1XF3B

Structure of ligand-free fab dna-1 in space group p65
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
218
Chain Sequence
QVKLLESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCVRGGYRPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Light chain
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 218
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf3B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf3B02
4QF1A 3MRIB 1JE6A 5BJTB 4R97C 1JYVA 4Y0GA 2DTMH 4KRPC 4PRPE 2FATL 3KS0H 3UDWA 4QWWC 4XXCA 4U6TA 2Z8RA 3HRZB 3GRWH 5KS9B 3LQAH 5KSUB 3GSNH 3RVTC 3T4YA 2YUVA 3IDIA 2IQAB 5B3NA 4RNRB 3DOSA 4IDJL 4OM1L 2BSRB 2ORBH 1CXHA 1OAKL 4NM8L 4ALAH 3MRCA 5J6GB 5C0BB 3TGXA 4Z7NF 4KZDH 1ZGLM 4HLZH 2H8PA 2Z8VC 4K2UH 4N0FA 5SWSA 1EJOL 3BH8A 3S36X 1P6FA 3WFEH 4QLRA 3KYMB 2HKHL 1YMHA 4L8DA 5D70H 4UTAH 3P11L 3EYFB 3OG6B 3JUZA 4O9HL 3PWNA 3VGFA 5F1IB 1G9EA 2E5EA 3VXQB 4AIXA 3DXAA 3HZYA 2P1YA 5K9KB 1OWRM 2JELH 5EA0L 4NUJA 1H5BA 3G6JE 3MUHL 1KTKE 1JPGA 5A16B 5L7XH 3DSFH 4OQTH 1IQDB 3QQ4A 2AI0H 3BQUD 5C7XH 3RZCA 3SE3C 2VABB 1T1ZB 3QIBD 3ARQA 4GO6B 1NUNB 2V17H 2FX8L 4ZDHA 3ROOA 2FYYB 2FRGP 1JRHH 5J1AA 2R8SH 3P77B 2BX5A 4L4TA 4MVBC 1MELA 1FLRL 2ZSWB 3B5TA 2X6MA 3SJVB 3SO3C 5GS0D 4OTXH 4Z78B 5I1AB 1F90H 2C3VB 1RURH 2YEZA 3C2AH 2L4OA 4H1LA 1R24B 4YDVB 3STZA 1ZA6B 4TSCL 4DFHA 1N2RA 3MRGB 2W91A 4YK4C 1G6RB 1NDGA 1HIML 3BIAX 3VI3E 1IAKA 2EDXA 1LO2H 3NN8A 4R2GB 3TH4T 2QADC 5ITFB 4Z7WB 1NMCC 1NAML 3CX5K 4UTBL 4PJFF 3NIFF 1RI8A 2EE9A 2IJ0C 3HC0B 2ZUQB 5FO9B 1NFDE 1RK0A 1WEJL 4ERSL 1HI6A 4RQQA 3NMEA 3Q6FA 1I1RA 3BFOA 4NZUL 3TZVC 1KULA 1ORSA 1S5IH 1MNUH 2ESVB 1MRCH 4HG4J 2J5LC 5E24E 35C8H 1A6VL 5SV4A 4JPIB 3C6SA 3ARDB 4F9PA 5KSVA 5IGXH 4E41B 4PV9B 5DDHB 1QSVA 4FQQA 2P48B 3DROB 5T3XD 5FM5O 1MRFL 2F54E 4LPTA 4U7KA 4JO2L 3D85B 4X4XB 1AXSB 4KTEH 4PJIB 4PJBA 4YHPA 1U8MA 5MEQB 4TN9A 1KELL 4M9OA 2GUOA 2PO6C 3P9MA 1I1AB 2Q3AA 2WBWB 1T22A 2NY0D 3KYKH 4JZJB 2Q86A 4LVNC 4YUEL 2Y4SA 1NMBH 1HWHB 4XPAL 1NMAL 4FFYL 4YFLI 5BQ7A 5IMOB 2BNQE 2EE2A 3LRHA 1U8KB 1A3RL 5FDWB 2ITCB 1QO3A 1DQQA 2IAMA 1VKXA 1KEGH 5FOJA 5IK3B 4BZ1H 3LEXB 4CNIA 5T1LA 1TZGL 3V5DA 1JHTB 2XRAH 3MZGB 4XPTH 2FX7L 5CKGA 1CD0A 3NFSL 4GRMA 2FJFB 1J1OL 1AJ7L 2HLAA 2WV3A 3U4EB 3V5HA 5T3ZD 2X89D 4KVNL 4OLVL 4JFEA 5D7JC 1XGTA 3N85L 1NLBH 5SWZB 4LL9A 3TESA 3MOBH 1ONQA 4RMSA 4PD4K 3UBXG 1HZHH 2H32H 4L3EE 1FSKC 4YIQB 4X9IA 3RWIA 5JORB 5JHDD 1JF5A 3LQMA 5A3IC 2A6IB 3QISA 4DAGH 5JTWA 3G5ZA 1A0QH 2D03L 5MEOB 1OAQH 1CYGA 1OARL 3DTXB 3I6KA 5J3HD 5ALBH 4XXDA 2DLFH 5I1JH 3QSKB 1IEBA 4MXQD 1EAPB 4O51B 3ZDXF 5E70A 3DUUB 4JR9L 1Z6JT 4CMHB 1INEH 4HZLA 3S5LG 2DTSA 4JPVH 5H37H 1RK1A 5GGVH 1A4JB 1SMOA 1CL7I 1U36A 1MREH 3IDJA 3U9PL 3W9EA 3S8WA 1GZPB 1IT9L 3UYPA 4HXAH 1T20B 3V4UH 3IJHB 4KZEL 4OF0A 1KCLA 5DJ2A 4ENEC 1MFCL 2VXQL 1MCPH 2X70B 4Z77A 3FRUA 5DI8B 4LCWD 4C57C 4YHYB 1QFOA 4FZEH 4U1LA 4LIQE 1CLYH 3VFSA 2I9TB 3LDBC 5E8DL 3VRJA 4JCLA 4ZFZA 3T8XB 3MLUH 5IT2L 2ZJSH 4F7MA 5I8KL 5B39G 2DQUH 3FT3A 5JOFA 5ESVB 1MJ7L 2D7TL 4HDIA 5I8OL 4P4KA 3LPGA 3ZKND 4TOYH 4ZD3H 3WFBH 2P8LA 4OB5L 2W0PA 5KVMC 4WV1A 5MERB 3SGJC 1SJVA 2XN9E 1BFVH 2QHRH 1XCTB 5F9JA 2V2XB 4FHBD 4LBEB 5J11B 1DBKH 5HXMA 2BC4B 2IH1B 3ZT5A 3QIBB 3VXRE 1A3LL 2QR0B 4LCIH 2GK0A 4Y19A 1JI1A 3EOAA 2IG2L 1OGAA 3H9SD 3QIUC 3PF2A 4Z7NE 3QAZC 3PL6A 4Z0XB 3VRLF 5E6ZA 1CN4A 3BW9B 1HQRB 3AM8A 3C60C 2BVQA 5ESQA 3JWDH 4X9FA 3BWAB 4JO1H 3RY4A 1A1MA 4QT5B 3AY4A 1F00I 5AZ2H 1MPAL 4NKOB 4ZO8A 3W39A 3IETA 1CQKA 5LGKA 5IM7A 2VZ1A 3ZTNH 3OPZH 3FB5B 1FFOB 4IHOA 3H9YA 3WCYA 1X3DA 5KJRH 3U2SB 3INUH 4F2MA 4XZUA 4JGMA 2R69H 5EO1A 5GHWH 1A6AA 1UM4L 1KB9K 3PE9A 3DRTA 1FYTE 2QQKH 2Q20A 2MHAA 1CDYA 4YHIB 2OJEA 5C8JB 5BV7B 2VZSA 2WNGA 4V2CB 3ARFD 2I25N 3AMKA 2Q3ZA 2R0KL 1A2YB 4GRWF 2YD7A 3SO5A 2ZUUA 4KKBC 2R0ZL 4FQPA 1KENL 2VZUA 2Z31A 4G8GD 5D9SB 5ANMA 4R0LB 5ENWB 4DVBA 5C0EB 4OCWL 4PRNA 1JFQH 3K8KA 3V6ZB 1V3KA 1EZVX 3QXTA 1HEZB 4JRYE 3MFFB 3OKKB 4G6AD 3O3AA 1L7IH 3JVGC 1J86A 3BX7C 1J0IA 1AGFB 2XKUA 5IQ7H 1BWMA 4QHNB 4AT6A 4DN4L 4PJFE 3NIFE 1UVQB 5F7LB 3GI9H 3GSXA 2VDKH 1I7RA 2Y9RT 3FCTA 3FO1B 5E56A 3PQYA 3U30C 1PYWA 1EEZA 3UPRB 1G9NH 3AB0C 3BRGC 3VXMD 3H0TA 4Y2DB 1EUTA 2Z93A 1JMZA 1V8HA 3QHTC 3VWJA 4IMKA 2DQDL 3C5ZB 5D1XC 3BEVA 4J6RH 3N9GH 3QIWC 2K7PA 5GGTA 1DL7H 4OQ1A 3VFGL 4ZXBA 5E0QA 2OQJA 2XV6B 3EGSA 1YECH 3MGAA 4XCNA 2PXYC 1DTUA 4TRPH 3T1FB 3P9LB 5GGTL 1B0RB 3BPCA 2WIIA 4PRBB 1DSFL 2DM2A 2MCPH 4GQ9L 3QULB 1YN7B 3NIGF 4OZFH 5SWSE 4N0YH 5B21A 1T2JA 3TFKC 2XICA 4Z7VA 4M7ZC 4UIKL 5JHDB 1S9XB 3F6IA 4JPKH 2LU4A 3S34L 4KUZL 1WF5A 4XGZB 2DWDA 3DXAE 3EYSL 2CQVA 3T2NL 1OLLA 3O4LB 4JDTH 1FL6B 5F97E 2D9QB 2H1PL 4NQDD 3EOBB 2VDNH 1U8PB 1XIWD 4OBSA 5TDNB 3W0WB 4RFEA 1G9MH 1XZ0A 4HXBH 5E2TH 4F7EA 5J8OA 1KYOJ 1D6VH 3KAAA 3F58L 5DURB 5IFHH 5A2JH 1QACA 4L4TE 3IKCB 3C6LA 4Z7QF 1REIA 5IBLC 4BUGA 5ACZB 3GO1H 2DI9A 1U8OA 1AE6L 3TEUA 3MLXH 4LCWB 2VIRB 5CIPA 1EK3A 3PP4L 1S7RB 3MZTA 3H7BA 1B3JA 4OLEA 2WBJD 5DFWH 3O6FA 3ZDXE 5DMKB 1PAMA 3IU4L 3CUPA 2HVJA 2ERJC 4IRZH 5I1EH 3GMRB 3ULUL 1GOHA 1N3NA 1FL5B 4Z9KB 3CD4A 5GS1B 5A3ID 5JNYA 2NY1C 1IFHL 1D6EA 1HHHB 2EDFA 4YHKH 4F7PB 1DFBL 2FBOJ 2UYLA 5LQBL 5I19H 3WS3A 2YUWA 1N7ML 3UAJD 1TZHB 5E6IC 4XNMA 4MYWB 1UQSB 2A74B 2HH0H 2NNAA 3EO0B 1IC4L 5CINH 1AFVH 1GJIA 1OTUC 5GRWA 3QRGH 4BSWB 5IB4B 2NW3B 4O5LL 1SY6A 3T0EC 1YY9C 1RJYB 3GNMH 1L9MA 4EIGB 4OZIB 2N7AA 2VDOL 3QUML 5FOBB 1KBGH 4AIZA 1KACB 3HNTL 3Q6GL 5J57B 3X12B 4EI5C 1SY6L 4W6YB 4YWGL 5EZIH 3FN0L 1QP1A 5BO1H 5HPMB 1YUHA 1ZSDA 1NCAH 2DICA 3FB6A 4CADA 2RQ8A 1KLFA 2FSEA 5CGTA 4RX4A 3IXAB 3DVGB 1KB5H 2CH8A 4DEPC 4LLQB 1UZ8A 2WBKA 3QDMD 2F8OA 3QDHA 43CAB 2KBGA 4M6MH 1DQML 4PJAB 4Z7VF 3ULVC 5CUSH 3SGKA 1GGBH 2AEPL 3KLHD 4U6XB 1PKOA 2VDQL 3CFKA 5D1QD 1KJ2B 4GMSH 3VRLE 1JV5B 5JHLH 2LVCA 4ZG1A 1P4BH 3PGFH 4UT9L 4UT6H 3ARFB 1ZLVH 3T2PA 2YOCA 2E27H 2BMKB 4FFWD 4ZODA 5DRZA 1PG7W 2IPTL 4GBXD 1TDQA 4UV4H 2XPGB 5DLMH 5GGUA 2SEBB 3BT2H 5IFAH 4LCCA 5JPNA 3MRKA 1ULVA 1QLEL 2VXSL 4UB0L 5EU4B 3QUXD 5F8QC 3WMSA 2XXMB 4UMGA 5EUKA 4LSRH 2EO1A 3OX8A 2CUHA 4I0PD 5T1DH 3O3EA 3RWCA 4RGNB 3D0VA 4LGSB 4WHYG 3ULUF 3RDTD 4C56A 5KAQG 2BSSA 1QSFA 5MI0C 1CBVL 1H3WM 4MNQE 4GRWE 1N4XL 5F9OL 5C3TA 4EBQL 5TE7H 4I3RL 4WCYH 3ZKQD 1BWWA 1V5JA 4I4WA 4HHAA 4DOHE 4F7CA 3N1FC 5DD1L 1EEYB 5KTEH 5TH2B 5JW4N 3F65A 3HUJA 3L7FA 4R4ND 1RUKH 5I71C 5BVJA 3L3IB 1MIEL 5CHNB 2WWMD 3IGAA 4X6BB 3TIDA 2AKRA 4K7PH 1LEGA 2ICWB 5ACMA 3I9GH 5TGBA 3MV7A 1MCDA 1IGCL 3ZHDA 5C2BH 5TFSL 1JGDB 2A38A 2R23A 3QZWG 4R2GC 5E08H 4LRNH 1YMMB 3SQOH 5IFJB 3D0LB 4PBXA 4F7TB 3O8XA 3VMPA 4NRZA 2BVTA 2HT3D 5ECJE 5EN2A 3FOLB 1PD6A 4M5ZL 4P59H 4GW4B 3RU8L 1M05A 1B0GB 2ZUQC 4YE4H 4ODXB 4L8BA 2FEEI 1EGJA 3ARSA 5ESAA 5JR1L 4Y19E 2CPCA 3WS6C 3MNVA 3PDOB 1IKNA 1OGAE 2YD6A 3ZZ1A 5GXBB 3GGWA 3ARDC 2BCKB 5T1MB 1JWMB 3WKNA 2GJJA 1A1NB 1WBXA 3CSBA 4OCYL 4WO4A 4X6EB 2E3VA 4AMKL 4BJLA 4PUBL 4XCFH 5GS3A 3S3JA 4OCRL 3TA3B 5IMLB 25C8L 1C1EH 4YO0A 1I1AC 5FHBL 1DQJA 3OL2A 4GOSA 4NQSB 5JIKA 3SGDI 4CL7A 3MR9A 2J12B 4HAGA 3ARBA 4HUKB 4X6FA 4D9RD 3HB3C 4OCLC 1N5AB 2WBJB 3GFUA 5CP7A 5DVOA 2HFTA 1A1OB 1P7QD 3CDYA 2DQFA 5DJYB 3TH2T 3QRFM 2YWYA 3CFDA 5B4MD 3VD3A 4U6HA 1W0YT 3NFNA 1X7QB 4ETYA 3RVXC 4Z7QE 9CGTA 4DVRH 1HKLL 4B41A 2FBJH 2PYEB 4HH9A 4NKIH 5HHQB 5ANME 1S7WA 1HILA 3RIAK 1M1SA 2VLRA 3I02B 5DEZA 5TJWK 4IDJH 4KJYA 3BRFA 2NX5A 2A77L 1G1YA 4MQXC 2VL5A 3MRPB 1OAKH 5GGRA 1KCUH 1MF2L 3RWJB 3HUJF 2M2DA 3BKML 3SY0A 1CFVH 5BJTA 1HDMB 2EDBA 4KKLC 3OKOA 3QB7C 1YQVL 5DD6B 1C08A 3CFBB 1KLUB 3TCLA 5IKCB 2NR6D 5I1KL 1WCQA 5ACLA 2HKHH 3IS0X 5IMMB 3BHBA 3U7YH 1L9NA 3L5XL 4O9HH 3QUYD 1C16A 3Q1SH 5IJKC 3VFNA 5IQ9B 1KJVB 3GHEL 4OIIL 4B53A 3PQYE 2BY2A 5EA0H 1OAZL 1S7TA 3QDMB 5I16A 1J05A 2W07A 5DJCB 5E00B 4CMHC 3MLWL 2C4XA 5I6XB 5BOPA 1UZ6F 5IB3B 3TN0C 3TM6A 1QOKA 4X5WA 3DX8B 2B0SH 5D1QB 1A7NH 5DRWB 1WWAX 3O2DA 4NDMB 4U1SB 5T1KD 3NABL 1QQDA 1HK6A 3LKPB 1JNLL 2P7TA 5E6ID 4GMTH 4OAWA 3TBTB 2JJSA 1KLGA 1FLRH 4M6OL 4YHYC 5GRUH 3O2DL 2XZAL 4MCYB 1CXKA 3DX9A 2A6JB 4GBXB 5C0ND 3JUYA 2DQIL 1X4XA 4RGOL 2VDLH 4EZMA 3KPLA 4R3SA 4KK9C 4PRAA 5FB8A 2R1XA 3ZE1F 3AXLB 4PJCA 4Z7VE 4Q0XL 3V5KA 1HIMH 4WI5A 4X4MA 3V7MA 2CR6A 4M4PA 3EDFA 4JVPA 1D9KA 3MBEA 1WAAA 3V95A 4Y7MA 4P2YA 3QXDA 3K4AA 1T3FA 1G6VK 5LXGL 4JY6A 4KQ3H 4UTBH 1NAMH 2KZWA 2VXVH 1JN6A 1ZA6A 2VLKD 3HE6D 3KPRD 3MV11 1F3DH 5J11C 2GY5A 3CK0H 4JLRB 5JW4R 3SDDA 1MLCB 4LFHD 4NZUH 1A9EA 1SEBB 3U1SH 2V7NA 1MQ8A 4MJ6B 4XI5C 1VADB 3PHOB 1JWSA 2ZUSA 1A6VH 4ZAKD 1LDSA 3MX0A 2ZSVA 3KS0J 1J5OH 3VXUB 3WIHA 1MRFH 3JWOL 4KH2A 1VDGA 5HGGS 1J9CT 5HYJB 3CVHH 4D0BA 5JZ7D 3S4SB 4WFEE 4WFFD 3ULUE 1J18A 1OTTC 2OLDA 2X4QA 4UNTA 2A9NH 2VISA 3WIHL 1E4WL 3UYRL 4FTVD 4HWNA 1BECA 1KCRL 4N0CC 5FGCE 1KT2B 1IEHA 4GKSB 2CLVA 1YN6A 3TO2B 3Q5OA 5JPMA 4LLYB 5KANG 4XPAH 1MJUL 1MUJB 3C8KB 4HS3B 3RIAF 1SEQL 1OP3H 4N90E 5E2WL 4O2CB 3S35L 5BV7C 3HS0B 4WEUD 3GJEB 3CLFH 1IM3A 1F2QA 4QXTA 5C08A 1FG2A 3DIFA 1T1YB 1XEDA 3QI9A 4JDZB 5EU6D 1N8ZA 1TZGH 4DW2L 1ZT1A 3O2WL 1HINH 1WFOA 2NXYC 2FX7H 2AQ1A 3BIBX 4FNLL 4R0LC 3NFSH 4MJ4A 1AJ7H 2UZXB 4KVNH 1A22B 4OLVH 5EC2B 3L3DB 4KMTL 1F3RB 3U82B 1TNNA 5F7DB 5HYSA 3N85H 3S3SA 4XAKD 1DN0A 1CFTA 1JHLL 1AD0A 1GGIH 5GZOC 3Q48A 5FDYA 3H2WA 3HG1D 1KIPB 5DJAB 1R3KA 2ZPKL 1U3HA 2FZ3A 4YX2H 3NCYS 2AJZA 5DMYA 4LU5L 3PABB 1XF3B 5BVPL 2HT2D 3F8UB 1P84J 5E2JA 1JRHI 2HMID 1LDPL 2CMRH 1ZVSB 5JMRA 3LN4A 3UZVB 4PJCF 4L4VD 4D0DA 1CFNA 3M1BB 1KIQB 4NO5B 4Y2DC 4AEIL 1P7QB 4TVPD 1RUQL 1RZKL 2VJXA 5GSVA 5EPMB 3C5ZC 3BP4B 3TNMA 4NZTL 5J9PA 4FQXA 1A6PA 4O2FA 3M8OH 5IV2B 2FL5A 1KXVC 3BWUC 5ETUA 5J13B 5MEPA 5L8JB 2P24A 3KLSA 4KZEH 2GTZB 1QNZH 1U95B 4FXLA 1MFCH 5FYJL 4CU8A 5IROC 4EUPH 5DHYB 3L95A 5DC4B 4P5TD 4RAUB 4L8CA 5A43C 1F4YL 3Q3GA 1CXEA 2Z92B 2ZCHH 5JW5B 4MB3A 4PYHA 5HYIA 4H88H 5IT2H 4NCC1 2OJZH 1SJEB 4J3UA 2GSIA 1MHHA 4L3CA 5J0BA 4PJ5B 1MJ7H 1QEWA 2D7TH 3LKSA 5I8OH 1DUYB 3AU1B 3R8BB 4C56E 1KUMA 5HI5D 1TQBC 5HDOA 1QSFE 4QHUB 3NBNA 3JV6B 4ZUTB 4OB5H 3NCJL 3VXSB 1N0LA 3CSYA 3V0WL 3VI4F 4W6WB 3HC3H 1NBVL 4PV8A 3CSGA 2BK8A 2NXZD 1BD2D 5KG9A 4BQ8A 3NAAH 3HUJE 2XTJD 1S7QA 3QWRD 1UJ3A 4U1JB 4AY0A 3TO4C 5MHSE 1JP5A 3MRRA 3OXSA 3JTSA 1I9IH 2GY7B 4X83A 1I3RA 1UENA 2UVEA 3MV7E 1MPAH 1HHGA 5M7QA 3S4SG 3BQUA 4Z76B 3FT2A 3PHQB 2X41A 1AGCB 2AJ3A 4AH2B 2J6EL 2X4UA 2V5SA 2A73A 1JF1B 2BY1A 1S7XA 5IHZB 1UZ6E 2E7LA 3U6RB 1I9EA 1MSPA 1Y0LA 5IVXF 2F19L 1UM4H 3FQRB 4HJGB 2KDGA 1PBYA 3QDGD 5DUML 2WZPD 3PWJA 4PGEA 1P5UA 4KXZH 2VLKB 4P2QB 5EOQL 3KPRB 5GS0L 1MWAH 4BKLB 1B0WA 4X7DC 5I66A 2Q76A 3H7LA 3SKJL 2W9LA 1FH5L 4WDIB 4K8RD 2EDYA 1NC4D 3QCTL 5FUCE 3ZE1E 5B22A 4D2NA 1F45A 4YDKH 4ZS6D 3QPQD 4LSDA 1YY8A 4LLMB 5IOPB 3VFRA 5EOCJ 5LKNA 5DMGD 4Z5RA 1BM3L 4XVJL 3ROLB 5FGSA 1PZ5B 3MRFA 1OSZA 1N0XH 2VLJD 1XT5A 4APQB 2OZ4H 2RFXA 2N1KA 1UGNA 3S96B 1NBYA 5E1AA 5I1GL 3EHBC 3A6CL 3IFPB 1NL0L 2R9HD 4G6FD 5DUPH 3RGVC 5JDJA 4K3DH 2EIZA 5FYKU 3RVUC 3P0GB 1TCMA 2E6QA 1F3JA 3MBXH 1EBAA 1UB6B 1Z9SA 3OR6B 3TPUA 4EDXB 3OSKA 1QTYT 1OB1B 2FR4A 1KC5L 3BGMA 2E7HA 4MDIA 4M7JH 5T3XL 1ZA3B 2F53A 5EU6B 3VFUB 1DLFL 1PGRB 1OPGH 2W1NA 1IGIL 5SX5H 2VLRE 3ZKSD 5I1LB 3WIFB 1ZANL 4PGCB 2NX5E 5ICYA 1HH6A 4I3SH 4OCMC 4UINL 2AJXH 3IF1A 5GGTH 1DSFH 2BRRL 4WTZG 5KSBB 3U36B 1NH6A 1JGUH 1CGSL 3C5JA 3DX6A 5JXEC 1CGUA 1AXTH 4OM0H 3D69A 1BREA 4G9FD 2OTWB 4LGPB 4UIKH 2BXZA 4JY4B 3IFOB 4RGNC 1BQHB 2YN5A 3CU7A 3RWFB 4ZUUA 3T2NH 1IGYB 4JFPA 3UTTD 1TPXC 2IADB 2H1PH 2G2RA 2YA2A 5DYOB 4L4VB 4XCCL 1I7ZA 3EZJB 4RMVA 1F6AB 2YD2A 3VJ6B 1E0OB 5T3ZL 4M5YL 3M17A 1FNFA 2OMBA 4XB8A 5DRXA 4WUUD 4V1DD 4NWTL 4XP1L 3O3BB 1NBZA 1M6OB 4XNYL 3EJJX 5F3HA 3U0TB 1QKZL 2P46B 4G80A 1WT5A 4UOW1 2V5TA 4QCIA 4HULB 3ZT6A 5EIVA 1SBSL 4JFOA 4KI5D 1L0YA 5I2IA 4NN7C 4MD0A 3H3KA 3WFCH 4PREB 2H3NB 3V8OA 4PJCE 1KXQE 5HGBA 4ELKA 1IRAY 3QWQB 2YK1L 4IRSB 2YD4A 2ZKHL 4Q6IB 2EEAA 4NO3A 1K6QL 2NLJB 1WAAE 2AK4D 3BE1L 1IFHH 5IR1A 1WITA 1U8JB 3RRQA 5LQBH 1WWWX 3VRIB 1E4JA 3IU3A 5EORL 3ZKXB 4QRRB 3ECBA 4OLZL 5J12C 5FCSH 4POZC 2NXZB 5DD5H 2J8HA 2YKLL 1Q0YH 2W9DH 2FECL 3VW3L 5FHAL 5DT1L 4HGWA 2VDOH 5FECA 3GSNB 3QUMH 2MQCA 4XWOD 3TA3C 2DKMA 1ZTXL 4HPYL 2CDGB 3X13A 3FN0H 2FJHB 1DEEB 5JLZB 2V7HB 3O9WD 3ILPB 2APFA 1GGCL 3QEQB 3TBSB 4DGYL 2GITB 5TPWL 1WFNA 3VI4E 1EUUA 3H9SA 1CFSA 3P4MA 3GJFA 4F3FA 3KPOA 2AAVA 4K71B 1DQMH 3X12A 2XIDA 3BZFB 1DP0A 2AEPH 4N5ED 2VDQH 5F71A 5C08E 1U93A 4K3HA 3QDGB 1NCDL 4HIIB 1D5BA 4UT9H 4E42A 2NY7L 4N9GA 4J1UB 5BZDA 3BP7A 1ETZA 2GJZA 3C09B 2D4DA 1FC2D 3QUZB 2IPTH 3U46B 2BOCB 2H45A 2ZG2A 5GSRA 3PNWB 4ZTOL 4LKXA 1NC4B 5E4IA 4MJ2A 1QLEH 2VXSH 5DQJA 4IS6B 5TE6L 4U1NB 5F7FA 3X3FL 1A14L 3FRPA 4G8EA 1FC1A 1MHEB 3RJDA 4XC3L 3SDYH 3DO7B 5IVXE 4MD5B 3RA7L 3LSOB 1TLKA 2BMKA 5DFVC 4PJDA 1NGWA 3SE3A 1I4FB 1X5HA 4G8GA 4KROD 3AROA 5I6XC 4P23C 4MD4B 1S9VB 4LDEB 4JDVA 2Q8BL 1Y6KR 3AAZA 4LPXA 2IPKA 2UUDH 5EG6C 4G6FB 3N1PC 2CJUH 2Z4QB 5FYJE 5FEBA 1NGYB 1HHIB 4HIEB 2ZUWA 5GISL 1T1XA 4UOJA 4BH8B 2D7PA 5DD1H 3EZ8A 4X9HA 4DKDC 5FYLD 4X5XA 3TWCL 3CFEA 4NM4H 5BMFL 2BNUB 3QXAB 3C2SA 1MCKA 4KHTL 1BLNB 1JPSL 4HFWB 5E94A 3VXMA 4QYOA 1IGCH 4R7DB 4D9QD 3HAEH 4U49A 1N59A 4JN2B 3QQ9D 1HCFX 2W59A 3OJVC 4HJ0D 3VH8B 3VMOA 4LSQH 2XOTA 5DZLA 2J8OA 5F9WC 5AAWA 1GOFA 1VHPA 5EO0B 5HVHB 3GMPA 5IBUB 2B1HH 4M5ZH 4K3JL 1R3JB 3U83A 4YH6A 5HYQB 3QCUL 3UTTB 5KN5B 3QG6A 3GI8L 3RI5K 1YEFL 4U31A 3KJ4B 4LQFL 3QFJB 3SDXA 3MRBA 5JR1H 1JZ8A 4YPGA 4QRQB 1WJ3A 4JO3L 4Y16D 5IIEB 4PLNC 2HVKA 2IBBA 3SDAD 2VLLB 4V1DB 5E8EA 4OCYH 1QHPA 4KY1L 4YEEA 4PUBH 1LE9A 4NQDA 2BP3A 1OP9A 2X1QA 4YNYA 4OCRH 4K94C 2Q1EA 25C8H 3KWWA 5IW1B 3X14B 5L6YL 1ZGLB 1U8IA 5H2BB 1XIWA 4N0UA 1DBMH 4HLZG 1T89C 4LSVH 4U33A 3QT2A 4HBQA 3GSOA 3KXFA 1ZOXA 3TBWA 4DZBA 4NC1C 4PY7A 4DCQA 3CMGA 3HRPA 3VFMB 3D2UB 5IMLA 4PJDF 5AG9A 2ZCLH 3HMWL 1CS6A 3VFPB 1ZLSL 3MUGA 3VGDA 4NBXB 4FG6C 1KPUA 4MAYD 5LVEA 2R4RH 1AR2A 3DV6A 3JV5A 5E8NA 2YSSA 1K4CB 3O41B 1BVZA 3PJSB 4NKDB 4Y5XA 4PS4L 1BQLL 1B2WH 2DDQH 4XX1E 2I9LA 3HZMA 3U7AA 3PWPB 2A77H 1OSPL 1R5WA 1CGVA 1BMGA 3UMTA 1RV6X 5FKAB 1MF2H 3BKMH 2D7MA 2WSKA 5E2UL 4EN3B 3MGTA 2EKSB 2IWGA 3MV9B 3ULVH 1OTSC 4YEFA 2BVEA 4GXVH 3FB7B 2Y06L 3H6JA 2WUBL 4KUCD 2ITDB 3L5XH 3O9WB 1CTOA 3QJFA 3IJSA 5DJZB 2XZQL 2VB5A 2BRQA 4P3WA 1S7VA 4TYUA 1S9YB 3FN3A 4LNVA 2EC8A 2NZ9D 1OAZH 4ODVL 4FFZL 1G7LB 3HI1B 3MLWH 3RL1A 1LE5B 4CJ1A 1FDLL 3GMMB 3LV3B 1BZ7A 2XQYK 4GG6A 1RU9L 2R15A 3WJJC 2W38A 2ZUVA 1N64L 4KJQD 2F53E 5J13C 1FNEA 2BNQD 2EDRA 2DWEA 3L3GB 4KTDH 5BW7C 3E8UL 5E6YA 2DD8H 5D4QA 2WWKO 4M6OH 3SDXF 3L5WA 2XZAH 4RWHA 4PRID 4NHUB 3V6FA 1ACYL 1UH2A 3D39A 4OZGA 4YXKL 4PGBB 5KBNC 2VLME 1IQWH 1WV7T 1FP5A 4DTGL 2Y7QB 5A2IH 5IUSA 2P8MB 3SN6N 3SGJA 3FO9A 1U9KA 2FIKA 4JANB 4MX7A 4EDWH 5L2KB 5KZCB 4CVXA 1FZJB 3F62A 1M4KA 3V52L 5IBUG 5K9OB 4L3ED 4KK8C 5FYKH 5LXGH 2X4NB 4KROB 5D6CA 3NCYP 3MA7B 2EXYD 2N56A 4LAQL 2EE6A 1T2XA 2G75B 2XA8L 4NP4L 3QUXA 4L5FL 3AGVA 3C60A 2IMMA 3LIZL 1DBAL 3GMOA 3EYQC 3F7YB 1NJ9A 3O45B 2CIIA 1P7KA 2P45B 1PEWA 4XVTL 3KPNA 3VXPB 4BFIA 4I0PA 1AXIB 3BPNB 4OIBA 1G6RH 1RIHL 3DHMA 2B2XL 3P4LA 3RDTA 3U0WH 1JHKL 3JWOH 3ALPA 2BDNH 5ADOL 4PRPB 1FORL 1W0WB 7CGTA 1N5YL 1YNTA 3B9AA 1E4WH 4AEHL 4XWGL 3UYRH 5SV3A 3MRDA 3CLEL 2HRPL 1KCRH 1IGFL 1WIUA 4OSUL 5F1NB 4NYLB 2H9GB 1FFRA 4ACPA 5F7EL 5DTFB 2PNDA 1MCFA 4LVHB 4UQ2B 4Y4FB 4Z95H 5KW9L 1LILA 3LMJH 2ICES 5E2WH 3ILQD 1ND0B 5HTSA 4P9ML 4H8WC 2R4SL 4HX1A 3AUVA 2JB6A 1A5FL 1Q1JH 3P73A 2I26N 4DW2H 1PQZA 5LJYH 3KPSA 5EBMA 3ZYJA 2VDRL 4P46D 3SKNA 4GG6F 1NFIB 5EU5B 4Y16B 5F88B 3OKLA 2XN9D 4GAFB 1YEEH 1GC1C 1XCQA 2IH3B 4KMTH 1EAJA 3SDAB 3WXWH 1IGTB 3BSZH 1XF5B 1J0ZA 3SGEH 3LZFL 3TJHD 1K8DB 1ZS8A 4WU7B 2R2EA 3R1GL 1XR9A 4A2MA 3RPIA 3I3EA 2ZPKH 3LRGA 2HA1A 3PGCA 3KYAA 5CEYA 2X09A 4OKDA 3BVNB 5DC9B 1ORQA 4L9LB 5D1ZD 4JB9H 3IT8D 4TULL 2K3TA 4APQC 4OZGF 4FRWA 5BVPH 3BIKA 3H9SE 5CEZH 2VO5A 1I7TB 1MFNA 3GSVB 4TUKL 1DR9A 1X4ZA 3DBXA 3R06A 5EC1A 4AEIH 2XFXA 3EUUA 1JPTH 2WUCL 3PGDB 4UNVA 1J0HA 1RUQH 4OLUH 4HIHB 1RZKH 4AG4H 1I9JH 2GTWA 4NZTH 5D72H 2BHYA 2P5WA 2C4FT 4MJ5A 4XAWL 3VFWA 3RWGA 1XF3A 3TC9A 2HLFC 1BAFL 3T3PF 3W11D 1XR8B 2NY2D 5DSCA 4LLWA 5IEHA 5F7HA 4U2YA 3KDMA 5JW4Q 1EEQA 2IGFL 3IDMA 3BO8B 1NFDB 3LS4L 4QXUL 1DBBH 4OKVA 5DUBB 3EYOA 3KLAA 4GAYA 1F4XH 2Y5TA 3HR5B 3VCLB 2X9WA 2WAHA 5DXWA 4PJDE 2ZNWA 4G8GE 5D7IA 1FAKT 2F54B 4JZNA 3LN5B 1VEPA 2QQNL 4M1CD 4JAMB 4L1HA 3BMVA 4Q9QL 1GPOL 4HIXH 1WWBX 4LEXL 4I5BB 3KPQB 3C9NB 5GQBA 4XTRD 3SBWC 5CFHA 5L9DL 2YA0A 4XNQA 5EU3A 1PKQA 2DB8A 4JQVA 4KHXL 4MXWL 1L0QA 1UYWH 2AK1L 5FF6A 2C3HA 5D5MA 3CCHA 4A6YA 3QUYA 1F11A 2BNQB 2DF3A 5CJOL 4MWFA 4PTTB 5B38G 2C1OB 3VFVA 3VGBA 5HHNB 1LK2B 4UAOC 1GGUA 2DLGA 3GMNB 4ONFL 1KIRB 5HGAA 3VXME 1IMHC 3LKOA 1H3PH 2V9TA 2ARJQ 3QPXH 2DRUA 4PIRF 5I74B 5E5UB 4GKZB 4G6JL 1FIGL 4IRSC 4KKCD 4OFIA 4XPBL 4HWBA 2X4TA 3ALWA 4Q6IC 2J6EH 2EH7H 4G42A 3BXNB 5T1KA 3G5VB 1UM6L 2BXYA 4KWUA 5E6IA 3B6SA 12E8H 4M61A 1PG7X 5INDA 3T65B 32C2B 2F19H 3ZDYF 4Q58C 4HWBL 1L4IA 5SWSD 4OZ4B 1T21A 4PJ9B 2JTDA 4QRUA 5HHPB 4ZUVB 3WFDL 4L3EB 2R29L 3FQWA 2A6DB 3HNSL 1FZKA 2P42B 4LSPH 1YEHL 3CDGB 3SDXE 5CSGA 3HFML 4BM7A 4UQ3B 2F5BL 1T7WA 4OIAA 3UTZA 4N5UA 3SKJH 4M93B 4JQXA 2O5ZL 4XP6H 1T1WA 1YC7A 3RL2A 1P5VA 5I1DA 2DJUA 2X05A 1FZMA 2BOBA 3PWVB 1IAOA 4NQDE 1RHFA 5GS2D 4U0RB 3DVNA 3HE6A 4ZO9A 3T09A 1QFWM 4L4TD 3RZWA 4N0UE 3OBAA 1BM3H 4XVJH 4PP1D 5GGQL 3TCXA 4O02L 2VXUH 4OZFG 4LARL 5BV7H 2XNAB 1G7PA 1VCAA 2ADJB 5F3BA 4H26A 3RBGA 4K71C 3WDIA 1LP9A 3KXFE 4ZAKA 3ZSTA 4XHQA 1IAMA 4HMDA 5J6HB 5I1GH 5EDXA 3TV3H 1XAUA 3A6CH 1NL0H 4Y4KD 1AKJB 2BSTA 1RZJC 1X4YA 1HSAB 4U1HA 1VEOA 5CJ5A 5C0AD 5T3XH 5I76B 3TVMD 1NCTA 1HHKA 3DETC 5DVLA 1EHXA 4JY5L 3C09C 4FTVA 3UBXA 3QUZC 1IGIH 1XGYL 4NKMA 1LO4H 3VD4A 3BYTA 3BDYH 2QTEA 4J4PC 5JQHC 2AV7A 1MY7A 3BEWA 2EYSB 3MGOB 1DVFC 2XN9B 4H25B 2XZCL 4AM0B 5D5MF 3DUSB 5GGVY 3JTTA 4WW2B 5C1MB 1CGSH 4X4YA 3I85A 1J8HA 1U8QB 1JJUA 4W4NA 3VXRB 4KKAC 2V2WA 1QZ1A 2HKFL 1TVBB 4KJWD 3BISA 3MOAH 3VD5A 2CUIA 2DMCA 5I8EB 2H26B 1ZT7A 2AEWA 4QXGL 3S5LA 2X7LB 5D1ZB 3PWUB 2JIXA 4FQ1L 2EECA 2J3SA 3VFOB 1U3YA 2X1XR 1FNGA 1HXYA 4XCCH 4OD3L 4LCYB 4GG6E 1FFNA 5C0GA 5T3ZH 3FFDA 4M5YH 3HG1A 4WEBH 4XMLH 1VFAA 4LLVA 4U1MA 2GCYA 4PJ8B 1KGCD 1KJ3L 1OHQA 3FMGL 1LD9A 1T7XA 3E6HA 2ID5A 4Z8FL 3CFCH 1RMFH 3MLYH 1E27B 3D6GA 3OKNB 5L2JB 4WI3A 4NWTH 1HYSC 1FYTB 4XNYH 2VITB 5ID0A 5HVGB 3OGCA 5CLWA 1QKZH 5B39A 1LO0L 2NYYC 3QBTB 3D39E 3VJ6A 4OZGE 4WW1A 1NEZG 5HDLA 3MJ9L 4WHYH 1ITCA 1OAUL 2AV1B 2VDPL 2JJUA 1NAKH 1BZ9B 1M7DB 3OF6D 4KXZI 5EBLB 4PTUA 4MNHB 1JGEB 2YK1H 1F8TL 4PLJC 4TVPL 3P9WB 2ZKHH 2PCPA 1U58B 5TDPB 1TJIL 3PV6A 1KB9J 1DE4B 1E28B 1HH9B 1TENA 4JRYB 4OD2A 4AQOA 4TPRL 4JG0H 2ZOLA 3LEYH 2IMNA 3WS6A 1G0DA 4P5TA 4PG9B 2Q87A 4R7NB 2F74A 3WJLC 1LVEA 3QNXB 2VZVA 5IG7B 1LP9F 3RWDA 2WANA 1I3VA 5EORH 4Y5YA 5I30H 1T4KA 3MV01 4MQSB 4PJFB 3QUKB 2X42A 4OLZH 4XP4L 1DBJL 4YDJB 1RZ8B 2EC9U 3I50L 2OI9B 1UKSA 2YKLH 3SDCB 4MNQD 4NQXB 4LPWA 5HHVL 3VW3H 4X7TA 3MJ7A 3O3DA 4OI8A 4QF1B 3TYFA 1ZTXH 2LAGB 4NPYA 5CMAA 4Y4HD 1RUPL 1MFDL 4UILL 4OF5A 4WTXA 1T5WA 4P3CL 4HUWB 3TT3H 3LS5H 1BJMA 4S0SD 3T4YB 1GGCH 4IIQA 3IDIB 4P2RD 4MGXA 4DGYH 1BD2A 3R0MA 2PF6A 4QRTA 4JEGB 4W4OC 1MQKH 4G6ML 1X5GA 1K4DA 1Q0XL 3X3GL 3MRCB 3HI5H 1A7PH 4P5KA 3QEUA 5K59F 5KVGL 2H8PB 4G9DA 1R6VA 4N0FB 5SWSB 3BH8B 5I1CH 2YZ8A 3H9ZA 1YMHB 4Y1AD 4L8DB 3SE4C 1KTDA 3PWNB 4P4KD 5C86A 1CFQA 3OJ2C 4JGUA 4KQ4L 1NPUA 3KPSE 3DXAB 3HZYB 4UBDD 1JWUA 2NY6B 1M7IB 3MCLH 4NUJB 1H5BB 3FT4A 5DA4A 1JPGB 1TTUA 1AHWC 1XF1A 3QQ4B 3QNYA 3RZCB 4S2SA 3QEGL 2Z8WC 2XQBH 4EN3C 3VWKC 5TE6H 1TTGA 1A14H 3H42L 5I15H 5DWUL 1KPRA 4I2XA 3Q5TA 4WIQA 4XC3H 4ZDHB 3ROOB 2FGWH 2WLYA 4LMQE 4WEMB 5J1AB 3ZDYE 2YUXA 3WDHA 4JM2D 4L4TB 1KJ2H 2I5YL 2VUOA 4CVZA 1DLHA 1OCWH 4OLWH 3TN0A 2WW8A 2YEZB 1EHAA 4H1LB 1FFQA 3STZB 3VG0L 1N2RB 5DF0A 3GSUA 2F8VA 4XP9L 4NN6C 1KJMA 2DQJL 1NDGB 4K8RL 1IAKB 2P5WE 4MD5A 1BHGA 4ONGL 5MP6L 3NN8B 5C70A 5JA8B 1DQTA 1NSNH 2VLJA 1WICA 1GGTA 4KHTH 1A4KA 4HKJA 3VFTA 2V9QA 1RK0B 3K4ZA 1HI6B 4RQQB 3Q6FB 4HGKC 3RVWC 2W0LA 3JWDC 3UROR 3WKML 4IRJC 1ORSB 3ARED 2WP3T 2Z31D 1GXEA 5D2NA 3FFCD 4GG8A 3JWNC 1ZWIA 4S1DD 1KOAA 4FA8A 3C6SB 5KSVB 1B4JL 2J7LA 4FQQB 5D7IE 1XH3A 3D25A 2EE3A 1NLDL 2B4CL 4JHWH 4PJBB 4YHPB 3B9KC 3QCUH 1U8MB 3TBVA 4WI4A 4Z7UA 1IAIM 2GUOB 3MXVL 3P9MB 1EHLL 3FO2A 1HQ4A 2DL9A 2QSCL 4RMUA 4LQFH 2YR3A 1R5IA 3FO0L 1PKQE 2DIBA 1T22B 3IDYB 1MH5A 2IBZX 2YA1A 5HHOE 4G9FA 4JO3H 5D5ME 3BPNC 5BQ7B 1AGEA 3DGCR 3GK8L 3PWLA 1Q9OA 1QO3B 4LNRB 1DQQB 2IAMB 3WIIH 1VKXB 1AC6A 4FS0A 1FVDA 1J8KA 2HYMA 4CNIB 5T1LB 3DECA 4ODWA 4ZXBD 3V5DB 1VA9A 2YC1A 4OF6A 3LQZA 2RCSH 3C5SA 2O5XH 2HN7A 4HBCL 3O81A 4GRMB 3VE0A 5C6PB 4JKWA 2HLAB 3V5HB 1U92A 3LRSA 2EDHA 4WUUA 2YXMA 1XGTB 1HWGB 4P2OC 3ARYA 3IVKA 2VKWA 4Y4FC 1ONQB 3CFJA 4XVUC 3UX9B 3DMMD 1P1ZA 3RWIB 3T0EE 3P0YH 1ZT4A 4I8DA 1ZLSH 4H5SA 4NZDA 3VGAB 1TZIA 5EO9A 2A9ML 3G5ZB 2CUMA 3GMQA 5F72S 5DO2C 2X9XA 3RIFK 3I6KB 4XXDB 4RFOL 1CGXA 5J7CC 1IEBB 2D2OA 2XXCB 5LAXA 4I77H 2AK4A 5DS8A 4MNQB 1HE7A 3H3PL 4GRWB 4HZLB 1CIUA 5JIPA 1RK1B 3V4PH 1F97A 3ES6A 3OAUL 1DZBA 5E2UH 5E03A 3IDJB 3PXHA 3BDXA 4DOHB 3W9EB 4L9LC 1KTRL 2NPLX 3RHWK 1IC5H 2GT9A 4HUVA 2WUBH 5DJ2B 2APWA 2VDML 2EDKA 3B83A 1QRND 2XZQH 1KN2L 2DBJA 3FRUB 3TNNA 1JNHA 4Z77B 1LP9E 3BZDA 2L7UA 5E9DA 4H1LG 4R90L 5IVZA 4U1LB 3VFSB 4ODUA 2QJDA 4ODVH 4WFED 3VRJB 2CO7B 4ZFZB 2BHUA 3EYUL 4RFNB 5BS0A 3EFFA 3L5IA 4WU5A 1YYML 2DBLL 2D9CA 4WWKC 1IGJA 1RIUL 4LCUA 4MA1C 4F7MB 1RZFH 3ETBF 4DGVL 5A40E 1LWRA 3FT3B 3REVA 3UTOA 1N64H 2OX5A 5JOFB 1S9KC 4HDIB 2NY4D 4FTVE 4Z7UF 3E8UH 4WHCA 2YRZA 4P4KB 4N90D 5E4EB 4R6UA 2P8LB 4K23L 3G5XA 5C0DB 4WV1B 3B3IA 5K9JL 2QSVA 1ACYH 5TQ2L 1NCCH 5F9JB 4JZOA 2EO9A 4RZCA 4YXKH 1EA9C 2ADGA 3MTRA 4XMKL 1J8HE 2E6JA 2GK0B 4Y19B 3RX7A 3EOAB 1MJ8H 4E5XA 1OGAB 4DQOL 3O6ML 2QKIA 1QYGL 3PL6B 1ED3A 5K59E 5AD0A 3MA9L 4JFDA 2LABA 2BVQB 5ESQB 3UJJL 2D7NA 2JCCA 1A1MB 4K7PY 5HY9A 4HUXB 3W39B 3IETB 4XAKE 1W2KT 5F6HJ 3B4NA 1Q9WA 5IM7B 4RX4D 4NP4H 3S97C 3I6GA 3HG1E 3UTQA 4IHOB 4F58L 4P4RA 6FABH 2O26U 1DBAH 3TO4A 4C59B 4F2MB 3DX7A 1AIFA 4XZUB 4GAGH 5EO1B 4GAJL 4KI5F 1A6AB 4PP2A 2EKJA 3DWTA 2X40A 4K3EL 5F6HI 3DRTB 1RIHH 4JM4H 5ISZA 5IHBA 4LHUG 2MHAB 4HG4K 3QZWA 1SM3L 2OJEB 1HXMA 4N1EA 5I74C 1N5YH 3G9VA 4G7VL 5LCVH 2YD5A 4U7MA 5F96H 5ANMB 2Z31B 4DVBB 1C7TA 1S3KL 4YHML 3CLEH 4PRNB 2HRPH 4EI6A 1IGFH 4O4YL 1GZQA 4Y8AA 2FIRT 4OSUH 4BK4A 5AAMA 4KKNA 3RIFF 5F7EH 3O3AB 4PJ9C 4Q7DA 1UCBL 5IWLC 3R0NA 3BN9D 5HYFA 1TTFA 4NSKA 5FYLL 4P9MH 5FCUL 4AT6B 4N8CL 1XF2A 1A7OH 1WQVT 5D6DC 1A5FH 3GSXB 3DGGA 4C56D 4M93C 4M62L 1I7RB 2Y23A 2FEDD 1QSFD 3FCTB 3QR2A 2OR7A 2VDRH 3PQYB 4K94H 2ADFL 1PYWB 1EEZB 1VACB 1MHPL 3ARGD 1QR4A 5CSZA 2FX9L 1FO0B 3H0TB 4LRIA 3DV4A 4CMMA 2BZDA 2I27N 2Z93B 4IBLT 2ZG1A 3VWJB 1ND0A 3GSWA 4EUPG 5JXAL 1AGDA 2HJFA 3BEVB 4HUUA 2AXFA 3LD8B 1EFXD 4ZXBB 1WK0A 3B2VL 2OQJB 5JMOC 1RUAL 3EGSB 3RTQD 1A6UH 3RGVA 4TULH 1CF8L 1BD2E 2P43B 1CQYA 1PLGL 4XCNB 5MHSD 1YNKL 3S88H 3G6JA 2XTJE 3LB6D 5KAQF 3BPCB 2WIIB 1TQCB 2X4SA 4TUKH 3O0RL 1D3CA 4Y5VA 1GHFH 4DKAA 2WUCH 4ZUSA 2XWJA 2ARWA 4TTDD 3RKDC 1FJ1A 4GQPH 3VD7A 4Z7VB 1ADQL 1A64A 1X5LA 1ZKAA 2JCCF 1UT9A 3O8XD 1UXWA 4MXVF 1XGUA 2DWDB 1BAFH 1FNHA 1SJHA 4BZYA 3OWEA 5H94A 1U8HA 3HE7D 2VQ1A 3SE8H 5C0FA 4BUHA 1MFAL 3N0PB 4J3WA 1INQA 2IGFH 2PW1A 4HKZA 4WW2C 3P4NA 4B7IA 5GJSH 4QXUH 4RFEB 3ZDZF 1XZ0B 3EJYD 2XKNA 4I2XE 4F7EB 3ZKMD 4D0CA 1S9WA 1CL7L 5JO5A 5DR5L 3C6LB 5EWIH 4MAYA 1SVZA 3G04A 1BBJA 2VZOA 4HAFA 4QHKI 3MJ8A 5I1HL 2GIYA 4L8SC 3O3UN 1U8OB 1Z9LA 4KDTC 5ILTH 1CICD 3ZYZA 5CIPB 4U6VL 3H7BB 1GPOH 4ZO7A 4Q9QH 1ODAA 3T0VA 1MRDL 5EIQA 1OT1A 4U7SA 2Q6WA 1X5ZA 3O6FB 4KHXH 4MXWH 5FGCB 3CUPB 2HVJB 4URTB 2VE6A 3SKUD 1N3NB 2VLJE 3UTPD 1PW3A 5JNYB 2NY4B 1IARB 3O2VL 4YFLF 1D6EB 5ICXA 2UYLB 3WS3B 1OF2A 3L1OL 4YHZH 4XNMB 1VPOL 4IOIA 2NNAB 3E2HC 3PDGA 3OHXA 2Z35A 4N9OB 4EJ1C 5D2NE 4GXUM 2VLRD 1FIGH 5TQ0L 1A9BA 2PTTA 2H2PD 4HK0A 5T33L 4ODSL 4OUUA 5J1TC 2A1WH 3GIZH 4JPWH 1JGLL 5EBWA 4AIZB 1QBML 4P2CG 3CAFA 5HHNA 2O61A 3KLDA 1Y6NR 4PRIA 1P4IL 5DK0A 5KSAC 1AR1D 4Z7UE 5C6TL 1PG7L 1YUHB 1AC0A 5DZOA 3RJQB 3FB6B 4ZFFA 4CADB 2CGRL 1YEHH 3CZFA 2FSEB 3OGOE 1KNOA 3MLRL 3UC0H 2V2TA 3HFMH 2OI9C 4G9FE 3SDCC 1UZ8B 2Y72A 2HAZA 1J7VR 1HNFA 2HFFA 4RSVA 1FAIL 1BIIA 1EV2E 1T03L 2IEPA 2X4PA 4WHTA 4UV7L 4CKVX 1UA6L 4NNYA 1MAJA 4N1HB 3CFKB 5CEXA 1GGYA 5IW6A 4XXCC 1AO7D 5JDSA 1U8LA 3L7EA 1ES0A 3ZHLA 3WNOA 2EEBA 5C09A 4KK6D 3WEXA 4ZOBA 4UQ3A 3A67L 4O02H 5DRZB 3B2UC 4JO4L 4LARH 3G6DL 1FE8H 1ROWA 2CIKA 5F7MC 3T0BA 4WUUE 5GGUB 3AS2A 3GKWH 4LCCB 5JPNB 3MRKB 3FOMA 2ZUYA 4WI6A 4KI5E 1A7BA 1M7XA 5EUKB 3OX8B 5D2LA 1GC1H 3NGBB 4OFYA 3BPLB 4QHMA 3O3EB 3RWCB 2NY6C 3KJ6H 2VWEC 4JY5H 1H5BC 4C56B 5GRXG 1WZMA 2BSSB 1QSFB 3LOWA 4K7FA 1RHHA 1VFBA 2X2YA 3RZCC 2AK4E 2W60B 3SOBL 3ARPA 2V5YA 1H3VA 1T7VA 2C9AA 2R2HA 2XZCH 3MACL 4H0GA 4KUCF 4GW1A 1T80A 3TYGH 4I4WB 4LIQL 4KRMB 5KVEH 4F7CB 3K0WA 4NQED 4P23A 5HHME 3HUJB 3IFNH 3L7FB 3VU2A 5HVWA 5F9AC 2PYFA 5HI4C 2KH2B 4M7KH 5BVJB 4P46A 2OR9L 4CBPA 2YHGA 5E9DE 4FQ1H 3IGAB 2CKNA 3TIDB 2AKRB 4OBRA 1LEGB 2CLRA 4LPUA 4J3XA 5TGBB 3MV7B 3DURA 4NHCL 4KVCL 4HIJA 5BS0E 4NNPL 4ZSOA 2UY6A 4OD3H 4Q9RL 2X4OA 5IW3A 1DQLH 2R23B 3L6FA 2LTQB 4LLUA 4ZO6A 2L7JA 3FZUC 1I9RL 1KJ3H 3QDJD 3FMGH 5J56B 5EUOA 3O8XB 2JK5A 4NRZB 4PB9L 1A6TA 5EN2B 2NZIA 4NO2A 1TIUA 4WY7H 1M05B 2OL3A 4OGXL 1NCBH 4X8XA 4L8BB 1KYOK 4QHLA 2V9RA 5ESAB 1Z0MA 3MNWA 2R1YA 2HTLD 2EIDA 2HG5A 4GXUN 2J4WL 3MJ9H 5T5FH 4NCDA 1OAUH 3MNVB 1G7MA 3UP1A 1MJJA 3GGWB 4JREC 4NNXA 1ZHLA 3PDDA 4M00A 1F8TH 1BVLB 4TVPH 2Z0BA 4JFDE 1TJIH 1CU4L 5IB1A 1WBXB 3EOTL 4WO4B 4ODTL 5GZND 3ZE0F 4FQCH 2JCCE 1M71A 4TPRH 4MXVE 2ARJA 1KCSL 4NJ9H 1CT8A 1T66D 3NZHL 4YO0B 1U3HD 1DQJB 1LEIA 4FQJL 5LWYL 3MR9B 4NQVA 3QQ3A 3ZL4L 3ARBB 2QLVB 3GSQA 4X6FB 1E6OL 5CP7B 1IEAA 1NDMA 2B39A 5DQDL 3RQ3A 3ZDZE 3F7VA 2MKWA 4JHAL 2OXHA 5ISZE 4UI2A 1OWWA 3HPLA 2IAMC 3CFDB 1ZMYA 4U6HB 1RVFL 3NFNB 5F8RC 1T89A 3T0WA 1WBZA 4XPGL 3VDCA 3CPLA 4BFGA 1RUPH 1MFDH 3K1KC 4HH9B 4U0QB 4UILH 4FFVC 4HKBA 4DWHA 2L0DA 1HYRC 1S7WB 1HILB 1JZ2A 3CU1A 2VLRB 5CILL 4HWEH 4M7LH 4KJYB 2NX5B 1PSKL 4G6MH 2VL5B 1Q0XH 5GGRB 3SY0B 3PUCA 4FXKA 4KJPC 4CVWA 3OKOB 2NY5L 5KVGH 4X6DA 1C08B 1G7HA 3OKEA 3TCLB 1ZV5A 2DIAA 4D3CH 2CK0H 2APXA 5AWNL 3NPZB 4HUWA 1BGXL 2H2SC 3BHBB 4D9QE 4KTYA 1C16B 1OL0A 4WI2A 2E7CA 3IAGC 2PETA 4KQ4H 3VFNB 4OFVA 4A2LA 2NY3C 2EYRA 4JFFA 4HQQL 3VDBA 1MCOH 3DRQA 1T04A 3G08A 1S7TB 3U48A 3K46A 1FQ9C 1J05B 3A0OA 5I16B 1G7JA 3EJZD 3D18A 3NA9L 5EUOF 5CD5D 4G8FA 4ZPVA 3W81A 2HFEA 4WFGD 4X5WB 3DVFA 2BFVH 3EOYG 4LSTL 5KVDL 1QQDB 2AERT 4N0RA 4D8PA 4DZ8A 3EO1A 1X5AA 2P7TB 1TCRA 4OAWB 4PJXA 4D9LL 5HHXH 1RZJH 1KLGB 1M7IA 2I5YH 3HAEG 4F37K 1N6VA 1HKFA 4O2EA 3DX9B 3RWHA 1F4WL 5EB9A 3KPLB 3VG0H 4R3SB 4PRAB 5D7LA 1TETL 5FB8B 2R1XB 4DUWA 2DQJH 4PJCB 2IALA 4HH8A 3V5KB 3GKZA 4TQEL 1UB5A 3K8MA 4YHOH 5CJBA 4ONGH 5MP6H 1D9KB 3MBEB 4WTZA 4GW5A 5E4EC 1U8NA 4ZTPH 1HCVA 2HFGL 4PRHD 3QXDB 3ULSA 1T3FB 2YMXL 1DANU 4JY6B 4S1QH 1JN6B 3EKCA 3FTGA 1IM9A 4F15B 1VFOA 2CDFA 2VQTA 3FQTA 4G3YH 1A7RH 4GKNA 5C0JA 4Y4KA 3SDDB 1A9EB 3WKMH 4GJTB 1RD6A 2V7NB 3VD9A 4ZNCD 3LHPL 4YGVA 2F15A 3PL6C 5B3JF 4O00A 5C0AA 4FMFA 1JWSB 5E8PA 3C08H 5FUOL 2ZSVB 3TVMA 4MJID 5CBAA 1TJGH 3AY4C 4HFUL 1Q9KA 5HI3D 1NLDH 2B4CH 4FQHA 4D0BB 5IBTL 2GJ6D 4LQ1A 3P4OA 3MXVH 2C5DC 2X4QB 2VISB 1RJLA 3EDKA 3FO0H 4PGDA 5C0CA 1ZHNA 2HT4C 3LEVL 3KR3L 1AH1A 5D7SL 2CLVB 2H6PA 4X6DF 3O6KL 1YN6B 4GUPA 4RWYL 5DJ0A 3RX8A 2AJUH 5JPMB 5DRNA 1FVEA 1JZ3A 1E6JL 1PY4A 3U4BL 5E99H 1WGOA 4UDTA 5CGYC 1X44A 4HSQA 3L3JA 4HS8H 4QXTB 1IM3B 5C08B 4ZYKA 3STBA 3MYJA 1FG2B 2YPVH 3DIFB 2F53D 3QI9B 1N8ZB 4W68A 4MCZA 1ZT1B 1D5IL 4Y89A 1LNUA 4WI7A 5FXCH 4HBCH 1W72A 1T83C 5IB2A 2EXWC 2MCG1 3S35X 4IJ3B 2RBLA 1LHZA 3DO3A 4YC2B 3D48R 5HYSB 5TE4L 3V2AR 3O4OB 1DN0B 4LNRA 2VLMD 4LPVA 1FNSH 5HBBA 4M1DH 1CFTB 4JRXA 4PJXF 1AD0B 1QR1A 1HN1A 1VFUA 4PRIE 3MRQB 4LEOA 4OGAD 1U2CA 1R3KB 1SYSA 3SE9L 4LK4A 1U3HB 2FZ3B 2AJZB 2EZ0D 4CU6A 2A9MH 4JFZL 3OF6A 4JRWA 1ZEAL 1WZ1L 4NC2B 3LKRA 4Q2ZA 3LN4B 4KK5D 1OQOA 1KG0A 4K9EL 4RFOH 2JJTA 2NCMA 4D0DB 1CFNB 1C8PA 4F9LA 2JF1A 1I8MA 4N68A 3VWJC 5GSVB 4R8WL 3BP6A 1FL3A 3TNMB 1I1CA 1E4KA 5J9PB 4FQXB 1QRKA 4GS7B 4O2FB 2FL5B 4GKOA 5C09E 3RVVC 3ZE0E 2RGSA 5ETUB 5MEPB 5E7FA 1P2CA 2P24B 3A6OA 3ORJA 2VDMH 1D5ZA 3L95B 5I1IL 1IKFL 3QHZL 4IDLA 1NCNA 1TQCC 3MLPA 3DARA 4L8CB 2OP4L 4MNQA 1AI1L 2B8OT 3Q3GB 1QSEA 5CJQL 4HKXA 1U91B 4X0KA 2Q7YA 3EYUH 4LDLB 5D2LE 4GRLC 4Y4HA 2YD8A 4XHJD 3BH9A 2KZ1B 4ZFOA 2GSIB 5EOCH 1MHHB 4HK3J 4L3CB 3QWOA 1HOCA 3HMXH 1CG9A 3MCKA 3LKSB 1QEWB 5EH1A 4P2RA 5IJVA 4H20L 4ZFOL 3CSYB 3V9FA 2ICWJ 4NGHH 5TQ2H 4PV8B 1KEMH 4XMKH 3K2UL 4PFEA 4OJFL 5H35A 4Y1AA 5KG9B 4NUGH 3C6LC 1UWXK 1P4LA 5DD3L 1LO3L 1S7QB 1RFDL 1UJ3B 2ICWI 4MA7L 4Z0BL 4OLXL 3BUYA 3ZSSA 2E9IA 3UJJH 5C0DA 2F8XC 3OXSB 3MRRB 3G6AA 3JTSB 5ABDE 1I3RB 3HPJA 2IQ9L 3MMEA 2Y6SD 1HHGB 3BQUB 1H8NA 4WTWA 3FT2B 3ULUC 5CLTA 4FQIL 4Y88A 4ZSOE 3BKYL 4S1SL 2AJ3B 3O6FC 3RBSA 4HJJL 2Z9TA 2X4UB 7FABH 2A73B 2WLZA 4KMQA 4KRPD 1S7XB 5EUOE 4QWWD 1H3UA 4FQLH 2HWZL 4JM2A 1I85C 2FO4A 4CAGA 1EDQA 5C0IA 1N6QL 3KVQA 1Y0LB 3RVTD 4XNXH 4HUXA 1JGVH 2R0LL 1BJ1J 1YNLL 3PWJB 1SM3H 4PGEB 3JBG7 4LSUH 2NW2A 4QOKA 1R5VA 3SKMA 1SYVA 2FH6A 3WD5L 1AGBA 3G5YA 1J11A 1I1YA 5I66B 2Q76B 1BFTA 3OKYA 1T7YA 1S3KH 1EJ6A 4O4YH 5BZWA 3DI3B 5HYSG 1BBDH 2AEQL 1K5NA 1YY8B 4I18A 2QQLL 3H8NA 1C12A 1UCBH 3VFRB 3OJDA 1W0VA 4PY8J 5SX4H 4BFEA 1I8KA 5FYLH 1OT2A 4Z5RB 3CGTA 1UWGL 1CLZL 3GRWA 5AYUL 5KANI 3MRFB 3AREA 3WE6A 1OSZB 3FFCA 4FP8L 2RFXB 15C8H 3V6OC 1MCQA 4O58L 3SGKC 1NBYB 5E1AB 3GRWL 3LQAL 2FX9H 5GPRA 4MVBD 2QHLA 1X9QA 2EIZB 2VTFA 5B3JE 4KRNA 5CJ8A 1F3JB 3TPUB 5JXAH 2ORBL 2FR4B 3BGMB 4ALAL 2YPLD 4MDIB 2HTKC 2F53B 4RGMB 3B2VH 4K2UL 2NY0B 3H9HA 4NC1E 1F2XK 4NZJA 1EIBA 5DHVA 2X44D 1CF8H 1PLGH 3WFEL 2FNBA 4J3VA 1VACA 5D70L 4UTAL 5ICYB 1HH6B 1FO0A 3IF1B 4OQTA 4FABH 4S1RH 1JI2A 3O0RH 4XH2A 3CDCA 2QADD 3N1QC 4X6DE 2IPUG 2JELL 3C5JB 5HD8C 3DX6B 1P84K 2WP3O 5DJ8A 5L7XL 1FO0L 2VAAA 3DSFL 4OQTL 3D69B 3NGBC 4JGJA 5FV1L 3VMNA 43C9A 2X9YA 3BPLC 1ADQH 3O6LL 2AI0L 5GGRY 5C7XL 4WUKL 5FM5M 5E2VL 1DVFA 5CZXC 3TZVD 3H3BC 4ZUUB 4JFFE 4JFPB 2OMNA 1RUML 3REWA 2G2RB 4WFHE 1DEDA 1MFAH 1I7ZB 1MCWW 2YWZA 3CH1A 4XMPL 3CXHJ 1G84A 4YR6A 4JM2F 4OTXL 1WFTA 3DMMA 1F90L 3M17B 3C2AL 4LDOB 2ATPA 5DRXB 4PJXE 3W5MA 3L3OA 2PO6D 1FV1A 3IDGA 1RZGA 1XGRA 1NBZB 5F3HB 3QO0A 4G80B 4QCIB 4C54A 4PR5A 1JYNA 3T77A 4JFOB 4R9HA 5I2IB 1DDHA 4UNUA 5D7LE 4MD0B 3RNQA 1HHJA 4UUJA 5DQ9A 2ZP0T 2NTFA 2LTQC 4IM8A 5HGBB 4ELKB 4BSVA 1XGQA 3KXFD 5JW4M 1MVUA 2DAVA 4NO3B 5F1KC 1UADC 3VGEA 3VGHA 1QRNA 35C8L 5IR1B 3O2VH 4Q6YA 2VNCA 5M94B 1MY5A 4S0TD 5D7JD 3L1OH 1VPOH 1CDHA 4OLYL 5IGXL 3IU3B 3SHSA 4H0HB 5I0DA 2EYTA 3BAEH 3TF7C 4IOFC 1IKNC 1JK8A 3ECBB 3UTSE 1VGKA 1R0AH 3B9EA 5C0AE 1NGZA 5FUCC 4KGJA 3HI6L 5T33H 1KCKA 1EXUA 4ODSH 2WWKT 4WO4C 4XX1G 4HGWB 1NKRA 3KYKL 4DGIL 4NRXA 5FECB 1JGLH 2IANA 2ICEA 1JTPA 3QA3A 2WQRA 3X13B 2XT1B 4LSSH 4MS8C 5C6TH 1PG7H 1R3IH 1KN4L 3S37X 1KV3A 3ARBC 4PJEA 1T0MA 1P7HL 3BKJH 5C0CE 3STLA 1KFAL 4R26L 1WCBA 1QBLH 4BZ1L 3BGFC 2Y36H 1CFSB 3H9SB 1L0XA 3P4MB 3GJFB 4R97B 2XWBA 2XRAL 3KPOB 4F3FB 4KRPB 3T2OA 5AZEH 5FFLA 1FAIH 1VEMA 2C3WA 3VGGA 5ERWB 2VR4A 4ENED 4UV7H 1UA6H 2CXKA 2H32A 2HJKA 1U93B 1P53A 4RAVA 3WN5C 1CK0H 1EFQA 2JB5H 2PKDA 2RR3A 2EH8L 4W4OA 1D5BB 3OKMA 3ARTA 4E42B 4NC0B 4HCRH 4N9GB 4B7LA 2CK2A 1HZHL 4RBPH 5BZDB 5B8CC 1KGCE 1K2DA 3SCMC 3BP7B 1ETZB 2GJZB 2EDQA 1VB9A 2E9JA 1IILE 3G6DH 4RA0C 5CZVH 1FHGA 1AP2A 5GSRB 3MQIA 2YZ1A 3D39D 4LKXB 4JJHA 4DAGL 3OB0H 5DJDA 1JF6A 5CD3A 3SE4A 2Y07H 2OBGA 3RX5A 1OAQL 2VC2L 4JRXE 3QP3A 5DQJB 4WNQA 4CDGC 2K1MA 2DJSA 5ALBL 4G8EB 2DLFL 5I1JL 4OV6F 1T0NA 1MI5A 1AHWA 2GFBA 3JSSA 1CDJA 4PJDB 5GGVL 1NGWB 3GZKA 4G8GB 5T5NF 3VWKA 3QNZA 4LP4A 4PJHA 3QIUD 4JDVB 3V4UL 3V7AG 3RUGA 1EO5A 3AAZB 1B88A 2IPKB 5TDOA 3SOBH 3BESR 3KNBA 3C60D 3P30L 4TUOA 1WWCA 2UZIL 5CP3H 4ORGA 1T1XB 4U1KA 4LIQH 3MO1A 5IVOA 3B43A 2JJSC 4X5XB 1QPPA 3CFEB 2ED9A 2ZJSL 4GH7B 5D96B 5CBEA 4YXHH 3BI9X 5E5MA 2XACC 2W60A 3ARGA 5E94B 4ODHL 1QSEE 2AJSH 3VXMB 4QYOB 1MOEA 3T2QA 5EZLA 2A6KA 3D87B 1IC1A 1YJDL 4NHCH 4TOYL 1BF2A 3WFBL 1LO5A 4YQXH 4AEFA 1NUGA 1JYWA 1N59B 4PLOB 2AP2A 5I17A 1BFVL 2LV4A 1D9KC 3MBEC 1EFXA 5DJXA 4OF7A 1KIUA 2P47B 1DBKL 3RTQA 4P2RE 1Y6MR 4LCIL 2GSGA 4X99A 3GMPB 1OAXL 4PJEF 4IRJA 4KKBD 4TNWK 2YPKA 4F15C 4JKPH 2Q8AH 2J5LB 4OGXH 1KTLB 3QG6B 3QHFH 3SDDC 1FCGA 4LLAA 4FXGA 4HMEA 4J8RA 1V7ML 3U4AA 3SDXB 4JO1L 3JWOC 2J4WH 3KPSD 3MRBB 1DJSA 2A0LC 4YPGB 4Y1AE 5AZ2L 4ZMAT 5BRZA 5EZJA 4PRDA 5FGBA 2HVKB 3FQNA 4B0MM 3B9KA 4NRYA 3K7UA 3OPZL 5E8EB 3HC4H 3EOTH 3HE7A 1LE9B 3FKUS 4NQDB 3WLWC 3EAKA 1O5DT 4YNYB 1KCSH 2R69L 3KWWB 3NZHH 5GHWL 1J1XL 5IEKA 3WO3B 1NKOA 1U8IB 1FZOA 4ELMF 1RULL 1XIWB 4N0UB 4RRPG 3PP3H 1AD9A 3OR7A 2QQKL 4N8VA 3OB8A 5B38A 1EGJL 4P5MA 1S7UA 1OVZA 5D1XD 1BVLA 3EO9H 3NIGE 4YBQC 3QIWD 3GSOB 3KXFB 1V7NL 3DLQR 5DQDH 1NEUA 3AMLA 1QFHA 3AS1A 3TBWB 4DZBB 4AYFA 4LOUC 4MAUH 4PY7B 4DCQB 3MLZH 3MRHA 3HHRB 1CICA 2PXYD 4HV8A 2X5PA 3QI9C 2P5WD 4LHJB 4LF3A 3WNMA 4XPGH 4QOKE 1QLRA 3MUGB 3A6BH 5D8JL 4JZJC 4P9HL 1TJHH 3PHSA 4PJHF 1ZHBA 1KPUB 5DD0H 4PLKC 3ZLQC 1L7IL 3RUGF 4P2OA 3DV6B 5E8NB 2YSSB 2PUQT 4Y5XB 5KOVC 4YC2C 3TFKD 2D0FA 2BVOB 1UC6A 3NH7L 4MZ3A 1B90A 2MJWA 3IKKA 5CILH 1B4RA 3CSPA 3O4OC 2I9LB 3HZMB 5FIEA 1PSKH 1R5WB 4X8JA 3E6FA 1SHMA 1I3GL 1NC2D 1GH7A 5IB5A 1EZVY 5KOMC 2FATH 3JXAA 3MGTB 4K55A 1G9NL 2I07A 4MDJA 4Z18A 1RZKC 3FFCE 3G9AB 3Q5YA 5DZNA 3QJFB 3IJSB 4BH7A 2G9HA 1S7VB 4JVUA 4OM1H 3N9GL 3I75A 5CSBA 4HQQH 1DL7L 3FONA 4NM8H 1D7FA 3ZO0A 5L8KB 3RL1B 3VXOA 4MQ7A 5IBLD 3RAJL 3NA9H 4FQXC 1BZ7B 4OZFA 4GG6B 1C5DA 1EJOH 2UZYB 4N8PA 4Q74A 5E8OA 5HHOD 4ORZC 3P11H 4ZQKA 1FNEB 5KVDH 2DWEB 1GOGA 1TVHA 3MV8A 3LDBB 1S78C 2MCPL 4FOMA 4TVSa 4N0YL 4D9LH 2D0GA 2J8UA 3EYVA 3S98A 3RNKA 3IRZA 4YHNA 3L5WB 4WWKA 3NFPA 3QO1A 3V6FB 2P8PA 4JPKL 4I9WE 3BP5A 1K9TA 3D39B 4OZGB 3RWEA 2MQ0A 4YXLL 2I60L 4TNWF 1JYXA 2NY1D 1J0KA 4JDTL 1AO7A 5LGJA 2FX8H 1IGML 1YEIL 4R96A 2XY2A 1D5XA 3FO9B 4JKMA 2FIKB 4MX7B 3IAPA 1G9ML 1OTUD 4HXBL 4CVXB 5ID1A 2HFGH 5E2TL 2CLZA 4NT6A 1N26A 5D6CB 5IFHL 3T0ED 4TSCH 1YY9D 1NGQL 2CXGA 3QAZB 3QUXB 3C60B 5DVNA 3KHOA 4EI5D 4H1LH 3GMOB 1OW0A 1NJ9B 2CIIB 1P7KB 3LHPH 2GYSA 1QFUL 1CE6A 3KPNB 4BFIB 4I0PB 2PR4L 4QTHA 5FUOH 3CMOL 3RDTB 4GLRH 5D7KE 2FJGA 2XG5A 1X6LA 4HFUH 3UJIL 1OGTA 3BQUC 4YZFF 4ETQB 4IRZL 1WEJH 4ERSH 3QIBC 1YNTB 4MMXC 3ULVD 1UM5L 4M43L 3JZ7A 4R4FL 4YHKL 3OZ9L 5I19L 3MRDB 3LEVH 4NQEA 2E7LC 3KR3H 3L5JA 4JCMA 2HH0L 4I1NB 1Y18A 3MLTA 3O6KH 4Q9BA 2DM4A 1NEZA 5GS0C 4RBPK 5FGRA 1E6JH 2VRAA 3MRMA 2GKIA 1QRNE 3OTTA 3QXWA 1QD0A 3QRGL 3S7GA 4JO2H 3HLAA 3F7QA 1N6UA 3WUWA 4NOBA 1KELH 4HX1B 2BY3A 3AS0A 5C0BD 2VAJA 1CLCA 2JB6B 1CDGA 1F4AA 3P73B 1D5IH 1PQZB 4BFBD 4YUEH 3V0AC 5EZIL 1KB5A 3KPSB 5EBMB 1MAML 5SWQA 3SKNB 2CSPA 5IWLA 1WBYA 1NMAH 3QDJA 4FFYH 2GQHA 5BO1L 1ZLVK 1GYAA 3OKLB 4C55A 3QFDA 1XCQB 3WL9A 1A3RH 4Z7OF 1K8IA 5TE4H 2IANE 3LKQA 5D6DA 3GSRA 1J8HD 4KV5F 1ZS8B 4NQCE 2R2EB 3FB8A 2J8UF 1XR9B 5IHUL 4M6ML 1UKQA 3LKNA 3WFHA 3RPIB 5CUSL 5CEYB 3PGCB 1GGBL 4PJEE 2AS5M 1ORQB 4R4BA 3EDJA 3QDAA 5CWSA 1J1OH 3S3PA 4EOWL 2JIXD 4GMSL 3BIKB 4XP5L 2UWEA 1ZEAH 1H0DA 2WM0A 5FYKD 1WZ1H 3DVIA 2VXTL 3DBXB 4UT6L 3R06B 5EC1B 4U6YA 2XFXB 3SJVD 2E27L 1FGVL 3MRQA 5DC0A 4R8WH 2R2BA 3TIEA 3J8F7 2GTWB 4UV4L 4MHHI 1EH9A 5DLML 5IFAL 5IVXA 2P5WB 1WIOA 4MJ5B 2V5MA 3VFWB 3RWGB 2NY0C 1UFUA 2D03H 1QLFA 5D93B 1OARH 5JUEL 1QVOA 4JJ5A 5IVNA 5DSCB 4LLWB 5IEHB 4ELME 3KDMB 1IKFH 4R2GD 5EULV 3HZVA 1BVKA 4M7ZB 3IDMB 4JR9H 5T1DL 1AI1H 1CGWA 5CJQH 1MFEL 1CXLA 4OKVB 3T0AA 3EYOB 3KLAB 3GM0A 1NGXA 3U9PH 4GAYB 1MI5E 1IT9H 2Y5TB 4GRWH 5FA4A 2E6PA 5TE7L 3GMLA 2VXQH 4WCYL 1NANH 5D7IB 5F7WC 2MPAL 4JZNB 3CZJA 4OZHA 1QA9A 5KTEL 4PJHE 3GDBA 5INCA 3RUGE 4H20H 5E8DH 3ARDD 4E41D 2VR9A 1LK3L 1U91A 3L9RA 1RUKL 3D85D 4XNQB 5EU3B 1PKQB 3K2UH 4LKCA 5I8KH 4L8SA 1MAKA 3WLBA 3I9GL 4OJFH 4KDTA 4WJ5A 5FF6B 5HHOB 2MFNA 5D5MB 1I1AD 3CCHB 3OQ3B 4MMZC 4A6YB 3QUYB 1F11B 1RFDH 3NZ8A 5J3HC 5C2BL 2BERA 2APVA 4MA7H 4MWFB 4Z0BH 4OLXH 4HD9A 2G5BA 3VFVB 3MRJA 4MXQC 1YQ2A 5E08L 1SMAA 3HB3D 3SQOL 5HGAB 4G8IA 3THML 1JZ5A 3LKOB 2ERJB 3C87A 1A7QL 3IXTA 3K3QA 4P3DA 1A3LH 1X5FA 4P99A 5F1OB 4YE4L 4HJJH 3D3VA 2IG2H 2X4TB 3B8YA 4RCAA 3RVXD 5CEZD 4G42B 5T1KB 5F9DC 3NA4A 5E6IB 3B6SB 2HWZH 2ICCA 4CUCA 4M61B 5INDB 1MCLA 4L29A 5I75B 1T21B 4QRUB 3FQWB 1CD1A 2UWEF 2XWTA 3L3KA 1FZKB 5SWZD 2GAZA 4MQXD 5I0ZA 1BOYA 3LH2L 2E9BA 4KKLD 4WHDA 3T4AA 3BD5A 1ZHKA 5BRZE 3UTZB 2MMXA 1C1EL 3OMZA 5GS1C 4BQCA 3GB7B 2VZTA 3RY6C 3BOVA 5KSAA 3ZKNC 4OFPA 3MRLA 3WNNA 1T1WB 4PRHA 3RL2B 5I1DB 2D3VA 2AEQH 1FZMB 2BOBB 3ZE2F 1IAOB 3VA2C 5L88L 2QQLH 2OTUA 3DVNB 4DEPB 3HE6B 5HGHA 1KCVL 2R0KH 2FWOA 3D5OF 5AYUH 2R0ZH 1KENH 2R0WL 3TN0D 4OCWH 4X6CA 2MKLC 1G7PB 3HA0A 4FP8H 5F3BB 4DVRL 4MA3A 4H26B 1WVZA 2FBJL 1LP9B 2AVGA 2W92A 4O58H 4E0RA 4ZAKB 2YUZA 5ALCL 3WSQL 3K2MC 4NKIL 4MJIA 1T6VN 2XY1A 2J88L 2BSTB 4OD1L 4WW2F 4XCEA 5EOTA 4F8QA 4U1HB 2DLTA 2GJ6A 3F12A 3PIQA 4IEFB 4OZHF 4DN4H 1KCUL 1CFVL 4KK9D 3OV6A 4X98A 1HHKB 1RZIA 4FTVB 3UBXB 4YZFE 4NKMB 5EU7E 2W65A 4WVRA 3U7YL 2AV7B 5LG1A 3BEWB 3UTPE 2AXGA 1UH3A 4PJ7A 3Q1SL 2FGZA 3P2TA 2W0FA 2DQDH 3JTTB 5DHVH 4X4YB 1J8HB 5IMKA 2MTPA 2V2WB 2C1PB 3ARFC 1FO0H 1AQDA 1FFPA 5BXFA 3VFGH 3O6LH 5MI0B 4WUKH 1ZT7B 2BVYA 3F5WA 5DGQA 3S5LB 5E2VH 2B0SL 3SKOA 2JIXB 4XBEL 1A7NL 3MROA 5GGSA 1PY9A 1H15A 4XI5D 1RUMH 2F5AL 1FNGB 3W9DA 4G6AC 1HXYB 4GMTL 3WYRA 4GQ9H 2NTSP 4XMPH 1FFNB 1R3LA 5C0GB 3HCVA 3FFDB 5GRUL 3HG1B 1BOGA 1VFAB 4HC1A 4LLVB 4U1MB 2GCYB 5I71B 4XVSL 4Z7OE 2VDLL 1SVCP 1FVCA 3OKDA 1LD9B 3AC0A 3E6HB 4RDQF 2Q7NA 3S34H 3MV8E 4KUZH 3SPVA 2BVPA 4KV5E 2XYCA 3EYSH 5D96C 1OTTD 2J8UE 4HC1L 1MHCA 2B1AL 1NAMA 4N0CD 5F7NC 5ID0B 2HP4A 3OGCB 3WO4B 5B39B 3ARVA 4F33A 4WW1B 3B9VA 4KQ3L 1AO7E 3O11A 3GIVA 2FD6L 2VXVL 2X10A 4PTUB 5FM8A 3F58H 5F89A 2GK2A 3CK0L 2PCPB 3BZEA 3IDNA 3PV6B 5AYQA 1JNNL 2PN5A 2NXYD 4OD2B 3U1SL 2ZOLB 1AE6H 4P5TB 1L7TL 2F74B 2YD1A 3PP4H 4X6CF 4KDWA 1OP3K 3CVHA 5FO8A 4BYHA 5E95B 1J5OL 3RWDB 5C9JA 3CC5B 4OLYH 4Y5YB 1A6WL 1T4KB 1TMCB 3LPWA 5SX4I 1BPVA 5GZOD 5CIPH 3TJEL 1PVHA 2FCBA 3CVHL 3IU4H 4OV5A 4JFQA 4XBPA 5EFIA 3ULUH 3HI6H 2A9NL 4MNGE 4X7TB 3MJ7B 3O3DB 1MLBA 4DGIH 3KYNA 2YRPA 4EXPX 3IFLL 1DFBH 3TYFB 1N7MH 1WZKA 4NPYB 1XIWC 5CMAB 1YEDA 4AJ0A 1IC4H 4Y2DD 2R56L 5HHMD 4QO1A 2CKBA 1T5WB 1KN4H 4LFHG 5FK9A 2XKSA 4PJ7F 3C5ZD 4IIQB 4O5LH 5FO7A 3CLFL 4LHUA 1KFAH 4NQEE 4R26H 1BD2B 2CDEA 1TVDA 5E9DD 4QRTB 3S37L 4HWUA 1ZK9A 2XTJB 2CKBL 1K4DB 4X7CC 5HSFA 2LFGA 1HINL 2ZG3A 3NIDF 4PB0L 5FYJU 2ATKA 1YEGL 1QFWL 4P5KB 5BS0D 3HNTH 3Q6GH 1G7QA 3QEUB 2ZNXA 1SY6H 4G9DB 1I3UA 3ET9F 4YWGH 1MCJA 4G43A 1KTDB 2EH8H 4ESKA 2WBJC 1CFQB 1ZAGA 1GGIL 4M3KB 4X80L 4Y5XC 3QDJE 1JWUB 2ED7A 2BSED 3FT4B 2YN3A 1G0YR 1TNMA 4YX2L 5ERWA 3QNYB 4S2SB 2VC2H 2CMRL 6CGTA 3O4LD 3UAJC 1KPRB 4I2XB 1YA5A 4JFDD 3W0WD 1YZZA 3IS1X 4CVZB 2YXFA 4NFDA 5J4MA 1DLHB 2UWEE 4NQTA 4EUPA 2QQQA 2DLEA 5FA3A 3TN0B 3M8OL 4P57A 5DURD 4MQTB 1WC7A 3UEZA 2QEJA 4UB0H 3B5GA 3GSUB 1QNZL 1MIML 2GHWB 2VN4A 1KJMB 3TO4D 2P5EA 3P30H 2UZIH 3N50A 5GJTL 5JIIA 2ZCHL 4QRPA 1BQHG 3ZE2E 5DEGA 3QH3A 5JQ6L 5FV2A 5ISZD 2VLJB 2AEIT 4H88L 1CBVH 4PGZA 5GIRA 1H3GA 2OJZL 1A4KB 4HKJB 4I48A 3VFTB 4PJBF 4PG2C 4WGWB 1N4XH 3KLHC 5F9OH 4ODHH 4EBQH 1HSBA 2A83A 5D1QC 1YJDH 4I3RH 3HZKA 1CR9L 5D2NB 5I18L 1KF9B 4GG8B 4JKKA 1EEUA 1UH4A 3E3QE 2YPLA 1ZWIB 2OK0L 3HC3L 1Z3GL 5E7BA 4FFWC 5K93A 4GBXC 2W9EL 5EZOL 1MIEH 1XH3B 3D25B 4OZHE 1OAXH 2AJVL 3NAAL 3IJYA 4PJGA 3TBVB 3KPPA 3QUXC 4XPFL 4Z7UB 3IAQA 2X4RA 2Z91A 3FO2B 1HQ4B 5AUMA 4ZOEA 2DN7A 5TFSH 1R5IB 4S11A 3V4VL 1V7MH 1I9IL 1MH5B 3OXRA 4G9FB 4I0PC 4ODBD 1AGEB 1Z5LA 1BP3B 3PWLB 1Q9OB 5CAYB 1IC7L 3V0VA 3RDTC 3TZVA 1NGPL 3RU8H 1PDKA 1KTLA 3ME0A 4U3HA 2KPNA 1EX0A 1FVDB 2NMSA 4M03A 4ODWB 1J1XH 2YC1B 3VXNA 3EHBD 1UXSA 1MWAA 1RULH 3LQZB 4QRSA 4WFGE 3C5SB 3RGVD 2HN7B 3VE0B 4AL8L 3RVUD 3D3VE 1CGTA 1U92B 3LRSB 1EGJH 8CGTA 4ONHA 5EIIA 3I2CL 1MCRA 2WIMA 1S5HA 4WUUB 1OD9A 3VXTA 4POYA 1MWAL 2PO6A 4R4NC 1V7NH 4NBYB 3UJTL 3IVKB 4RA3A 4AMKH 2D4FA 2FDBP 2WWMC 2NXYB 4TUJA 3CFJB 3W82A 1P1ZB 1T83A 1G7IA 2D31A 5FHBH 4L3AA 1ZT4B 1TXKA 1CDBA 4YFEA 4H5SB 4YDKL 5D8JH 1TZIB 4P9HH 5EO9B 2FO1A 3L5HA 4Y8DC 2DKUA 1OQXA 3GMQB 3MRNA 5FKPA 2OZ4A 5JXED 1FIEA 4HWZA 1YPZA 4I0KA 2HT3C 4HEME 5SX5K 3NH7H 1Q9LA 5LAXB 3VDAA 4PRHE 2AK4B 5DS8B 3U0PA 4RGND 1N0XL 4PBVC 4ZUWA 2D7QA 2OZ4L 2OSLA 4JG1L 3U79A 3ES6B 1I3GH 5DK2A 1HKLH 5D7JA 3MOQA 5DUPL 4MHHG 4K3DL 5HHMB 2GT9B 4HUVB 3MBXL 1DCLA 4X6CE 4HLJA 1II4E 2BVOA 3TNNB 1JNHB 3MREA 1FNAA 3BKCL 3U7WL 1BFOA 3ARWA 5E9DB 5IVZB 4M7JL 3TBYB