1XF3B

Structure of ligand-free fab dna-1 in space group p65
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
218
Chain Sequence
QVKLLESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCVRGGYRPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab Light chain
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 218
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf3B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf3B02
3HAEA 4R0LB 3TT1H 3L3JB 4GQ9L 5IR1B 2CPCA 1QG3A 3D18A 5LQBH 5D7IB 4LRIC 4FABH 2DKSA 1ZOXA 4ZNCD 3L7EA 3BEVB 5I1GH 2I24N 5HBBA 2BNQD 5CCKL 2AEPL 5EG6C 1JWMB 4NNPL 4H8WL 1TCMA 5I73C 1B4RA 3EDEA 3NZ8B 1UWEH 5EDXA 5F1IB 3FT3B 3DXAE 4G42A 1I7ZB 1Q9WA 2VN4A 3OKOB 5IB5A 3F65A 1YJDH 1T80A 3HMXA 3E2HB 3MPCA 2VXVL 1IAIM 3OAUH 5ACZB 4Z7WA 4GKNA 1NSNL 3V6FB 4D9RE 2R39A 4LLVB 4HGWA 5I76A 5L9DL 5F6IC 3K8KA 3EDJA 5C0IB 3BPLC 1CK0L 3MRQB 1H0DB 1VFAA 2VOTA 1I3UA 1BZ7A 2J8HA 2K7QA 1MAMH 3KDMB 4G6JL 2F19H 2CGRH 4JM2A 2HG5B 4MHHG 2D4FA 1H3VA 4XBEL 3D0VA 4MNQE 4LEOB 5J1TC 1QYGH 4GSDL 2H6PA 4N8PA 3NPZB 2QSVA 1MQKL 2J4WH 4OGXL 4XC3L 5C0BE 1NBVL 4MJ6B 3VGAB 3BKJH 1KIQB 5I1IL 2DWEA 2FGWL 2BC4B 1DP0A 7FABL 2E8ZA 2ZOKB 1A3LH 1Y6NR 3C5JA 2ENYA 4OLWH 4XP5H 4NFCA 5CS7A 4WI6A 3MBEA 1IGML 3D39D 3T77A 3FONB 4FTVA 4H1LA 35C8L 4Y4KC 3FB5A 1G6VK 3EFFB 5ESVA 5T3ZL 5IESH 4CVWA 4R0LC 5I8EA 2NR6D 1ZTXL 3VI4E 2FEEI 2DQFA 5GS1A 1UXWB 1FAKT 3FQRA 3MLPA 4HIJA 4FQLL 4PJBF 3S37L 2JKXA 2CRMA 3ZDYF 4JG0L 3RWIB 3OAZH 4AH2B 2UVEA 3ARRA 1UVQB 3SDXF 4KKCC 4PJ7B 5HI3D 1DQQA 1TXKA 3TBVB 3F7PC 3T0VA 3VE0B 2JCCA 4NO3A 2QV2A 4ZUUA 1FNGB 3DHMA 4DUVA 2YA0A 2X89D 3ESUF 4TVPL 2J6EH 4O9HL 1FNFA 5EC1B 5E8OB 2VLKE 4N1HB 1MREL 3E2HC 1KJVA 1ZANL 2X42A 4HWBH 5TGBA 3AU1A 5EU4B 5IVOA 3BH9B 1FP5A 4GKZB 5FV2A 4GH7B 3QO0A 3PP4L 4MNGE 1CR9H 1JI2A 3BDYH 2IBGA 3IXTA 4MX7B 4NKMB 1VEPA 1NLDH 3MLWH 5DUPH 1FL3A 3DX7A 5I15L 2BRRH 1X3DA 4HEPG 4MYWB 5I8OL 4WEMB 4PJ8D 1H8SA 4F7TB 2ESVB 4XCCH 4HGKC 4ACPA 3JWNC 4NJAL 4Z7UA 4HC1H 1VPOH 5AZ2L 1G7PA 5D6DA 1WITA 1RZKC 3VGAC 1XAUA 5KAQG 3BE1H 5BMFL 1JZ8A 4K7PH 1JN6A 4WFHD 3U4BH 1QSEA 4YBHA 2CXGA 5C0CA 1JZ7A 2AQ1A 4X7FC 1CL7L 5JDJA 4G5ZL 5DVKA 3OG6B 1EV2E 4F37K 2YN5A 4HUWA 1BOGA 2YPLE 2C1PA 1KJ2H 2F8VA 4W81A 1IARB 2K9UA 4HKZA 4XMKH 5ITBH 4GBXD 3P9MA 5GSVB 5FUCE 3SKNA 3VG9C 3NAAL 3OKKA 6FABL 3EGSA 5BVPL 4YHZL 3HB3D 2ITDA 5HDBF 3GSQB 3HKFA 3H42L 3PABA 3CSPA 3CH1A 2Y5EA 4PLNC 2DQDH 1EVUA 1MFCH 5T5NF 4I18B 3AS0A 2WBJD 1G7QB 5MEQB 3QNZA 4JE4B 2XPGB 1RIVH 2C4FT 2EYSB 3MQIA 5I75B 4MJIE 3ROLB 4ZG1A 5HHOB 2BNUB 3RBGA 2C3XA 4WWKB 1HH9A 2BNRE 3TPKA 1MFDL 4Z95L 1I1AA 4BH7A 1T2QL 3SKMA 1G7JA 2VSCA 4ONHA 5JTWA 1T83C 1X5ZA 3QXAB 4LCWB 3S6CA 3ARDC 5CIPB 5I1KH 3NMEA 1NGYB 3EOBB 4M43L 3TFKD 4U1SA 5INDA 4NQXB 3V6ZA 5HGDB 4LSDA 3O9WD 4XXDA 4P23A 5SX5K 4M8VA 4O2EB 5E1AB 5HYQB 2FHFA 1FO0B 4PRPA 1JRHH 2WV3A 3AB0B 1IGIH 3KYNB 1JUFB 3FHQA 3NH7H 2VDQH 2X1QA 5DQDL 4M5ZL 2OQJB 3TBSA 4NNYA 1DBKH 3WYRA 1EHXA 4LSUL 2HKHL 4HUMB 3MV9B 3ROOA 4LMQE 3MRJA 1FFOA 1WZ1L 4V1DE 1S7UB 4G8EB 3MR9B 1EHAA 4M1DH 3SJVD 2NY1C 4QRRD 5IT2H 1KT2B 2VDPL 1I3RB 5ID0B 4J23A 4KK6D 1N4XL 4JAMA 3WE6A 5EIIA 1M7DA 1A7PH 2VLJB 5FOJA 2W59A 4FFYH 5F1NB 2A6KB 4XZUA 3T0WA 1QNZL 3TNMB 3F5WA 5K59E 3K80A 4S1DD 2WUBL 1IC5L 3NABH 1JNLH 3X11B 5LGKA 5MEOB 2F15A 4KPHL 4UILL 5IFJB 1C7SA 4F2MA 1UB6B 4P4RA 1YY8B 4L8DB 3S4SA 4P3CL 3U2SB 4ZAKB 3IJSB 4H25B 5IM7B 2KDGA 5D2LB 2VAAA 2W9EL 4X7TA 4AL8L 1IGFH 4IEFB 3GBMH 5GGUA 2IF7A 2OP4L 2UWEF 3FQNA 4NQCD 4NKIL 2DTMH 1EGJL 3QPQC 1H3PH 4JQVA 5C08B 5CD5D 1DEEB 3AB0C 4RQQB 4DJMA 4QHMB 4CNIB 1IC7H 1A4KB 3U7YL 1QO3A 1UM5H 3RUGF 1Z2KA 3SQOL 3VD7A 2E5EA 3KYKH 1JK8A 2DWDA 5MENB 4PGEB 5I30L 3G6JA 5DD3L 1J1XL 4ZODA 4S11A 4OFDA 3H0TB 4C57C 2GT9B 5IEHB 2G5BB 4Z7VE 1QKZH 4WW1A 3DV4B 1EH9A 2WLZA 4CL7A 1J1PH 1I9JH 4P3WA 1R3IH 1CG9B 1CD1B 5FB8A 5E8NA 3V0VB 2D7OA 1AKJA 1Q9OA 3GKZA 3LN9A 3QFJB 1MNUL 1CN4A 1UEMA 2FGZA 4HT1L 1QLFB 3HE7A 3FOLB 1EDQA 5B4MD 4IRJB 1XIWA 1UZ8B 3OJDB 1MI5B 3BMWA 3DUUA 1MVFA 1T20B 3T09A 1AQKH 2IFGA 3QIWA 2V17L 1MCOH 5DRNA 3VXME 2AJSL 4F7MA 4U1MA 4PGDB 2VISB 4IMKA 2EDRA 1LDSA 4NJ9L 2MCG1 5GRJL 4H5SA 1Q94B 1A6PA 1T1WB 3IDGA 3KYOB 3NA9L 4QHKJ 5TH2B 1JJUA 2IFFH 3MV8A 1EVTC 2FSEB 1BQUA 4HHAB 4NO2A 4YDIL 1IEHA 1NDGA 4R7NA 4AG4H 3VXUD 1EAPA 3KXFA 4MJIB 1BMGA 3H7LA 2ZUYA 5EZLA 3I2CL 3GMRA 4AEFA 5CZVL 4RAVB 1M7IA 2WANA 3LKRA 3TJHD 1F3RB 3H3PH 3ILPB 1FAIH 4OTXL 3QQ4B 2QLVB 4M7ZC 4OGZA 1CGSH 2BNRB 4X4XB 2AEIT 1JGVL 4JREB 1L7TH 5E6ID 4ODWB 1CE6B 1F11B 4U1NA 3VGHA 4KKLC 2G9HA 1S9VA 2GFBA 4MJ2A 3SOBH 1IC1A 5DLML 4WTZG 1U92B 5DHVB 2HT4D 2VIRA 4ENED 5LG1A 4P46B 5DJZB 4HPYH 4L29B 3I50L 1A7QL 4C4KT 5FYKL 2LTQB 3VXOA 1HCFX 4M3JA 4B50A 4DN4H 2FECL 3ES6B 5IVNA 3VXRD 4OCSL 3D2UD 4XNMA 3VFSA 3KPRE 4Z77B 3T0DA 3LEXA 5F7KC 3I02B 1S7WB 2B2XH 3QIUD 2RFXA 4NQVB 5DXWA 1AGEB 4RMQA 3CGTA 4RA3A 3RNQB 2DLGA 3UJTL 3IRPX 4WHTA 4F7CA 2X4SB 1A6ZA 2CKBH 2P5EA 3UC0L 2F5AL 5SX4H 3QEHA 4W68A 2XN9E 3V7AE 4WUKH 1CFVH 1H3TA 1DBML 3NOIA 1SMOA 4JQIL 5C6PB 1Q1JH 3GFUA 3H2WA 2EE6A 3KR3H 4WDIB 2YK1H 1NJ9A 5JPMB 4HWZB 4KUCF 4ELMB 4KXZH 1EGJA 2V5SA 1YUHA 1IM9A 1TTGA 3MNWB 4HH9A 4AK1A 2O5ZH 1HQ4B 4BKLB 4J3WA 2D0HA 1FNSL 4OFYD 3LH2L 5HJ3B 1MAJA 4MA1C 3VU2A 2VXTH 1MOEA 2IPUK 2NY6B 1OP5K 5C7XL 3UAJD 4U7KA 2OTWA 1W0VA 1IEAB 1OTUC 1NL0H 2NY7H 4LLDB 1X5IA 2I07A 1WK0A 3AFLA 2VQ1B 1VFBB 2EDDA 3N85L 2ZUWA 4IHOA 4CMMB 1T5XA 1ETZB 4Y19B 4JY5H 5L8KB 4IDJL 4D94A 4DKDC 1RVFL 4MXVF 3BQUB 4Z7WF 1AO7B 4BSJA 5TJWK 1DQJA 3D3VD 3SBWC 1BIIA 4OLYL 4JHWL 5D1ZD 1DCLA 3CZFB 4NHUB 3AMKA 2FWOB 4XI5C 3OKMA 3EJZC 3HZVA 2LTQC 3MRLB 3QUXD 4CVXB 4I8DA 4JM2F 1I9RL 3PWUA 5HPMA 2F54D 5F88A 1SEBA 3LMJL 2HJFA 1KFAH 3LB6D 4TUOA 3QJHA 4FG6D 4DAGL 3VFUB 4PUBL 4ISVB 4G8GB 3RL1B 1BZ9B 3BZFB 1UENA 5E1HB 4I3SH 3FB6B 3AXLB 1JTPA 3W0WE 2GUOB 1U6AL 4X6FB 4O02H 3RRQA 4AM0B 3L3OA 3GK8H 3BUYB 2YS4A 5HYSG 5DMGC 4LPVA 4KV5F 5JW4Q 4OM1L 3F6IA 3BIKB 4GRMA 3K7UA 1C08B 2NY5H 4OZHE 4E41D 5SX5H 4M7JL 4BJLA 5K9KA 2ITCB 2R56H 4UTBL 5M94B 5JXEA 3B8YA 3STZB 5A1AA 4KKBD 4K8RD 1KLGA 4EVNB 2YUZA 5IFAL 2MPAL 1JMZA 4YHNA 3SHSA 4ODUA 5JA8B 1WBZB 2IBZX 3LRGA 1F4YL 1OGAE 1QSFB 1UH3A 2ZSWA 5C0JB 3T0EB 3QG6B 5C8JA 4PRNA 4Y5YC 4N0FA 1ZA3B 2JCCF 3TBYB 1NC4B 3TC9A 1PYWA 1S9YA 5ICYB 4GRWE 4S2SA 1NGPL 1MJUL 3S5LB 4UZGA 5EUOB 3MLTA 1UXSA 3O6FA 3D85A 1T66D 2P8PB 4Q97A 4KVCL 3P4NB 5F9WB 4QHLB 3MFFA 3HR5B 3ARQA 4MB4A 1YNKH 4M1CC 4YHML 2IG2H 1IGYA 2PO6C 4I2XE 5C2UB 3FFDA 3QULA 3HMWH 4YGVB 2C26A 4HJGB 2FEDC 4ZFFA 2P42B 3C6LA 4M6NH 3T3ME 1P53A 1W0YT 2HFEB 5E9DD 4HKXB 3H9SA 3PP3H 1ACZA 4TTDC 1PZ5A 1U3HD 3DARA 3EYFB 1GZQB 1KBGL 1FFPA 4KUZL 5J89A 2EYRA 4IMLB 2OR8A 4PS4L 3MRDB 4Z7UF 1P7QD 4TPRH 1IAOA 3BWAB 3BKYL 2APFA 5MERA 2YPKB 3WS3B 2ORBH 1GXEA 3RI5F 4MQXD 4BSVA 2DQJL 5ISZA 5TQ2L 4G6AC 3QR2A 4RX4A 4AIOA 3IDJB 3RPIA 1TVBA 2VE6B 3FO0L 1CVSC 4YHIB 4OLVH 4GS7C 5FK9A 1AH1A 2P45B 1K4DB 4EUPG 2GAZB 1RSFA 3MRGB 4XPHH 2CRIA 1MCBA 2PYFB 1KXTB 4PBVC 3S35H 1K8DA 1R3JA 1KTDB 2O93L 4R6UA 2PXYC 3ARED 4P9HH 4P2QE 3PXJA 2VLME 3ALXA 3MFGB 3FB8B 3CSYB 5H2BB 4G7VH 1B9ZA 3D0LB 1HHKA 4YQXH 5GXBB 2J8UE 2EIZB 3CFBB 3TA3A 4Q9RH 5BO1L 1D5XA 1ZK9A 1BJ1H 1N5AA 1ZHKA 3T0EC 4WO4A 2R8SH 1BQLL 3L7FA 3BYYA 5DEZA 5FXCH 3SDCD 1Q9LB 3GJFH 4HPOL 1Z6JT 2GJZB 5CKAA 1SQ2N 4NWTH 4P99A 5F9WC 3TYGH 4XCYB 4CJ0A 4JGJA 4I77H 3GIVB 5AUMA 3CD4A 5HI4C 4OT1L 2VB5A 5J9PB 1WAAA 3BD3A 2CH8A 3ZSSA 4WEBH 1QRND 2CLZA 4TUJA 5E2TH 2NXZC 4XAKD 2IPUG 2QSCL 3PUCA 1AJ7L 4FQ1H 5GRUL 2R1XA 4PB0L 2ADJA 3SGDI 2X4RB 4IRZH 4WW2C 2E9WA 3PE9A 3QDJE 2ARJQ 2BVQA 1ES0B 5J4MA 4QCIA 4H0GA 4OM0H 5D6CB 3PGCB 3VFTB 2XIDA 4M02A 5CGYC 3RAJL 1QA9B 1N64L 2W0FB 2PYEE 4Z18A 5JUEL 3ZLQC 5C9JA 3LKPB 4J7RA 4O4YL 5FF6A 2E7MA 4PGBA 1WT5A 1CXKA 2EDYA 3SO3C 43CAB 3IKKA 3QHZH 5L2KA 1FGVL 3E8UL 1JGDA 1CLOL 5HGAA 3SGEH 3LS4L 4MA7H 4MD0A 1MCEA 1S7SB 4F9LC 1JIBA 1FVCA 1N8ZB 2WINB 2ILLA 4DGIH 3F58L 3PDOB 2H41A 3O2DH 2Z93A 5CSZB 2DQEH 3W0WB 1S5HA 4LLYB 1ZGLB 3ABZA 4XC1H 1A14H 3T2NH 1BLNB 3CFKB 4XHJD 2V5RA 1RK1A 5I1EH 1PG7W 4LARL 1D5BB 3QO1B 4NP4L 5HY9A 1JI1A 4I5BB 5GGQL 3W5NA 3DBXA 4EOWL 3L1OL 1GZPB 3X12B 5IVZB 1XGQA 4JFHD 1BEYH 4X99B 3JBG7 2J3SA 4NKDB 5GS0L 4HS3A 2LU3A 3BZ4B 4KROD 4JG1H 4HFUL 4I4WA 3RWDA 4J3SA 4NPYB 4XVUC 1HYRC 4EUPH 1BVLA 5F7MC 2AV1A 2CIIB 5CGTA 5HYFA 3BT2L 3QI9A 3BP4A 3BVNA 5GJSH 3P4MA 3UJIL 4D2NA 1VA9A 3KLSA 1CBVH 4HCRL 3ZMRA 4NQEE 3S34L 4Y4HC 1D9KA 1YN7B 5TE7H 2D7TL 3IAGC 4G3YH 1YEIH 4M4PA 5IBLD 5GIRB 2FEEL 2VZ1A 2Q8AL 4LHUA 1ODAA 2JIXD 3ARBD 3BIBX 2Y07L 4G43B 3NBNA 2W38A 4PJDA 3OWEA 4IOFD 4L8CA 3U36A 2AV7A 4J12A 4JRYD 2QADD 1PX4A 3DHJA 1OTTC 4U1HA 4WTXA 3TCXA 4Q6IB 5GGSB 4L9LA 3RZWA 1G7MA 3JV5A 4KK8D 4LAJH 1CLYL 4QTIL 4Y88A 2B20A 3G6JF 4HUVB 3NVQA 3QEUB 4MD4B 3RGVA 4DUWA 5IJVA 3O4OB 1FNEA 5J13B 4QRSB 3I6LE 1OP5H 3TZVD 2ENSA 1WF5A 1QR1B 3MLRL 2HRPL 5GSRA 4P5MA 2R0KL 4X98A 4L4VA 4P59L 1OAUL 4GW1A 4KJQD 3DRQA 5TF0A 5I8CB 4J8RA 3RA7L 3UPRB 2VXQL 3ARGA 4ODVH 1LE5B 1G1CA 1P5UA 5GRVK 5C2BH 3HRPA 5H35B 4D9LL 4R2GD 2BXZA 4XPTH 4X4ME 2BDNL 2DTSA 3RDTD 5JW3H 2J8UB 3BGFC 4PLJD 2XKNA 1RPQA 4GG8A 4AEHH 1A4JA 4AZ8A 5DS8A 4KJYB 5IW3A 4FA8A 3VH8A 4IIQB 3GUTA 3C09C 3CMGA 3ULUE 5TF1H 5EO9B 3VFPA 1F42A 2DDQH 4OUUA 4K3EL 4JKMA 2YMXH 4B53A 4IJ3B 3PL6A 3QCTH 4JPVH 3U82B 5C09D 4JFXB 1FDLL 5JIHA 3WIHL 4GRWH 2ED8A 1EIBA 1CD9B 1TJIL 5ETUB 2GJ6B 4HK0B 1XF4A 3HG1E 3K8MA 4ETQB 4OCXL 1INEL 4XNXL 3CNKA 3NIFF 2DYPB 4N8VB 4WCYH 2BSSA 2VABA 5E6YA 4QNPF 4AENA 2XZAH 3FL7A 4MA8H 5HGHA 5DR5H 4XXCC 4MNHA 5TE4L 1EX0A 5I6XC 4B7LA 4JY4B 2EKJA 1J7VR 1U8OA 5AZEL 1BGXL 1AE6H 5GRZA 3O6KL 3D1MC 2XRAH 3HPJA 4KRPB 1OSZA 4PJ9A 2R2CA 1KJMB 5J13C 2EXYC 4XH2B 1LO0L 1BD2E 1IAIL 1K2DB 4R7DB 3ET9F 1DBAH 1FGNH 3V4VH 4TSAH 1TDQA 3OX8A 4Y16B 3WO3B 4EI5D 3L3DA 3TBTA 1BFTA 2GK0B 4P2RD 4YXLL 1MFEH 5TDPB 4AIZA 4WY7H 1RJYA 1ZGLM 3H3KA 4BFBD 2DBJA 4NWUL 2F53D 1JV5B 1NFIA 2FBJH 1QBLH 1SHMA 3VWKC 1A1MB 4RDQF 5I1CH 3PV6B 4HCRA 4Z78A 4LLWB 3BIAX 4GLRH 3Q5OA 4BZ2L 3QUML 3WFBL 5GZOC 2R1YB 4YK4C 4JPIB 1RU9H 2G60L 5JLZB 3ARZA 5FYKU 5CINH 3BEWB 4KK9D 3IU3A 1LNUA 1TMCB 3MV7A 4XNUL 5D9SB 3R8BB 4K3JH 3WN5B 3EO9L 4IIQC 3B5TA 1KLFA 3WSQL 4O2CB 3D87B 2J7LA 3VD9A 1JPTH 1V05A 4HX1B 2YPVH 1XF3A 5ICXB 1Q9KA 3ARFA 1KB5L 1G9MC 4LGPB 5JR1L 4ZOCA 3S37X 4KZDH 4NZDA 3VI3E 1UQSB 1F4WH 3GBNL 4MQTB 4QRUB 4E0RB 1ZLWK 1BAFL 4NQEB 3V5DA 2J1KA 1EO7A 3GSXA 1KG0B 1NQBA 4JRXE 2EDTA 3OZ9L 4C56E 4I13B 3VDCA 2HMID 1UGNA 2JJUA 3MRRA 3NFPA 1ND0B 5HDQL 1UWXH 4K23L 3BDXA 4K9EC 5D96C 1QFWH 5FKAA 4KRPC 2RR3A 4NKOA 5B8CB 4PGCB 4NKQB 3BP7A 5EU5B 3R0MA 4XP1L 1FHGA 1CGUA 3ZL4H 4Y16C 1ZHLA 2OR9L 2P48B 2C3GA 5HXMA 3HNTL 1X5JA 3STLA 4HIIB 4I48B 5HHNA 1E4WH 1YDPA 3MLSL 5DTFA 4JLRB 2ADFH 4KI5F 3GB7A 1GYAA 4K3HA 5DFTA 3DIFA 1KIPB 3B9EA 4YFEA 2ADGA 5DFWH 4PLKC 2K3TA 3B6SB 1CLZH 2PTUA 4LVHB 1XGRA 4C54A 4F33A 5C0RH 5E03A 4LF3B 4KHXH 3C60A 5B3JF 4Z0BH 2C3VB 2DM4A 3WL9A 3WIHA 2ICES 3P0VH 5FM8A 1Z9LA 3REWB 3TN0B 1IRAY 3CU1A 4D3CH 3VFWA 1P4IL 5HHXL 3O3BB 1YYMH 1I9IL 4NCC1 1YJDC 5CWSB 2OXGA 4LLAA 4Y4FA 1L4IA 3QPXL 4M1GH 3EJYC 1UJ3C 4G9DA 2AEQL 1WC7B 4ZXBC 1LVEA 2QQKH 5DURB 4YZFE 2VNCA 3U7AA 2HTKD 4MDJA 4YAQA 3NPSC 3A6CH 1JCKA 4WU7A 1B0GB 1YMMD 2MJWA 4NNXA 1I4FA 2XTLA 3HZMA 4XTRD 1NBZA 2ZKHH 3EHBD 3U0WL 3GMMB 2HT2D 1E28B 5FYJL 3ARXA 5I8KL 3ZT7A 4XP4H 4TOYH 2FDBP 5B8CC 1L6ZA 1PD6A 4HFWB 4UV7L 4FXKB 5J1AA 4R8WH 4KFZC 5D7LA 1U8LA 5T5NG 1U8KB 1M1SA 2XYCA 3MRMA 1CFNB 4NFBA 5F7EL 3ZKMD 4U2YA 1NCCH 1TENA 5MI0B 4XP9H 1WEJL 3KPQA 2HAZA 3TVMA 1SYSA 1ZS8B 3K2UL 1JPSH 1UG9A 1CGWA 1E4XH 2V9TA 1T04B 1EEZB 2EIEA 4QYOA 3RGHA 1DQLL 1P9MA 3UTTE 3MX0A 3O11B 3HC3L 3T8XB 3DURA 4WJ5B 1X5GA 3S7GA 4BQ8A 4LVHC 1OB1B 3INUL 5J7CC 4UUJB 1KCLA 4FN0A 5FUZL 2A0LD 1KB5A 2KZ1B 1MJ7L 3VRJB 1XH3B 4QTHA 3LKNA 5ALCL 4BZ1L 1GGBL 4S0TD 4LLUB 1FPTL 4Z7NF 5EU3B 5CFHA 2V2WA 4RFNB 5GRWA 5CEXA 2F5BH 1JMXA 3BHBA 3EKCA 1NDMB 3VD5A 2UYLB 5I71C 4KTDL 1VACA 1CD0A 1UH2A 1T0PB 4RGMC 3KYAA 3P77A 3PWPA 5T33H 1CD8A 1PKOA 3VXSE 5C0AE 1HSBB 2KQMA 1H3XA 5KSAD 1H8NA 1OQXA 4R4BA 2AGJH 4EZMA 3ULUH 3IXAA 3WXVL 2NCMA 43C9B 3TCLA 2BVOA 1AGFB 3G5YA 1UYWL 2AJXL 5EOCL 3CVHB 4GKOA 1GHFH 2BMKA 3QQNA 4MCYB 1RUPH 3LN4B 3A67L 3CDGB 5GGVY 3MLUL 1WAAF 1S7XB 2GSIA 3FT2A 3IETA 4JRXB 1SY6L 4C56B 2FD6H 1EHLL 4FS0A 2Y4SA 4W4OA 1LO4L 4PJCE 3AUVA 1S8DB 1DLFL 4HBQA 2Q87A 5MI0C 2VLRA 4H0IA 4UQ3B 2YD7A 3W9DA 3GI8L 1CU4L 5F96L 1YPZA 2HA1A 2DMCA 3I75B 4OFPA 5CUSH 5C92A 1AHWA 4D9QE 5ILTH 5E6ZA 3VA2C 4PRIE 1E0OB 3LKSB 4XMPH 1YEEH 1FFNB 1C7TA 5EBWB 4S1RL 1P7KB 3NCYP 1T89C 2P44B 1AIFA 2YSSA 3GO1L 2YRZA 3DGCR 4K2UL 4X8JB 3L3JA 5HI3C 15C8H 1PVHA 2C3HA 4RFNC 2WBJB 5D7IA 4DKEL 1X5XA 5JW4N 3U9PL 3BEVA 4V2BA 3IKCB 2FRGP 2DLIA 3M8OL 1MPAH 1E6OL 4UNTA 1JWMA 3SKJH 4X0KB 4PJHE 4X4ZA 5FO9B 1JYXA 3NZ8A 2MFNA 5F1IA 4OGYH 1T0MA 1I7ZA 1UJTA 3FFCD 3OKOA 5E7FA 2Z31D 5EBGA 2XZZA 1K5NB 3Q0HA 3S36H 1ZA6A 3DECA 3CX5K 4PJ8C 5ACZA 3V6FA 4E9LA 4LLVA 3WHE1 2FR4A 2P46B 3OKDA 4N0YL 5JDSA 1TVHA 2C1OB 5CP7B 4Q9BA 1H0DA 3VJ6A 1IGTB 2APWA 1RZFH 3MACL 4G8FA 4HBCH 2HG5A 4XNYL 4QHKI 3WNKA 3PWVB 3ZE0F 5ADOL 4LEOA 1OGTA 5F9JB 1RY7B 1V7ML 3VXQB 3SPVA 3SJVB 4JFDE 4PJDF 1EHNA 5KSUA 1X6LA 4MJ6A 1I1RA 5IIEB 4OCYL 4HUXA 1KIQA 5T1LA 2BC4A 3V8OA 2ZOKA 3WEXA 4GBXC 4FTVE 5HGBB 1J0KA 1KCSL 3FONA 1CDCA 4DQOH 5AYUL 3HB3C 4WI8A 1Q0YL 1FO0L 3IFLH 1EERB 3EFFA 4Y2OA 1XGYH 4HZLB 2OTUA 3V4PL 5IQ9B 1W2KT 1ZLWH 4KDWA 2ZOLB 1UXWA 4KQ4L 4ODBD 5FGBA 4AEIL 3GNML 5C1MB 3DGGA 4QRPA 3X3FL 2VXSH 4AH2A 1KCKA 4FQXD 1WICA 2VR5A 2EDQA 1Q0XL 2LAAA 1UVQA 2JCCE 4F7PA 2AXGA 5DMIL 1XGTB 3VE0A 1I8IB 4PRDB 1FNGA 3BW9B 1GL4B 1HSAB 4QRQA 5LCVH 3O6ML 2YR3A 1KN4L 2GY5A 1G6RH 2OBGA 4NFDA 3TFKC 4JKPH 3UZEA 3RVTD 2OK0H 3K81A 4G7YL 4GKZA 4XWGH 3O9WC 1INDL 4JFZH 3C2AL 2PN5A 4HGMA 4LEXH 1LEIB 1MCSA 4MX7A 2DD8H 4J3OC 4NKMA 2VUYA 2AABH 2P5WE 2R29L 4FNLL 4XHQA 2Z91B 2ICCA 5EU6A 5T3XL 4PV8A 3TO4D 4Z7UE 4F7TA 3L5WA 5HYJA 2ESVA 3DMMA 2HT3D 2PKDA 1VGKB 1HKLL 4G6KH 5BW7A 3BAEH 4PJAB 2FX7L 2W9DH 5D7JB 4Z7QE 4I3GA 4KK6C 3HAEG 2FX8L 4LDEB 3MUGB 2Y9RT 4NZTL 5C0CE 5J6GB 3QUYB 2J5LC 1LWRA 1OM3H 3FN3A 1FN4B 4DGYL 3MOAH 5K9JL 3RU8L 1FG9C 1ZVYA 1RUKH 4S1DC 5JHLL 1KB9K 2QQNH 5DEFB 4PRIB 1LHZA 5D8JH 2IPTH 3THMH 3QNXA 2AJUH 1RIUL 1MRFH 2L7JA 1WFOA 5C0FB 1JGLL 3EO0B 3GSQA 5EC2A 3HUJB 1DVFA 4BFEA 4PJXE 5JPNB 2P24B 4K94H 5DD1H 1OARH 4ZTPL 5F7FA 5BRZE 3ZT5A 4I18A 1QLEH 4OCWH 4KQ3L 3VXUB 1CDBA 1H3WM 2EYSA 4WTWA 2E7BA 1VDGA 3RWGB 5JHDE 4TSBL 4RGNE 4OZIE 1LEKB 2XOTA 2PR4L 1T4KB 1IFHL 5HHOA 3DXAA 2BNUA 1J9CT 4XWOD 5CD5C 4WWKA 4MMXC 2YA2A 1A5FL 5KG9A 2I9LB 2VDLH 4MAUL 1DL7H 2ATPB 3QXAA 4EQ3A 2EDXA 4N90D 5CIPA 3HFML 4LCCA 3EOBA 4R4FH 4GW5B 3OXSB 4NQXA 1A6UL 1G84A 5HGDA 2L0DA 3KG5A 4HXAH 1QHOA 5HYQA 1FO0A 2I60L 4N1CA 1RMFH 3KYNA 1JFQL 4OI9A 2OQJA 4MNQA 4JM2D 1DFBL 1TITA 4XVTH 2MOVA 1EMTH 3GRWH 4JO1H 1MCPH 2F58H 2XTJD 3X17A 3MV9A 1FCGA 4UOW1 1H5BB 2OMBA 5CD3B 4G8EA 4WI7A 5C0BA 1Y0LB 5EZOL 1OD7A 5FIEA 5B4MC 1D5IH 3P0YL 4GMSL 4M6OL 3VD3A 1I3RA 3MRCB 1R0AH 4TVPE 3UYPA 2X1PA 3ZE2E 4I0PB 5ID1B 4PTUB 2F74B 3MBED 3JTSB 4HDIB 2XFXB 3ULVD 1MRCH 2A6KA 5F8RC 4NQDD 1KYOK 5E08H 3HAEH 1HINH 2YWYA 5C9KA 2Y06L 5IFJA 2BSTB 4PRHE 4H20H 5DUML 4RCAA 1UB6A 1YEDA 2CIKA 2R9HD 4OJFH 3TJHC 3QRGL 3QFDA 1F58H 4OCRH 1K6QL 1YY8A 4B5EA 4OLZL 5T1KB 4Y5VB 3GMLA 2K1MA 1FNAA 2QTEA 1KEML 3B2VL 3IS0X 3U2SA 2CMRH 4ZAKA 1GAFL 5IM7A 1PW3A 3UO1H 1EAJA 5E6IC 3D25B 2VLKA 2D7QA 5D2LA 1KC5L 1PDKA 5DDHB 5F9OL 3C5SB 1NFDE 5K93A 1JRHI 4NYLB 3UPAA 1U8NB 2FBOJ 5E94B 4BELD 1CFSB 3HMXH 4LAQL 3PF2A 3DSNA 2XZCH 4ZUWB 1DUZB 4MNGA 3JTTA 3LEYL 5A40E 2WWKO 8CGTA 4ENEC 3GMQA 5C08A 3SGKA 4RQQA 2HJKB 2P5WB 3QUXB 2GCYA 1DN0B 4CNIA 5IB4B 1A4KA 1VB9A 1IQDB 1CGXA 1XR8A 2BCKB 2A77L 5IHZB 2BFVH 5IW1A 2F54B 1AGBA 2E6JA 3OAYK 3WV0A 1X5YA 3WJJC 5IKCA 3D5OF 2FATH 3QIUC 3R1GL 5IJKA 2GT9A 2IC2A 5IEHA 3MYJB 3IYLW 1HZHL 3PHOA 3MXVH 3O41B 1OAZL 3DNKA 3LQZB 1NCDH 1QSED 1CD1A 5CJOH 3TPUA 4Y8AA 3MXWL 1IGJB 3GMNB 4M62L 1Y6KR 5ECJE 3JZ7A 3GI9L 1QLFA 1PFCA 3H3BC 4IRJA 1MCDA 4DOHE 3OJDA 2NY5C 3HRZA 3M17B 1R3LB 4LSQL 3E3QE 3SKUD 3QNYB 3F7VB 3WNOA 4PGDA 2VISA 3KPOB 4PJXB 4I0KA 3LIZH 4M48L 3VRLE 3KYOA 5DHYB 5BRZB 5TH2A 4I1NB 1MCKA 3UAJC 2FSEA 4HV8A 5EORH 2YOCA 3SDYH 1JL8A 3V6OC 3KXFE 4GAYB 5IBTL 5DMJB 3RZCB 3VGDA 2WIIB 4BH8A 4MJIA 5JHDB 4RGNB 3MCLH 4J6RL 1A9EB 1YA5A 4KKCD 3GJFB 1WJ3A 3ILPA 5JIPA 3HZYA 4YWGL 3QG7L 4JM4H 5I74B 3BFOA 1BFVH 3FT4B 4N9GB 1HCVA 5D1ZC 2BNRA 4X6EA 4X4XA 2NXYD 4P4KC 4PJEE 5I1HH 3B2UC 4IM8A 2VDOH 3IDNA 5L88H 4LGRB 4ODWA 1I1AD 3RX8A 3DSFH 3QUXC 1CE6A 4NSKB 5TDOB 3TYFA 1F11A 5EBMB 1TIUA 3VFNA 4NRYA 1C8PA 1HH6B 2AK1H 3MUZ1 3FN0L 4ODSL 2E7HA 3FO9B 3LB6C 5IWLC 1U92A 4FG6C 4WHCA 5DHVA 2RAMA 1I85C 4P23D 1OSPH 4DW2L 4P46A 2NX5D 4WFED 1X5HA 4RMWA 4PRPD 5HHME 2XKSA 2CDEA 5T3ZD 4C4KO 1RFDH 3ES6A 1UZ6F 3KPMB 1NLBL 2Z35A 4V1DA 1T1YB 1MWAA 5E8EB 1B3JA 2HJLA 2NY3B 2X4TB 1I8LC 1J5OH 2DI9A 3I02A 5E2VL 2CLRB 1S7WA 4UI2A 5CCKH 1YPZF 5FO7A 4NQVA 5MHSD 4FQCL 4OFKA 1D6VL 1Z5LB 1AGEA 3TJEL 3RNQA 4ELKB 1OPGH 2AJZB 4OLXL 4P9HC 3AREB 3FO1B 5EFIB 4ZTOL 4WFFD 4X6BB 5F89A 3FQUA 4KKBC 1QVOB 1A7RH 4WDIA 5JPMA 1QZ1A 1FIGL 1J86A 2VXVH 2Q86B 1IEBA 4U49A 4XBPA 1LK3H 2A74A 1IZKA 1NSNH 3MLXL 4K71C 1LO2H 4Q58C 4HZAA 2V5YA 4PRHB 4BKLA 2JJWA 5D7IF 1CK0H 3AVEA 4MJ4A 3I84A 1WV7T 4APQC 3SDCB 4G6JH 3B3IB 1QBML 3OV6A 4IOSD 1WZKA 3G9VA 1KIRA 1T66C 5JORB 4HJ0D 4XBEH 4AQOA 3RJQB 4A2LA 4GSDH 1T0NA 4JFEE 4IRSA 1IEAA 1MLBA 4Y2DA 5AWNH 4LLDA 1MQKH 1NFDB 2VQ1A 3BP5A 1VFBA 4OGXH 1QRNB 3GZKA 2D31B 1NBVH 2IPKB 1N0XL 1HI6B 5GS2D 4Y19A 1ETZA 4CMMA 1NBYB 3UZQA 4MSWB 2AKRB 4PYHA 3BQUA 4GOSA 1AO7A 1U3HC 4JHAH 4J4PA 4N0UE 1G7IB 3L5JA 1P4LB 5FGRA 1IGMH 3JVGA 2OLDA 4GO6B 4NHUA 2FWOA 3NCYS 4PR5B 4PJGE 5I1JL 4KMTL 1I1YB 1DTUA 3LKQA 2RCSH 5T3ZH 3MRLA 4MQXC 4GUPB 3MRPA 5TPWH 4CVXA 5KVMC 4ZO6A 4HMCA 25C8L 4LSTL 4ONFL 4KI5E 1T03H 4FQLH 4Y8DC 3STBA 2AW2A 3DVNB 4U6YB 4PGJA 4ISVA 4Z7VA 1QFOA 1S3KH 1BZ9A 3G6AB 3Q6FB 3RL1A 2AQ3A 1TZGL 1V3KA 1XZ0B 2E27L 5FCUL 3T3PF 5EWIH 2YBRB 4KXZI 1P6AB 2DQIH 3AREC 3AXLA 3BX7C 5IMLB 2GUOA 3WHXB 4X6FA 4AM0A 4O9HH 1MLCB 1UCBL 1AKJD 3WDHA 1MREH 4PP2B 1HK6A 2VC2H 3HE7D 1XIWD 5I66B 4NGHH 5HPOA 3VXMA 3PP4H 3MLVL 1ADQL 3QIWD 3OB0K 5F1SA 4KROB 1QRKA 3SDCC 3STZA 1JPGB 3NCJH 3GIZL 1IKNA 5CMAA 4TQEL 4DVRL 4EVNA 5I15H 3DWTA 4ZS6D 2XACC 3A6OA 1WFUA 3MV8D 1E6JL 1QSFA 5C0JA 3FQWB 5FYKE 1EJ6A 5HYSA 3RNKB 4NJAH 3BKML 2RGSA 5AZ2H 4U3CA 3TBYA 5GS2H 3CMOL 5ICYA 2DQGL 5BMFH 5IBUB 3MA7A 3IJYB 4PJEB 5BJTB 2JIXB 1LK2B 2OTPA 3ARBB 4QHLA 1EZVX 3MNZA 1DBJL 1U8PA 1CL7H 4WV1A 4PJIB 1IL1B 2NY2D 2BSRB 1QFUL 4JRYB 2QADB 1N5YH 4JDVA 5HD8D 1UA6L 1EBPA 3MNVA 1X5FA 4F80A 4A6YA 2VQUA 3KVQA 1ZHNB 4RDQG 3SE4C 1P84J 2A6JA 3UZVB 3VW3L 2ERJB 2WBKA 3FOMB 2DICA 3U9UB 3NIDE 4ZUVB 2GTWB 5E5UB 2HH0H 5BVPH 9CGTA 3BWAA 2QQLL 2Y5TB 2YPKA 3WS3A 5ISZE 3H42H 3TZVB 3PDDA 2W9LA 3NA4A 3VFVA 2VE6A 3KPRA 5SV3A 4YHIA 3TNNB 3VWJA 4POZD 4XHJC 3D69A 1HHJB 1MHPL 1K4DA 2YC1B 3F7YB 5DK3A 1P4BL 2PYFA 2VYRE 4LSPL 1Z9OA 3EYVB 4EN3A 1F02I 5E2JA 3H8NA 1V7NL 1KTDA 2XN9A 3QDHA 4I9WD 5DD6B 1KENL 2P5ED 1YEJL 4KROC 4R2GB 4EDXB 3FB8A 3CSYA 1T2QH 2O26U 3RDTB 4KDTA 1GGUA 4LIQH 3MCG1 5KS9B 1F8TL 3DX8B 5E00A 2VMFA 4LSRH 3OF6A 3KPSE 4YFLI 4GAFB 5BV7B 1OW0C 3DVGB 2EIDA 4QT5B 4JDZB 5IBLC 2IBZY 3GHEL 2DIBA 2GJZA 3N1QC 2J2ZA 3BD4A 1HDMA 2W65A 1BFSA 4LSUH 5EIQA 2HKHH 3ARBC 1WZ1H 2B1AL 4QLRA 2Y36L 5J9PA 4IOFC 2QADC 2H2PD 5D7SL 2JB6B 1MJ8H 1IQWH 3NFSL 3NGBB 4ERSH 1NMCB 4YR6A 1FBIH 2VDPH 1MH5A 32C2B 1KEGL 1N4XH 2ARJB 2X4RA 4MJ5B 4KK8C 1LE9B 5JOPD 1ES0A 3KJ6H 1MHHB 3LKOB 4PJGB 2PTTB 3PGCA 2B5IB 3VFTA 2NW3B 5IVXE 1UACL 3MRFB 4KKLD 1QA9A 1XF5B 4JJHA 5A3ID 1T21B 3LKPA 2E9BA 1PY4A 2WUBH 2MKWA 1AXTL 1IC5H 1QQDB 1CWVA 4XVSL 1G9ML 4EI5B 2G5RA 43CAA 3QIBC 3RTQB 5DMYA 1ADQA 4KPHH 4P48A 5ESAA 4YHLL 1IC4H 1P2CA 1SBSL 4KJQC 3PQYD 2C7UA 2GQHA 2IBBA 3SE3A 2CXKA 2WINA 1N8ZA 5E2UL 2M26A 3PDOA 1NGWB 5CEZL 5JW4M 3FMGL 4J3TA 3EDDA 3V0WH 3W0WA 2Z8WC 4LLYA 1ZGLA 1MIML 1KELL 2IANE 4R2GC 3IFNH 1I7RB 5JIKA 5EN2B 3WXWL 4LSVL 3RDTC 5ADPL 1HWHB 2W9EH 1X7QB 4AL8H 3B8SA 1MY7A 3GSOA 4Z8FL 3QO1A 4OZHA 2XQBL 5E8PB 1Z9SA 4I5BA 4DZBB 3VI4F 4NKIH 1BECA 1EGJH 1GZPA 2O5YL 3QZWB 4F58H 3I6KB 4NKDA 3BZ4A 2YZ8A 4UT9H 5JMOC 4NN6B 1JHKH 4NPYA 5JXED 3U7YH 4FQQB 2EDFA 3BSZL 1D5MB 3SQOH 3CX5J 1OGAA 1WISA 3TT1L 2IEPA 4UU9B 5E8DH 5I30H 1VKXA 4ZOBA 5J6HB 5LQBL 4FP8L 2I9TB 1J1XH 2GSGA 2H3NA 5D2LF 1NMCC 3OR6B 2AQ2A 3TBWB 2C5DC 3H7BB 2XT1B 1RV6X 1NKOA 5GIRA 4HWNA 3O6FD 3D85D 4RMRA 1RJLB 3NIGE 4I2XA 4OZGE 1J87A 4LPWA 2UV3A 4LASL 3UBXB 1CT8A 3C6LD 3I6GA 4Q6IA 2GTZA 3HI5L 3ZKXB 4EI5C 2VZSA 3QQ9D 3H9SD 1FYTE 3TO2B 3UTSD 4PJFE 1EA9C 2AJSH 2HTLD 4UQ2A 3QEUA 4MD4A 1MJJB 2OJEA 4NJ9H 5I1AB 3QCUH 4QXTB 5GRJH 3N06B 4LRNL 1I75A 4QRSA 3IAPA 2CSPA 1MAML 2ICEB 3NA9H 4JZOA 1K8IB 1A8JH 2CGRL 3SEPA 2NTFB 5DJ8B 1QR1A 4RX4D 1T22B 4BSWB 2YD3A 4MD5A 2J4WL 5CZVH 4ZOEA 4O00A 5IROA 1OAYL 4KK9C 3BO8B 2OX5A 3UPRA 4OTXH 1LE5A 1A3LL 2E6QA 4XP5L 3S96B 2APXA 5H8DA 1HXMB 5DMGD 3E6FB 3UMTA 2BVUA 4NN6C 2J8UA 2JLLA 5IB2B 4RBPK 2GW5A 5FEBA 2VJXA 4ZUTB 3TA3D 3MJ9L 3SDDC 3QDGE 4KJYA 3P73B 4WO4D 2EEDA 5DC9B 2ZCHH 4MZ2A 3QUZB 3GMPA 5EO9A 1YNLL 3I50H 1A7QH 4XMLH 3WJLA 4U6VL 2AK4E 5F44A 5DF0A 4YPJA 2HMIC 1ACYH 5CILH 4JFXA 4LNRB 4OCSH 4F37F 4G80B 2GJ6A 3O3AB 4HIHA 1QFWM 1A3RL 1IGCL 1U8JB 4N8VA 1DUYA 1I7UB 2HVKB 3BJLA 4HWBL 3CC5B 4ZQKA 3P0GB 3QDJA 4YGAB 3UJTH 1GGYA 3IB4A 2E8YA 4Y1AD 4JY4A 1RI8A 3UC0H 5IFHH 3OB0H 4FXGB 2PW2B 5IVXB 1CR9L 4JQIH 3K1KC 3BDYL 4R26L 1TPXB 1QP1A 4JRWA 4XH2A 4WUUD 1X44A 1ORQA 3N9GL 3U4AA 4R7DA 1NLDL 5DUPL 3UTQA 1KOAA 2BRRL 1W72A 2DQUH 3BZEB 1R5WA 2Q7NA 5TDPA 5L2KD 3V7MA 1FNSH 4OQ1A 2NY4D 4P49A 3LH2H 4X6DE 1VPOL 3B43A 3BE1L 4F15C 1NCTA 2ZG1A 3EOAB 4K7PL 5GRXG 4KTEL 1A1MA 4RFEB 3U4BL 4CN4A 2UZIH 5ALBL 3RPKA 3A6BH 1A64A 3WKMH 1A1NA 3CLEL 2R1YA 3GHBH 5K59F 2ZUXA 5JLZA 2XA8L 1LD9B 4L3EE 5D2NC 2IALB 5D72H 2C3WA 1RVFH 1KJ2L 5D9SA 4JFOA 3VFOB 5DK2B 4LHUG 2HTKC 4P2YA 3WN5A 4OLYH 3CU7A 4JHWH 5HSFA 4GKSB 4UB0L 4CVUA 4O2CA 5ITBL 5KSAB 2OL3A 5D70L 2VLLA 4NT6B 4ZSOE 1WIOA 4HX1A 1ZEAH 2XKUA 4PREA 3IDIB 4O58H 4PTTB 4XTRC 2P7TB 4CW1A 3EHBC 4RISH 2HT2C 1R3HB 1UQSA 2Z8VC 2DQDL 4E0RA 3QI9D 4QRUA 1AD0B 3DO7B 1FVDA 4FZEH 4NQEA 4JFYB 3X14B 3MROB 1RIVL 1KG0A 5GGRY 1MFAL 5BVJB 4DKAA 1D9KD 1A47A 1E4KC 3CCHB 3BKCL 3ZKMC 4AYFA 3ZDXE 4NM4H 5HI4D 4ETYA 4Q2ZB 4OZGB 1C5CL 4LHUD 1S7VB 4PGCA 4HIEA 5EU5A 3VGBA 1R24B 3L3GA 1JF5A 5JW5A 4NHCH 4GXVL 4D8PA 5I1KL 3G5VB 1TZHB 4PJFB 5FYLD 5IMMB 1BP3B 2FO4B 2WQRA 4M7JH 3RWCA 5BXFA 2IWGA 4I48A 4NZUH 1JF1A 3R06A 4UTBH 3CVHL 2A0LC 3RGVD 4GLRI 1JRHL 4GMTL 1IGIL 4X8XA 3U4EA 4Z7VF 5CLTA 1DLHB 3NH7L 2VDQL 1X4YA 1KIPA 3MJ9A 3LRHA 3MUJA 4YIQA 2A1WH 1F4YH 4TULL 1DBKL 5EBLB 3B6SA 3HC0B 4AMKH 3QA3A 1C1EL 4HD9A 4KH2A 4YXKL 4L4VD 4FQHA 3OHXB 4F7EA 5HHVL 3WNMA 4G6FB 3VRIB 4JZJA 1KF9B 4YDJB 3IGAB 1ED3B 1MJUH 5IT2L 2C3VA 4ZDHB 1U9KA 1FFRA 4ALAH 3QQ3B 2BOCB 3REWA 3TN0A 1LO5A 4KVCH 4CVZB 3ARGD 4QEGA 3FAXA 1L7IL 3O3BA 4X4MA 5DJ6A 3W9EB 1A7PL 5JA9A 3FFCB 1IKFH 4ODTL 5CWSA 4BYHA 5IB3B 2Z31B 1G6RB 4LKCA 5CJ8A 12E8H 4L8SA 1HIML 1XGUA 4TVSa 1RHHB 5I9QC 3K0WA 5KJRL 3UCRA 1OWRM 1JNLL 4KUZH 3RY6C 3BH8B 2P8LA 4PS4H 4L4TE 1EEYB 3O81A 2Q3ZA 4TSCL 3NFNB 1QFWI 1DN2A 1M7XA 1NKRA 2NLJA 3QUKB 2DM2A 3MJ6A 1ZMYA 4K7FB 2H8PB 3PL6D 2DQJH 4X7DC 3QEQE 1I8KB 5TQ2H 5KBNC 1NGQH 5IHUH 1E28A 3HG1A 4Y4HD 2V2TB 1F4XH 3UDWC 1A7NL 3BOVA 4G9FD 2CJUL 4FXKA 5HYIA 2ZSVA 3W81A 1YECL 5JQ6H 1FRGH 4JFPB 5EZIL 3QDME 2XG4A 3H9HA 3T4YB 1CFNA 3OB8A 1ERNA 3AC0A 1EO5A 2LABA 5AD0A 3AM8C 1RIHL 3JUZA 4KWUA 1RZJH 4OIIL 1WVZA 4M61B 5F1OB 1BD2A 4PJ9D 3KNBB 2EYTB 2KL6A 1WWAX 2XWTB 4YUEL 3TESA 1T04A 1EEZA 1IC7L 1UM5L 3O11A 5KSVB 4WJ5A 1OB1A 3BP6B 4JB9H 4X6DB 1BQLH 4F57H 3GJEA 4FQXB 3BMVA 3VRJA 4FMKA 4ZFOB 3BI9X 5FOBA 1J1PL 5EU3A 1R3IL 2QR0B 3LQMA 3WFZA 1G0YR 4L5FH 1NDMA 2Z31C 2UYLA 2EZ0D 5JO5B 1T7ZA 2QSCH 1BX2B 3ARSA 5GRUH 1YN6B 4PB0H 3PWPE 3A0OA 1LMKA 3MRHB 5FO8A 1HHGB 3MV7D 2HFGH 1N3NA 3DX9A 5C3TA 1HSBA 5SWZD 5DFVD 3JV4B 4QXWA 4YEFA 1U41A 3RAJH 5JUEH 3CFJB 1FJ1A 3X13B 3FB7B 1A0QH 3ARFD 4O4YH 4RWHA 43C9A 3TO4B 1AGFA 1VADA 2IFFL 4J1UA 5KN5B 3CVHA 5DMKB 5KVGL 1FGVH 3CXHK 3E8UH 4ORZC 3LN4A 5DJ2B 2D9CA 3LS4H 1S7XA 1FZOA 3FQXA 5JOFB 1FZJB 4JRXA 1CCZA 4C56A 3F58H 4ZOAA 2HLAB 4X7SL 1G7HB 5FGCE 1RURH 2R0LL 3HCVB 2UZXB 1CGSL 4UQ3A 1TNMA 2YZ1A 1AP2B 5LBSL 2A9ML 2ZUTA 1LDPL 1L7TL 4L1DA 1BWWA 1SYVB 4RBPH 3I75A 1EEQA 5DRZB 1NCBL 2NMSA 4NN7B 3VGEA 2A9NL 4DKFL 4EOWH 2CR3A 3V52L 1FFNA 4FFVD 1P7KA 1T7WA 4X7CC 4FQXC 5EO1A 4K94C 1EO8L 1S9KC 2Q8BL 5D7IE 3O3EA 3P11H 3BT2H 2N4IA 4BQ6A 4G6MH 2WBJA 3ECBB 1AXSA 3V9FA 2YD8A 2G75B 3WFHB 4HCRH 3IKCA 3C6SB 4DFIA 1GIGH 1UB5B 2BVPA 3TIEA 3ZYIA 3RVTC 1QEWA 2KZWA 4OZHF 5I18L 3GSWB 3T4AB 4CN1A 2Y07H 4MAYD 4YHPB 1Q9WB 4WUKL 4Y5XB 1WZMA 4UNVA 3EZJB 4WFGE 1I3GH 4GKNB 3TO4C 2DKUA 2X1WL 2VH5L 2NY0B 2HT3C 2V7HB 1CLYH 8FABB 3MOQA 5I76B 2VXUL 5E2WL 4YXHH 1YZZA 2O5ZL 3CSBA 2C1OA 1U8IB 1YNTB 2DB8A 4JFFD 5CP7A 5GISL 5MP6H 3U46B 4N5ED 1BZ7B 2XV6B 3O45B 3L3KA 5JXAL 4JM2B 3ZTJG 3JXAA 3PWVA 3MUHL 3O0RL 3DETD 2XTJB 4XPAL 3MLRH 4EEEA 2HRPH 5F9JA 3VXQA 2LVEA 3L3HB 4P59H 4DEPC 1OAUH 1WQVT 2AXHA 3SJVA 2XI9A 4ZUSB 5IIEA 3T3MF 4P2OA 3QUMB 4NN7C 3DOSA 2VXQH 2CUMA 2IQAA 5D7LD 4DVBB 1TETL 5ANME 4D9LH 1S78D 4U1IB 1A02N 2BDNH 4H1LB 3TVMD 4NQDB 4O2FA 3FB5B 2QQQA 2O5XL 4Q74A 5I8EB 4HZLA 2YA1A 3MJ7A 1T5WA 4UV4L 4YHYB 4OZFB 1KFAL 3FQRB 5D1QB 4HIJB 1MEXL 5KOVC 4K3EH 1J0YA 4X80L 2EEAA 4PJ7E 4F9PA 4OQTA 2XICA 5AG8A 3WIHH 1GGCL 4XWOC 3ZYJA 1DQQB 4BQ9A 1TJIH 1I8IA 3UYRL 4NO3B 4PRDA 4K3DH 4ZUUB 4O02L 2CQVA 1INEH 2H26A 1F90H 4HLZH 1KJVB 2J8UF 3AU1B 5F3HB 1WTGT 1IT9L 5TE4H 2YD1A 2NY5L 3P30L 5C0AA 1F3DJ 5AZEH 1MFNA 1NC2A 1N7ML 1NCNA 3O6KH 2NZ9D 3B9KA 1LEIA 4OLEA 4U05A 1A7OL 1LO0H 3K4AA 2DJ4A 1YEKL 4AY0A 1IAIH 1ZHBB 4JM2C 4IOIA 1J1OL 2YRLA 2DQCH 4CGTA 5GRYA 2MWCA 3H6JA 4YXLH 3SGJA 4PJAA 1NAMB 4CDHA 2KPNA 1MCFA 5D7JA 1G7PB 3MJ8B 4LL9A 4NWUH 4PJCA 4FQIL 2H32B 3QUYA 1QSEB 4C55A 3EOYG 2CO6B 1U58A 3MBEC 2VLRD 1HHHB 1NMAH 4BZ2H 1FH5L 5EH1A 5HGGS 3T2QA 2G60H 1RULL 4YBLC 1X6NA 5DEFA 4PRIA 5CBAA 1GGTA 4XNUH 1LEGB 1KNOA 4OD3H 4TUKL 5C71A 3OXRA 3EO9H 3K8LA 1TJGL 5CBEB 4YHYC 5GS1C 4Y4KB 2R9HC 1WBYB 3OKKB 3I9GH 1KB5H 3KLHD 2DL2A 3HUJA 5JR1H 4BFIA 4CN6A 5DJDB 4Q9CA 3GBNH 4YLQT 5CEYA 3SCMA 4OV6F 4P5TA 3OGCA 2J8OA 4MXQD 2APVA 5EO0B 4PJHA 5HHOE 3OZ9H 4XPHL 1Q8MA 2GY7B 3IDXH 1FV1B 1T4KA 2FH8A 4YPGA 1M05A 5HVHC 3WUZA 4K23H 3E0GA 5FYJD 3S35L 5DA0B 1HH9B 4P9HL 5IMKB 2I9LA 3PNWB 1J88A 4LCWE 1DDHA 4GJTB 4ZFZB 1BM3H 1G7JB 4ONHB 3WDIA 4OCLC 5FDWB 5A2LH 4K8RL 3JWOH 4GW5A 2OR9H 3OXSA 2ID5A 2IQ9H 3PG2A 3HNTH 1I3VA 5INDB 2HKFL 1MCNA 2R8SL 1CQKA 3BRGC 1AFVL 3MLSH 3SE9L 2NX5B 4PRPB 5D6DC 4AIXA 4C58B 1NMBL 3QSKB 2OXHA 4LQFL 4YX2H 3MV9E 4K55A 3TBSB 4H26B 3O8XA 4NNYB 2AJYL 4LKXB 3PDGA 4O51B 1FFOB 1H5BA 4JFDA 4RMTA 1JNNL 5CD3A 1Y0LA 4JPWH 4OB5H 1G0DA 5T1DH 4WEBL 3UEZA 3KPNB 4QOKE 4OI8A 3VFGL 3WIIL 5T1LD 1OP3K 4JAMB 1M6OA 3WE6B 2VLJE 3W2DH 5ANMB 4ZMAT 1P4IH 5EIIB 1M7DB 4I0PA 4M6AA 4ZPVA 5ID1A 4PTUA 4HDIA 1RZIA 1I9IH 1HN1A 5KVEH 4JJ5B 1A2YB 3IRZA 4U6XB 4LP5A 2WWMD 4BK5A 4E42B 3VG9B 3C08L 3UTPD 3G5ZA 1S7RB 5IHBA 2ZNWA 1BBDH 3RVVD 4PV9B 4ZNEE 4F2MB 5JNYA 4POUB 2IAMD 1HILA 5T3XE 4QRPD 4LVNB 4P0DA 5T1KA 4Y5VA 3S4SB 2OZ4L 3O2DL 2NXYC 5FYJH 4L8BB 5D2LE 3MC0A 3D25A 4XC1L 5SWSD 3IJHA 1I1AC 5DDHA 1JYVA 1UM6H 2BHYA 2NYYD 2MCPL 3C5SA 4NYLA 4X7TB 4Z9KB 1U8NA 5E94A 5I1EL 5C07E 4QXGH 5LAXA 1OVZA 1UEYA 5FA4A 1EJOL 5F7EH 5C08E 4ZUWA 1DUZA 2IH1B 1AY1L 3FQNB 5JOPE 2R23B 3EW3B 4O5LL 1WEJH 4P23C 1BEYL 4NRXA 3ARDB 3ULUF 2YD9A 4LVOC 2EKSB 2P5WA 1DN0A 4LLMB 5IB4A 3OBAA 1IQDA 1DQLH 2BCKA 5IHZA 5MENE 2ADIB 3HC3H 5EU6D 1JK8B 2DWDB 5IOPB 3QH3B 1OCWL 5C3LD 1B90A 3INUH 5HYJD 2H45A 2ESVD 4GXUN 3MGTB 3DMMD 4XCEB 1CBVL 5FUZH 2D9QB 3IDUA 1MJ7H 5CZKA 4HULB 4UT7H 5GGRA 5TE7L 4BZ1H 3NTCL 3O41A 4YBQC 1KACB 1GGBH 1BJ8A 2PW1B 1MVUB 2X09A 3LQZA 1QLRB 1MY5A 2Q76B 3ISWA 4WI9A 3QFJE 2NY1B 1HNGA 4JCMA 1AKJB 1I8LA 1BQHB 1Q9OB 1MI5E 1CVRA 4RWYL 2YEZA 3HE7B 1XIWB 3QJFA 3FO2B 3CUPA 1RD6A 4PY8J 5C0DB 1EFXB 1ULVA 3QNYA 4NC2B 4Z76A 2Y7QA 3KPOA 5IGXH 3BESR 4PJXA 2XXMB 4LVNC 1IM3B 4H5SB 4HJ0C 5BRZA 1FZKA 4GAJH 1DVFD 2Y72A 4URTB 1MCJA 5F7HA 4YHOL 1P6FA 4NO2B 3HR6A 4FFWD 2JB5H 1NDGB 3ARVA 3RZCA 4R7NB 3MLUH 5FHAL 5JHDA 4OZIA 4KJPD 3RQ3A 3BN3B 1M7IB 1EHLH 4AJ0A 4S0SD 4KHTL 5EZJB 2AEWA 5EUKB 1NCWH 1DLFH 3CLFL 4NC1C 3HA0A 3EUUA 1B2WL 3DXAD 3RIFF 1F6AA 4JQVC 4WWKD 2NY2B 1F45A 3GI8H 2VR9A 3R0NA 4OZ4B 4JKLA 3B9AA 1Z9MA 3MODL 4NSKA 3CX2A 3S8WA 3WS6A 1HH6A 3VI3F 2GFBB 1S9VB 3GMOB 5EB9A 3VG0L 4D9RD 1U95B 3FO9A 3AY4A 2XXCB 4UDUB 4YDKH 4KZEL 1J05B 2B4CC 2X6MA 3BPCB 1TNNA 2RB8A 1WCBA 2DDQL 3NZHL 2YMXL 1ITBB 3QCTL 4JPVL 4MNQD 5H37G 1ZT7A 1T1YA 4UBDC 3MRKB 5C0BD 3HE7C 2CLRA 4QOKB 1UH4A 3M8OH 1S9XA 1E6OH 5F7DB 1XIWC 4HAFA 2RFXB 3EZ8A 2G2RB 2OZ4A 3WKNA 4ELKA 3MREA 4A2MA 5DR5L 3AREA 3OKNB 1A6ZB 3QIWC 3QEHB 1IE5A 1NEUA 5GGTL 5DEGB 4DZ8B 1QVOA 4IMKC 3LDBB 4ELME 1U91B 4ZS6C 1NJ9B 2Q86A 2VSDA 1D5ZA 1P5VA 3GKWL 1FGNL 5D4QA 4PRHA 5ABDE 1DJSA 1MFEL 4WY7L 5IV2B 3IU4H 3TM6A 3MACH 1G9EA 1DE4A 5JORA 1T6VN 3QB7C 3WFCH 1QBLL 2YXMA 2EXWD 1CTNA 1V7MH 2OTWB 1W0VB 5I1CL 4ZAKD 2NY2C 5DQ9B 4Y19E 2I07B 1NFDA 5DO2D 2VLKD 3U7WL 5HD8C 4LNVA 2D31A 5C07B 1N6UA 4HJJH 4M7ZB 2WWKT 3T0AA 2DL9A 1AO7E 4MSWA 4JGUA 1RU9L 2EDEA 2AKRA 5CINL 4F8TA 5FFLA 3F6LA 5CIPH 1S5IL 4YZFF 3HS0B 1DQJB 1G7IA 1P4LA 1BIIB 4Y1AE 1K3IA 1KCSH 4KRLB 4Z6AT 4LCIH 5BV7L 2XY2A 3OKMB 1FO0H 4OI7A 2N7BA 1MRDL 1VFUA 4KZDL 3PWUB 4QHNB 5HPMB 1SEBB 1I9EA 4KQ4H 2HJFB 4POZC 3GNMH 3IDMA 5DZLA 4G8GE 3PQYB 1AC0A 1NANH 3DVNA 3X3FH 4NZRH 3VCLB 1FORH 3Q6FA 4XCFL 1XZ0A 2GJJA 2HFFB 2YBRA 5DMIH 5DSCB 5IMLA 5DGQA 3VMNA 1QFWL 1MLCA 5CJQH 3LHPL 3LDBC 4PP2A 5IK3B 4P9MH 2YPLD 3UYOD 4YFDB 1SJHA 2WP3T 1F3JA 4G7YH 3U48A 5I66A 3DV6A 1INDH 4U31A 1R6VA 1R5IA 4ONOA 1A9BB 1JF6A 2D0FA 1E4WL 2DJSA 1JPGA 1XGPB 5IQ7L 3MGAA 2O61B 1U3JA 3BZDA 2ADFL 3IFOB 1KLGB 1HNFA 2R29H 1QSFE 2CDGA 3T0EE 1SEQL 1Y18B 3LQAL 1KTRL 3FQWA 4MA1B 1HKLH 4PRNB 2H2PC 4K7PX 4N0FB 3CFCH 5DQJB 2FX7H 4MJID 1S9YB 5EUOE 5C0RL 4NO0B 3CSGA 2H9GA 4S2SB 4KHXL 3RVXD 3X3GL 3GSRB 4NZTH 4RNRB 4JQXA 3MLTB 3P0VL 3IJYA 3D85B 1S7QB 4PJEA 5BJTA 2JIXA 1LK2A 2EDWA 5DD0H 1AC6A 2BNRD 3MFFB 4D3CL 3RU8H 1BBJB 1IGYB 1NCAL 1YYML 3EO1B 4U1KB 5DD5H 3RKDD 2BVEA 3QULB 3KPLB 5A3IC 1T6WA 3FHAA 5JHLH 3LZFL 4Y7MA 1ZHNA 3O4LE 4HWEL 3H9SB 4XPFL 3PIQB 3FOMA 3UTSB 1HHIB 1ZVHA 5GGTA 2WNGA 1FFPB 3U9UA 1RIUH 4KDVA 4ZUVA 4PJAF 2JTDA 4KI5C 3A6CL 1IAOB 4P46D 5MERB 3O6LH 1JZ4A 5EOTB 4PJCF 3TZVA 4ZTPH 4BSVB 3QXDB 5E5RB 3RWEA 4EXPX 3CPLA 4V1DD 3RPIB 3C5ZA 1TVBB 2ICWA 4JO2H 3KHOA 3PHQB 3TNNA 4OKDA 5L0QC 3JSSA 4TOYL 1CFQB 5FK9B 4TSBH 4EBQH 4LLQA 2YC1A 5DT1L 3MA9H 3IVKA 4LSSL 4TNWF 1K8DB 1R3JB 2Y25A 3HHRB 1NCCL 5DD6A 1A5FH 3UTZA 2BHZA 3DRTA 1JHLH 3V2AR 2IJ0C 5JXEC 2E7LA 2ZZUT 1XMWA 1JPSL 3N1FC 3HFMH 3GSNB 3HUJF 2BERA 5L8JB 3UPCA 1GC1H 3DX8A 5FECB 1N5AB 1ZWIA 1ZHKB 3MOBL 3OJVC 4XPGL 2I60H 1CL7I 1TLKA 1JFQH 4HIXH 4XNZB 1TQBB 4PJHF 1DFBH 1IAKA 2Q1EA 4Y5YB 3O6FC 4JFEA 1MF2H 3IF1B 2NY6D 1B6UA 1GOFA 1JYNA 4IRSD 1G7LA 2OSLA 3FRUB 3CXHJ 1FLRL 4PJ5E 4Y2DD 1BWMA 1B0RA 5EZOH 2JB6A 4GMSH 3BWUC 4M6OH 2JJSA 1GPOH 4G9FE 1H15A 4TUJB 3C6LC 3PWLB 32C2A 5D71H 4P4KD 4N0UA 3QQ9C 4MJ5A 1EZVY 1JPFB 3B2UD 2PO6B 3BQUD 4Y1AB 1E4JA 5F71A 1OWWA 1I1CA 4J4PD 2WMPA 2HTLC 3LKOA 4PJGA 2VWEC 2PTTA 1SBBA 4QCIB 5DHVH 3MRFA 5JW4R 4WUUB 1XF5A 3AS2A 1T21A 2AP2A 4U1JB 4OLUL 1QQDA 3WCYA 1AQDA 1AD9B 3CXDL 1AI1L 4XAWL 3RTQA 1PSKL 1MWAH 5DUMH 5FAAA 1RUPL 4GRLA 5HGAB 5LGJB 5FM5M 3V8CA 1LO3L 1FVCB 2PNDA 1NGWA 2X4QB 2FD6L 1KEMH 2Z93B 3B2VH 4GS7B 4HMDA 1GAFH 4OD1H 3RX5A 4U6TA 2XZQH 3G08B 5INCB 1I7RA 4LPTA 1KC5H 5DRXB 5EN2A 5F9OH 2JJTA 2R0WL 4MDIB 3S5LG 1GCFA 5HI5D 1Q38A 2PXYB 4M7LT 3TA3C 4KJWD 1C5BH 3LEYH 1VGEH 4QGTA 4WO4C 1J18A 3R4DA 1XGQB 1F6LL 4XMPL 3SE8H 3U0TA 3VXMD 5BQ7A 3I6KA 2ATKB 5CJ5A 1A6TB 5LXGL 5SWZE 3WDJA 4XNZC 3ARTA 1TQBC 3MLZL 4YO0B 1D5MA 4OD2A 3U1SL 2FIKA 4UU9A 4PGZA 3OSKA 3QI9B 5J6HA 1XR9B 4APQD 1LQSR 1LP9E 2I9TA 3S88L 3OMZA 1KTLB 3EYOA 3R1GH 3OR6A 5JMRA 3TBWA 5D5MB 1D7FA 3H7BA 1HZHH 3GSUB 4ONGL 4PY7B 1I7TA 2KUTA 2AXFA 2OR7A 2NXZB 1WUNT 4PJDB 2R4RL 4LFHG 2AV7B 4WW2B 3UBXA 3O4LB 4U1HB 1S9WA 2VAJA 4FFZL 1BF8A 5EA0L 1WT5C 1ZAGA 4LSQH 4L9LB 1EXUB 4YEEA 3V7AG 1G7MB 1CF8L 3RY5A 3I3DA 3P9WB 2NY4C 4Z7QF 1FLTX 3RGVB 5I1AA 3SO3B 4QXTA 5IJVB 1FNEB 5GGVH 2ICEA 1K8IA 4X5WA 2NTFA 5DI8B 4EDWL 2NNAB 4D0BA 3TEUA 3HI6L 5GSRB 4P5MB 4X98B 2PETA 3KPRD 4YDVB 3VWJD 4BSWA 5JIIA 2VDML 3BPNB 4GW1B 3O3UN 1PZUB 3DRQB 2WZPD 1ONQA 2BOBB 4LFHD 3MMEB 3BO8A 4I0CC 4J8RB 1Z3GL 3TWCH 2B7DT 3QG7H 4NM8L 4BUHA 4S1QL 3ARGB 4EN3D 2HWZH 5F3BA 4NCC2 3QWOB 1OY3B 5D7KE 3S96A 4IDLA 1HXMA 4HUUA 2XN9D 1RK0B 2YKLL 5FKPA 4NRZA 4UNUA 5K9OA 3CK0H 3OKEB 2LU4A 3OTTA 4OKVA 4PJXF 5DVMA 5HVWA 2EH7L 3LEVL 5DJAA 3FN0H 1XGYL 4RIRA 1OL0A 3QI9C 1L9MA 3KPSA 4M3KB 3SQBA 3VH8B 5J57B 3GUTB 3U0PB 1PGRB 3QUZA 4YDLC 4WI3A 3VFPB 3W39B 1D9KC 4OUUB 4OZIF 1DEDA 4ZO9A 2VXSL 2FJFB 4X6CE 1B4JH 2HVJB 3I3EA 4LNRA 1F4HA 2GJ6E 2JJVA 4PJ5B 2VL5A 4Y4HB 4FQJH 3EFDL 3O3AA 1QTYT 5IG7B 1XF4B 5CEZE 4G9FB 2DKMA 2Q7YB 5AAWA 5E2VH 1U8JA 5LCVL 4FQCH 1D6VH 1I7UA 2BSSB 2HVKA 1X4ZA 3ILQD 2I25N 1E4KA 3TJEH 1G6RL 4AENB 5KW9L 4A6YH 4L9LC 5AG9A 4MNHB 4OLXH 4N0CC 3U83A 1FYHB 1RZJC 5IVXA 4UTAH 2DQHL 3VD4A 3RGVC 4PJ9B 1OSZB 4LEXL 2H1PL 1FIGH 4RFOL 2Z4QA 2AABL 4WRLA 4OSUL 5LJYH 3L9RB 2N56A 3LAFA 4L3CB 3O2WH 5T5FH 3BZEA 3FN9A 3BPNC 4AIZB 1RJYB 3BAEL 4N9OB 2D3VA 2XNAB 4XGZA 3DTXB 1QBMH 3JWDL 5F8QC 1NFIB 1BVKA 3ARGC 4ODXB 2GITA 4S1SL 3ZE2F 2IANA 4JDTL 4RFEA 3W0WD 1OM3L 4MLIA 2M1KA 4Z78B 1URLA 3WIFA 1PG7H 1CICA 4QRTB 3LY6A 3P4OB 2IALA 3FCTB 5D8JL 5A2KH 4DK3A 4GG6E 1NUDA 3THML 1K9TA 3BGFB 2R2HB 3RL2A 5SWZB 4C83B 5KSAA 4XVJL 1FVEA 4NT6A 4PG9B 2HN7B 1QUNA 3PL6C 4PTTA 3ARFB 2P7TA 4DN3L 3DPBA 4K94L 5DD1L 1OGAD 4ZFOL 3C09B 1F00I 4XCNB 1LP9B 2ZUVA 1AD0A 5L7XL 4ONFH 3DO7A 4HSQA 1QLEL 3EDFA 3MROA 3L95A 2EIBA 4NUJA 4ZD3H 1NFDF 4MWFA 3UJJH 5BVJA 1BQSA 1TZGH 1WCQA 3CCHA 3OAZK 3NFPB 4Q2ZA 1EUUA 4P57B 4OCMC 1T1ZA 4X83A 4OZGA 3K74B 5KZCB 5F7WC 1S7VA 4HMEA 1NAKH 3SDAA 3FAWA 2AVGA 3F7RA 4PJ9C 1UCBH 4N8CL 5I6XB 2VDLL 1RQ5A 2DLHA 4WIQA 4PG2A 3DI3B 5SWQB 3U30C 1FYTA 3KLAA 4R4FL 1RUQH 1TZHA 4PJFA 3MV01 2FO4A 1YQ2A 1V3MA 3STLB 5B39B 1ADQH 3JV6B 3MV11 1YDPB 2NPLX 4HXAL 5DTFB 4EQ2A 3GIZH 1C5DB 4TQEH 5F72S 4DVRH 3QIBD 3F8UB 5GJTL 4HKJB 1E6JH 1CQYA 1MCCA 1MCPL 5EBLA 3HC0A 2BNQE 1N26A 3W5MA 1PKQE 2EZ0C 3DVFA 3CMOH 3VWKB 4UDTB 3VRIA 1D5IL 2DQGH 2E9IA 3VMOA 1ED3A 4ZDHA 3WL9B 2DRUA 1R0AL 3I85A 2R69L 3QQ3A 1HXYB 1UT9A 5E24E 3WHE0 3HE6A 2B8OT 4YK4B 4MAYB 4P2QD 3VFWB 5DFVC 2VLMD 1QFUH 5CJXA 1ZVSA 1UA6H 4N8VG 3ARFC 1HWGB 4RGOH 3VRLF 5KSBE 2F8XC 5IMOB 5L2JA 3CAFA 5E08L 3F12B 4ORGA 3QDGA 2Z8SA 5EPMB 4HS8H 4PYGA 1IMHC 3BH8A 4JFFB 3WD5H 4YAQB 4OAWA 2AK4A 1MAKA 4X6CB 4WU7B 2R2EB 3QUKA 4OJFL 4QXUH 4FQ2L 1F58L 4OCRL 4K7FA 3V95A 1I4FB 3O3DA 1MUJB 3HZMB 4D0CB 4GXUM 1KPUA 1NBZB 5ITFB 1Q72H 3DYOA 4PJEF 1OAQH 2CMRL 2V2TA 4N68A 1MHPH 2P43B 3RJDA 3S35X 1P4BH 2X4NA 1JVKA 4LSPH 2OS7A 5D7LB 5D96B 3D39E 3QDJD 5BCAA 2XZCL 1V7NH 4XBGA 4EI6B 2BY2A 4R3SB 2V7NA 1YEJH 3RIFK 4FFVC 1NEZB 1YY9D 4NBXB 3TVMB 2PYED 3KNBA 2XWTA 5E4EC 5FUOL 3MRBA 3EYSL 5KSVA 2VQTA 5IB1A 2Q6WB 3DURB 4X6DA 2XQYK 3Q6GL 3Q5YA 5EOQH 4RAHA 3C60C 3RBSA 3GHEH 3MBXH 4QTHB 3LKNB 1IBGH 4MAYC 1NCDL 2B1AH 2BHUA 2N1KA 2Y36H 5CEXB 4NO5A 3UROR 5D7SH 2AJVL 3BHBB 1MQ8A 5ICZA 4Y4FC 2R2BA 3ULVL 2UY6A 4L3EA 4L3AA 5CAYB 3VFRA 1YN6A 1VACB 4GG6B 2BY3A 4W6XB 1HHGA 3EOTL 4JN1L 3OG4B 1NPUA 5DWUL 4CJ1A 4ZSOA 5J12C 1UJ3B 3LV3A 2JF1A 4JZNB 3RP1A 3JV4A 1XCQB 1UACH 2ZP0T 4N5EC 2WLYA 4ZXBB 3WNLA 5KANI 1DBBL 2DBLL 2VITB 3CFJA 3SDDD 3LIZL 1AXTH 3DETC 2RHEA 1YC7A 1G9MH 2NW2A 3TCLB 5JQHC 3MRNA 3NPSB 2BVOB 2E9JA 1HQRB 3SDYL 4J3UA 4YHLH 4PRAA 4F8QA 1SBSH 2BMKB 5TDNA 5DJ2A 1YEHL 4NQED 5JOFA 1FZJA 3BXNB 1R3KB 3FT2B 2B1HH 3IETB 3HNVL 4WFHE 3MCLL 1KPVB 1CXEA 1D6EA 1G7HA 5H94A 4OF8A 4TNVF 3HCVA 4LVEA 3GSVA 1BFVL 1MCQA 1S78C 1KELH 5I1DB 4PJGF 2BJML 4LSVH 2VDOL 3TVMC 1AGCA 5T1MB 1SYVA 5ADPH 1A1OA 4M8QB 1YPZB 2ED9A 1YQVL 3DSFL 3VXPA 1P69B 3N50A 2XQBH 4HQQH 1P9MC 4QKXB 2AK1L 1KJ3H 1CYGA 1W72H 2O5YH 2X7LA 1OF2A 1M71B 5A2JH 1NAML 1SM3L 3DUSA 1OLLA 1AIFB 3DROA 3BSZH 2YSSB 4CMHC 1RFDL 3I6LD 4HF5H 2BNQB 3ECBA 3NACH 3TV3L 1H3UA 1PKQB 2G75A 4FP8H 3WFHA 5C86A 3DLQR 1I1FB 2R4SH 4YNYB 1J5OL 3C6SA 2V2XB 1UB5A 3S3JA 5D1XA 2ZUUA 1JGUH 1OPGL 3GSWA 3WUWB 3TN0D 1QFPA 3T4AA 5I71B 2NZ9C 4YH6A 1FZMA 4LHJB 4YHPA 1T0MB 3G9AB 2BY1A 4NDMB 4YE4L 5KSBB 2OL3H 4Y5XA 3V5KB 2MNUA 4LASH 2EH8L 4E5XA 4RGMB 1A7RL 3JWOC 4RZCB 4R97B 1ZA6B 3HI5H 1ZLSL 3RHWF 1LK3L 1LO2L 4PY8I 4UOW0 4X5XA 5DURD 3ZTNL 2V7HA 2FR4B 4L4TA 8FABA 3OKDB 1CE1L 2VTFA 5JDSB 3C8KB 2MHAB 4W4NA 1U8IA 1U8HB 1TVHB 1YNTA 3ULUD 3VJ6B 3WO4B 3U46A 1KGCD 4LRNH 2V9QA 3QEQA 3O45A 4G8FB 1BJ1J 4W4OC 1UFUA 4FZ8L 1KCRL 2WUCL 1OGTB 3SJVE 1FG2B 3AMLA 3L3HA 3HG1D 5AWNL 4QF1A 4QRRE 4OFVA 3SPVB 1FIEA 4ZUSA 5KSUB 3AAZB 1OAYH 1AHWC 3QDMA 4M9PA 1E27B 5C0EA 3D39B 4HUXB 1G1YA 3QUMA 5T1LB 1CDJA 2LQRA 5J8OA 5FA3B 4JPKL 4DVBA 3WEXB 4JHAL 5DHXB 4MXWH 3G6DH 5TFSL 1KJ2B 3NIDF 1G9NH 4U1IA 1DQMH 4NQDA 1BD2D 2XWBB 3KLHC 2VDRH 2X5PA 3QISA 3PWNA 2X4UA 2RCSL 5TPWL 1CI5A 1LGVA 1RUMH 2OTUB 3MJ9H 2FJHB 1A6AB 5BS0D 4OZFA 1RZKL 5D1QA 1T03L 4MA3B 2LFGA 1YNLH 4MXQC 2IAMB 1II4E 3DGGB 1T1XA 4QRPB 4U6VH 4DTGL 1S3KL 3V4UH 4UIMB 4LRIA 1OAKH 4F7PB 5EWIL 2AXGB 2XQYG 2DQIL 2BY0A 3NN8A 5SWSB 1LILA 4QRQB 1A3RH 1IGCH 4MQ7A 2DM7A 1ZLUK 1HYSD 2IGFL 4R97C 2VC2L 4NQCE 3O2VH 5DUBB 5F3HA 4TNWK 3MCKA 1OTSD 4NGHL 3WLBB 2EC9T 1DQDH 4R26H 1TTFA 3WO4C 4X9GA 4PJ8B 5F7NC 5A2IH 3N9GH 3NCJL 1ZHBA 1N6QL 3OR7B 5FDYA 4MS8D 5CP3A 5EU6B 1CZ8H 4PJAE 4PV8B 3BGMB 2EE2A 1INQA 3L5WB 5HYJB 3CVIL 3DMMB 1NAMA 2NQCA 4LQ1A 4DGVL 4JHZA 2I27N 3MJ8A 1RJZB 4JRXD 4C56D 4KTEH 1FL5B 2H32A 2YD4A 1JHTA 5ALBH 1HHHA 1RHFA 3G04A 1KIUA 4HKBA 4U6HA 5IVXF 1A6VH 3CLEH 2WWMC 1N5YL 2XA8H 2VZTA 4GBXB 3EBAA 1PLGL 1ZSDA 1F2XK 1LEGA 5CBEA 4F3FA 4UB0H 4Y4KA 3QNXB 3RVVC 5FGBC 5D70H 4R0LA 1WBYA 3MLYL 3ZKSD 3DUHA 2IAMC 3HUJE 5IR1A 2PCPB 2HH0L 2B4CL 5EC2B 5DJCB 1DVFB 2JELL 5DJDA 3VXUE 4HUKB 3IFPB 2ZCKL 2NYYC 1MFAH 4V2CB 1KCVL 2HFTA 4PB9H 5EO0A 3FT3A 3BKCH 3KPPB 5HYEA 4UIKL 1IAII 1FV1A 4HXBH 3DXAB 1C5CH 3REVB 3IT8D 5IMKA 3PNWA 4X9BA 5KG9B 3QWRA 3TLRA 4I3RL 4ZFZA 3ZYOA 4LPXA 3O9WB 3R8QA 5FDWA 4LIQL 2QBWA 1XFPA 1U3ZA 1WWWX 4GXVH 5C0IA 4LCCB 3MRQA 4W70A 3DMMC 3KDMA 4OBRA 4BFGA 1W8OA 4LSRL 3CVHH 5BW7C 3MGOB 2NX5A 1OHQA 1WIUA 4GMTH 3VXRE 5J3HD 4PIRF 3WFDL 4MNQB 2K7PA 4H26A 3EYUH 3IS1X 4TULH 3NIGF 4LKXA 1MFBL 1AXIB 4QRRB 1P7HL 2X9XA 4O51A 1C1EH 4OZGF 4YXKH 4U0QB 5C0BB 5HHVH 4U3XA 4LHQB 1MJ8L 2J5LB 1IQWL 4ERSL 3KPNA 1FBIL 4P2OD 2EDBA 5ANMA 4PP1D 4PJFF 1L7IH 3KJ6L 1MCRA 2Z0BA 4ODTH 4JJ5A 1A2YA 4U6XA 4UINH 2KBGA 1DVFC 4KY1L 1HIMH 3UTTD 4E42A 3NCBB 2DLFL 5KJRH 1OD9A 1S7RA 4FFWC 4I18C 3PP3K 3RWIA 4OF0A 4TSCH 4PV9A 4KJPC 1IC4L 1J8HD 1YEDB 2CIKB 5I75C 4MMZC 3HPLB 4PJ7A 3QFDB 1L0QA 3TBVA 3P4LA 3DYMA 3GMLB 2BVTA 5K9QG 3V6OE 1FCCA 4NOFA 4WENB 4H88H 5EC1A 1SY6A 5E8OA 3V0WL 4L8BA 4WWKC 1A7NH 4NQUA 5ESQB 5EU4A 2W0KA 2VLKB 1CGTA 2CJUH 3BH9A 3IFNL 5TQ0L 3VXTB 4JO3H 1YECH 5IEKB 4NQCB 3SKOB 2Z92B 5EZIH 3D3VE 3LS5L 1L9NA 4LCCC 4JANB 2IH1A 4MNGB 3JTTB 2R23A 1OAXH 1RIHH 3EDKA 3VXSD 5C0AD 3GMQB 1HE7A 2X4PB 1NC2D 4OIIH 1T83A 4TN9A 4F58L 3ARDA 3C87A 5F9AC 3B9KD 2EKSA 4XPBH 4UT9L 4YUEH 4LLMA 2F54E 3FQTB 3TF7C 2GCYB 1JHKL 3F62A 1XR8B 3MO1B 1JGEB 2ADIA 5IW1B 1AGBB 4HLJA 5IOPA 5E8DL 3QH3A 2WAHA 2MTPA 3MGTA 4XCEA 5ERWB 5IKCB 4FRWA 5D7JD 2X4OB 3PWJB 3FTGB 3PHOB 3GJFK 2PW1A 1MVUA 2J88H 1QLRA 3QUYD 2Q76A 2E7CA 2FB4H 3TPUB 1X4XA 1BQHA 2CKBB 1JWUB 2YPLB 2W0LA 4D9QD 4XP6L 5GSVA 4E41E 3FO2A 4PRID 3HRZB 5GQBA 3T1WA 2WQ8A 2VDKL 5C0DA 1EFXA 3VGGA 4ODHH 1QR4A 1CFTB 5DVOA 4GAGH 4KUCD 3Q1SH 1PEZA 4X6DF 3ZDZE 3QCUL 1IM3A 3ZYZA 1G7QA 5MEQA 4OQTH 2EXWC 4L4JA 2XPGA 2HP4A 3QXWA 5FHBH 2ZCLH 4HV8B 5BOZG 5AYQA 1N59B 4ZFGH 4ZAKC 3K2MC 5KVGH 3TT3H 5FM4A 3ROLA 1W0WB 5DO2C 3SCMD 3QEGH 4P5TD 4BH8B 4ZO8A 1CDGA 1DSFL 1ZT1B 5BZDB 4GFTB 4X7SH 1RUAL 4LCYB 2R0LH 1KSRA 3HZYB 5E6IB 5EZJA 5EUKA 1FNLA 4X6EB 2CD0A 5GGSY 3K4DA 5LBSH 4LCWA 2A9MH 3SGKC 1LDPH 4OZ4A 1NGYA 3IDNB 5E9DE 1KCUL 5EIVA 3TYFB 3VFNB 3CFDB 1NCBH 4NRYB 4DKFH 2A9NH 4O2EA 5E1AA 3GMOA 2HLFD 1U95A 4UDUA 1JUFA 3V52H 4KRMB 1J05A 2DOCA 2CRZA 2VZOA 3BPCA 3VXRB 2ZCHL 3N1MC 4XMLL 5IJKC 2CDEB 4MHHI 1EO8H 2Q8BH 3RWJB 2M2DA 3D2UB 3ZDXF 1ACYL 1S7UA 5CILL 3MR9A 4EKXA 1XT5A 1KN2L 2Z35B 4V1DB 1XF1A 3O8XD 3QIUB 3S3PA 1MWAB 1KT2A 4JFDD 3MRKA 2HJLB 5ID0A 2QHRL 1ZLUH 2EDHA 5DK0B 4QOKA 1YC8A 4IRJC 5F7DA 5FO7B