IT1A 4LDJA 1KJWA 2MMGA 2R6GA 2RGNC 1KK1A 4CEIA 5EQTA 2CEAA 5FBRB 2F1RA 2DFLA 1KZGB 1QRAA 3DOFA 1HT1E 1KI1A 2QA5A 1SVMA 4GOJA 1ZU4A 3ZVMA 4UJ3A 3RS4A 5EP3A 1T3HA 3CM0A 2AK3A 3CR8A 4DEYA 1XMJA 5BXQC 2O8FB 4A82A 4GFDA 1FQKA 2VBCA 3PV0A 1E1RA 4OQMA 2RGEA 3P27A 1G5RA 3TGPA 1P2SA 1KTVA 1RPZA 3EZ2A 3K0CA 4PSAA 3SFZA 1NF3A 3EA5A 4MQBA 4BRUA 3W5JA 4CZ2A 5FPHA 3FMFA 1NY6A 2ZEJA 4Q4JA 1S0UA 5F3WB 4TMKA 1EGAA 4B3FX 4QNRA 4PZZA 5KSPA 1KI7A 4C0QC 2BDTA 1W2GA 4HAXA 1G8PA 2CL7X 2HLDD 3DVLA 2JJ1A 5JMTA 1TUEA 2IXGA 4BFSA 3SJCA 3KFXA 2R6DA 2TMKA 1QBKC 3DDCA 4JLNA 4LJAA 4QHYA 3ZJYA 4ACAA 4BECA 2H17A 1P75A 2IYXA 2B92A 3H2YA 1RE0A 3CH5A 3MSXA 1ZM7A 2VSFA 1N5KA 3SJZA 4TMXA 2WWXA 4US1R 1DAFA 2W6ID 4LYAA 5JSZB 2VYFA 2EWVA 1E0KA 4MKIA 3PJRA 1P7CA 2GVZC 2FFBA 3D6TB 3OESA 2IWHA 5FOVA 2WHXA 1E3MA 1E96A 1HQYE 4BFVA 1R7RA 2C99A 4EPTA 2BWJA 4EJSA 2ZR0A 2PJZA 1WBDA 3FHOA 2FFAA 1FTNA 1H8ED 4QOSA 4KFTA 1PLLA 2ZI3A 1A4RA 3EIEA 5TDHA 1LS6A 4TYNA 4D4MA 2BBTA 2X8AA 5IRCD 1CULC 1R0YA 2LKDA 3EIQA 4EQ6A 3OEHA 3BH0A 2WPDD 1ZU5A 4DT1B 3A1VA 4AY2A 1S2MA 2Z43A 3QKSB 4LZZA 5TMPA 3ZLJA 1YZKA 3Q85A 1KSHA 4G01B 2IXFA 4KSBA 4OQXA 3Q3JB 2E1RA 5L3RA 1DELA 1I2MA 3B85A 2ZI6A 5TB5A 2FN4A 3TR0A 1DAGA 2OE2A 5AJXA 3OAAD 3EPLA 2F43B 2W2VA 4M1OA 5A0FA 4CEHB 3ZS9A 3C5CA 3QVUA 5KSOA 1TMKA 1Y63A 4UNSA 3A8TA 3GFPA 8OHMA 2WWGA 3HU3A 1Q12A 4ZO4A 2R6AA 1CF4A 1KKLA 4LBVA 4DLXA 1FTSA 2YOGA 4NYIQ 1ZM3A 3CRRA 2IUSA 3NDPA 3GLGE 1E69A 4KFUA 3EC2A 3GLHE 1Z6TA 1XEWY 2W2XA 3TVTA 5KO2A 4ESHA 4JLDA 5FTMA 5UKDA 3TMKA 1E2IA 2RCNA 4GOKA 1GDDA 1XP8A 1CJTC 4KBFA 1WCV1 1KI2A 2GESA 4CW7A 3AGPA 3FKSD 2NO6A 5JBQA 2CNWA 3DOEA 4R98A 4GRAA 1G8FA 1YKSA 4MKHA 4YC7A 1ESMA 4B71A 2WTUA 4LOAA 2BMDA 4I99A 1QHSA 4LHWA 2BEKA 4K8OA 2CK3D 2ZUDA 5JJKA 5EP2A 4FCVA 2B21A 1GL6A 2H1LA 5GJVC 3KUDA 2ZI5A 3V4RA 4I81A 3U6KA 4II7A 3EC1A 2KJQA 4H1VA 2XTZA 3IDQA 3MJRA 4IOLA 1NKSA 1YE8A 4HDOB 4IDQA 4KI0A 4WVFA 5EE0A 2REOA 1CXZA 4CEJA 1JNYA 3AUXA 3ECCA 4OL0A 3EZ6A 3CF2A 2ANBA 2W6JD 2H5EA 5LB4A 3RRMA 4EAQA 3U7HB 2JLWA 4KCGA 2EFHB 2QE7A
chains in the Genus database with same CATH superfamily
3KT8A 4NBLA 3OIUA 3NEJA 3WMWA 3RSHA 4DCGA 3DNMA 4F6CA 2ATCA 5L3VA 3FFXA 3OQIB 2HA6A 1R64A 2GBFA 1JG2A 3HJCA 2XQVA 4XWAA 2F9LA 3N07A 3ROPA 3NWJA 1OBCA 5FUVA 3BIWA 4LRQA 3SNHA 3RM3A 1QNFA 2IOHA 5LQCA 4P08A 2HUPA 3TNYA 5GJBA 3IQGX 2Y2UA 5ALNA 1K6MA 3ULKA 1AK2A 3LUGA 2QD5A 3PC7A 3CUUA 1YCFA 4IIJF 5DI9A 3CVVA 1EX1A 4YRRA 3PTLA 4P5DA 5CEJA 2HXGA 5LP1A 2DUWA 5I7OA 1DRKA 2B9VA 4JR0A 3LCMA 2NZVG 2QRJA 4CN8A 4ER6A 1QQTA 4FZ5A 1B26A 1G5IA 3GARA 5E1BA 1HA3A 1F14A 4N6GA 3ROZA 4AP5A 1KI4A 1YCGA 4JVNA 3OQOA 1S3GA 2XSZA 5A5FA 3VJRA 2PD3A 3CVXA 1XZ8A 3BJEA 4HB4A 1KIMA 4L9WA 4QBHA 1P73A 1PGQA 4D96A 2ZSBA 3AILA 2OYRA 2R4QA 2NT4A 1JKJB 3B2QA 4FJ0A 2A35A 1L7MA 5C8VA 3K70C 1TCBA 5DNYB 2F48A 3FNFA 4HO1X 1SIBE 2PAFA 5IJXA 3QTLA 3TXYA 1JIJA 1SPXA 4HDKA 2PVSA 3HI4A 4G5FA 4ZAWA 3EDOA 5DHPA 3LPAA 5HK9A 1UF9A 3O2JA 1REQB 2J46A 1ZK1A 3WFJA 1GGNA 4UCFA 3ZEIA 1RAGA 2E9SA 1U5CA 3H83A 4KH0A 3A14A 4UUBA 3WLKX 3A6PC 2PXHA 4F2DA 2L82A 3GD7A 3TTWA 1UFQA 1X1SA 2ZG6A 3MWKA 4RZUA 2NV2B 1RI3A 4H7DA 2HQOA 1BA2A 2VHZA 3FFBA 1LF0A 4HBGA 4TTJA 1RNLA 1AGNA 1OZ0A 2XE7A 3OCXA 4YJFA 5DI3A 2J09A 5K3CA 3RVKA 4DSTA 5IMSA 1U6JA 3L04A 1GZDA 2IYTA 2YMLA 4FSXA 3G2MA 3NAGA 1VA4A 2FZ4A 4G97A 5DYNA 3H5LA 1UOOA 2J9XB 5IF9A 1EU1A 1MNAA 3KJGA 3RR2A 1NC1A 1J06A 3VZDA 4TXMA 3HCDA 5CDUA 4MPRA 5H8WA 3ZHXA 2Q41A 3D4IA 4C0AC 1GZ6A 1ZNZA 4AXXA 5HIAA 2W2TA 1UPTA 4BAUA 2YV5A 4DCTA 4GVXA 2LE0A 4L9AA 2P30A 1BQ4A 3UYKA 1Q0LA 3BJMA 5CA0B 1HGXA 1V1RA 3NETA 4G24A 4HN2A 3ZWVA 3G9ZA 2GPBA 2IX3A 1M2OB 2XEXA 1ULSA 4L6AA 3HB5X 2WDZA 2CUTA 2QTZA 2YWXA 4GECA 3BKWA 1YQUA 3MW8A 1U2TA 1RXVA 3MCZA 1OR8A 3HGQA 4ENQA 3RYCB 1JDNA 1HQDA 3E5MA 1VLZA 3M34A 1JT2A 3GGOA 1KKUA 1JKJA 4XDHA 3ZWCA 4EA9A 2FJPA 5KHAA 2A59A 3AHEA 1RIIA 2FUNB 3QWFA 5CR9A 4ALLA 4BP9A 2FUKA 1DC7A 4D6XA 1RXYA 5I8WA 4KSYA 4ALIA 2D1RA 1WU7A 1IRIA 3WV5A 3KJFA 4PGFA 4TQ9A 2JA2A 3PUZA 2Y1FA 3AVPA 4O25A 3LL4A 3ICOA 2AZMA 3MMSA 5EVCA 3RASA 1GKKA 4BV8A 3Q6IA 1G2PA 2IYRA 4CM5A 5JWOA 2NT3A 1CUDA 2W2LD 2V9PA 4RHYA 3HN7A 5IDYA 2NSJA 2WYVA 2GPJA 1Y7IA 3GFFA 4U7GA 5AKJA 4I3HA 2P6RA 2Q1TA 3AUAA 4URUR 4X65B 2OBNA 4OUDB 2ZQYA 4KIJA 4YP0A 1FXUA 5K6TA 2M6LA 5F78A 4RD0A 1CDEA 1FUKA 3DHVA 4Z3DA 5CXUA 1WUKS 1TZMA 1KOGA 2DY1A 5KQGA 1KPGA 2Q0XA 3GEHA 4BNUA 3C3XA 3IR7A 2GX6A 4Q9KA 2CE7A 4F2PA 5TV2A 3CF6R 1G5HA 1JQDA 2G7ZA 4ZANA 2DQZA 3PR2B 2QAIA 1YL7A 1YO6A 3COVA 2YV4A 5AM5A 1RQRA 1TRKA 3DWIA 2CMHA 2OV4A 3M1YA 4OQQA 3OOWA 4NF2A 4B3SB 4UQOA 3BVPA 4FKMA 1PW7A 2LP4Y 3TDKA 2EJCA 3E2MA 3F96A 3G5MA 1J42A 3M5PA 4I55B 3M6WA 3ML1A 5JMOA 2QD4A 3L6DA 4KJXA 2RCYA 1O87A 3O1HB 3H86A 4QPPA 2C2WA 2Z2XA 3AFMA 2WWWA 1EP3B 2JGJA 3K5PA 4YJ3B 1EFCA 3V8VA 4J43A 1EBUA 4XJTA 1PZFA 4R2KA 2B36A 3CN9A 1DJMA 1NYQA 4N03A 4DNFA 1UCFA 4LK2A 2HCFA 4OM8A 2C5BA 3D02A 3DT8A 5GJCA 4U0KA 2XGMA 2IEBA 5AOBA 2GO1A 2BGJA 4FE4A 4V3CA 5GIPE 3BRWA 3AZQA 2EGHA 4G0ZA 1WY5A 1KZ6A 4I1SA 4MWBA 1XDDA 4OSEA 3JYQA 3TLGB 1OI7A 2K6GA 1PW5A 4WTOA 3ONEA 1JLLA 4CM1A 1Z2CA 2E4YA 1N2GA 3DBHA 4BX3A 3KKEA 4M9SA 5DBOA 2FMKA 5H70A 3B53X 2ZKLA 1M6EX 4JT8A 2OG1A 5EGNA 3K5WA 3NNSA 3WYBA 1EE1A 1E6EA 3VAYA 4KC0A 3LOPA 4CUZA 4QU5A 3K9NA 4NJMA 3CB2A 4G0XA 1FOEB 3R7NA 3L6UA 2WF7A 4UTRA 4JC0A 1WUIS 4ZC8A 1DT5A 4W8HA 3QZUA 1MKYA 1L6IA 4FMDF 5FUMA 2CMDA 3CF0A 1YJ8A 1KETA 1BE0A 3C6YA 1E92A 3C85A 2DE0X 1PG2A 4AJNA 3H1GA 1ZSVA 2AKYA 1GT6A 5BW5A 1U2ZA 1X7XB 1ISPA 1HTBA 1QDUA 3IAXA 3AIKA 1VJRA 3OOHA 4LGYA 3QLVC 4EEKA 2B2CA 4MVJM 3GOQA 2RGWA 1KE1A 2Q3LA 3STVA 2JD0A 4FN5A 3ZK9A 4CTJA 2DECA 5IYZA 2IDKA 4LHSA 4QYSA 2C00A 4IEEA 4LAFA 4N41A 3PLNA 1OE0A 3RVBA 4ASUA 2V7WA 4RZSA 1I1QB 5LP6F 3OJEA 2WB2A 5B6JA 1J21A 1L4HA 4ZU3A 5I7EA 1C14A 3TM5A 3HDTA 1NP7A 4QG7A 5A7GA 1KEZA 2C2BA 4YUXA 4HFNA 4IR7A 3NHYA 4M1KA 5LP6B 2P9ZA 2ACEA 1N1MA 2QMQA 3G02A 3I0ZA 1U9IC 1PFQA 1N6RA 1TU4A 1R8QA 3I5UA 4US0R 4B3XA 5K4HA 4XX1A 5DGIA 2EG5A 3AR8A 4FM9A 1ZP6A 3ENZA 4O08A 4QM6A 2OCDA 2YY5A 4FD2A 1U0EA 2WA1A 1CB0A 5LLDA 4BFZA 2B4AA 2G83A 1IVYA 1UBFA 1LDYA 2A86A 2CL6X 3CNOA 2AG6A 2YYYA 4GMXA 5BOSA 4OXQA 1KO7A 3W4JA 2EC5A 4EARA 2EX1A 1Y81A 2A9FA 2GRAA 2GTPA 2WUEA 4IEFB 3FCEA 4TWAA 4X94A 3UMBA 4ENTA 3C8HA 3U4GA 4JBLA 4E21A 2IWRA 3W78A 4FMDB 3X44A 3R5SA 4B46A 2OCXA 2O2GA 4LBYA 2HJ9A 3PF8A 4Q9HA 3TINA 1DEKA 1MO6A 2PEZA 4C08A 3BBPA 4B2IA 1TYAE 3LTNC 3D7KA 4RK7A 1CETA 1YA4A 2I4TA 5HFAA 1SBZA 4DKXA 1TCUA 1AK9A 2I8AA 3IJRA 4UPVA 4BNTA 3VJKA 1Q22A 1TTHA 3LHFA 1E2BA 3UAGA 2AJDA 5JPCA 1PK8A 5DV9A 2X9LA 2VJPA 2X0EA 4YUZA 2B35A 2X2OA 1OI4A 2V6MA 4UU7A 3HCOA 5AIBA 1HETA 1GHTA 5KQSA 2EATA 1YK0A 3DFKA 3KD2A 5KC8A 4N6OA 2FW0A 3ZCUA 1I3NA 4TN5A 3TCXB 1UBGA 2PBLA 1SOMA 4AF7A 2ZUEA 1OV6A 2B1QA 1IG0A 3WJ7A 1Y0BA 2DGDA 4HDCA 2ODNA 2R1UA 3CPHA 3B3QA 3BCRA 3KJIA 4OXIA 3U62A 3DUFA 4MB2A 1M33A 3PBKA 2CXSA 1ZRHA 5CT6A 1UBSB 1Z45A 3KO8A 1KC3A 3MM4A 3SS8A 1P18A 4XIFA 1DBWA 4NESA 3QOFA 1JLHA 3NOXA 4RF3A 3FOWA 1JBKA 4NHEA 5FPYA 1L8XA 4BQQA 1SVUA 1KO4A 1YU9A 3INTA 1ESNA 2PKWA 4J4HA 3RWOA 1TJYA 1VXRA 2D62A 2ZPAA 5T41A 5IDXA 5JCZA 4Z0TA 1ES9A 1AHPA 4CWAA 3J81A 2J30A 4LNHA 3Q3EA 2H9AA 4LXHA 5LDGA 2FEPA 2VSNA 3VPCA 1M0WA 2DPMA 2VSYA 1WMSA 3L1VA 3NALA 4K6KA 4LMRA 3T7CA 5SZKB 3ROFA 5LQMA 1E6WA 2GM5A 3ELDA 4MV7A 421PA 1G7SA 3ADDA 3EGXB 1W0CA 5AK0A 4AU1A 5IXSA 5IARA 5C3UA 5CDFA 1I2BA 2YUTA 1DX6A 3PNQA 1NF9A 3L02A 5KCMA 5AQEA 4YQYA 3DCYA 3HYSA 4P84A 3ZHCA 1BGWA 1L4KA 2F3PA 2OCBA 4NCIA 2D3WA 2VDJA 2NU8B 1DDGA 3SHTA 4NRDA 3WFZA 5B2FA 3RBZA 3VU8A 2K4MA 3H3FA 4MI9A 2JLUA 1AUQA 1XEAA 1SWVA 3OP4A 1SCBA 1UZAA 5L3ZA 3UG6A 2PUFA 2VAXA 4C3OB 2TYSB 4PZUA 3BL5A 1PRYA 4CEHA 1H9CA 2VRWA 1OIWA 1ESCA 5DTEA 1ODTC 2NTVA 2OZVA 1N9GA 1LXCA 5FWDA 4QG3A 2IV2X 3IPXA 2CE2X 4MQMA 3DE6X 1PGOA 1ZIXA 1TT5A 1AF7A 4GPAA 3R5TA 3BXXA 3WIEA 1ZD3A 1OVMA 1E4YA 5IK2A 2HJRA 1O57A 3ESCA 4KQKA 1FMTA 3JD2A 3PA8A 4M87A 1GPAA 4LOHA 1P9LA 4QO7A 5JLAA 3VNBA 1GZ7A 1QAMA 1OD6A 2MTBA 3LDGA 2PX2A 5JANA 1SCQA 1J8QA 4CKXA 4EJ2A 4PPNA 2QORA 3RBXA 1XI2A 1Y4UA 1S7CA 5EE3A 4YX9A 5BV8A 1M1YA 1HM5A 2JVIA 3TAUA 2XOXA 3U31A 4RLFA 3GLGB 2FN9A 1X7HA 1C7FA 2YIVX 3CH7A 4I08A 4EL5A 4B3HA 4ZK6A 2HSJA 1PT8A 1I2AA 2HA3A 3FNBA 3RSSA 3UMYA 2CHUA 3ET4A 1L5FA 4DW8A 1OWLA 2C03A 2NZWA 4UOQA 4GLBA 3D8RA 3SIRA 1IHUA 1SKBA 1GGMA 4INAA 3N53A 2G0NA 4I4TF 1S3IA 1T9ZA 3MOSA 4GYJA 3HR4A 2BMVA 2QTAA 3HNRA 4FR2A 2A9QA 1SXJB 4WCFA 5BPFA 4N7RA 3PYXA 3GVIA 1JJIA 4JI4B 4MRMA 4ZHSA 2OXCA 5NULA 4QUIA 4F06A 1IFXA 4L7QA 3WQRA 4MZDA 4M9QA 2WWFA 3NPAA 3B1YA 2QBYB 1J1ZA 1ND6A 4JJGA 4P4UA 1F5SA 4RVDA 1EXVA 2OAP1 4OJQA 2O8DB 1I5RA 3IAM1 3JVDA 1UZNA 1FYVA 1G59A 4DDMA 4XWGA 4DPKA 4MKFA 1P31A 4LWOA 3UGKA 3EUWA 1WXIA 3SU8A 4YR9A 1QKKA 1WZ2A 4JLUA 3VOAA 1VMIA 2YJTD 4M88A 2Q8PA 1QQ5A 2BBWA 3CLRD 3NVDA 1OLSA 3VHXA 2OAQ1 3DEHA 1W7AA 3STXA 4WGGA 3AF1A 1D2AA 4Y6SA 1G18A 2VHCA 2JBAA 3M5DA 4G0PA 1AKWA 2ZYAA 4YI3A 1RMQA 1JIVA 4F6RB 1CZOA 3FFAA 4Y6OA 2VPIA 4YCBA 1BNCA 1BX1A 4BPBA 4HQOA 1E5TA 2XPCA 1RRVA 4XVRA 2CBZA 3KYBA 1MIHA 1VI2A 5J5AA 1L4YA 1OC4A 5LXTB 2PGJA 3LUJA 3QBVA 4D9JA 3LVBA 3NHLA 1DAEA 3O4RA 2VZ9A 1VMAA 1NVGA 1FUYB 4TRJA 2B3DA 4AWAA 1RSZA 1T0PA 2VXCA 4BQIA 1RQXA 4XFDA 4BVGA 2FW8A 1CRQA 2O4UX 1U3UA 2AI2A 2HH9A 3ZHSA 1M66A 2PO7A 2DWPA 2VJKA 2ZE5A 2M1ZA 1L1RA 1Q0SA 4DM4A 2V03A 4G5SA 5A1JA 4UVGA 4WBXC 2C0QA 2Z2JA 4DNOA 4E51A 1WF3A 4O4IA 4E7OA 1LS1A 3DTVD 5JCPA 3THXB 1NNI1 2A5GA 1E7WA 5JS6A 2TMDA 3HNOA 1XYGA 5KMGB 2BEUB 3BWDD 3PC4A 1S6YA 4C6HA 2JVJA 2IL1A 4XFJA 3R9WA 2AVDA 5HYVA 3HKEB 3KUKA 2I99A 3CWCA 4G0MA 2NV6A 2EF0A 3KFVA 3ND8A 4KVAA 2D2VA 1A82A 5H81A 1M2VA 3FVVA 3D5QA 5IPFA 2MINB 1P72A 2J4CA 2QL9A 3PNOA 3UGJA 1KDOA 2ZTHA 2UVPA 3E4CA 3NM6B 4FR0A 3BGDA 1E3IA 4LMBA 2QRNA 4CMCA 5G4LA 2DH5A 2G6BA 2CB9A 2I4OA 5IN5A 3IE0A 5LQAA 2APJA 2A9KA 2C96A 4L4YA 5TC4A 4ZI7F 3KEGA 5BYAA 3C15C 5EXSA 3C5EA 4OQFA 4F3YA 4D80A 1NZDA 4RZQA 3A26A 3M81A 4UU8A 2KX7A 3TZEA 5FUQA 2JLAA 4C22A 4OFXA 4GXTA 3VU9B 2CNNA 2ZCVA 5JAPA 3K5HA 9ATCA 5H5JA 1AH2A 4JLJA 1T2AA 1NU8A 1Z6QA 1U7DA 3SZLA 5C8YA 3BL8A 4YAUA 1J70A 5EIFA 1BFUA 2AL7A 5JS8A 2VPTA 4DSZA 3LUFA 5C8DA 2P5YA 3WO0A 4QASA 1HRDA 1JYFA 2ONJA 3O4IA 5HFNA 3K0SA 2JKYA 2B7LA 1B0ZA 3D0RA 3FWHA 2GEUA 3BD6A 3VVLA 1Z28A 1NVUQ 1RM0A 2GHQA 3QLEA 4HUTA 3G59A 1QG6A 3U0VA 4F5WA 1CU1A 1JAZA 1JVSA 3FXAA 3DTVB 4F96A 1W8DA 2HHCA 4M1YA 3GB9A 1V11A 2MSEB 3CISA 3GJXC 4H0CA 5I7SA 3KEQA 4O3MA 3RIMA 3PDJA 3EISA 4D46A 4K46A 1J4AA 4F9TA 3J7TA 2B1RA 2NU6B 2PUCA 2RE8A 4OHCA 4XGQA 2BP7A 1BXRA 4D02A 5LL6P 4P9NA 3U3DA 3N0WA 1LA2A 4X0EA 1V25A 2BLNA 2P27A 2UVPB 3I9OA 3MS7A 3D3NA 5FPKA 3LNCA 4XGNA 4HVLA 3K16A 5F1KA 3VU3A 4LI3X 5BMVB 3L82B 4G0UA 2P6OA 3DBVO 2NP7A 1NAIA 3EPHA 5ERYA 5B1DA 2JLZA 2JAXA 4H35A 3RQSA 5HE8A 5JHGB 2MJLA 1RCFA 4QBFA 5KREA 3LL7A 4HNQA 3D6HA 2DSNA 1IOLA 2A1UB 5H16A 4ER5A 1MNQA 4L3VA 2ZRNA 4RDXA 4XDGA 2R87A 3G9TA 5FEMA 1JPNA 2W0SA 3W8DA 5EWJB 4N1AA 4BNDB 2G82A 5DCUA 4M3NA 2R47A 4FZRA 4G23A 4MCAA 4EBBA 2HV8A 3F6RA 2WFAA 3DAPA 1ADFA 1JLRA 2CLDX 2R7KA 3N76A 1FNCA 1T5SA 2QE6A 4LZOA 2J0UA 5KYUA 1WEHA 2ACWA 4B5KA 3PIDA 3SC3A 1X74A 4K9KA 4F8YA 5JAZA 5M04A 1BROA 2KYRA 2C3UA 4J1SA 5WRFA 2J5QA 2X6QA 2DQYA 5G3ZA 1WQ4A 4BAGA 2A57A 2PUBA 5AJVB 3DPSA 3G5AA 4DWJA 3A3KA 2HZBA 2OUIA 1GVHA 2O4CA 1QYIA 4NK5A 2R1VA 4M1MA 3DR3A 1EZ1A 3L0BA 1YFKA 2RBGA 1PTJA 3H5NA 4FFNA 2Z0MA 5DGTA 3DR5A 1FZQA 2E6KA 5JSYA 3AVXA 4M76B 4A8JA 1W36D 3PX7A 1G2OA 2BEVA 2OZLA 2QZSA 3CZAA 1GZ3A 1TIPA 1XD9A 1TK2A 1XEXB 3PXCX 3RT1A 3H4VA 3IOMA 3ZWPA 1OZHA 5HIMA 3TAHA 2VPYA 2A78A 5EWMB 5KQMA 2J59A 5T7BA 4N49A 4KAXA 4B31A 3MTQA 3OQPA 1ICIA 1UFVA 4GMHA 3K73O 3GUZA 4RESA 4URZR 2ONYA 1ZK3A 3IIKA 6ABPA 3OZTA 1TEVA 2WMYA 1HE8B 1OXSC 1SU7A 3JAKA 4KITB 1XDSA 1PWHA 2NSDA 2ZR9A 3CONA 2XITA 1HUQA 3DJFA 5KHOC 3IUPA 2EW8A 2I76A 3FOAA 5JYEA 3OJOA 4ZMSA 2VWHA 1ZRNA 4QQ8A 1W5FA 5TMDA 3AW9A 1O97D 3ZWBA 4Y2HA 1CJMA 1YQWA 1GGKA 1XHLA 1JFSA 3COZA 3KJNA 5F2EA 3A27A 4CU5A 4ABTA 4Y2GA 4G0WA 1WETA 2V59A 2ZJBA 5L7WA 4RTOA 3RS0A 3FB4A 2WQ6A 3ILYA 5DM60 1T0JB 1SKQA 1E7YA 1V2HE 1WUHS 3KQWA 4PBTA 4WCDA 2EBHX 4Y9SA 3VNSA 3ZI4A 2QROA 1KVSA 1P39A 2HDOA 4TRRA 1KR2A 4H7IA 2VJDA 5DTJA 1YZQA 1A1VA 1EB8A 1H1TA 1RXCA 4HFRA 4ADSG 5K20A 1D0IA 3GCGA 3LX5A 4KHPB 3ZDQA 2XB2A 4QUEA 1NW3A 3BQNB 4JNCA 4JNKA 2J3MA 4PFKA 4OBWA 3DD5A 2IVFA 1ZJ6A 2GBCA 2D5CA 3G23A 3LP6A 3LSTA 5J9FA 5T6BA 4A0SA 2AZXA 1QFXA 5DBGA 4CKWB 3R5FA 1YAJA 1SCNE 5JNSA 3EGXA 1KFCB 1QCDA 1Z2OX 1AE1A 2OOKA 4OU4A 2LCIA 2ZR7A 5M3BA 2H1RA 1ORIA 3S2GA 2V6IA 1Q7GA 1QS0A 1CUCA 2AG5A 2QR3A 2LBPA 4RA6B 1NXPA 5A7HA 1BN7A 4AQDA 5JT1A 2OVBA 4FNGA 2AE2A 2ATXA 1KMHB 3TOZA 4B3TB 1HT2E 1II9A 4MI3A 5CXSA 3V34A 1YKFA 5COBA 2Q07A 3LGXA 5I4BA 3OEWA 3O0TA 3GNLA 2PUAA 1X7GA 5BNTA 4NBUA 3GAMA 4BMPB 3PNYA 1ZKDA 2BH9A 2XQFA 3IJ5A 3NC4A 4OK3A 4FIZA 4OAQA 4DJEC 4XSGA 1VPVA 2H06A 1I2CA 5CDSA 1P7YA 2I3ZA 2P3QA 3IIMA 3KSZO 1FRQA 3OOEA 3N0RA 4LGVA 5EOVA 5CEFA 1HFKA 1L4EA 2ECOA 1TJ4A 1VG1A 3D6MA 3H9CA 1JFRA 3TB6A 3WHPA 5JMPA 2R00C 1P6UA 2EBUA 4HX9A 4R2JA 1GZ4A 3WDMA 5HP4A 3FPFA 4K9PA 2GZSA 2HCRA 4AROA 1V0JA 3T61A 5DBHX 3SCZA 5HR5A 1JTEA 4IG4A 4BVJA 1HT0A 3GEEA 1UEIA 2AHRA 1QPGA 2BFMA 3ZIAA 2BL4A 3H7AA 3O1LA 1RAFA 2X9NA 4ZT2A 3F5SA 1D07A 1UFKA 3C8DA 1O6CA 4HS4A 2DY0A 1U0BB 1E7RA 1SCAA 3FIUA 1EVJA 3FLAA 5A9RA 3U4QA 1E5VA 2WFMA 3GRAA 3OMXA 5AI4A 4QD3A 4JVOA 4Y7CA 3RAGA 3TFWA 2VSOA 1FLVA 2VI5A 5E0OA 1AZTA 2A9RA 1DBQA 4J1TC 2HRZA 3L79A 4TX1A 2FSVC 1MX1A 2NUPA 4HMOA 4CNQA 4DDVA 2G1KA 1WNFA 4WXPA 5LMCA 2ATVA 2J08A 4R2IA 5D3ZA 4FOSA 1FC0A 4B6OA 3IEVA 2HMTA 3JQ7B 5BW4A 1XTTA 2AS0A 5AP9A 2BN4A 3HYCA 4N48A 1KVQA 1VYHA 3N2KB 3QV1A 4FINA 1HKHA 5F64A 3HDGA 4R7ZA 2NQ8A 5DCYA 3OPQA 3WRVA 2OKGA 1ZIOA 2CVHA 3ENQA 3P2JA 3CX8A 3TZKA 4EJ0A 1GTRA 1XF1A 1BGXT 4ZAZA 1XKLA 1U99A 3O21A 5HDQA 4BMVA 1UBJS 1YC5A 1Z7BA 2QXUA 1M73E 4IXDA 1XO1A 3EXHC 3T3IA 2X4IA 1US8B 2ZUBA 3F97A 3WOVA 2ZJ1A 3H1FA 4OLBA 3Q9UA 1QF9A 1EUCA 3EXIB 3QX7A 2P9CA 3N2EA 3TBFA 5HXAA 5DLEA 2WDPA 4XSHA 2GZ3A 2FSFA 2CJFA 2W2NA 4RGBA 3VVBA 5BVHB 3GT4A 3KZNA 1JFTA 1PJ4A 2NSLA 4XA8A 3PD0A 4R9RA 3RRZA 4A15A 1JH9A 4JMPA 3GEDA 4OLHA 4BMNA 9MHTA 1UAAA 5CAEB 4NIMA 4ZOCA 3LBYA 1XBTA 1FVHA 1OIXA 3NUQA 3RVNA 5AVRA 5M29A 4IUYA 1E62A 1IRXA 3H84A 3U7FB 5GVRA 4MP6A 4HN9A 1F9AA 4RL6A 5JW6A 4L2IB 5KSYA 3GEGA 1R4NA 1ZGZA 2CVZA 5JJLA 3H2SA 3ZYCA 1CUBA 2HIAA 1QIIA 3QP9A 2YWFA 4PYLA 4CMBA 3D1VA 1JQ5A 3R3VA 3ISVA 3STYA 3E8XA 4UEQA 4AJEA 2FG7C 4DCOA 4BO3A 3KJHA 2IPLA 1VTKA 2BR4A 3LDAA 3QXGA 1Y5IA 4LRXA 5EIOA 5AFSA 3AY7A 4BFXA 1JAIA 4F92B 2IEDA 3SYTA 1MOZA 4EY6A 3C3AA 3WNQA 5BSGA 4PONA 1NW7A 1GTVA 4QXAA 1O7JA 3AU9A 3D3EA 1UP6A 4IH4A 5BRNA 4BB5A 3ZE8A 4ZARA 1I0IA 4JQCA 4YJGB 5LYJB 1JAXA 3RWBA 1N5IA 4MGYR 2Q5CA 3IKLA 2A6PA 5FUWA 4E6PA 1I94B 2FUG1 3BD9A 3M1LA 4Y9DA 2NU7A 3V1TC 4UC0A 3LT4A 3W2FA 2IS4A 1UC5B 4JUCA 1WB6A 5KNBD 2X2EA 2X0IA 4YP7A 2ONCA 1RBQA 1GPNA 1J7JA 2CLKB 2HNBA 3E9ZA 4MGIR 3VDRA 2V7PA 3N7AA 3D2CA 2KSQA 5E7MA 2G9RA 3NRBA 4H2DA 1Y7LA 4Q05A 5J2UA 3FCUB 1JHMA 1DIAA 3AESB 1N2ZA 3RIYA 5FL7A 4ZO7A 5B5SA 5K5EA 3BD8A 2IHBA 1NBIA 2IEIA 1Z3IX 5A6SB 1OHHA 3ESYA 1WHSA 5D84A 1PR3A 1Z2EA 3BFPA 1PR1A 2BF4A 2JF0A 3UFXA 5IK2D 3RIHA 5AXBA 4KKXB 4B7ZA 4N76A 2I8LA 4P4TA 1MD9A 3H8SA 4Z0HO 3M2TA 4I4TA 2WMNB 1DV1A 1AHHA 1N34B 5BSFA 3QU7A 2XMGA 4FHEA 1NVWQ 4TXLA 5AW5A 1NFRA 2OILA 2NYAA 1A9XB 2UYOA 2VP5A 3EXFA 5LQNA 1F6BA 2ZBQA 2QZPA 2HA0A 4EPYA 1BXGA 4WJZA 2J9YB 2WJYA 2GAOA 2WF5A 2Z5LA 1SZJG 1WX1A 3HY4A 4OATA 1YI8A 2AUMA 1R50A 3RO7A 1EWQA 2CJXA 1BS2A 4P54A 4Y6PA 1M5TA 3H5RA 3KHKA 4OJMX 1J33A 3ZHTA 4BVEA 3B7GA 3ECSA 3ZWAA 4ZDKA 2P6PA 4JI5B 2X4GA 3O1JC 3QYJA 1E4EA 2WJJA 3DZIA 1XQ1A 4M0KA 5ALSA 3LE8A 1NHWA 1NVFA 3ZU3A 4A7PA 2P0YA 4DJFC 4EZIA 5C1PA 5CDFE 3ZLTA 3UIEA 1VJ0A 4I6JA 4A92A 4AQYB 2G8LA 1MGPA 2V7GA 3OLZA 4HPWA 2DFVA 2FWNA 2O2CA 4LSMA 3U3MA 3ZS8A 3CTMA 3TSOA 1V95A 4BO5A 3UV7A 1MRSA 5CVUA 1LLFA 3ES9A 4IH9A 1J2JA 3TOSA 2GNAA 1IQ0A 2GYYA 4A2WA 5KTYA 1CUHA 1SU4A 1EVZA 2L19A 4TN1A 3RU7A 4N5MA 4OU5A 1HLGA 2QYHA 1O95A 1G8JA 3IO5A 1U9ZA 3PGXA 2O1EA 4MV4A 2IDJA 1UXJA 2HYIC 4N3NA 4BUZA 2ZYUX 4OTZA 2RKOA 4HT3B 1ZN2A 3GFQA 4XARA 4EDHA 1S2OA 2WYIA 2Z3ZA 1UINA 2YY6A 2P3SA 1QDEA 2LD4A 3LBFA 4UNQA 2D7JA 1P4RA 1KXJA 1GNRA 3CNLA 1A9QA 1L5OA 4XIYA 5DULA 2YBDA 5TNXA 2UDPA 5AVZA 8ADHA 3NVMB 1DFGA 3LRPA 4YAWA 5HIIA 4EG4A 2HMSA 3OIDA 1WSDA 2R6R1 3VBCA 1RYDA 1UKEA 2JASA 2PKQP 1N2BA 1KZYC 4JLSA 1N7JA 4QQFA 4K2AA 1J2EA 5EXXA 3ZUGA 1AUXA 3O7MA 3C4QA 3WA6A 2I2AA 1M34B 3AJEA 5LN1A 1SXJD 1GZHB 1KSFX 3OCWA 1VL0A 2G67A 1M6HA 5DIFA 1Q7EA 4IS2A 2PMWB 3THYB 3LQQA 3TKLA 5DPMA 1ZQ1A 3QSYA 1AQLA 1FYEA 2XUHA 5KU7A 1IQRA 1P2DA 3EXHA 1JFVA 4YALA 1V47A 3HBLA 5I6DA 2DT8A 4FYXA 4G09A 5BR1A 3AKDA 1T6NA 3QYFA 3RVMA 1QIGA 2WMOB 3FUUA 3E18A 3S1LA 4FBLA 1NLUA 4B32A 2EWMA 3M4JA 5CVDA 3EBOA 3L6OO 2Y3IA 3O8RA 1T8SA 1DQSA 1IB0A 5DTQA 5G3YA 1MVNA 4PNEA 1G19A 3IHTA 4I1IA 2PUEA 4EA6A 2YFQA 3ILHA 1D6JA 1YNSA 2Q3FA 1TW3A 3HUTA 1X3SA 3OT1B 5I9NA 3JPYA 2FZVA 4L8FA 4IO0A 4RPGA 1L5SA 2IFTA 4E5UA 4KU4A 3IUSA 1Z0ZA 4JJ4A 5FHRA 3T7KA 3VH3A 4EPVA 4FGJA 1GRNA 5AW8A 1CIPA 2OHIA 1GRVA 2XWSA 4L02A 4MVXA 5TVKA 1TAHA 1YJXA 1EFVB 1WCWA 1FMLA 2BMEA 3NTUA 5EIAA 1O0SA 3N8GA 1M9NA 4YCCA 3TG2A 4MV5A 4L07A 2QTVB 2AE1A 4RORA 1CUVA 4G85A 4KAAA 4IRMA 3F3SA 2QYOA 3CUYA 1O94A 2R6HA 5DM70 4E5NA 3E2IA 3K9WA 4UM5A 4EVSA 5IJ9B 3S6JA 2CNLA 2I78A 2JFNA 5K0FA 3O8QA 3O82A 1M34A 3FA2A 3HGTA 3UAYA 1LI5A 2EYUA 2QJFA 3UH1A 4DANA 2OBBA 1E89A 4UHDA 1LPSA 3BFJA 4FMBB 3KZXA 4MYTA 4PCVA 1TQ8A 2F43A 4MS4A 3V4VB 1GUZA 2HHAA 3GCWA 3PHCA 4DPMA 3WLEA 4BQNA 1PFGA 1NVMB 1YR1A 3QE0A 1G2IA 4ZEXA 2W2OA 4Z4HA 3GW8A 2J8ZA 4DWOA 3PXUA 4LN1A 2MIIA 2XNDD 4COOA 5GTDA 3LQ1A 4ZVOA 2HK6A 3KIPA 4QWMA 1P60A 1Z88A 2V7QA 4FT4A 4HZUB 1QQ6A 1U8YA 1QFMA 1TA4A 3DMFA 2C4UA 1E5XA 5DW3A 4DC9A 2JLCA 3ZLUA 2NUAB 4HPJB 1J0XO 1T8UA 1LVUA 5K8TA 2NMVA 4LZWA 1P3Y1 2CXUA 1C7JA 3E9NA 3D54D 4Q7MB 5BNWA 3T1HB 4PN7A 4TV8B 1YZNA 2VTBA 3EPKA 4HSGA 4ND3A 2GJSA 3LNTA 3NIWA 3OCZA 3FUVA 4YBRA 2PXCA 2XIQA 3AY6A 1JHAA 2I3DA 5J2TB 4ZOEA 3N2LA 5CK4A 3UJ9A 2CMGA 3WO1A 1F20A 4JT2A 4NE9A 4RHXA 3VTKA 5IJZA 1R0XA 1MO2A 3HYTA 1TCAA 3KB1A 1P4JA 2OMKA 2XGOA 2P8JA 3BEDA 1HKUA 2YHAA 4M89A 2IF0A 2J6BA 2GN9A 3EPPA 5ESRA 2ZTMA 3KTAB 5L51A 4YWJA 2RC6A 4V0ME 4XDZA 4YROA 3FDIA 4J9VA 2G4LA 4IIXA 4HX5A 1CFJA 4F04A 1MT3A 1OW3B 2OTCA 3V3KA 3WQSB 1NXWA 4HEQA 2VDVE 3DTVA 4YRJA 1L4MA 4MULA 5A4KA 1JE0A 1T2CA 3AG5A 1LWNA 2W4MA 3LUHA 4ZI5A 5KX5A 3PCXA 5CW1A 4B4UA 2J7KA 4CEJB 2IW3A 2VJCA 1W4ZA 3LFUA 5E95A 5H7XA 3WRXA 4FB5A 5KZMB 4DA4A 3SOPA 4BKQA 2MYNA 3W2HA 1JHZA 1ZIYA 4BBJA 2XMPA 4J1TA 4FSHA 3LW7A 4MUFA 3RYHB 4Q1BA 5A03A 2YJGA 3BIXA 4Z4FA 3IPLA 3QELA 4J8PA 4DA6A 2RGYA 4WOCA 2C98A 4MUIA 1SBIA 4HUQA 5IKEA 1LZKA 1OLUB 1MVLA 2IYLD 4B9EA 2X7XA 1I9CA 2RI1A 2BGLA 3UFXB 2RH4A 1R10A 1DNPA 4G8CA 1KFEB 3O8QB 3VNQA 1YZHA 2EYQA 4ARSA 5KWIA 4TL9A 4YMIA 4F12A 4JQSA 3C3WA 2ZFUA 3ELBA 5DI3B 4K86A 4QC2A 1BXRB 4WKGA 5FIUA 5ALPA 1R6BX 5J2UB 1UXKA 2F67A 1DQRA 3ADOA 2HIMA 1AT1A 2P35A 3JTEA 2XSZD 1J56A 3ZY3A 5DT9A 2QVGA 3QEMB 5I9LA 3TLCA 1O96B 1FA9A 1OV4A 1YUMA 2GZHA 4G63A 1PTJC 2IZ0A 1FRVA 4M0MA 1L3IA 3CRW1 1YQDA 5DB4A 2YBEA 1LX7A 2BZSA 3O3MB 3QPAA 3SYRA 4A5OA 5FA6A 5CFLA 1FFHA 2HJVA 2PFKA 1RKVA 3HADA 2BR5A 2PUTA 5K4AA 1T9AA 3IAHA 4LVNA 3NBAA 3T7DA 1KO8A 1LKZA 3S44A 3ZZTA 3T35A 1ZEJA 2DERA 3ITKA 4AW9A 3ZXXA 5KYWB 4QBIA 4J0FA 3TL3A 3UWMA 3N5KA 1LBQA 1M2EA 1VRVA 2H51A 4H0FA 2LZ0A 4HNGA 1A5ZA 3SNKA 4B83A 1GU0A 5EESA 3TTXA 2OZLB 5LR6A 1VSTA 4YAEA 4AO8A 1T4MA 3OA0A 4XVCA 1WULS 3BWYA 2D2EA 1Y8AA 4FFWA 1Y1LA 1FDIA 4BO8A 3A36A 4QA9A 5JNLA 3B60A 1C4XA 1GUDA 3TNLA 3EVGA 1A5BB 3BERA 2O0JA 1H94A 1HDXA 1V8OA 3BUSA 1XJCA 3QWIA 2C7QA 1USGA 1W36B 1L7PA 3PE3A 2XCRB 1X8LA 2RHJA 2HO4A 3SDBA 1J8YF 2G71A 3ZKWB 3ZU6A 3FVTA 2HA2A 4C7BA 2C7PA 1OH6A 4EPWA 4HNAB 1VI6A 2Q7XA 2A33A 3FGNA 4G8BA 4PO3X 1FS6A 2GA8A 3A4TA 2QU8A 3DEAA 1LC3A 4ND1A 2GFIA 3MOIA 3QBEA 3RVDA 2BZ1A 1LPOA 2JIQA 1JVNA 4JBYA 1CNEA 4Y1GA 2JA1A 3PVSA 1PJ8A 2XE4A 3CN7A 1Z07A 2MSWA 4JYCA 3WWEA 2WHQA 1UADA 1FQOA 2ID9A 2KLBA 3AGQA 2QG4A 4OHV