1XEXB

Structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
161
Chain Sequence
b'KKNVFMRTFEAISRNFSEIFAKLSPGGSARLILENPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALAFVFAIQKFKPAPFYLFDQIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANADKIIGVSMRDGVSKVVSLSLEKAMKILEEIRKKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SMC protein
publication title Structural biochemistry of ATP-driven dimerization and DNA-stimulated activation of SMC ATPases
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
total genus 41
structure length 161
sequence length 164
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xexB00
1RRFA 1FW6A 2ZSEA 2JJ8A 4Q7KA 1CR4A 4HB2A 4V0OA 4Q03A 5JHGB 3I73A 3U61B 3ZVMA 3A4MA 4OL0A 3X1ZA 5JFGA 3WMEA 4ZKDA 1E2PA 2OBNA 2NZJA 4M9XA 1F48A 2PLRA 2BMDA 3N2IA 2F1HA 3K9HA 3K0AA 4XWOA 2QAGB 1KIMA 3AVOA 4LV6A 3AVPA 4ACBA 4JYBA 4DIDA 1SULA 2JDID 3QXCA 5FPHA 1KMHA 4GT1A 1W4CA 4US1R 2VP2A 4PZYA 4EKDA 1SKQA 3GFTA 2Q9CA 2PEYA 3CLVA 3UWKA 2PZEA 4L8GA 4MKIA 1WBDA 4PHGA 4B3BA 2ZANA 2XGJA 1ONBA 1VCOA 2FSIA 1DPFA 2CL7X 1KGDA 5GVRA 1Q3TA 1FMJA 4G5QA 5JECA 2QE7D 1NY5A 2PJRA 4F4CA 2ZM5A 4C9BA 2J45A 4D4LA 1FZQA 3AUXA 1KO4A 4H1UA 3KQHA 3VNVA 2GCOB 5HTKA 4QJ3A 5C4MA 3Q72A 2D74A 4OK6A 4TMXA 1ETUA 1W36D 1FTSA 4QGAA 3TJZA 5JLJA 1DS6A 2JLUA 3U4QB 1S1MA 2GF9A 4KJZA 4PQYA 4S2EA 1N3BA 2Z4RA 3CZQA 3TR0A 5AUOB 1KI6B 2K5UA 2FG5A 2GXQA 1NL3A 3IDQA 3QXSA 4B47A 2KE5A 4OKSA 2ODBA 4DEXA 1VIYA 1YZUA 2WV9A 1ZNZA 4JVLA 1T91A 1UFQA 2VF8A 3HJNA 4JJKA 2FN4A 4A82A 1LW7A 4ZO4A 2IS1A 1H8HD 5JRZA 4L5BA 5J4KA 2JJ2A 4D4MA 1KI2A 5JS8A 2VIIA 2B8WA 1VIAA 1E9RA 2FWRA 1XCPA 4AY2A 4UKDA 1FNMA 4PAQA 4AG6A 2GEUA 1IOZA 1XPUA 1KSJA 3ADCA 2NPFA 8OHMA 1MO4A 3WRXC 2OSBA 4Z54A 4O25A 4NKRA 2DWQA 1U81A 2HJVA 5JWOA 5J5CA 1KI8A 3M0EA 4DUGA 3P4XA 5DHAA 4TSFD 2IYLD 4LJ8A 1LY1A 3RRNA 3WHKA 3IIKA 4G5RA 5TARA 4FMCB 2A3RA 4A9AA 1NLZA 2RB4A 1X3SA 3I8SA 4URYR 3QJYA 1W5TA 3CR7A 3ZS9A 4DLSA 5SZHB 2YWFA 3K53A 2ODEA 3PUVA 1KO7A 1RJ9A 2BKEA 2GZAA 2Y8EA 3EPLA 4X8HA 5EXPA 5SZJA 4WZ6A 1M7GA 1F2TB 1IN8A 1VG9B 4P31A 1ZM3A 3FFAA 3EA5A 3V9PA 1Z0FA 1XRJA 2JLRA 4OHWA 2W6IA 3K70C 2GJKA 2ZI7A 3R9XA 1G8HA 2ATXA 4LJ6A 1W1WA 3VNUA 4L15A 4D81A 3SBDA 1E0AA 2V8OA 2VHCA 1LTQA 2BCJQ 3V4FA 5GJBA 2WKPA 4V0LA 3AVWA 2OFXA 3OE7D 4GOJA 3VHXA 4D25A 2CHGA 3LBHA 4LV5B 2XZPA 4RZ3A 4C0JA 3KQLA 4BE7B 3VU9B 1CKEA 5DISB 4OQFA 1G5TA 1WRBA 1QVRA 1E9AA 1ZU5A 1G9XA 1XTJA 2WIBA 3C5HA 4ZCIA 4OJQA 1DO0A 3W3AA 2IT1A 2FE4A 4B2PA 4EQ6B 2OCYC 2QP3A 4RY2A 3ONWA 5FL3A 2J0UB 4EIWA 3I61A 2W0MA 4PAOA 5C1BA 1TEVA 3U7EB 2ZE8A 5HKKD 3K0CA 1HH4A 3A1WA 4MRVA 3RNLA 1ZM2A 1Q3HA 4DRZA 2JLQA 3N70A 4G0NA 2PH1A 1E2EA 3IHWA 4HAWA 4BWYA 4DT1B 2EW1A 4RSGA 1BIFA 1B0UA 1KOFA 2SHKA 4WXRA 3PFIA 3RDPA 1T8TA 1E9SA 1A4RA 1IJFA 2GWHA 2FFAA 3WMFA 3QF4A 5KU1A 4GP7A 3W5IA 5G3YA 3SS8A 2ZRMA 3QY0A 1YR7A 4LBWA 4V0ME 3I1FA 4YDHB 1DAFA 3NWJA 4LOAA 3GLFA 1ZVQA 5FBQB 4TYPA 1VYTA 4R98A 4E22A 1DAEA 2AHOA 4Q66C 1R0YA 5FBWB 3VR5A 1JNYA 4AYXA 3CF6R 1IXSB 5DI3B 3Q7PA 2QAGC 1E2QA 2CJWB 3OEEA 1GKUB 4EAQA 1VG8A 2J41A 2DFTA 2NO9A 3P20A 2QT0A 4TL7A 1CR1A 2PT5A 5DYGA 4RZ2A 3P32A 4QHYA 1X8LA 3P27A 4GZMA 5EP3A 2IUUA 2EFGA 2VSFA 5JWRA 1R2QA 3NBYC 1VECA 1D9ZA 4YLGA 3ASZA 2C9YA 1W44A 3ZQJA 1EGAA 1NKSA 2DR3A 2EVWX 2FPLA 2BM1A 3HWSA 5TMPA 1G4UR 5LD2B 3HU2A 5KPDA 4Q01A 5C4GB 2JA1A 1I4LD 1NN1A 4TLEA 2V54A 1U8YA 2C2HA 2G0TA 3C16C 3Q9LA 4RFSB 4E5UA 5EUQB 2IL1A 5FOVA 1GWNA 4PAMA 1QHYA 2O8EA 1NG1A 3OHMA 3TIFA 1G3RA 4XJXA 5FBLB 4ERNA 1ZUHA 2PEZA 4DLUA 4GP6A 4AKIA 3QKRA 5F98A 2WTUA 3FPAA 2OM2A 2CCGA 3WYAA 4AIIA 1XTSA 4GBMA 3RSLA 4U00A 4H1VA 1JXOA 1QHGA 3BH6A 4JKIA 4RKFA 3T35A 2H1LA 5FFMA 3EZFA 4FIDA 2WPDA 2VSXA 1LFDB 3P26A 3KKOA 3BORA 5CK5A 1FL9A 3FHOA 3RABA 3A37A 1U0LA 5B64A 2A5JA 2ZYTX 3LW7A 4DDWA 4IXMA 5FTNA 4C3ZA 4KITB 1N5JA 3RS0A 4KFRA 5K8LA 4PXAA 1OLOA 2IS6A 4Q4JB 2C98A 1S9DA 3KUDA 3REFA 2ZITA 1S4QA 3U2QA 2IW3A 3QVVA 3Q5DA 5JEEA 1NBME 4HAVA 1ZC4A 2YOGA 5GADl 5JMTA 1Q20A 3CRW1 4LJYA 2NQ2C 5FTMA 5EQTA 4NTZA 5E3HA 1Q1QA 4CT5A 1LS6A 1HEIA 3U3MA 4ARZA 1XWIA 4IRUB 1VG1A 1OH6A 2OCPA 1E9FA 2CXXA 2X19A 4KXFB 1OIVA 1YZLA 3B9QA 1E96A 2R6GA 2JJ2D 1EX6A 5IDVA 1UJ2A 4CIDA 4MGYR 5F9HA 2ERYA 3SYKA 3TKLA 4BFWA 4PC1A 4F38A 4CEJB 1ZMXA 2HLDA 2EFDB 1T3LA 1E2LA 4PPNA 3QVUA 2V55B 3HU3A 1GL7A 4LPSA 4PSVA 4QGGA 5EP4A 1B23P 1NLYA 4I1VA 4DUGD 2Q3MA 3FMIA 2GA8A 3BK7A 2FSHA 4DLYA 4ZI3A 2MSEB 3JVVA 2QBYA 3PIRA 1DE0A 2QTFA 1T8UA 3TSOA 4ZIRA 1Z8FA 1XD2A 3BGWA 3IBYA 3QPUA 3ZDQA 2RGAA 5FR1A 2BWJA 4XVRA 5L3SB 2C9CA 4JBWA 2P65A 4A4DA 3THWA 5EXTA 221PA 1OFUX 2JJ1A 3OIWA 4Q21A 1P75A 1X86B 4Z8YA 1D6JA 3UWOA 2E87A 4GL2A 1AIPA 4QJ4A 2W6ID 4HUTA 4A0HA 2QSYA 3RRMA 4NCNA 4NMMA 1W4RA 3A8TA 2BKUA 4HYYA 1Z0DA 4QC2A 3WYFA 2ZRNA 4ESVA 2DFNA 2X2FA 5AJYA 2ZI5A 3MD0A 4Y0AA 1VMAA 3T1OA 2GESA 3A1SA 3BS4A 3QKUA 3PR1A 2BDTA 2ERXA 1OXXK 2QAJA 4YXWA 2ZRDA 3QBTA 2IWHA 4IDOA 1TX4B 3L0PA 1NJGA 2G1JA 2GDJA 2ZI3A 3VR6A 5KPJA 1MOZA 4G01B 4NZYA 1OPXA 1LB1B 1QHNA 3MWJA 4AURA 3LFUA 2FMXA 2O8FA 5EXXA 1HE8B 2H57A 2PBRA 1SVOA 1T0JB 5BN5A 5TVKA 5IHPA 1R10A 4LI0A 4M22A 4Q47A 5E95A 1CJMA 1N5IA 4IFEA 2CEAA 1E2GA 3Q7QA 4PO1A 1U9IA 4UXIA 3WRYC 2IYSA 1ZM7A 3AVTA 4UNRA 2ZYWX 3EASA 3R20A 2TMKA 2X8AA 4Y0VA 1E9DA 4D26A 2ZVQX 1FQJA 4JT2A 4AYTA 1G20E 4HAZA 3TR5A 2Z4SA 1KKLA 3LV8A 4OI0A 4KFUA 5KUTA 1RPZA 1SVKA 1SXJA 1ZUIA 1HUQA 2C95A 2D06A 2GZHA 3KUCA 4TLAA 4PPGA 3AEZA 1N2CE 2ANBA 5LD2C 2W0SA 4KYUA 5FUYA 1P61B 3SQWA 2KWIA 3OEED 2FF7A 4CZ2A 4HZUA 2PCLA 4MH0R 1W0KD 1Z08A 2ZSAA 2Z83A 1V43A 1EFRA 1ZAKA 2NMVA 2Q3FA 2WKQA 4CF7A 2ZR7A 1MO5A 5KOYA 2FU5C 4PO9A 2IF0A 4RKEA 1OXUA 5G40A 4BLPA 5EXSA 1ZM9A 4BUJA 3QXXA 5K8IA 2BBSA 2W2TA 1D8TA 1Z6AA 2KBFA 1P2VA 1VHLA 1E94E 2XJ9A 1OW3B 3CPEA 3TSWA 2N42A 4DSNA 1XEWY 1ZC3A 4XTRA 2QU8A 1H65A 4JVSB 4ZV4A 4PX9A 1XEXA 1BYIA 1BO6A 2QE7A 2WJGA 3FGNA 3CX8A 4KSBA 1PJRA 2RGNC 4C7OB 1VHTA 3AKEA 3JVUA 1KNXA 5A0FA 4KCGA 4TT3D 1R5NA 4GMXA 3R7WA 4W5WA 4J0QA 2ZJOA 1BOFA 1R0ZA 2H7VA 4LZZA 4B73A 2XX3A 3HYTA 1M7HA 3RS3A 4LYJA 4URWR 3EC2A 1QG4A 4LRWA 1PUJA 1RE0A 3R8CA 3BB1A 2F3RA 2C03A 4UJ3A 2DCUA 2A7QA 3IUYA 3LQRA 4Q1BA 1N6KA 2ZSDA 4WZAE 3SC3A 2RAPA 3VMFA 4DCSA 2J59A 1XJQA 3TMKA 1VDZA 2D4HA 2VLIA 2WM9B 2CE7A 4LHVA 4YONB 3CZPA 2WJHA 5G41A 5AUPB 2VL7A 2IYZA 2WZQA 2W00A 3D6TB 3W6PA 1P9RA 3SJZA 4BEJA 2VSOA 3LX8A 3GFPA 3TW4A 1GTVA 2JASA 3N5CA 5JZVA 1H8HA 1G3QA 1KSFX 4MDEA 3W6NA 3L82B 3AGPA 4HB0A 4JLOA 1CLUA 3QEOA 3BB3A 3NHBA 2VTKA 3RANA 4QXAA 2FFQA 2Q3HA 3IO5A 3WNCA 4DCNA 3EX7C 2D7CA 4DLVA 5KNBA 4JVNA 1JQJC 2IS4A 1KDPA 3FE2A 4LBYA 1NMXA 2J0QA 1DAIA 3A6PC 1S96A 4PHTA 1E2KA 5HZHA 4OK5A 3K9NA 4ZI2A 2ZJYA 4FCTA 3B1YA 2XNSA 4I4LA 1TNDA 2ZRHA 4A15A 4TSFA 3U60B 1MABA 2OAP1 5AJWA 1KJZA 2O8CB 4XOIA 1JB1A 5DGXA 1T9HA 2NO6A 1JPJA 1JR3A 4M0LA 1YRAA 3CNLA 4PZLA 5E4FA 2HLDD 4QBFA 4OHXA 2FOLA 2QRZA 3F8TA 2NO1A 5F3WB 3AP2A 3D8BA 5B2ZA 4XSHA 1S0UA 1G7TA 3L2OB 3O8BA 3QPVA 5FUXA 4EPTA 3THXA 3KL4A 1YE8A 4E07A 4C0AC 2FDCA 2HYIC 2X2EA 1V5WA 5EZ5A 2XTNA 4D0NA 1GITA 3B1XA 5SZIA 1T0HB 2GKSA 1GRQA 2V6IA 2P0EA 4DIEA 2QPTA 3GLIA 1R8QA 2QL6A 4R7ZA 2JJ1D 4DBLC 2RGDA 5JI3E 3T12A 1CRQA 4P4UA 4F93B 1XMSA 2NIPA 4LUCA 3AVVA 1CRPA 4DSTA 1P3JA 4MYTA 1I4TD 3BERA 5JCZA 4KFSA 4A92A 3AF2A 1CTQA 1SXJB 3IQXA 4RJLA 1BS1A 1SGWA 3GEIA 4B6EA 1M34E 4EJSA 3GLGB 2D2FA 3SEAA 4LWZA 3FFBA 3FMOB 2RGCA 2GTPA 5HKKA 2CMKA 4HZUB 4OJKA 1W7AA 5FPTA 4A8JA 3LH5A 5ELXA 2ZYVX 3LA6A 4N3NA 1F2UA 1UBGA 5KTYA 4MDFA 1Z6YA 5AJVB 1AJEA 2WVJA 1FTNA 3U7HB 4JT4A 2YYZA 4FWTA 1QF9A 3ZLJA 1LF0A 4LCBA 4Q1CA 2DHRA 3PENA 1KO1A 1G16A 2QMUA 1GNRA 4Q5IA 1G291 1MKYA 3TW8B 2QTVB 2IUTA 4DLTA 2BV3A 2R62A 2OEPA 1W48A 3FDIA 3GLHA 3BWDD 4I81A 3CF0A 4DCTA 4U5XA 3RSOA 2EFEB 2R6CA 1Y63A 2RH5A 3DZDA 4I1UA 4W9MC 4CT4B 1KY3A 1FOEB 3LVRE 3RRYA 3B7GA 5LPNA 2QG6A 1UM8A 2IWRA 3VHLB 1Z83A 4MKHA 1G6OA 5G53C 3KKPA 2E9SA 1R5BA 1G3UA 6Q21A 4B43A 1X8KA 4ZDIA 1EXMA 3IQWA 4LJAA 1YRBA 2EWWA 1P5ZB 4HLUC 3AVXA 4OI4A 3KB1A 1W36B 5J4HA 2DWOA 3K09A 1T4GA 4C0BA 3K9LA 2VRWA 5AR1A 1IBRA 1NNEA 2I3BA 5DN6D 3P4YA 5DIFA 4LBVA 1GUAA 4Q18A 3SQXA 1RFLA 1ZJ6A 2WSSD 3I8XA 3OIVA 5DE3A 3VX4A 3ZVRA 1JJVA 2R2AA 3DM9B 1EFRD 1R7RA 1W5SA 3QUSA 2F7SA 1TQ2A 4DXAA 4WAUA 1E4YA 3SN6A 1FMLA 2DY1A 4TQAA 5LBIA 3VAAA 4MRSA 4D0LB 2AX4A 4O2RA 1YZQA 3IBGA 3BOSA 2IYVA 5SZKB 3K70D 4JIMA 5J4LA 3CH4B 2REBA 2CDNA 3B2EA 3VR1A 4MRNA 2H5EA 4JLMA 2W58A 4A1FA 3AKCA 1II8B 1Z0IA 3TLXA 1ZM4A 4LX0A 4A2QA 1Z28A 4UQOA 3QOFA 2DFKB 4HUQA 4RD1A 1SHZA 1YJ5A 1XPOA 2F9MA 2VPPA 3O8DA 1PVOA 1L7VC 4V0KA 2YINC 4QM7A 2IF2A 4RVCA 4DHEA 2FV8A 2QSZA 4JBYA 1RW4A 1ZD9A 2IYYA 1KJWA 3ADKA 1XTKA 1E9EA 2QP9X 2ASEA 3W34A 4A0RA 4LHXA 2O8BB 2DWPA 3U3OA 3A1VA 2OXRA 2XZOA 3T15A 3TQFA 4JL8A 4Z51A 4B3GA 2JLSA 1EK0A 1EX7A 1EWQA 4ITRC 3OIYA 2AK3A 1ZP6A 4JLDA 5HR5A 3CPJB 4PSKA 4TQUS 1MV5A 1A2KC 3R8FA 1JQLB 2RGGA 4I1SA 2IYRA 2AXNA 4Z8XA 1QHIA 4NCKA 2ZEJA 1D5CA 3W5JA 1XU4A 4EPVA 1GOTA 2ZAMA 2B7CA 3KQKA 2OLKA 1COWA 3MJHA 4RD0A 4NHOA 2GILA 2QTHA 3BH0A 3CWQA 2Q9AA 4C4PA 1IJEA 2YKGA 3VKWA 1LS1A 4CDGA 2FZLA 2F9LA 4DSUA 4EFLA 3BRWD 1U98A 3SDZA 4R71A 5CLLA 2PT7A 3SHWA 4DLWA 3I4LA 3QNUA 4OQXA 4D0GA 5FUWA 4D82A 2FJUA 5DI9A 1WXQA 3F0TA 4MGIR 1KI3A 5EE0A 3KX2A 4A6XA 2WBLC 2IA5A 1G7RA 1E0JA 1J70A 2HUPA 3L43A 1JR3D 4CW7A 1W46A 4Q4AB 2OCAA 3KXIA 1WA5A 1YZNA 4LHYA 2ORVA 5CJ2A 4CYMA 2OG2A 5CB8A 4DDUA 1GRNA 2OBLA 5CYOA 3WYGA 3K0FB 3K0SA 3UPUA 2A5FA 2EU8A 4B2IA 1T3SA 2YC4C 1G8GA 2RHMA 4OQMA 4LYHA 4WA7A 4F4JA 1DG1G 2A78A 2BCGY 2XNDA 4M1TA 4NDZA 3REGA 3GPLA 2F43A 1SXJE 3DHWC 4CEIA 2ECKA 2JLYA 2O8DB 5JEDA 3TH5A 3GLGE 4PFSA 4Q7MB 1Q57A 3B1WA 3NTUA 5CM8B 1Z3IX 3QXJA 4P4TA 4Q1DA 3X1WA 1GDDA 3L0SA 4HAYA 5FPKA 5K8TA 2D3WA 1CP2A 2PMDA 4JLBA 1TQDA 2FEOA 2YNMA 3WXMA 1AQUA 1OJLA 1UAAA 1JR6A 2ZRFA 1QG2A 3PJRA 2XXAB 1TU4A 5FPSA 3B6EA 3MWYW 1CS4C 3KFXA 1HV8A 1E2NA 3QXHA 1KK1A 2C96A 2I4IA 4XVQA 5JI2E 3OFND 1XCGB 2XZLA 2N1BA 5DHFA 1HURA 1OFIA 2CCKA 2YOHA 5LB4A 1UKVY 3KJGA 5JJKA 1U8AA 1SVMA 2IXFA 4B2LA 5B57C 3K0AB 2OESA 3AF3A 5KDOA 4LPKA 3AQ4A 1J90A 4BLOA 5KNDA 2V9PA 3PUWA 3THYA 4HAUA 5E7IA 1ZW6A 3NDPA 1HTWA 4W5JA 1KMHB 4B34A 1RZ3A 5BYKA 4FMDF 2JLVA 3UMRA 5GJWC 4MUBA 1C9KA 1KI9A 1Q1ZA 4ZDWA 3NBZC 3T1QA 3QI2A 3E2IA 1HY3A 4IKEA 5EZ6B 3DPUA 3GEHA 2CE2X 1DARA 1KI7A 1P60A 4C0HA 2N46A 4US2R 2GXAA 4HUQB 2VEDA 1OYWA 2VHUA 4TQ9A 4B3DA 1W0KA 2RGEA 3G5UA 2PL3A 3NDBB 3CRVA 1RYHA 3FTQA 2PMKA 5KSPA 3PQCA 2AR7A 3TSZA 2CVHA 5KSZA 5FTLA 3DKPA 2OLJA 5BWMA 3FHTA 1VKJA 1MRNA 1QHHA 2O52A 1DVRA 1Q12A 1ZIOA 4NE2A 1GM5A 1XEWX 2HT1A 3KB2A 5BN3A 421PA 2NOAA 4ABYA 4G5SA 4R9UC 1OSNA 2G3YA 4BPBA 1EFCA 3U7GA 1MRSA 4JMPA 4URZR 4V0NA 1OKKA 1Z6GA 3BAFA 4Q9LA 3EW9A 1KI4A 2ZJAA 3DM5A 4NCJA 2EFHB 3B5JA 3TVDA 4LJ5A 5EE9A 2OE2A 1DAKA 4X8LA 5JWHA 4TT3A 3VKHA 4K81B 4HDQB 4KODA 4GPTA 2F3TA 1N6RA 3L8YA 5AJZA 4Q1EA 4JVMA 2J7KA 1OB2A 2C5LA 4PTLA 2P6RA 3AH8A 1KK3A 2GXSA 4B75A 4C0KA 3ZVLA 2QQ0A 2EYUA 4BEBA 2GBLC 2OXCA 2IYXA 4LC0A 4Q9IA 2GHIA 4FCVA 2NG1A 2WWWA 5L8VA 4L16A 2P5SA 4JSTA 2F1IA 1QHXA 1P72A 2OO7A 4S35A 1CXZA 4E09A 3BXZA 3RVBA 3PEWA 3F5FA 4UJ5A 4NYMQ 1E2IA 3MJRA 1TEXA 2J7PD 1ZYUA 2DYKA 2J0VA 1PLLA 1E32A 2G88A 5FR2A 2JGNA 3VR3A 4MYUA 4TYNA 3I3SR 1M7BA 1RJ9B 2IK8A 4M1SA 1GL9B 1SVIA 2OILA 5C18A 3OZXA 4A0GA 1QZXA 2OFOA 4I1OA 4M53A 3BFXA 1XPRA 3GLIE 5M04A 1KK2A 2WAYA 5FTKA 2AKYA 3PUXA 4AK9A 2XOKD 3NEYA 1N6OA 1W0JA 5LDDC 4XVUA 4EPWA 5EE5B 1ESNA 4NBSA 1RRPA 2QY9A 2R6DA 2VP6A 1NIJA 4LK2A 1XP8A 5FL7A 1AZSC 4CEIB 4Q4HA 1Z0JA 1Y3AA 2ZSBA 5FI0B 4M1KA 3RWMB 3W6OA 2LCFA 1HT2E 4AKHA 3EG5A 4OK3A 1WMSA 4NYMR 4LHWA 4YMTA 3RS4A 1P6XA 1COWD 3MWKA 1Q21A 4D4JA 5KYKA 1Z29A 3AKYA 2GJ9A 3CRRA 3KTAA 3W90A 1N6PA 2H8KA 1US8A 2P6NA 1UADA 2ZETA 2ZRCA 2NO7A 4IVPA 1T5LA 2OFWA 3TVTA 2RMKA 4BFTA 3WMGA 4O0MA 5H8WA 1Z6TA 1XMIA 1Q1BA 1Z47A 4M1OA 3A1TA 2GF0A 3QSYA 2ZUDA 4ASUD 5C2JB 5DO9A 3ZD7A 1JJ7A 1D2NA 4PC2A 3DEFA 1GFIA 2IBMA 2WWGA 3EZ7A 3SHFA 3I32A 4KBFA 1KSGA 4ACAA 5CIWA 2GAOA 4AKEA 3I5XA 1HT1E 3EIQA 5CYPA 2GAAA 4AYWA 3G82C 2O0JA 3THYB 2QQEA 3QF4B 1UKZA 3AV0B 1GVNB 1SZPA 1TTTA 5KSYA 3DZ8A 4URVR 1W49A 4IXNA 1NSTA 4XIGS 3THOA 2BEJA 4Q1AA 3GMTA 3GLFB 1E1QA 3ICEA 1E69A 4F92B 2EYQA 1QVAA 2QP4A 3HU1A 1XB2A 4RZUA 1CEEA 1O87A 1E2DA 2XNDD 4B48A 5KDDA 2WMOB 2YV5A 1R8SA 3WHLA 1WBBA 1GNQA 1KK0A 4BLTA 2P2LA 2FA9A 3RHFA 1XJ0A 1MH1A 1E9BA 4NONA 2B21A 4QRHA 3GCGA 5HE8A 1A1VA 4LYFA 2YZ2A 3EPHA 1N6HA 2RCNA 2VHJA 4WW0A 5EE1A 2BVNA 3NG1A 1E2HA 1OXSC 2IYUA 3AM1A 4IOJA 1KNQA 3ICQB 4QGFA 2IXEA 5IRCD 2O5VA 2RGBA 1BMFD 4UXJA 3IIMA 2WIAA 2ZXUA 4BZPA 4WBSA 1N25A 2GVZC 2ORIA 4KVGA 3S1AA 2AKAB 4TWZA 1XCMA 1XDBA 4M21A 4GMDA 4FW9A 3VR2A 1YR9A 4LY6A 3J81k 1OHHD 3SOPA 5H70A 4TN1A 4DCUA 5IK2D 3HR7A 2O8EB 2W83A 2KSQA 2G0NA 3EZ9A 5BYJA 3WNBA 1GP2A 4EFMA 3QKRB 4MRPA 1N0UA 2QGNA 1Z0AA 3GEEA 1TU3A 3W8RA 1XBTA 4BZXA 1S3SA 4MQBA 1H8EA 3RYTC 5L3QA 1YVDA 3RS7A 4CEHA 1FP6A 1IQPA 1N5LA 2PCJA 5DN6A 3JZAA 5HCIA 2IX3A 3U3KA 2KBEA 3AB3A 3AVQA 5J40A 4BGDA 4BRWA 2WSSA 1U99A 1BYUA 2MMCA 3X2SA 3ND8A 4G1UC 4JLKA 2JCSA 5FTJA 2B92A 1KMQA 2CLCX 2HCJB 2HV8A 3PEUA 4M1YA 2IHYA 1JECA 4TZ6A 4LJ9A 4QBGB 1G5PA 3EZ6A 5FOSA 3IILA 1ELOA 3R9WA 5C46F 2BBTA 2AD1A 2P6UA 2V6JA 3FKSD 3SFZA 3K8YA 4MGZR 4KO8A 4V03A 3NIBA 3EIHA 1NIPA 1NSFA 4G3XA 1VTKA 1RRGA 2QEQA 5TDHA 3KXKA 1ZINA 3T5GA 3CRQA 2NTYC 4FD2A 3TE6A 1OKKD 5D3MA 1UF9A 2WAXA 1MO3A 4M1WA 3IPXA 1AS3A 4QHTA 3D31A 1L4YA 2BIFA 1HQYE 4ARZB 3OAAD 2ZPTX 3LWNA 4D80A 3V4RA 4R2HA 4ZPXA 3ASYA 4ZCLA 1TF2A 1DADA 1FX0A 1LNZA 5FOTA 3L0OA 1DO2A 3MLEA 4BFYA 1EFHA 5JRJA 1YZGA 4C2TA 1K5GA 1XMJA 4AKGA 2IYTA 4QFMA 4FXPA 2VQSA 4WXPA 1P2TA 2CK3D 1UEJA 2UKDA 4JLAA 2XSZA 2FEMA 2ZI9A 2PJZA 4B3CA 1OFHA 4P0TA 3IEVA 4Z1MD 1N5KA 4XWKA 1UKEA 2H18A 3ND9A 2WKRA 4AD8A 5JS7A 1IXRC 4V0MA 3UG6A 4TYQA 4TLDA 1AKEA 4ESHA 4W7SA 4A6PA 2DB3A 2QPAA 3H4MA 2QBYB 4A36A 3MRSA 4ZIRB 1XD2B 3TNFA 1XXHA 2QENA 3KDSE 4TZ0A 4Q9HA 3RRZA 1XZQA 3THWB 2ZRIA 4B74A 3HPRA 4IDNA 2QMOA 2NPIA 4P4SA 121PA 2VBCA 3ZQ6A 2IC5A 3MMPA 1OE0A 1S8FA 1X8JA 2CL6X 1ZD1A 2AWNA 3LO5A 5ANRB 3V00A 2V1UA 1DAHA 1FPMA 2AWOA 4PR0A 2QAGA 1W0JD 2I1VB 2CHQA 3AP3A 5LB2A 1YQTA 2R65A 2JLZA 3K0CC 1CJKC 5CJPA 5FL7D 2OUKA 3EPKA 1G17A 4M2LA 3FWYA 1XTQA 4NPHA 4JKYA 1QDEA 4AG5A 2H17A 5F9FA 1ODFA 5A4JA 1IY0A 5IT5A 4RD6A 3BC1A 2OV2A 4TLCA 3E1SA 2WWXA 4D2IA 4C2UA 4P3YA 2J46A 3G0HA 5UKDA 5FBVB 5AUQA 3LLUA 4JLPA 3K9GA 3FVQA 4FMBB 1AGRA 2ZRLA 3UIEA 4EDHA 1NVUQ 3DOFA 3NEJA 3H2YA 1G8FA 4KFTA 2IEYA 4MKGA 2O8FB 4BFZA 4QL3A 5B58C 3GLFE 2ZE6A 1KDOA 1VYUA 2GCOA 1GIAA 1F3OA 3AVUA 1ZCBA 2CL0X 4L4UA 4TTQA 1KJYA 5DLQC 1KHTA 2Q0HA 4OYHA 4HAXA 1GILA 1SVSA 4B6FA 3U4QA 1KI1A 3OEHA 2AL7A 2VP5A 3RS2A 3ZZTA 1LF5A 3C7KA 1E6CA 2GXUA 4IW3B 4BFUA 1SQ5A 1TAGA 1Z6XA 1E1QD 1U94A 1X1RA 3BBPA 4WIAA 1KI6A 3QG5A 5KO2A 1F5NA 1TADA 4KHZA 1C1YA 1X6VA 4EPXA 2WSMA 5L3QB 3PEYA 1U2RA 3OFNA 2WJVA 3TAUA 1OT3A 3U7FB 4CEHB 1XJCA 1Z07A 2JIZD 3IGFA 1EFTA 2QUZA 2R8RA 2A9KA 2Z0MA 4DEYA 2FSGA 1N6IA 2ZRGA 2MMGA 3KZ1E 1Z63A 1XTIA 3B8HA 3CRMA 3GJ5A 1IM2A 2Q21A 1A5TA 4TMZA 3GJ0A 4HATA 3KXLA 1SVLA 3LY5A 2ZR9A 2XITA 1WCV1 2CVFA 3LAWA 4KVAA 4AWXA 2FGKA 2W2VA 4KAXA 1DEKA 2ZJZA 2G9NA 1VYVA 4KSCA 1RVDA 4LSGA 5DH9A 5G3ZA 1XEXB 1GSIA 2J87A 1IY2A 3I92A 4Q9KA 3RWOA 3L0IB 5HE9A 3SE0A 3KKNA 3FB4A 1YZTA 3R7WB 1G8YA 1E4VA 1F2TA 2DPXA 2QPOA 3MUFA 3CF2A 1Q0UA 3ZJYA 2ODNA 1AK2A 2JEOA 3IHLA 4CVNA 1FUKA 3CKLA 5BW8A 3LBNA 5HZKA 1RKBA 2ZS7A 4HDOB 1P9NA 3A1UA 4TL9A 5TB5A 1H8ED 3GJXC 4RZXA 1FFHA 3H0KA 3U3JA 1JALA 3LLMA 3ZZ0A 2ZJ8A 2QRNA 5H1YA 2O0KA 3H1TA 3C15C 1Z2AA 1OXTA 3ZIAA 4IEIA 3TUIC 3TQCA 2XAUA 3ZZUA 1CJTC 4JZKA 4N0EA 3A4NA 3VU9A 4FMDB 4ZCMA 1CIPA 4PANA 1G64A 1DOAA 1E2MA 4PSAA 3O8CA 1XXHB 3PXGA 2PZGA 5DYIA 3MAAC 1LVGA 1A2BA 4IEEA 4B76A 2J0UA 1TPZA 4P4SB 5JSZA 1GKIA 2GEVA 4IOMA 5FOXA 4BFSA 3T61A 3IEUA 1G7SA 3B60A 2EFCB 2PX0A 3EWSA 4LYAA 3LRPA 3PEVA 3SJBA 4DT1A 5L3RA 2UVQA 1XD9A 4Q02A 4LHZA 1OXVA 2Q6TA 3VTKA 5FI1B 3NH6A 4Q9JA 2VP4A 2PZFA 1W2HA 1MABB 4TMKA 3TBKA 2RGXA 4YDSA 1AN0A 4C0SA 2J7PA 2QROA 5J4YA 3BD9A 2QZ4A 2BMFA 2W2XA 4QOSA 3BFKA 4BFVA 1D9XA 1KZ7B 2UZ3A 3CONA 1ZUNB 3CPHA 2ZTSA 2ZUBA 4MYCA 4ZKEA 2IXGA 1P9WA 3CNNA 3RS5A 4DWJA 4JL6A 1S1CA 4IDHA 2XSZD 5DI3A 2YHSA 3TK1A 4TMVA 4BZQA 2CJWA 1NN0A 4KLZA 4PPQA 3OIUA 3T5DA 1G19A 3THXB 3B82A 2VH5R 1G4AE 2V4ZA 2JAQA 3DOEA 2XOKA 3BB4A 3MWLA 1W47A 4N0DA 4GRAA 2ZI4A 3U6KA 2LKCA 5BXQC 3B85A 4XSGA 1J8MF 4LC1A 3WNDA 1T5IA 2QORA 2XTMA 1DG3A 3ZH9B 5FH9A 4FCWA 4DSOA 4F7WA 4L9SA 3GLIB 2G6BA 5J47A 4IJMA 5F2EA 2WOJA 3ETLA 1IAQA 1C4OA 1Z22A 1CU1A 5E7JA 5FBRB 1VG0B 2WWIA 4GDFA 5CM9C 3HDTA 1MO6A 2BMEA 1JI0A 1NLFA 4PQRA 4E03A 4RFSA 3MSXA 1Q22A 2EWVA 4EJSB 2DBYA 4ASUA 4BQSA 2FPMA 1AKYA 5JJIA 4YQFA 1U9IC 1G1MA 3HR8A 2WOOA 2VYFA 1O3YA 1NVWQ 2C04A 3KJHA 4G5GA 3NKVA 4DKXA 1JAIA 2FH5B 2LKDA 4A8JB 1OYYA 1G7CA 1F2UB 5KHOC 5KNCA 3L8ZA 2XTZA 4X8MA 4G5OA 1NP6A 3GQBA 1IXZA 2OHFA 1NJFA 1CJUC 2LWIA 4P32A 1NY6A 1NVXQ 1P2UA 2F1RA 1SXJC 4GNKA 1YR6A 4PPFA 4C0QC 2C99A 1U0HC 5J4VA 1EESA 1AS0A 2EQBA 1LV7A 3MFYA 2CNWD 2WJIA 2RGNA 4RD4A 2QGZA 3NH9A 3EA0A 3X1XA 2QI9C 1G21E 3GLHB 3KKMA 3QKSA 4PC6A 2GCNA 2R6AA 1SVWA 1QRAA 1RIFA 1Q44A 1E79D 1HYQA 3TUZC 3IKJA 4IVQA 2GK6A 4Q4JA 5FUVA 4DDTA 2HDNB 4EPYA 3OEHD 4OHVA 1S2MA 2BBOA 2QNRA 4Q1FA 5EP1A 3CX6A 3B1VA 2WICA 4MGKR 4QBHA 4YMVA 2BBWA 1CR2A 1OIWA 1NN3A 4ZDKA 3UKDA 1Q1EA 1W4BA 1BMFA 4HZIA 1NF3A 4UNQA 3C8UA 4YMSA 1CF4A 2X77A 1P4SA 5TV2A 2BJVA 1TUEA 5EUMA 1HA3A 1IN4A 2ZRPA 2QA5A 1VCNA 1E98A 4Q7LA 2ZS8A 3BJIC 2A5DA 1NBMD 1YZKA 1OHHA 3C4JA 3CB4A 4CEJA 1A7JA 3UANA 3QIAA 1E0SA 3QBVA 1ZIPA 5IK2A 5AUNB 2B6HA 3MG9A 4HLCA 1K5DA 1KO5A 3O8RA 2OT3B 1TQ4A 4DB4A 2YWGA 3KJEA 4B71A 2GRJA 1WF3A 2O0HA 1ZCAA 1J99A 4TTRA 2QM8A 3DMDA 5AJXA 5GJCA 3CO5A 4PQFA 1W4AA 1K8RA 1OFTA 4PHHA 5EP2A 3NXSA 5JSZB 1W36C 2V1XA 3IPYA 4YC7A 1WB9A 4BLSA 1Z06A 2NGRA 3GJ3A 4HLQB 5TXGA 2GNOA 1SKYE 2A5GA 5D3QA 3VQTA 1DAGA 4OQNA 1KDRA 1D2EA 3MCAA 3T1VA 4OHYA 5L3SA 1IN6A 3ZYCA 2HEIA 1PZNA 4B3FX 1FNNA 1KY2A 1TF7A 2CLDX 3SJCA 3H84A 1Z5ZA 2C77A 2V7QD 3Q5EA 1D2MA 3CX7A 2AN9A 3K1JA 4JBXA 1E0KA 4U02A 4FN5A 1G8PA 1M2OB 2KI5A 5AK0A 2VO1A 2Z5FA 2ZQ5A 1XXHE 2XB4A 1WE2A 4GOXA 3FKSA 1IY1A 3QENA 4BFXA 4FINA 4ZDJA 1IN7A 2GEDA 2VHTA 2C78A 3QEJA 1SHKA 1J7KA 1U90A 2P67A 2ZJBA 3ZIAD 3AF0A 2NO0A 1XNJA 4JSYA 4NU0A 4PC3A 4HB3A 2W6JA 3HP1A 2F55A 3OAAA 1AZTA 3NBFA 4MITA 3UMFA 1KYIA 5B30A 1G3IA 2ODWA 4A0FA 1JBKA 5FOWA 4KLNA 4POAA 3B9PA 4LBZA 2PLFA 2ZAOA 3M4YA 4UNSA 2HYDA 3LNCA 2ZIAA 4Q7JB 2QM7A 1CJVC 2HXSA 2UZIR 1AQYA 1JR3E 3TAHA 3X1DA 1ZNXA 4XH9B 5CDFA 3TUJC 3H86A 2CK3A 2FX3A 1OF1A 4UNNA 4H9GA 5CB6A 2IHBA 1L4UA 4BECA 4HSEA 1YU9A 2J3EA 2ONKA 4Z1MA 2I1QA 4IVRA 4A2WA 3SYLA 5JJLA 3CNOA 5FOUA 2IYQA 2VP9A 1R4AA 1NMZA 1YHNA 4MRRA 1X1SA 4PZZA 1G41A 2BMJA 1DELA 1IHUA 1KO8A 3GJ8A 4GI7A 2ZU0C 4P33A 1TL7C 2ZE5A 4TL8A 1I4DD 4OHZA 1ESMA 3UMSA 4HEJA 5JBQA 2PX3A 2ZS9A 4M8NE 1Z0KA 4O2LA 521PA 3SBEA 5HPYB 3AF1A 1GRRA 1L8QA 4EJSC 2H92A 2GK7A 1EFUA 5EJEA 5TY0A 1RRCA 2V3CC 3FYHA 2E1RA 3DVLA 3LW8A 3EIEA 1IN5A 1IONA 2C9OA 4MKFA 2GJSA 2F43B 5EE3A 3QKSB 4EPRA 4Q19A 1UBEA 3RLFA 4QNMA 1WDTA 4A8JC 1G5RA 3DL0A 2FPKA 4II7A 5P21A 5CITA 3QKTA 621PA 5BQ5A 3B78A 4M9ZA 721PA 3PCRB 3I5YA 3Q3JB 4FMCF 2GCPA 2B7BA 3EZ2A 4HLUA 1OIXA 1NKTA 3JZMA 5CLQA 4QKQA 2VP0A 2Q9BA 3B1ZA 3DMNA 4HI0E 1MT0A 2JATA 3VX3A 2P5TB 1G3MA 4NH0A 3W9YA 4GOKA 3PUYA 4C7OA 1JPNA 2AFHE 1UDXA 1P73A 1WP9A 4EFNA 4DLXA 1AGPA 1PLKA 3IIJA 3TRFA 1U8ZA 2REXB 3NBXX 1FUUA 2YC2C 4C0LA 1XD8A 1ZNYA 4HB4A 3HYRA 3NVAA 1J8YF 3QE0A 4OBEA 4TTPA 3GLHE 1I2DA 2FFBA 1R0XA 3E5HA 3FMPB 4M9QA 4NL4H 1R5OA 3U5ZB 3I62A 3W3ZB 3SI7A 5JCPA 4QBIA 3NC1C 4TL6A 4DVGA 2GZDA 1S9HA 4TLBA 1GG2A 3BH7A 1U0JA 3K09C 3LQQA 3CM0A 1BH2A 4AC9A 2CLSA 2R44A 4JS0A 1UEIA 3UATA 3WP0A 4QGHA 1ZU4A 2J1LA 1TMKA 3SYNA 3CIOA 2JIZA 4B3XA 4F91B 5KSOA 3AP1A 1Z2CA 2G83A 3PUZA 5CK4A 4M4SA 3EC1A 3FHCB 2ZVPX 2G77B 4TMTA 4DCVA 1QBKC 3Q8XB 5JHHB 1QHHB 5BN4A 2D7DA 1PUIA 4AI6A 3EPJA 4MUAA 3PVSA 4D6PA 1UBFA 3T34A 3FMFA 4IDQA 1II0A 2GVDC 1FQKA 2ZROA 3A36A 1NI3A 1KAGA 4O3MA 1P7CA 2HF9A 3WBJA 4M9SA 2CCJA 4OQLA 4PHFA 2O8CA 1WQ1R 2BEKA 2WWHA 1NRJB 1JEDA 1UBCA 2HCBA 2ATVA 2JLWA 2KJQA 2FFHA 3LXXA 2X1VA 2ONJA 2MSDB 1ZD8A 2B8TA 1AS2A 2BOVA 4ILEA 3LBIA 5GJVC 3SZRA 2QT1A 4Q00A 3GJ7A 3UG7A 1E9CA 4DC9A 2J9RA 1N6NA 1P2SA 2WJYA 2ORWA 5FPYA 1R6BX 2IYWA 3AUYA 1OB5A 3QG1A 2JLXA 4YMWA 3RC8A 1NVVQ 1N0WA 2RHDA 1M6NA 4X8OA 3O47A 3SJAA 4GFDA 3KQNA 4XTCS 3DDCA 2FNAA 2IUSA 3PITA 4QJ5A 3AF4A 3UXMA 2GETA 2D2EA 1HE1C 3D3QA 4XD7A 1GL6A 1E1RA 1II9A 4KU4A 1M8PA 1GZSA 2QMHA 4M1MA 4JLNA 2HJGA 3NHAA 3GLGA 1HQCA 3W8NA 1KZGB 3D7MA 2ZRKA 2AK2A 2C8VA 2KB0A 2QN6A 4LJ4A 3TGPA 4NYIQ 1NN5A 1VPLA 3M6AA 4NCIA 4RFVA 3OF5A 3ZVNA 1NMYA 4K8OA 1VCMA 4DB2A 1CR0A 1E3MA 4LDJA 1XEFA 2W6JD 3M1IA 4TYWA 3EAQA 2REOA 1ZBDA 2MSCB 2JDIA 5KDLA 4Q4HB 1J2JA 3KFVA 1NVVR 2WWFA 2P3SA 4JJZA 1L2TA 2WJJA 3KKQA 3SNHA 2GJ8A 2YWEA 1T6NA 4OI2A 1F60A 3LXRA 3KTAB 3QPWA 4HDCA 1GNPA 1US8B 4B32A 1KDTA 2AFIE 2ZYUX 1XX6A 3BFVA 2H16A 1KTVA 3R9IA 2IEZA 3ZD6A 3FKQA 4RCYA 2ZREA 4IOKA 1E99A 3KQUA 4NYIR 2Z6VA 3U44A 2HT6A 2F6RA 1DBSA 1T3HA 4B35A 1UKYA 3UK6A 4LV8B 3PV0A 4HLDA 3E70C 3CR8A 1BKDR 2ZRJA 2A5YB 4BRUA 1GKYA 2AXPA 1ZNWA 4Q4LA 1N0VC 2J0SA 2RKOA 3SFVA 2FZ4A 2AD5A 1AM4D 4OI1A 2YJTD 4US0R 1F6BA 4A2PA 4L9WA 3VFDA 4WOPA 4F4IA 3KJIA 4GSYA 2WPDD 4KYIB 2CBZA 2ANCA 4UXHA 3QQ5A 4R2IA 5DNYB 2G1KA 3IO3A 2A2ZA 2IS2A 3ADDA 3T1TA 1VCIA 1ANKA 2WHXA 3NC0C 1TUIA 2F1JA 2ZRBA 4Q48A 4WZBE 1P62B 3LVQE 4CGZA 4IOLA 3PG5A 3CWZA 4DZZA 1RYFA 1AA9A 5E7MA 4QHSA 1OH8A 3MGCA 4W5HA 4BASA 2VHQA 3RC3A 1EWRA 2OZEA 1UPTA 3BE4A 1I2MA 1II8A 1M1YE 3HPQA 4ON9A 4KBGA 3WY9A 1JEEA 1E2JA 1PLJA 3T06B 2BC9A 5L3VA 1W2GA 5A5GA 4FWIB 1DTSA 4URXR 4KI0A 2ZU6A 4MYHA 4V02A 3LDAA 3F3YA 3DKVA 2CNWA 4NYJQ 3S1AB 3ADBA 4DJTA 2OBMA 4C30A 1QHSA 2D62A 3WBKA 1NG9A 2ZI6A 4BLRA 2VA8A 2XEXA 4QG7A 1KKMA 2NZ8A 4DLZA 1TF5A 2OAQ1 2BHRA 3ZGXA 1E79A 3N2EA 3WP1B 2O8BA 1XTRA 2OCBA 1A82A 1MR3F 4PO8A 2DFLA 2ZRAA 1PV4A 4RCZA 2CHVA 1GAJA 3K0EA 1OV4A 3EARA 3GFOA 3RAPR 2GBLA 3GD7A 4NP6A 4RD3A 1OH7A 4UNPA 3AVYA 3I72A 5CIQA 5H68A 2XB2A 1M74A 3CW2A 4RD2A 2WWYA 4LJ7A 4IFBA 3FOZA 3AKDA 1S3GA 2ZE7A 4FI3C 3EWAA 3ECCA 4NYJR 3SR0A 1XZPA 3OE7A 3OESA 3C41J 4JYCA 3C14C 3X1YA 1NBMA 2L0XA 4GZLA 3SU8A 3B13B 2YWHA 3CBQA 4I99A 3LD9A 3A4LA 821PA 4XWAA 1K6MA 5K8UA 3A58B 1OH5A 3U6BA 5GVSA 2BJWA 2Z43A 1FP7A 4QNRA 4YMUA 3K70B 3ZS8A 4JLVA 2GJAA 3GP8A 4KV9A 2QMEA 1JAHA 4IHQA 1R0WA 3P1JA 2YOFA 3Q85A 4JLJA 2YVUA 2FGJA 5D3MB 4TYYA 1XFAA 2HXYA 4EUNA 2R6FA 4PC7A 1DAMA 4K46A 1N6LA 4YXWD 3VKGA 5DSZA 1XMVA 4Q4AA 1YR8A 2BM0A 5CDFE 4BLQA 1JXMA 2XJ4A 3C5CA 2ZSFA 2J5XA 2ZJ2A 3GJ4A 1EG7A 3K0FA 1G18A 2FSFA 3CUEF 1FX0B 2V7QA 1ZRHA 3AGQA 3U3RA 2ZUCA 1KAOA 3LX5A 5AWFC 1KSHA 3BIFA 2HF8A 4TMWA 5IF9A 1CBUA 4QM6A 1SKYB 1RC8A 2ZR0A 4MA4A 4NCHA 2A30A 4WVFA 3GJ6A 3DO6A 3EXAA 4B44A 2ZJ5A 2O8DA 1TQ6A 1XF9A 4DDVA 5HCNA 4IDPA 4CRWB 1CULC 1UDWA 3U44B 1E2FA 2R9VA 3QF7A 4N1AA 4B33A 1YKSA 2WMNB 3VR4A 4D4KA 2XXAA 4URUR 4DLRA 4XD7D 1E1RD 1SXJD 4JL5A 1G6HA 4LGMA 4U7DA 3CH5A 4EQ6A 2VF7A
chains in the Genus database with same CATH superfamily
3O0TA 3FR7A 1FW6A 4Q7KA 4HB2A 4V0OA 3ZVMA 1RPTA 4ZKDA 1OA0A 3FDZB 1E2PA 4M9XA 1EVQA 1NHWA 1F48A 2PLRA 1D1SA 2F1HA 1ZH6A 4CQMD 5CEFA 5J2TA 2CB0A 3VGJA 4C3OB 2HU5A 4E5PA 2I29A 1C0PA 1UINA 3AVPA 3CO0S 1H6BA 3FTPA 3RD5A 3NUGA 1RKXA 3B6MA 1Y9DA 4RK1A 3ZTYA 5C1OA 4XLZA 2QTLA 1KMHA 3G2LA 3QFSA 2PZJA 3WQSB 4EUHA 4IIJA 4KN8A 5H83A 4PZYA 1Q1NA 1BE1A 3T9DA 4TTAA 2JFHA 1KOJA 2PWBA 3DHVA 1U4OA 2PEYA 4TTVA 3EGOA 2F3SA 2X0RA 4YCCA 2I3ZA 5HDBB 2PZEA 9MHTA 1ISFA 4N0QA 3GBPA 13PKA 4B3BA 5KWJA 2XGJA 1VCOA 2FSIA 1FFAA 4JP5A 5IMBA 4OSPA 1TXGA 2E6KA 5DTMA 2ZM5A 3GGJA 4FFOA 4L5AA 2JCGA 1ZHOA 3CLSC 1KZ6A 3EG9A 1EX1A 2GPSA 4FIZA 3D3KA 4H1UA 4I46A 3KD2A 5CVEA 3UC5A 4QJ3A 1U31A 1M76A 3UHJA 3FTFA 2IDZA 4BAGA 4DC0A 1CY1A 4MVJF 4IJVA 3A6KA 3QVJA 2QJRA 4DMKA 5HIKA 4QGAA 4Q4CA 3U4QB 3DNPA 2GF9A 2P27A 4MQUA 3BEOA 4KJZA 4IKOA 4PQYA 1N3BA 3CZQA 3I2FA 3E3NA 4DUPA 3ANYB 2ZTUA 1FVHA 2FG5A 3LCUA 4E1VA 1NL3A 2YZNA 3IDQA 3OJOA 3DOUA 3A1EA 4YPFA 4H60A 1QRDA 1U5BA 4PZAA 2ODBA 4H7EA 5FBKA 2J4DA 2CGEA 1T91A 1UFQA 2VF8A 4KUHA 4UUBA 2D2VA 3OPMA 1ADBA 3Q1LA 5IW8A 1KH2A 4L5BA 1RMQA 1I0LA 5LQJA 1F12A 2JJ2A 2V7VA 3HKDB 4MMZB 4KR2A 2VIIA 4FNOA 1QV7A 3UAOA 1XCPA 4JLWA 1W581 5KX5A 4AO7A 1KSJA 3ADCA 2NPFA 8OHMA 5C3UA 1EUDA 4BB6A 1QH0A 5KNBD 1VKOA 4MB0A 4QTYA 4HX9A 2BZSA 2HJVA 2H11A 5EI5A 5J5CA 4BYGA 3M0EA 4NK5A 3AONB 3OLQA 4DUGA 4JFRA 5IUNC 1UPBA 4TSFD 4H3VA 1LY1A 1MIOA 3RRNA 4W5QA 3QUBA 1GVHA 4ND5A 4UDXX 1BWPA 4IHJB 1PEYA 1LSSA 2A0YA 4WEOA 5AW9A 3RUFA 1KEEB 3A2NA 4JC8A 3CR7A 1GGEA 1E5LA 4G9GA 1ABEA 5IKEA 3H0CA 1Y6ZA 4Q34A 2W4IA 3K6KA 5BV7A 3E61A 1TLTA 3K53A 3QU7A 4FTWA 4RNDB 4UEKA 3S68A 1UOPA 4JIGA 2BCEA 5HQ3A 1ZW1A 4X8HA 2B69A 5EXPA 2PXHA 3EPLA 3PXDA 2O3QA 2J07A 4B3MB 3FCUB 1F2TB 1VG9B 1I7NA 3H0EA 4P31A 4UM8B 2VK8A 2B1RA 2JJYA 1MIHA 2P6PA 1Z0FA 2JLRA 3HHEA 4PIMA 3NR2A 4RHFA 2GJKA 4YALA 3R9XA 1MQ9A 4F6CA 1IM8A 1Y7HA 4L15A 3BULA 3SBDA 2V8OA 1AO0A 4M8SA 1DFIA 2H4ZA 1GDTA 3VSBA 1PYGA 3V4FA 4MJLA 1YDEA 4MUYA 4EHDA 4HYQA 3UPDA 5DP2A 1QCCA 1RKQA 2P35A 2I6FA 4NCXA 3OE7D 4OXNA 4TM7A 1JUDA 2CHGA 5EJMA 4ZWNA 1Z4JA 1I1HA 4D25A 4E11A 4UHBA 2FRVA 2AMLA 3IQZA 4OQFA 1BCSB 1Z7YA 1ACLA 1DDGA 3VUFA 1ZU5A 3Q7EA 1Y6QA 2C5HA 4UUAA 4CR8A 3GEDA 1JNXX 4OJQA 2BHTA 1DO0A 2OSVA 4YI3A 2F8TA 3IR7A 4GWLA 3HACA 3F5DA 4EQ6B 3OC0A 5LMCA 3R5SA 2H2IA 1L5MA 3ONWA 3E7DA 2H3HA 5FL3A 3R75A 4NWIA 4KWHA 2ODAA 3ZHXA 1NXPA 3ONDA 2GT1A 4M55A 3V4LA 5C1BA 4PLYA 4K88A 5HKKD 1RC0A 3DF7A 4JMLA 4ZEXA 2FI1A 2FWPA 4MRVA 3RNLA 5NULA 4AMVA 4AS3A 2JLQA 3V8PA 1NLMA 4BWYA 1XCBA 2EW1A 2LCIA 3PPVA 4RSGA 3BD7A 4RGQA 1ZVVA 3PE3A 4WXRA 4E21A 4EHIA 2R8EA 3RDPA 4TLMB 1T8TA 3GY0A 3JRNA 1E9SA 3S29A 5H82A 5I45A 2FUG1 3WMFA 1BXRB 4HTFA 3L7OA 4YCAA 1H4QA 1ZCJA 1WD7A 4HNQA 2ZRMA 1TCBA 2Y1WA 4LBWA 4LZNA 3JARB 3GLFA 4J7CA 4JUIA 3OWXA 5JH7B 4G07A 1R6DA 4UHDA 4YRCA 5ED0A 1VYTA 1L7NA 1PR6A 1RPNA 4HEA1 4IS3A 3VR5A 1JNYA 2W6PA 1T6XA 3FKJA 3D0KA 3CEAA 2JD2A 5TEWA 3WL6A 3NIGB 1U3VA 3Q7PA 4H1TA 3TGWA 2GKOA 3EVNA 3GVPA 3QW2A 1VG8A 5D7NA 4UBLA 5EESA 3ZDCA 1FMFA 2P40A 4RELA 1GRVA 4BBAA 2NO9A 3OZVA 4NAHA 2BAGA 3CH7A 5DYGA 4FOOA 4TRRA 4J1QA 1KBQA 5F2OA 4CIBA 3QUQA 4PYOA 1DEXA 3VR4D 2J6HA 1QP4A 4OU4A 3D7NA 3RF6A 3D2CA 1NQUA 1N2CB 2NAPA 1KBOA 1CUSA 2JI9A 2XB9A 3ASZA 4YGYA 1W44A 4DJAA 2FXVA 4O59O 3ZQJA 1NKSA 1LBSA 2ADOA 1QQTA 2BM1A 4UM7A 2DH5A 5J1SB 1G4UR 1TZ2A 3IAEA 4JQZA 4O2BB 4N3GA 4PINA 4U7TB 4W8HA 3AUKA 3OZAA 2IEIA 1DRJA 5C4GB 1KIFA 2AI3A 2JA1A 4R05A 2X9LA 1H66A 1I4LD 4FYXA 1A9XA 2V54A 5H5JA 3QVMA 3GA7A 1AK9A 2G0TA 2IKQA 4BQFA 4ER7A 5BXYA 1M1UA 5EKUA 3ILXA 5DM4A 3SZOA 4FZVA 5LWQA 3SY8A 2JNWA 2Y3IA 4PAMA 5BQXA 1NG1A 4WWHA 4B5LA 3I6QA 2FG7C 2VNAA 3HXMA 1W88A 2OV1A 3BILA 4XJXA 4WACA 3LPMA 2WRZA 3VOSA 3UMVA 2HU7A 3OQIA 4U7GA 2XKJE 4KN5A 3H16A 3WYAA 1V2GA 2V6MA 4IGKA 4KRGA 3RSLA 1A76A 1OU4A 1FDIA 2B5OA 4H1VA 1RJEA 5JXIA 2JBWA 1EG2A 5DWDA 2BJHA 1OFVA 4BUZA 1BWSA 3A2LA 3OOYA 5IM5A 3T35A 4FIDA 3NOVA 1K8YB 4P0QB 3AHGA 4UDYX 4XRGA 2PKQO 1DIAA 1GCUA 1LFDB 5MHTA 3KSAC 1ZWLA 5C8XA 3TLJA 1GUZA 2Z5LA 4D9KA 2BFOA 2C42A 3A37A 5B12A 3IQFA 4MRAA 4EG8A 3KOYA 5JDIC 2A5JA 3O1JC 5C3MA 1YVUA 4RTMA 3LTNC 1GLGA 4WESA 5HNKA 4U7FA 2HMSA 3D6VA 5EJIA 5CA1B 3E05A 1OLOA 3BJEA 2C98A 4FYVA 1QIGA 2ZITA 4K6MA 3IRUA 2VJMB 1YQGA 1OYVA 2WINI 3T4PA 4CI0B 2JEZA 1RQLA 1EIWA 5JEEA 4DC1A 1NBME 1IUPA 2YOGA 2MTBA 4H31A 2BFBA 2GTHA 3VYRB 2UZAA 4RLFA 1TLLA 4HDNA 2C2XA 3DCJA 4G9BA 1R37A 4Z9BA 4A03A 4M98A 4LNHA 5EQTA 3O2QB 4A7PA 1USGA 3RTCA 3KZMA 1LS6A 1WIWA 2Z3WA 2RJOA 3BJRA 1MAWA 2G9VA 3BMOB 3KYDA 2YRXA 1ECPA 1PQUA 1XWIA 4INAA 2V74B 3U26A 3ZGZA 1KR5A 2PGOA 1E61A 3DTVA 1E9FA 4H17A 1N2BA 1NW3A 3NBAA 2ZYRA 1D2HA 3FYUB 5IDVA 4GZ3A 1UJ2A 4CIDA 4MGYR 3JQCA 3TX6A 2ERYA 1HQDA 4NEGA 4B3IA 4PC1A 4F38A 5A4FS 4RDHA 1DJNA 1CHDA 1T3LA 3K72B 5T7BA 3JY6A 3MUOA 4MKXA 3S2IA 3N7AA 4ALJA 1WLYA 2XE6A 4BVLA 4LPSA 1JXAA 3QU2A 2YXPX 1KMIY 3Q12A 1HRKA 2AEJA 2E48A 2Y9MB 1B23P 1U7DA 2AG1A 4HY3A 3SC2B 3ZNPA 5LZ9A 3O03A 3PC8C 4OUDA 4B4UA 1VJ0A 3ED5A 2ISSD 2LE0A 1LTKA 5E6SB 1P4GA 2P5UA 1JBEA 3ACCA 2NSJA 3FETA 3PIRA 2QTFA 5GY7A 3TSOA 4C5CA 2AB0A 2CFRA 1XD2A 3BGWA 3ZDQA 1TKCA 4ZIRA 3PNQA 3EXEA 3BWXA 1XWWA 3RNOA 1G2QA 1L3IA 2RGAA 2Y92A 3JQ8B 5FR1A 3X1JA 5L3SB 4XB2A 3THWA 4CG2A 4D4IA 1MX9A 4DV2B 1Q0PA 3RE1A 3W2IA 1N36B 4AO6A 1A8QA 3TB6A 2FPOA 4AO8A 3IDFA 3I45A 3PTLA 4FWBA 2JL1A 2SCUB 2BF4A 1V5GA 3GT7A 3QLUA 5M2QA 4CI9A 3PRYA 1Z0DA 5HGJA 4O2AB 3GP5A 4TKUB 3W5DA 2LNDA 3LDHA 4IDBA 5AJYA 4MWZA 5U1PA 2C07A 3WLTA 2JGRA 3MD0A 3L93A 4UMFA 4D3FA 2Q9UA 2GESA 3C8DA 3FYCA 1IZYA 3AJ8A 3DJYA 3GB9A 3KAKA 3KHTA 4WLOA 3UW1A 5LU9A 1Y6JA 2V7TA 2WYHA 3KTOA 2BDTA 5AM1A 3R6TA 4I3FA 1OXXK 1G2IA 2QAJA 4IG9A 1X13A 4F9FA 1EZ1A 4ER0A 5GIOE 4QVIA 1TX4B 3L0PA 3V55A 1NR5A 4MTCA 2ZI3A 3VR6A 3W4KA 4Z6KA 4RABA 2XADA 1YUMA 4GMGA 4B9EA 1SZJG 3D6AA 3R4VA 4BTEA 5K3AA 1PEAA 1WU8A 2FMXA 4JU8A 2A58A 3T1NA 3IOBA 1T0JB 5IHPA 1NRWA 1P1IA 1R10A 4JC4A 1L4FA 1CJMA 1C8KA 1G42A 1O08A 3HG7A 3HWX1 2HA4A 3N59A 2CEAA 5EPEA 3Q9SA 3WK7A 4UXIA 3AVTA 1DPGA 2HW8A 3F9CA 5EZYB 4X1OA 4RF3A 3JW8A 3S2ZA 3TTYA 4JXZA 3FOBA 1KORA 2ZTVA 3VXKA 5ITVA 2X8AA 1HDGO 1QKKA 1E9DA 4DR3B 3V7UA 2W42A 1XCOA 1G20E 1J1IA 1JG2A 3TR5A 5K0CA 1GQFA 1GSAA 2ACKA 4OI0A 4KFUA 1AB5A 1ZWKA 1SXJA 5FULA 1HUQA 3KUCA 4TLAA 1C1DB 1QAMA 1SR8A 2IZ0A 4PPGA 1MOQA 5EKXA 5A06A 2QD5A 4HNRA 5BSRA 2IU0A 4FD3A 4KGDA 3BSSA 2W0SA 2X8JB 3SQWA 3GCDA 3W77A 3W1WA 1XSEA 4YRLA 3T3NA 3ZHVA 2JW5A 3K2BA 5TQ0B 1JQBA 2DJ5A 4PNZA 1JXQA 3S4YA 4QOIA 2PCLA 1RPJA 4BNNA 2ZSAA 2NYVA 2QRJA 4RWEA 1FUIA 3UGKA 3W4IA 3WX0A 1ZAKA 2RC5A 1Y4DE 4RS3A 4V3BA 4DLNA 1ZD4A 1CK4A 1CUXA 1CYDA 4ND4A 3Q11A 3DAYA 1SPXA 1RWPA 1ODLA 2FU5C 2AG5A 1NBEA 1UXIA 1N2EA 3MOIA 4HSGA 3CUWA 3E2PA 5G40A 4RM2A 5DNCA 1X77A 3SWWA 3QXXA 1DKMA 2V5AA 2BBSA 3P96A 4KXXA 1E4OA 4RF5A 3TG2A 2O5RA 1OW3B 3LXMA 4TUYA 1JE0A 5AW0A 3QX3A 2B2NA 4IM7A 2PD3A 5IZCC 2N42A 2D0PB 1I1OA 2ZK7A 1H94A 1ZC3A 3H18A 4L0QA 4XTRA 2NSDA 2Z58A 4F4DA 4MUKA 1BYIA 3CJTA 4U9IS 2FPGA 4WGGA 1PJRA 1M1NB 2RGNC 4REOA 1VHTA 3C6MA 3JVUA 1MENA 1JV2B 1UEXC 4JSRA 1ADYA 3H9CA 1POWA 2GASA 4KCGA 4FP9A 4TT3D 4V0QA 4RUKA 1EFVB 3T9CA 3U9LA 3V1YA 4X3CA 3F71A 2ZJOA 1BOFA 2O4UX 2WZCA 4LZZA 1NONA 2PBLA 4B73A 1R74A 2JGFA 1M7HA 3HYTA 4UMVA 3RS3A 4DLPA 5LQSA 3L5OA 4K6OA 4N0MA 3WC4A 3R8CA 2IHUA 4PCVA 2F3RA 2NUPB 4UJ3A 2A7QA 3N8GA 5G2OA 4DCPA 4RMGA 2Q8PA 2HD4A 4J0HA 1N6KA 3RIGA 4CMAA 5DCUA 3ETJA 4WZAE 4DCSA 1K7XB 1N5DA 2J59A 2XDQA 4LAFA 4DANA 4ZO7A 3C7TA 4FYKA 1JHRA 2WJHA 5G41A 3ROPA 5AUPB 2VL7A 4ZK2A 3DO8A 3IYLW 2PWYA 1V37A 4ND8B 2FW8A 3TEJA 2WM3A 3L6OO 5CTAA 2XNCA 3SJZA 1UT6A 3FYUC 3TBFA 1CUGA 4NICA 4I9GA 5HK9A 1OQAA 1N2XA 4QFBA 4DLLA 5JZVA 1IATA 3N7TA 4OJMX 1WMAA 5JOQA 5EHGA 3ZXIA 1WMFA 4MDEA 3W6NA 5K0BA 4W1QA 4LYEA 3QEOA 3FMVA 2A6PA 1EK1A 3ET4A 2VTKA 1NUUA 4MR9B 1QYWA 2CV2A 3KIPA 4XM0A 3WNCA 5BN4B 1O9HA 2D7CA 2I66A 5KNBA 2IS4A 4J0IA 4LBYA 5KCMA 3WL5A 1NMXA 5I8PA 3IBSA 3A6PC 2JFYA 1S96A 4PHTA 1COZA 1ZKMA 3BMNB 2OCDA 2V7PA 4I4LA 4DYHA 1LDBA 3BL6A 1TYAE 3MMZA 3OT1B 4TSFA 3SC6A 5BSGA 3U60B 3RIXA 2VKQA 2OAP1 3DT6A 3ZZ1A 2O8CB 5INTA 1JB1A 3DLAA 1EM8A 5DGXA 2NO6A 2R5FA 1PQPA 3CN9A 3GQVA 1YRAA 5E0OA 4AJ9A 4JB0A 5E4FA 4DIOA 4CTNA 4ZYTA 1X0XA 4OHXA 2V9CA 4G37A 2EJCA 5I5GA 4XX0B 2W22A 4HFRA 2J9FA 4G8BA 4ZVVA 3S3TA 5BNTA 3INYA 1M6WA 1RMYA 1DKQA 3I58A 1WXDA 4ND7A 3RBZA 3WLPA 2VQFB 2B37A 2WT9A 1QX4A 1JIIA 4XSHA 4EI2A 3TFWA 3O8BA 4LDAA 3QPVA 5FUXA 4EPTA 1YZ3A 2IUYA 3VZSA 2Q5JA 4M37A 3THXA 1YE8A 4E07A 5EAIA 2WF8A 3K5IA 4PBRA 2J5RA 2X2EA 2I4OA 1SBCA 3L1IA 3BTVA 4CLXA 2XTNA 3BWEA 4D0NA 1QPGA 5F77A 3VBCA 1T0HB 2GKSA 3HABA 3KZVA 2V6IA 2B8JA 3M6UA 1KZ1A 4TV9A 4I1PA 1FIUA 3LK6A 1PKEA 3R3ZA 5T64A 4E5DA 3RVRA 3HM9A 2PSHA 3BF7A 4M99A 3GLIA 5IKMA 2OCGA 4R7ZA 2VOJA 3FHLA 3NC4A 4DBLC 1DJOA 4ZREA 2D1YA 2VDVE 3VOBA 3ZDXB 2NIPA 4LUCA 5HCUA 4DSTA 3AY3A 1FY2A 3OZSA 3AF2A 4BX9A 3L8CA 4JR0A 4S24A 4EJSA 3CLSD 2BH2A 1QRTA 2B4QA 1CF9A 1P5HA 2Q3LA 1IEVA 2C7VA 3V1NA 3BJMA 1QH1A 2GTPA 2UYQA 3AIMA 5HKKA 2XT0A 1F06A 4OJKA 2BHLA 1W7AA 2OD2A 4YUWA 1YH3A 2ZYVX 1SQSA 2HQBA 1F2UA 1UBGA 4MDFA 3ELDA 4G4JA 1I3MA 1MC4A 1Z6YA 1AJEA 1NP3A 3U7HB 3PD7A 5CB4A 1GZDA 2V7GA 1FYVA 2WUVA 2YYZA 3KSRA 3N5KA 1CIVA 3GAAA 4JT4A 2NU7B 2OXTA 1T26A 4LCBA 3U4IA 5DXAA 3NHRA 2WW8A 3G59A 1E3EA 1KO1A 1RBYA 2P7HA 3I6YA 3O3CA 2QMUA 4BO3A 2GPNA 3MT8A 5DKFA 5FD8A 4C3UA 3GCZA 3M9LA 2QD1A 1MHTA 2R62A 3DL2A 1V9SA 1W48A 2HAEA 4EI8A 3GLHA 4A5OA 4TTTS 3PHLA 1Y6RA 4DCTA 1RXCA 2P75A 4AMBA 4TRNA 4I1UA 2R6CA 3A1NA 5F1YA 4W9MC 3LQ1A 3D8NA 1MEJA 1QGAA 5F3RA 3K6SB 2EF1A 2EBFX 3B7GA 1RWXA 1A9SA 1U1DA 1BJKA 2YR0A 3DMRA 1BGXT 1T0IA 4LWPA 4OYLA 2RONA 1GPLA 4BN4A 1TFUA 3PNSA 1EZ4A 1NI4A 4LSZA 4A0QA 2E9SA 1R5BA 5DMHA 4EG6A 4X7RA 1XKTA 5IKOA 4HDAA 3H6KA 1ZXBA 2B1IA 3IV6A 4XJVA 4B43A 5C52B 3KE8A 4ZDIA 3DAPA 1YRBA 1DSSG 1DEHA 1P5ZB 3PNYA 4BMCA 3GZJA 1UC8A 3MWEA 1ECGA 4AP9A 1I7QB 4C0BA 2IOHA 2VRWA 1G6Q1 3BAZA 4RULA 3H5WA 4H0CA 3UHAA 1AZWA 5DN6D 5DIFA 1C7ZA 1Z4LA 1DQYA 4OH7A 3UUGA 1A95A 1ZJ6A 2FAXA 3OIVA 4D92A 2GYVA 3ZVRA 1JJVA 1YBAA 2BEUA 3HCAA 3QUSA 1TQ2A 3IOCA 3N58A 1NNSA 4ZHQF 3P0FA 5JC8A 1H2RS 1C8VB 1WL8A 3OHSX 5CBPB 1FMLA 3P0EA 4R51A 1DFHA 4TQAA 5ALYA 1YZQA 3W0LB 4RM3A 4JUBA 2CUKA 1QR6A 2R87A 3VBEA 2I67A 3ETGA 2REBA 4TSRA 4UBIA 3VR1A 3ZLUA 1KYZA 4IP0A 1TZBA 1P0QA 3PWKA 4P0PB 4JLMA 3HNRA 2W58A 4LHSA 1R6TA 1TVEA 4KVFA 2B83A 5EWLB 5TQVA 2XBMA 4OA8A 4AF7A 4WJLA 5GTDA 1ENZA 4LX0A 2QTRA 3IEPA 3S28A 2XTJA 3EQ8A 2RIRA 4HAOA 4QASA 4A2QA 1Z28A 1M5UA 4DXHA 4EG4A 4UQOA 4HUQA 2OPBA 2W93A 1XPOA 2VPPA 3BWVA 5DGHA 2RH8A 4JJFA 3HFSA 1H6DA 2IF2A 4DHEA 1PZEA 2WFLA 1LCIA 2J3JA 4ZOEA 2DT5A 1UJ6A 2IYYA 4DRXB 4UZFA 2XPCA 3UJ6A 2XUPA 4IILA 3W34A 4LHXA 5LVAA 1Z18A 3EPRA 4ZAZA 1P2DA 4EKGA 4IYJA 1LBQA 4DV0B 2F2TA 4RK0A 5DMXA 2CJYA 3DNMA 2C94A 4WDQA 2LZ0A 4JL8A 4N6GA 2BH9A 2F17A 4I4CA 1PYDA 4HG2A 1EXDA 1QRRA 4B3GA 3FN4A 5IJ9B 4F3TA 1X39A 3AX6A 1ZP6A 2DTXA 1M2EA 2I99A 2W8BB 3FTCA 4JK3A 4N40A 1MV5A 3RQIA 2NQTA 3JQ6A 2PKQP 5IAKA 2VAPA 4M8IA 1CUCA 1OUMA 2C9MA 2H31A 1R16A 5GMOA 2RGGA 2FP4A 3A3KA 1UPUA 4UBJA 1NJ1A 1QHIA 2LDXA 2ZEJA 3W5JA 3CSUA 4U8GA 1WEHA 5E8JA 5FHQA 4W99A 3MJHA 3FD8A 1U0TA 3BXHA 3G8CA 1PR2A 3KXPA 3WLIA 1D04A 1MOPA 3L8HA 3A6GA 4MPTA 4MZDA 1KHHA 4NHOA 2GILA 2QTHA 2QN7A 1I1QB 2Q9AA 4X95A 3W6UA 3NYQA 2NNLD 3M34A 3VKWA 3WZLA 5JVDA 2OHJA 3V8NA 1CETA 1NE7A 1R0SA 5DTEA 5LZ2A 5HDQA 3BRWD 3RJTA 3TZKA 4DKJA 5CLLA 5CDTA 5FORA 3UPTA 2I9KA 3I4LA 3QNUA 3WIOA 4LGYA 5BN1A 4D82A 2WFAA 4XE5A 3N0RA 1KI3A 5KYGA 2OAGA 3D4IA 2WBLC 4PFJA 1B1CA 5C5EA 3AESA 3L79A 3CC8A 3KEGA 1JSCA 3BTOA 2Q5FA 2CB9A 3MXTA 4LHYA 3OU6A 4NZOA 2OG2A 4KPYA 3EXHA 2H2AA 3EAGA 5CT4A 2TYSB 4UHKA 3H2BA 4MIYA 5H9VA 2K7ZA 1X1BA 2G9QA 2NT3A 1HKHA 3G0OA 2A5FA 3H1GA 2V03A 2VHYA 4GX5A 3O75A 3JWGA 1JA0A 1SBZA 1PT7A 3UVEA 4JQSA 4B2IA 1ACJA 4KHPB 1AV7A 4OQMA 2E1PA 3OX4A 1WZNA 4HZGA 1YNSA 3NT4A 1DG1G 4EBFA 3BA1A 4F3RA 1AUXA 3REGA 2GKGA 2RHBA 2XXJA 1SXJE 2WUFA 5CU7A 1AX9A 2ZYAA 3H9GA 4R9NA 3FUWA 2XMSA 1Q0LA 4IGAA 3TH5A 4L22A 3GLGE 8MHTA 4B81A 3MVEA 3B1WA 1F8UA 2I2WA 3NTUA 4KXNA 4EHFA 3CF4G 4FR5A 4P4TA 3X1WA 3L0SA 4EW3A 2MSKA 3LL7A 5F76A 3OPYA 2PMDA 3DMGA 2FETA 3LUAA 2PZ8A 3JATB 5JANA 5F4BA 2XXAB 3PJRA 1TU4A 3KWFA 4ENWA 2O6LA 3OM1A 1HV8A 2VSYA 3O9ZA 2Q5HA 2QNIA 4RL6A 2JFQA 4ESOA 3QTBA 3ETHA 1BN7A 4MGEA 2N1BA 1HURA 1OFIA 3DW3X 1C9DB 2FP3A 1VIMA 5BW5A 1UKVY 4WXYB 4JEUA 5HF5A 2QXUA 3RFUA 1U8AA 1SVMA 2X6RA 3ETEA 4B2LA 1W36B 1L1RA 3MN1A 3ZCRA 2COEA 3QBJA 1J90A 2C8LA 1HLFA 4M86A 5U4XA 3TX2A 3NTVA 1M0TA 1IAVA 5E1DA 3OTIA 3BHNA 3THYA 4R84A 1ZW6A 4W5JA 1HTWA 2WJAA 4JYMA 3ZY3A 3CG4A 4B1FA 1QCZA 3BGSA 2NXCA 3K8OE 4P2BA 1RZ3A 1R4NB 4BYMA 2G4VA 4JUFA 2JLVA 3UMRA 4PCLA 4JQCA 3L7BA 4YO7A 3COYA 1DC5A 2PO5A 2IVFA 5EZ6B 1RACA 3KEMA 4AJIA 4HDKB 3WKBA 4MSUA 1OH8A 5I7VA 1H85A 3FSEA 1SBIA 4IZHA 3HUEA 3E15A 4M0PA 1P60A 1FSGA 4ZARA 3VZDA 2ZR8A 3NXKA 5FCDA 2H65A 1Q0SA 1W25A 2VHUA 3P9IA 4QQFA 4QGSA 2RGEA 1GGNA 3LIPA 1AKTA 2HA7A 1UDAA 2X4IA 4ZANA 4RW0A 2QR3A 1RYHA 2P9EA 5KSPA 1ORRA 1UJ4A 3PQCA 2CVHA 2GN2A 1SOMA 3PD0A 2F9FA 4D3YA 1A50B 3G8AA 4LVUA 5KSZA 2A9FA 1UWLA 5BWMA 3FHTA 3MLBA 4HQ6A 1VKJA 1MRNA 2GK3A 1L1FA 2FQYA 2O52A 5DVZA 2XA1A 4J9VA 5JCXA 1XEWX 1VE9A 2AJDA 1H2HA 1E7QA 1YRHA 4IKPA 4S1WA 3WV5A 2XQIA 3K05A 4YQZA 4G5SA 5DN9A 1OSNA 3EY9A 4PZ9A 5DW3A 4IV0A 4URZR 3MT0A 4H7DA 2Q2VA 5HIAA 2GUGA 3DEKA 4HQ0A 5LIRA 1O54A 1Z6GA 3EQ9A 3GROA 3NOXA 1W6RA 2OO5C 3OY7A 5TQJA 3SSNA 4GLFA 3PJEA 3RW9A 1VQ1A 1EDDA 3O6VA 1YQQA 3HVRA 3NTRA 2I2DA 1ZXXA 2OE2A 1XVLA 5EJ7A 1DAKA 4X8LA 4B4VA 4TT3A 4LF6B 2YXNA 4J16C 4R6XA 4LISA 3E9QA 4PZCA 2H63A 3L8YA 3M83A 2LIVA 2H51A 4MR8B 3PL5A 2ZSJA 2M6SA 2ID8A 2GXSA 2HHCA 3AH8A 5IJAA 4B75A 4V1CA 3T7JA 4C0KA 2R4QA 3CY6A 4RBNA 1P7YA 3ZVLA 3CXRA 4MS1B 3DOIA 5EIFA 2AMYA 4EFDA 3PNLA 4Q9IA 2GHIA 2NG1A 4L16A 3WTBA 5I3ZA 4NCBA 4I08A 3NEAA 3R5KA 2WU3A 3UAYA 4CM4A 3N86A 5H3HA 2D1RA 3RVBA 2WLSA 4WCFB 4DDKA 4E09A 3WGHA 3FUVA 4UE6A 3GIWA 2NP6A 3ST7A 2J7PD 1H0KA 1EK2A 2PRYA 3HZOA 4WFQA 4DYVA 2XUHA 2CLHB 2ZTLA 3LLVA 1XK7A 3FVTA 2Y93A 4R1SA 1RJ9B 1YONA 3A4YA 1GL9B 2GLXA 1RHKA 1SVIA 3HI4A 3WLHA 5FQNA 3GN2A 5C18A 5ABPA 3BFXA 5T8KA 3GLIE 4ZYYA 2WAYA 3F1LA 3OY2A 4Z5XA 2QMZA 4WA8A 4ID9A 4MP6A 3NEYA 5LDDC 1W0JA 4EPWA 5EE5B 5FWYA 5F1OA 5BR7A 2Y0DA 3AWDA 2QY9A 1VL2A 3IJRA 2R6DA 4LK2A 1XP8A 5FL7A 4ZT7A 4AZSA 3KYCA 4CV2A 1Z0JA 1IXKA 1C3OB 1JAYA 3W6OA 4M1KA 1QB7A 2LRHA 3HXOA 4AKHA 4D45A 2YJGA 2OYCA 4F9TA 1VI6A 3LJKA 1WMSA 4I8XA 4YMTA 3G0IA 2HRZA 1COWD 3E7XA 5KYKA 1Z29A 3AKYA 3C4QA 3GRAA 4AUKA 3RKRA 2H8KA 4AW9A 4DR5B 2C2BA 2JANA 1TEZA 2QTTA 2ZETA 1JIXA 4IVPA 3GNTA 4NFYA 5LQRA 4EG3A 1N1MA 4OXXA 2H3EA 1I3KA 1W85A 4BWFB 3WV4A 4MR9A 2I7CA 2ZUDA 5C2JB 3ZD7A 2NZUG 2A92A 4J0JA 4HMPA 4C0XA 2XAAA 3UWMA 2JI8A 3BHMA 2HA0A 2QR5A 3EUWA 4G5RA 4A9AA 4OO3A 5CIWA 4ACAA 4CMIB 2EAUA 4WE3A 1Y3HA 2GF2A 1Z12A 4JI5B 4FT2A 1UBNA 3AG6A 4NESA 3KV3O 5CYPA 4UFPA 4MCJA 5KNCD 4OQPA 2GAAA 2PVSA 4E2XA 4CTOA 1FF9A 1FRQA 2W2MA 3AIKA 4H7IA 5DSTA 3BCRA 1AD2A 5BWNA 4OP3A 4B40A 1GVNB 1SZPA 2C5GA 1L7PA 4FFMA 4RE6A 4URVR 5KJ6A 4IXNA 3QHPA 3F6SA 2BEJA 3SEZA 1KMMA 2YJ6A 4F92B 1JQEA 2VZLA 1ZH0A 2EYQA 2QP4A 4K0RA 4DQXA 3K71B 4NVRA 2CDCA 3MBOA 1J07A 1XB2A 4PS0A 2RC6A 2XNDD 3HA7A 1U7XA 3KXDA 2YV5A 4BHTA 3EBLA 1WBBA 1PS8A 2VCYA 4BLTA 4P58A 3HA3A 2EHDA 2AYYA 1B93A 1K3FA 1B6RA 2BMWA 2OGTA 4KDFA 4WN9A 4EYKA 2IELA 5HE8A 4CV1A 1H42A 5DGCA 1EGHA 4LYFA 2YZ2A 1JKJA 1NUQA 2RCNA 2B3DA 3P94A 4G5XA 5KYUB 1MA3A 3MRXA 1NATA 2FLWA 4FE7A 4FR2A 3Q9NA 2IYUA 3WAGA 1MC1A 1P31A 2YUIA 3AO0B 4QGFA 3NT2A 3UJ9A 1JEYB 1DP4A 4UXJA 3IIMA 1NXOA 2B1GA 2ZXUA 4WBSA 2BFEA 1MFPA 2Q41A 3FZQA 2EEZA 3O1HB 4FSDA 3O4RA 4KVGA 4HXFB 2BTQA 1XTZA 2VZ8A 3BVPA 4RGVA 3EXFA 2YDXA 1UMBB 2PLWA 1FVXA 4EZBA 3HO1A 3GP3A 1HSZA 1JVNA 1OROA 1U1IA 2ZT7A 4FW9A 3VR2A 1ML4A 4DG8A 3I83A 1CEYA 2Y0EA 4M6WB 3PNBA 3WOVA 2IEAA 3P5SA 3E3OA 3G5TA 3H1AA 3DLIA 5H70A 1GZ5A 4TN1A 3ZK7A 4DCUA 5IK2D 5DJ5A 3HR7A 3TTUA 2ZULA 2O8EB 1EK5A 1MG5A 3VNVA 2DBVO 3P2KA 5EGSA 4E5YA 1L7MA 3D6MA 3EZ9A 3N3BC 5BYJA 3S1SA 1FDRA 1MJ5A 2IH5A 4MRPA 4QLBA 1R15A 2R7AA 3H9QA 5DYWA 1TU3A 3H9JA 3N76A 3W8RA 5K3DA 5JAUA 3PFBA 2ABWA 3IPRA 5D3ZA 4R0NA 1SUDA 1ZK4A 3ZBTA 1YVDA 4CKYA 2V0CA 4AWBA 3HJCA 4D1YA 1FP6A 4RORA 3C24A 5DN6A 4JUAA 3DQQA 1MX1A 2KBEA 3KSDO 5J40A 1VLHA 2I3DA 4I8DA 3SG0A 3UT5B 4BRWA 1BYUA 5EIBC 3RSSA 3X2SA 4FSHA 4WFIA 4JLKA 2PNJA 4TROA 5FI3A 2QBYA 2NQ8A 2VTDA 3OSZA 4MAAA 4D9NA 3D7KA 4MQ6A 3G13A 4IZOA 4S1VA 1YAJA 4EA7A 4R1TA 1JLRA 2ZB7A 2C1EA 4TZ6A 5JO9A 1L7BA 3IVRA 5KS2A 1REQA 3G6KA 1E1DA 1VJ5A 4KE6A 5FOSA 4CCYB 4EUEA 5C46F 4WEQA 2V6JA 2VBIA 3FKSD 1ECFA 3JS5A 4GR5A 3O82A 3SFZA 3PHGA 4C7KA 3IOEA 4R2LA 4V03A 5ADUS 4N7BA 1YE3A 3T52A 4C4ZA 4PCAA 2NTYC 5TJHA 4E7PA 1OKKD 5BR8B 2O19A 3FPJA 2HSJA 3QVOA 2H9IA 2WAXA 1J22A 3HCCA 3QITA 4QPCA 3HHPA 3N2KB 1I6LA 3QNWA 4QHTA 4QPJC 1DFGA 4WCFC 2ZWAA 3D31A 5HK8A 1L4YA 2E4VA 2J9ZB 2BIFA 1HQYE 1KAEA 4MP3A 2HSDA 4OHRA 3SYRA 1BA3A 4D80A 4YX9A 5JSQA 5LMUB 4R2HA 3V4RA 1C4WA 3RVDA 8ABPA 4PSDA 3FIUA 1GUBA 1L5HA 1FBTA 2BFCB 3IVMA 1FX0A 1LNZA 5FOTA 3V1KA 3DW1X 3E35A 1AHPA 4BFYA 4TXNA 1U2TA 3AB7A 3CH6A 2VPTA 4F5EA 2MJLA 2IYTA 4QFMA 1U8TA 1P2TA 3AY7A 3PDWA 2TMYA 1LBIA 3TLGB 4ZHQB 4D7AA 4WXHA 2PAFA 2PJZA 4FHCA 4R1QA 3BICA 4OBBA 5CH5A 3IEVA 1UKEA 4AD8A 1YFLA 1RBQA 4BQEA 2L17A 5TX7A 1J49A 4FDUA 4X5OA 3VJLA 2R4TA 3N6VA 4ESHA 2XYGA 5A5VA 5HWSA 1DBPA 3GAMA 3NNSA 4FFRA 4AJOA 2QL5A 4LXTA 1OA1A 1HDEA 2RFLA 4TZ0A 3DA8A 4AMUA 4EJ6A 4IO0A 2BHNA 4K26A 2J4FA 1TYBE 1U2ZA 4IDNA 5IEBA 3LPAA 2NPIA 3SZLA 5JFTA 2VBFA 4KBYA 1YB4A 1UIRA 3R40A 3UBMA 4D9CA 2GYUA 1Y98A 1Z6PA 3FDZA 1ZD1A 1O96B 4KPGA 5B3AA 5KJEA 3L7KA 1UK9A 3EUFA 3BRWA 3PE4A 2CD7A 4IDGA 3AP3A 3OPNA 5LB2A 1YRQA 3MTIA 3OCUA 2JLZA 1LBHA 3INTA 4Y1EA 4URHA 1PJTA 3JVDA 4CU2A 2ACWA 2MU1A 5B6IA 4XUDA 1UR5A 4TT8A 3H2KA 3LC7O 3ZY4A 1WXWA 4JKYA 3L7JA 1E6EA 1TO6A 3DGEC 2X9NA 4CMBA 3F78A 5F9FA 3X1MA 3L1UA 3U19A 2OV2A 1SCQA 1OX6A 3LT5A 3Q15C 1H3EA 3AFMA 4TLCA 3A3NA