1XF4A

Structure of ligand-free fab dna-1 in space group p321 solved from crystals with perfect hemihedral twinning
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fab light chain
total genus 50
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A01
1B6UA 1GOGA 4PJCB 5AYUH 3WFCL 2EXWD 4I9WE 4F7TA 4ODVL 5EPMB 4UUJA 3NIGF 5D5MF 5GJTL 3S88L 1ACZA 3SBWC 1M7XA 1V7MH 2BSSA 4HKJB 5DUPH 3V0WH 1QFPA 1XCTA 4JHWL 3QDJE 1IM9A 2DTSA 4YZFE 4GKNB 4JO2L 3JTSB 3B9KB 1A1NB 3H6JA 2P5WA 1UVQB 3UYRL 3O6KH 3MRFB 3HPLB 3LKSB 5IB2A 1BVZA 5F1IA 5HYJA 4RRPA 1QRNE 2P44B 1H3VA 3W39B 3AROA 4RGOL 4HS6A 1ZVSA 2P5WD 4R8WL 5A16B 1AXTL 5T5NG 2HH0L 4XCEA 4M61B 4XNMA 2ENSA 3HLAA 2X4PA 3CMOL 4LQ1A 4JFEB 1FYTB 4W6WB 1RJZA 3G6DH 1NFDA 5DT1H 4L4VD 4KV5E 1DN0B 1CD0A 1C5BL 1LP9A 3DOSA 2BY3A 3DV4B 5JQHC 3R1GL 4PGJA 1HHHA 3IGAA 5IMKB 4N0YH 5DEFB 1MSPA 2XY1A 1EEYA 3JVGA 4JN1H 5FCUH 1IQWH 3DVGB 2FH8A 3GJEB 2EYSA 5J6HB 4MXWH 2AXGB 3LH2H 3OKMA 1ZK9A 2AXGA 3LHPH 4C58B 2AEPH 4RQQB 3DUSA 1QBAA 3IDYC 2VDNH 2VXTL 4N8CH 3ILQC 5DJCA 5E6IC 5IWLA 5J9PA 5TPWH 2R0WH 1PAMA 3LRGA 1CDBA 4R6UA 5DJ0B 2ZNWA 3X3GH 3RNQA 5I1GL 4OJFL 1JYNA 4OLXH 1A7RH 1IC1A 3GIZH 3CZFA 2OXHA 4JFEA 2NTFB 4LHUG 3QXAA 2WWKO 4HKBB 1RZIA 5DZLA 4UTBH 3BUTA 4PJAF 4KI5C 3GRWA 4QRTA 1A64A 5SWSE 1QFWH 2DI7A 2D31A 2R4SH 3KPNA 3WLBA 1RZ7L 2VISA 2YD6A 4G7VL 4Y16B 3BMVA 4LCCC 1GGBH 1OTSC 2WUBL 4N0FB 4XCYB 2EDWA 2X4NA 4Q9RL 1BX2A 4C4KT 3GJFK 1RI8A 1C08A 1NH6A 4WENB 5IBLC 3BVNA 2VLRD 1UB5B 4X6DA 5CEXB 3L9RB 4EZMA 1NMAH 1YUHB 4NHUB 1GVIA 4ORZC 5KJRH 2WNGA 4MNGB 3SN6N 1QACA 1JPTL 3G08A 3K74B 3TIEB 2NLJB 1FRGH 1WEJL 4FZEL 2NY5H 4BH7A 3FT2B 3U30C 3RZCC 3L3JA 4FFYH 1A6AB 3LEYL 3GBNL 4MZ2A 3DRTA 5ICYB 3TBSA 1NBVH 4BELD 5MEND 1ES0B 4HUUB 2GSIA 5FF6B 3TNNA 2R56H 2YRPA 1DLFH 2HKHH 3NCMA 2J6EL 2V2WB 1BF2A 1T83A 3TN0B 2CJUH 4EI6A 4OFIA 3IDMA 3UMTA 3MLVH 5TDNA 1SM3H 2EICA 4YNYB 3QDGE 1ZTXH 2ESVB 5HVHC 3AMKA 1SY6H 2QJDA 3H3BC 4Y5XC 4MDJA 5GS1B 2V2TB 2AXFB 2J7LA 3ARYA 5C70A 4EDXB 3OXRB 4OT1L 4YUEH 1MHCA 2DM7A 1S9KC 3CIQA 3M17B 2Q8BH 1XMWA 4I2XB 4DCQB 4WEMB 3O0RH 4YO0B 3D85D 2WAHA 4ZOCA 4Y19E 3HR6A 4IDJH 4PJBE 2C9AA 5KOMC 3RZCB 2ATKB 4NZDA 3QH3B 3GDBA 3T2OA 3LZFH 5FO7B 4IOFC 4JZJA 1WV7T 3TO4D 4HCRA 3BGMA 4GT7A 4X7FC 1TIUA 1KCKA 2APFA 4MSWB 5DYOB 2FB4L 3KYMA 3MV7A 1RK0A 2VZTA 3CK0L 4QRPE 3WV0A 4NUJB 3QZWG 1KPVA 5IROA 1UJ3A 1J8HD 3ARRA 3FOMB 1BJ8A 1RZ7H 3LAFA 1YMMB 5C6PB 5DJAB 4F57H 2FCBA 2FZ3B 4OZHA 3OG6B 4K7FA 3U83A 5ICZB 2JLLA 5FKPA 3B83A 3QPXH 3FFCE 4HEME 1MCKA 3TJEH 4Z7WE 2IPKB 1OPGH 3NCYP 1A1MB 3V95A 1JZ4A 4GAJL 1YEKL 1KLFA 1TJGL 3N1MC 3C9NA 3EYSH 5BJTB 3DECA 4HXBL 4ORGB 1P2CA 1CL7I 1J05A 2Q7NA 4LHUA 4O2CA 2FECL 3CSYA 1YEFH 3OJDA 3WKMH 2XWBB 3NH7L 5I1EH 4N8CL 1X5YA 3TYFA 4WDIB 4Z5RB 5EN2A 1FVDB 2WBJD 4HIHA 3PF2A 1FCGA 5AD0B 3I75A 2AABH 1BREA 5EU6B 4MJIB 4H88H 3WFHB 4XP1L 1JHKL 3H9YA 4JG1L 4PPTA 3NPSC 3NMEA 3KLAB 4JEGB 2P7TB 4Y19A 2VN7A 3QNZA 5EO1A 3V9FA 1AP2B 3IJSB 5B21A 3BZDA 1MCWW 4D8PA 1BF8A 1V8HA 4HHAA 3IXAA 4OI7A 5DT1L 4R97C 3NIDF 4P0DA 5ALBH 2ZSWB 2NW2B 1H3GA 4Y89A 1TPXB 1AJ7H 5E1AA 5J13B 1AXSB 2DWEB 3MNZA 5IESH 5D1QC 4IJ3C 3OKDB 1R3KB 1JPGA 1AKJD 3BKJH 4MXVF 1BJMA 3FQTA 4QHLB 3K4AA 2YD4A 4FXGB 1T7ZA 3VGBA 3GM8A 4FZ8L 4Z7UA 3MLPA 1ZHLA 3CPLA 3NFPB 4GMTH 3TYGL 4TULL 4P9HC 1AI1L 2HT2D 3RWEA 2QKIB 3DUSB 1ZLWH 1YNTA 4WFED 3BE1H 5J57B 2FR4B 4EQ3A 1D9KC 4YXLH 5MERA 5EU3B 2EDKA 3GHBL 2ZCKH 5GIRA 1MI5A 1FIGH 5SWSA 1FGVL 2W92A 3QI9D 2DIAA 3NACL 3SKNA 1X4XA 2W0KA 1SQ2N 1EUUA 3NZ8B 3GI9L 5HGDA 4XP5L 4K94C 4LLYA 3QUYB 1ND0B 1G0DA 2J8UA 2OTUB 4O2EA 4LBEB 3BGAA 4MB4A 4POUB 1NFDB 2WWKT 3P4OB 4XB7A 3TH4T 3E8UL 5SV4A 1RZKC 4R9HA 2XKSA 4M61A 4KK5C 5IF0A 3BJ91 2VDKL 4L8DB 4D0DA 1MHHB 3O3DA 4WUUB 1P7QD 2WSKA 3ROLB 2NXYC 2XKNB 4IHOA 5AG9A 5E8EA 2XZAL 3T77B 3RUGA 2IPUK 3UJIH 2VC2H 2WM0A 4N1CA 3ARZA 1I9IL 4G6JL 4DGVL 2YD7A 2OR8A 3E2HC 4XVSL 3T0XA 3RRQA 4L9LC 1TTGA 3B8YA 1IM9B 3O6FB 1T0MA 4JFHE 2BRRL 5C09D 1XIWD 4WTXA 4R96B 3X14A 3MYJB 4HLZG 3K80A 4YHNA 1KJMA 2YC1B 5BO1L 4GG8B 4PRPD 5JHLL 5E08H 3QI9C 3OAYH 5C1MB 4JZNB 5HDQL 3TVMD 3WS3A 4JM2C 5DSCA 1BBJB 2OQJB 2VLJB 1TZIA 1C1EL 3T2QA 2Q76B 1TCRA 3BPNC 4LLWA 2A77H 5C08A 1UB6B 4PS4H 1MRDH 3GSNB 4RMTA 1QYGH 4PRAB 1L6XA 1WBZB 5DMGC 1XT5A 2LABA 1KJVB 1U8QA 4X0KA 4DN3L 3SO3C 5EU4B 3HI6L 3VH8G 1S9VB 4QRSB 3AVEA 3FT3A 4QHMB 4WW2F 3L7FB 3RKPA 5I1GH 3GSNH 4QTHB 4QXGL 5FYKL 3VW3L 3CZJA 3IDGA 4X6CB 4PRID 5E08L 4F7MB 5CZXC 1JNNH 5JPMB 5IK3B 4JRXD 1RVFH 3BT2L 3WFBH 5FA4A 4TSCL 5I73C 4PJDE 1HHIB 1RAMA 2DJ4A 3WJLC 1DANT 2V5YA 3O3AB 3DYPA 3Q5TA 4A2MA 3MUHL 5T1MA 4E9LA 5J0BA 1PGRB 2HG5B 3D69B 3QIUB 4MHHG 5IB1A 5HTSA 5I1KH 1QNZH 3RA7H 4NIKB 1UZ8A 1Z9MA 3PQYB 2OP4L 3GEWB 5EA0H 1CFSB 1WBXB 5DMIH 5GZOC 3WFZA 3DMMD 1N5AA 3STLB 1VADA 4S2SA 1RUML 3PL6D 4H8WH 3LQZB 2VDRL 2IEPA 3DX7B 1ZV5A 1FSKC 1FL5A 1VGEL 3GHEH 3I02B 2AJYH 4GQ9L 4JFOB 3UJIL 4DFIA 4JVUA 4YX2H 1YEIH 5IF0B 3W0WB 5D5ME 4Q7DA 4GRWH 4ERSH 1I1YA 4OD2A 2DMBA 4GOSA 4MAUL 1X5KA 5E4EC 4G80B 3WNPA 3PWJA 1V3JA 1XZ0A 3CCHA 2IAND 3EO1A 3TT3L 3WLWC 2FJHA 2HKFH 3T1FA 1MJJA 5DJXA 1W72A 3DYMA 5IHZA 3B9AA 4XC3L 4JPWL 1UXWB 3QUXD 4DN4L 3S35L 5SWSB 4PRHE 3ECBA 1GPOL 4PRDA 5L9DH 2CDGA 4ODWB 4CW1B 3RGVB 1FLRL 1CGYA 5LWYH 3ZKSD 3HTLX 4YK4B 5JZ7D 4HXAH 5D7KD 4IOIB 4WTWA 5A3ID 4KK6D 1CLZL 4MJ6A 3B9EA 3RL1B 3DMMA 1DUYB 3QPQC 2J5LB 4LQFH 2KDGA 4CVWA 1DE4B 1AI1H 3SPVB 4PJGA 2D3VA 3G5VA 3K8KA 5ABDE 1HXMB 2B4CC 3BDYL 3D0LA 4TULH 2PNDA 5D6CB 3EIFA 1KJ3H 3NABH 3OKDA 1ZHKA 4NKQB 3RP1A 43CAB 3MLRL 4NO0D 4P4KB 2FATL 4XAWH 5T1KD 1OAZH 4EN3A 4RAHA 4GRWB 1TNMA 3T1FB 2LU7A 5C09B 4OF7A 3CCHB 3WIHL 3MTRA 1PBYA 2RCSL 3QFJD 1ZVHA 4B7IA 5GSRB 2R2EA 3MRCA 4Z8FL 3QNZB 5EO1B 32C2B 1OP5H 4PJIB 3RI5K 4NBZB 4UTAL 4ZAKB 1B2WH 4J6RH 5MP6H 1G7JB 2EYRA 3QWRD 3UP1A 4WW2A 1F42A 2BCKA 4WCYL 2A9MH 1EEZB 2DYPB 1PZ5A 1L7IL 3D18A 3ILPA 4H88L 5CEYA 1KN2H 4JFZH 1K3IA 2WWMC 4PRHB 2V7NA 1CDIA 3QPQD 4ZOAA 5E95B 4CU8A 2UUDH 1T7VA 3ES6B 2JIXD 1RZ8B 1FE8H 2V7HA 4WW2C 5EUKB 4PJFE 1HQRB 5E2TL 5LXGL 4XX1E 2EDBA 2M2DA 3MUGB 3EYSL 5B22A 4JJ5A 4M4PA 3GZKA 2BFVL 2EH7H 3MBEA 3VD4A 1AKJA 4R4ND 2IBBA 4FTVD 5E24E 4MD5A 1HYRC 4KJPD 2DQGH 1P7KB 4PGEB 5HPOA 5F7MC 1EBPA 4NQTA 1U3HC 5IK3A 2NX5B 3BRDA 4XAKE 1RK0B 5F9OH 3QCTH 1WQVT 1QLFA 5K93A 3REVB 5C9JA 3ULVE 1NFIB 4L3EE 4P4RA 3I02A 3NAAL 5TJWK 3DX7A 2VYRE 4MD4A 2DBLL 4ONFH 3STBA 3P0YH 4KK9C 5T1LD 5DRXB 3P0YL 4FQ2L 3RZCA 2YD5A 1QSEA 1YYML 1SY6A 3SGDI 4G6FD 3OSKA 4LPTA 3UTSA 5F97E 3UO1H 4KKCC 3VWJC 4HC1H 5CZVL 3SEPA 1K2DB 4XVJL 1FZJA 5D7SH 1YC8A 5IG7B 4DVRH 2R2HB 4QHUA 3MLVL 4IIQB 4E5XB 2EXYD 4Q0XL 1TZIB 3QA3B 4YHLH 3KXFA 1WLHA 5C08D 2R0ZL 1XR8B 4PRPB 2X89A 1AY1L 2EC9T 4LCYB 1JNJA 1LO3L 2X4UB 1YA5A 1MH5A 1MFCL 4X9FA 2CH8A 4FMFA 3MXVH 5FA4B 3CU7A 2APTA 5FV2A 4KRPC 3RY4A 4FFWC 3OHXA 3W81A 1YDPA 1YEGL 2JJTA 3OF6A 3MLUH 4JKLA 5ANMB 3FFCD 1VFAB 3VCLA 3N85H 5BCAA 1JJUA 2EIBA 5DRWA 4JDVA 2BSTB 1P7QB 2IADB 4OZGB 4RX4A 5I76B 4NQEB 3L7EB 4WUUD 2E7LA 2K7PA 4ODXB 5FGBA 1IQDA 5KVDL 2EDQA 1T5WA 5LXGH 4KMQA 1WBZA 3UTQB 3GFUA 3IKCA 5GGUA 3TWCH 3HE6B 1ZA6B 5JW5B 2R2HA 4QHUB 3RQ3A 4MA3A 2HN7B 1JN6B 2E5EA 1N2RB 4TNVF 2PW2A 2JJVA 3MJ9A 4LBEA 2E7MA 2NQCA 2WK2A 3L1OL 3MRQB 4KRNA 4ZYKA 4JZOB 1SVCP 5JMOC 4XPFL 4WCYH 3EYFA 1X5XA 5I16A 4S1QL 1WAAA 3MJ8A 4OFYD 2VISB 3F7VA 1NEZG 3KS0J 5F7KC 2EH8L 4E41D 4HAGA 2YC1A 4S1SH 5EU3A 3BRFA 4Z77A 5D2LF 3BD5A 5C3TA 5KZCD 1KB9K 1EHAA 3B5GA 4X7TB 1KXVC 4RCAA 3V52L 2X40A 3C6LD 1MFDL 5B39A 1UM6H 2G9HB 3AFLA 1CLZH 3RTQC 1EFXD 3DI2B 3IVKB 1ETZB 1N64L 4PY7B 1J5OH 3WS6C 5ITFB 3LOWA 1UKQA 4U0RB 3DO7B 1F00I 1TETL 1KCUL 3V6BR 2P49B 1HOCA 1KJ3L 3F12B 1E4XH 4PRIB 1N26A 3O45B 4MQTB 4P5TA 4JKPL 4LLMA 5DUMH 2EYSB 5J6HA 4ZFOL 5GGSY 2DQJH 3LQMA 1B0RB 5GGRA 4EOWH 4LIQL 5DXWA 1N6VA 1NBYB 4MXWL 3ILPB 3IJSA 5I8KL 4LLVA 1K9TA 1I7RB 1L7TH 2P7TA 4ETQA 3MV01 3GMQB 4HWNA 4ZQKA 2CDGB 4ODWA 2NY3D 5IUSA 1E0OB 1IFHL 5TE7H 2HTLC 1MAJA 3S34H 1FYTA 3DBXA 1KYOK 2AERT 2DLEA 1A3LL 1C12A 2D7PA 4H8WL 1A8JH 5BOPA 4M7JL 1MWAA 2ADIA 1UGNA 1T6VN 4F7EB 5DMIL 5EA0L 1CGWA 1PJ9A 4B7LA 5EO9B 4HGWB 4AH2B 5KS9E 3RJQB 2DOCA 4PJEB 2DS4A 3GMLB 4OLZL 2Y1VA 4FRWA 3CXDH 2FHFA 1NDGB 4ZFGH 2ZOLA 3DV6A 3MFFA 4O4YH 4F2MB 5JR1H 5HHMB 4HBCL 1MWAL 2DM4A 1KJ2B 1HXMA 4M1GL 3H0TA 4HJ0D 4KQ4H 2FLRT 5E94A 1J12A 1FAIL 4NQXB 4OZFB 3G6AA 3CFCL 5CLWA 2FSEA 4R7NA 4EUPH 5F89B 2GJZA 5BOZG 4PJEE 1MREL 2F19L 4FTVA 4PGZA 5CINH 4PRDB 1SMOA 2GT9A 4ZUWA 4M43H 2PETA 5FYLH 2E9WA 2FYYA 4U4BA 1MUJB 3NVQA 3BWAA 4FQ1L 4CBPA 4Z5RA 4JPIA 2V9TA 4Y0GA 2FJHB 4PBVC 4NBYB 1XZ0B 3WXVL 3FZUD 3P77A 4YO0A 1H0DA 3OKEB 2PXYB 4PLOB 3SDXE 3N1GC 3VDCA 1I75A 3MRRA 1G7MA 3PIQB 3MOAL 2GK0A 3TC9A 3SDDD 5H2BA 3IKKA 3W9EB 4O02L 3VDBA 5BMFH 2H6PB 3O11B 5IMLA 1WBYA 4QOKE 4PJ8A 5D70L 4NQDB 3ZE1F 2CLRA 4HKZA 2VZ3A 3O2DL 5F7LB 4RNRB 3AU1A 4KK8D 5CJQL 5E4EB 4HIEB 1BGXH 1J8HA 3WFDH 3DJ9A 4JM4L 4PJAA 4EI6B 1KENL 4WV1C 4N1EA 4OZIA 1T1YA 1LE5B 3B9KD 2DLTA 4NSKB 3CVIH 3HZVA 4PJHB 4I4WB 1YNKL 2VLJA 1IC7L 3FRPA 3NPZB 2D7TL 4KKLD 1B0GB 1IGML 4YAQB 3AS2A 4F8TA 4WV1A 4GXUN 4NQDE 3OAZK 2VTFA 3NFNA 3TIEA 2GUOA 3BPLB 3NCJH 4YHNB 5EZLA 3MV8A 5GGVL 4PJBF 3VG9B 3A6BL 5MHSE 5KSBA 3DHMA 3RZWA 3MV8E 5IV2A 4QLRA 2DLFL 5FEBA 4JDZA 5DRXA 1LO3H 1IM3A 5IW6A 3F7RA 4QCIA 2X1XR 3GKWL 4XWGL 4P3WA 2I25N 5KVGL 1S3KH 5B8CB 2FX9H 3SDAA 5FA3A 1W0WA 2GJ6A 3QUML 3LIZH 1K8DB 4NJ9H 1U6AL 1KCRL 3ARGD 3SY0A 5EIIA 5T33L 1HE7A 1BAFL 1L0XA 2KZ1B 3ZYZA 4D0CB 5I0ZA 3S6CA 3PGDB 4PLKC 5J11B 2X05A 4NUGL 1QPPA 3V79C 4HGMA 1IKNA 4L29B 5DR5H 4HQQH 2BNRB 3NIFF 2CDFA 4NCDA 3QEUB 2EDXA 4XGZB 1HHGB 3ARDD 1U95A 4LCWB 4GBXA 5T3XE 1MCRA 3HN3A 3PDOA 5K9QI 3J8F7 2XKUA 1XGPB 4R7NB 3K2UL 4N8VG 2NY1B 2XYCA 1KPUA 3RHWF 4ZD3H 2P8PA 4YWGL 3D3VD 4FZ8H 1IC4L 3ZL4L 5I1JL 2MQCA 4HF5L 4KUZL 3VWKA 2CR6A 1YMHB 2Q6WB 4YGVB 4I48B 3MUY1 4DGIL 1JHLL 4TNVK 5C0AB 2VITA 1N7ML 3QHFH 4JQVC 5I19H 5I66B 1RUKH 3ZYJA 3JTTA 4Y4FA 3ARFD 2PR4H 1OSZA 4NC1E 5JMRA 4ELMA 4AJ0A 2VXQH 3BP4B 2R8SH 1WSST 1T03H 4PLKD 1YMHA 2Q6WA 2BSED 4D8PB 5HVWA 4BQ6A 3MV9E 1MLBA 1XGTB 5E99H 4DZ8B 2BVTA 1D5IH 1XH3A 4JG0H 1EA9C 2HJKB 3X17A 4GAJH 2N7AA 3RUGF 3UC0H 1Y6KR 3IU4H 1MCBA 4BFEA 2A74B 3AMLA 1YPZA 3BQUA 3CX2A 1CYGA 1LHZA 4ZSOA 3PP4L 2JIXB 4RISH 3P4NA 1HHGA 1NMBH 4MJ6B 3TGXA 1QEWB 3NFPA 2Z31D 4UBDD 3ZDXE 3OR6A 1Y6MR 1QR1B 4FFZH 1RULH 4KTDL 2AQ2A 4NNPH 1R5VA 2YPLD 4DVBB 1DN0A 1F58L 4HJJL 5HI5D 3KR3L 3VXME 1NDMA 1GIGL 2DQEL 1QBLH 3CLEL 1ZEAL 1V05A 1S78D 4LSRH 5I17A 1CXLA 4HDIA 4KAQL 4LAQL 4QHNB 4WI9A 3QFJB 5BV7H 2W65B 3G6JB 1UJ3B 1DBAH 5IW6B 1BM3L 1P4BH 4I3SL 4HXAL 1S7QA 3MV7B 3HPLA 3VXSE 4R2GB 3BISA 3KLAA 4EBQH 3OKLB 5IEHB 5HHMD 5JHDA 5SWZA 3S97C 4G8GB 4NO3A 1RU9L 3P9WB 3ZHLA 4MJIA 4PJCE 3LPFA 3RWIA 5E9DB 5BS0A 2DMKA 1G6VK 1IAIL 4JZOA 1DN2A 2NY7H 4QHKI 2D9CA 2Z4QA 4NRZA 4HCRH 5B38A 1TZHB 4TSAH 1AHWC 3LEXA 4JQXC 1B0GA 3HNTH 4P9ML 4PTTA 3L3IB 5D72H 3CSYB 3OJDB 1FZKA 2CD0A 5I8OL 4JE4B 5FOBB 2Z8SA 3W2DL 1J05B 1EHNA 1T04B 3F58L 2R2BA 4UV4L 3A6CL 5HI5C 4S1DC 4OFKA 1BJ1J 4LEOA 5IM7A 3OAZH 4JO4L 3W2DH 1REIA 2DWDA 3QUXB 4QNPF 1I7UA 4NQEA 3WMSA 1DFBH 1FZOA 5GGVH 2Q87A 4OZHB 1IVLA 5FM5O 2FEDC 4HS8H 4LSPL 1DLHA 1B88A 3QO0B 3DROA 4DZBB 3MFGB 2A9NH 2GK0B 3QQ3B 1XAUA 1JGDB 1FN4B 4Y1AB 3VD9A 1IGCH 4M5YH 4JZJB 3MSPA 5I0DA 5DUBB 4ZS6C 4P2OC 3VFGL 5TFSH 3Q0HA 1DBAL 4PB9H 4N0CC 3K8LA 5EZJA 5ILTL 2X2YA 5JOPD 3NIDE 4DEPC 3H9SB 1GAFL 1Z0NA 2X1OA 4KDWA 5IBUB 1VDGA 3IDIB 5EFIA 1U8MB 3IDXL 1BGXL 1HSAB 4LF3A 4U49A 1UB6A 4L1HA 3U7WL 3ULUF 3SKJL 4XXDB 4DW2L 1ZVYA 2AJ3B 1R5WA 2Q76A 2B2XL 3C5ZA 4KAQH 4Z7UE 4PJXB 1FCCA 2YEZA 2CUHA 2QADC 3N0PB 1TJIH 2AJXH 5JHDB 2JB5L 1GIGH 4G43B 4S1DD 4HV8A 3BIKB 4H1LB 2BJML 3STZA 5BV7B 5DSCB 1NUDA 3QIUD 1ZT1A 35C8H 4YHPA 5F6IC 3SCMA 2GJZB 1G1CA 5GZND 3PP3H 3AS1A 5ETUB 2DL2A 5D1ZC 2PXYD 3F6IA 2CSPA 4KRPB 4MVBC 5M94B 3MA7B 4X4YA 4PRHD 1XR9A 3CJJA 1J1PH 4P3DB 1H5BA 1UWXH 1CDGA 2CRYA 4F2MA 2A9ML 3G5YA 5FCUL 2WBWB 3P30L 1JGEA 4JY6A 4WFGE 2M1KA 4HT1L 3HFMH 1Y0LA 4DVBA 4XPTH 4P48A 4YE4H 1KEGH 4P2OB 5DJ6B 3ZTNH 3ARED 2G60H 1ZMYA 1MCJA 3KPRD 4G3YL 5K9KA 1KULA 4L3CB 4K7PY 5EUKA 3VU2A 4RQQA 1AQKL 1KELH 4JRYE 4JM2F 5TE6L 2HH0H 1ZSDA 3BQUB 1TZGH 5HHME 1U91A 2GTWB 2HA1A 3ES6A 4N90D 3TLRA 1UACH 5ISZE 4RGOH 3U1SL 3KPSB 4OGYH 1VFBB 3U0TB 3BD3A 1N7MH 4MAYC 1MWAH 1WWBX 3QWOB 4NZRH 3V5DB 3LN5A 3I6LD 4NO0B 2VLJD 3TNMA 3QIUC 3LN5B 1PLGL 4KUZH 2O61A 2X9YA 1LNUA 1NC2D 4KXZH 5MEPB 4RFEA 3L3HA 4Y4FB 1KLGB 3I50H 1KGCE 3SO5A 4NQSA 3EUUA 3MODH 1F5WA 2AEWA 1UFUA 4EVNA 1SMAA 3PUCA 2YA1A 4OLUH 4QT5B 2J8UF 1GZQA 4Z7OE 1AGCB 1IAII 3Q3GB 2EDDA 1WCBB 1KFAL 5DR5L 1M6OA 1X5AA 1BVLA 3WHE1 3FQTB 2LVEA 4MCZA 2AK4D 5CGYD 2W9LA 5CP3H 1OLLA 3RVVD 4EN3C 3K1KC 2JB6A 2NXZB 3LKQB 2X4OA 5EH1A 3QIWD 5INDA 5LQBL 1U6AH 3OZ9H 4X4YB 3ULSB 3OX8A 2NX5D 5DHXB 2ZSWA 4X5WB 4PFEA 1U8LB 1OT2A 4OLVH 5LJYH 2FO4B 2DQHH 3FQNB 3H3PL 4F7TB 3F5WB 1E4XL 1UCBH 3RWFB 3VRLE 4ELME 4PJIF 3WL9A 3WIFA 5I1LB 4ELKB 3DV4A 4CW1A 2VXVL 5KN5B 5LG1A 4NT6B 3ELAT 1MCLA 3HI5L 4D0CA 2FJGA 1NKRA 4YK4C 3ARUA 1JN6A 4R26L 2CPCA 2EDOA 3KPRE 5F1NA 2OP4H 3O4LE 4HW6A 3HNVH 5DJ8B 5A2KH 3V52H 3S35X 3LKNA 3PQYD 5IFJA 2AEQL 4TUJA 4XVTL 4XCNB 1YPZE 3SDAD 4O2CB 3OB8A 1FFNB 2APXA 1Z6JT 3H42H 3ZT7A 1QSFE 3CC5A 1XF3A 1VFUA 1Q9WB 3RVXC 4U2ZA 4OQ1A 2X4TA 1UACL 2V2XA 3O6FC 2JK5A 1D9KD 2KBGA 5F9WB 1KENH 1U36A 4WTZA 2F5BL 3U4BH 4JB9L 4Z7WF 4GW4A 3MRMA 5D7JC 3RX8A 4X6DE 1JF1A 1XF1A 5D2LA 2EYTB 4Q9QL 4FQHA 3KYMB 5GRUH 5L2KD 4PJFF 4L8BA 2C1PA 4P4KD 2OL3B 4DN3H 4LDLB 3ARTA 1JUFA 1KNOB 4ONGH 1NC2B 1X4YA 4KXZI 1K4CA 3QYCA 1BMGA 1JMZA 4IM8A 4NKMB 4TPRH 4F7PB 3MRMB 5GZOD 1A6TB 1NJ9A 4QRUB 4P57A 1HHIA 1KBGH 5FUZH 5A2JH 1D5XB 4Q6IA 2NXYD 1QSEB 4YBQC 1FGNH 1WT5A 2IFGA 4XBPB 1HHJA 5GS0C 3DX6B 1CZ8L 4GXUM 2MCG1 5TH2A 4U1SB 3UJTH 1QZ1A 5FB8B 3LN9A 2DF3A 4WY7L 3BW9A 5FYLL 3O2WL 3L6FA 4JFQB 1M71A 4MNQE 5CCKH 5JXAL 1SHMA 1G7PA 3QDMA 4Z95L 3V6ZB 5GS1A 3MLXL 2VDLL 1BZ9B 1FFRA 4UOW0 1JL8A 2YUWA 1QSFB 4KJQC 1T2JA 2VLJE 4WO4D 5TGBB 5IFJB 2BRRH 3T0BA 5B3JF 5IEKA 4WWID 1ZANL 2AK4E 4ZUSB 3ZTJH 2QQKH 3U9PH 1SBSH 3WKNA 4G6JH 3MUGA 5CJOH 2F53D 2IMMA 4OF3A 1ULVA 3DNKA 4JAMB 4ELMF 4HBCH 2UYLB 3SQOH 3LVEA 3SE4C 1EIBA 4KC3B 1F02I 3DRTB 5ICYA 4BUGA 2VZVA 1ACYH 1MJUH 3HE7C 5D7IF 1TZHA 2N1KA 1Y6NR 1JV5B 3IJYA 2DYPA 1ZGLP 1T1WA 2MQ0A 3VXOA 5C92A 1FAKT 1QRNA 1PEZA 2NYYC 2BVYA 4J3UA 3RDTA 4WW2B 3BPCB 3RWGA 5GS0D 1MAMH 5INDB 3DUHA 2PCPB 1FBIL 3QUYD 4D9RE 5I1AB 2X4OB 1UWGH 3OAUL 4JRYB 1KLUA 4L3AA 2X4NB 1M6OB 5I8KH 1CFNA 3X12A 3GHBH 4EXKA 5D5MB 5I75C 1GZQB 5K9OB 4LIQH 4OB5L 2P45B 3TEUA 4XCNA 5HYQB 3KWWB 2AP2A 4YHML 4OZIE 4HCRL 4KJQD 4PJCF 1T3FA 3U48A 1B9ZA 2ZP0T 2PKDA 4L8DA 4NP4L 1OSZB 5DJ8A 1TQCC 3J7HA 1KLGA 2BERA 3EKCA 3MOQA 1FO0B 1FHGA 2QHRL 1E6OH 1HH6B 1ZT4A 5ESVA 5FUCE 4K3HA 3BFOA 1KCUH 4FP8H 4UT6H 3DIFB 3QUYA 5MP6L 1SEBB 5DJZA 3QIWB 5DJYA 5IVZA 3OR6B 4LLVB 2VZ1A 1XGRA 3O9WD 4QHKJ 1Z9OA 3EJZD 3RPIB 3KPSA 3QCUH 5E2WH 3DMMC 1U93A 5C2UB 1U92A 1LO0H 3GI8H 3P0VH 3MV11 1S7WA 5FUOH 2R0LL 4WI7A 3ZKND 2ZZUT 2G2RB 1U95B 2XOTA 1OGAD 2Z93A 5CKAA 5D1XA 1INDL 2BNRA 4UQ3A 1T2XA 2ARWA 1KACB 1RZGB 3REWB 1JGLH 2DQDL 3PL6A 3AS3A 5E70A 4NQSB 2CO6B 1DQML 3LHPL 3DTXA 3VFRB 3JWOL 2Z35A 4IMLB 4HPYL 5MEPA 3GUTA 5B3JE 2ZG3A 2ZJSL 4P9HL 5D1QB 1W8OA 5B8CA 3IJHB 1CQYA 4PB0L 1WIUA 5T3ZH 1RIVL 1UEYA 4M5ZH 4JPWH 4DN4H 3L3KB 3QR2A 1IGCL 1HYSC 1MAKA 3SDDA 3B9KA 4KJYB 1BFVL 5D2LE 3VWJD 1NCDH 4DEPB 2ADFL 4PJAE 5ACMA 1SJHB 5E6IA 2QSQA 5HHNB 2Z8RA 4JPKH 1CGSH 3R06A 4KKAD 4MNQA 5EU5A 4H0GA 4M7ZB 1F4YH 1WK0A 1DQDL 4Z7QF 4AEHH 2R4RH 4MDIB 4OGXL 2ZCLH 5D4QA 3UDWA 4PP2B 1DBJH 3IT8D 4H25B 3L5XL 4APQC 2K7QA 4DWHA 2UWEF 2C3VA 4KI5E 3A6CH 2IPTL 2QTEA 4FQJH 3AS0A 3VXPB 3EO9H 4J3SA 3EGSA 4D9RD 2EZ0D 3M8OL 2BOCA 5E8DH 1M05B 4PJ5A 5FYLD 3VXRA 4GRMB 3UO1L 4HKZB 4QTHA 5IR1B 2FGWH 1BZ9A 3UAJC 2CKNA 1UQSA 1VENA 3NCFB 3RPKA 4X80L 1NLDL 3IETB 3T4AA 3JV6B 1ORSB 4UB0L 1YQ2A 2ID5A 5L2JB 4ODSL 3EJYC 4M8QA 4RMQA 4RWYH 5I1HL 2B0SL 3E2HB 4KKNA 1DBML 3SE3A 4I2XE 4QWWD 1JGVL 4YDJB 4ZMAT 3ZE2F 5FO9A 5HHPA 4BA8A 3O6LL 4CUCA 2GUOB 1BIIB 4NM8H 1SEQH 1OSPH 1UEMA 2W59A 5B38B 2FX9L 3MZTA 4Z95H 5JPNB 3CVHH 5BS0B 5J1AA 2A6JB 2ADJB 2I9TA 4EKXA 4Z7OF 2KQMA 5ESQB 4U1MA 1DP0A 5IHUH 4LDOB 1AO7E 1C8PA 1U8OB 2KKQA 1MHCB 1FNEA 1GGUA 1T1YB 2GYSA 4PP1D 1LE5A 1RUQL 1FGNL 5EOTA 3BZ4B 2K1MA 3PWUB 4QOKD 4PV8B 1WCQA 4LCWD 1CZ8H 5DHYB 3CSBA 3D2UB 4B0MM 1OAYL 5F89A 3OGCA 2W65A 4MXQD 5IR1A 2Z9TA 4JVPA 4OM0H 4PJ8B 2UY6A 1JFQL 4BSWB 4Z7NF 5ADPH 1VEPA 1ZWIA 3MBEB 1A7OH 2NY1D 1J1OH 4JJ5B 1NSNL 3ESUF 3UTTB 1MRCL 4GAYB 3T0ED 2HVJA 3EJYD 4JFYB 1B2WL 1NC4B 5TE4H 4M9OA 2ZOLB 2C1OB 1MCWM 5EIQA 3HCVA 3HMXA 1TQBB 3WFDL 3LS4H 3OKEA 3TZVC 3LQAC 3LEXB 5DF0A 1INQB 2IH1A 1NGYB 1MOEA 5AUMB 5CEYB 4R2GD 3UCRA 1RHFA 1WZKA 3QSKB 1BZ7B 3E6HB 1I8KA 5FIEA 2G5BB 4LEXL 1RUKL 4DK3A 2VDOH 3VGHA 4K71B 2KL6A 5J4MA 3O41A 3L5IA 1NEZB 1JHLH 3U0PA 4DGIH 4DFHA 3WNNA 1E6JL 4MZ3A 1OAZL 5CZKA 4BSJA 1Q94A 1CLOH 3PXJA 1NMCC 5DQJB 1CD1B 1FVCB 2L7JA 4X5LA 1BWMA 1HXYA 4D2NA 4OZFA 3IJHA 1ZE3C 1I3GL 1EBAA 1S7TB 1XGUB 3OX8B 4PLNC 5MEOB 4P5TB 4U7KA 4L5FL 5EO0A 4BK4A 1WZ1L 4X6DF 2VITB 3B3IB 4OZFH 3HZMB 5IGXL 3B8SA 2IALB 1ONQB 3S35H 3QBTB 3B3IA 4Y4HC 1S9YA 4Q9BA 4GMSL 2NZIA 3VI4F 4P2RD 5HVFB 3DETD 5LGJA 3PABA 4IMKC 4S0SD 2BMKA 1F11A 5DD5L 2DQHL 3H3PH 4HHAB 3M1BA 2ARJB 1RJCA 3W11C 2W91A 5B39G 5J6GB 5HYFA 3HG1E 4KZDH 1OGTB 3V6OC 1ZGLB 4NJ9L 3KPPB 1KPRA 2FWOB 3SE9H 4Z78A 3LS5L 3HAEA 1JYWA 5IVXB 1UXWA 4MS8D 3X3FH 4HPOL 2E7HA 2P5EA 1S8DA 3MROA 5MENB 2DQIL 4OLZH 3RGVC 1MFBH 1EAPA 4J8RB 2EDYA 4EJ1C 1KIQB 5D71H 2HJFA 3D9AH 3PGDA 4E41B 4PG9B 4GXVH 1INQA 1WISA 1OQOA 5EU7C 4XNMB 4LHUB 1FO0A 2PYEE 4BJLA 3PGFL 1W0WB 1IEAA 2YA0A 3O3EB 4OV5B 4GKOA 4UU9A 5TE7L 5FECA 3HC4L 3VWKB 4ODXA 5GGQH 5C0IB 4HUMB 4GG6B 4U6HB 1L7TL 3BO8B 1CFNB 1X5IA 4XRCA 4PREA 3C5SA 1AGBB 4WW1A 5T1KA 7FABH 5I76A 2KH2B 1R3IH 2J12B 4U1NA 5F7DB 4BKLB 5I1IH 3BH9B 3NCCB 2P4AB 1A6UH 2XA3A 4HAFA 3JV4B 5D7IE 1AQKH 1XGPA 1TXKA 3NIGE 1LP9E 1TZGL 3BT2H 3WFBL 1FPTH 4KH2A 3C08H 3HE7A 1P53A 4OKDA 4NCC1 4KKBC 3QIUA 1HEZB 5F1OB 3VXUE 5FGRA 1YZZA 4OUUB 1UH2A 1N64H 1D5ZB 1PKQA 4PGDB 4K07A 4M7LH 5JIHA 3CX5J 5IBUG 5ADPL 2DMCA 2MQ3A 1J8HB 1Q72H 1QYGL 4D0BA 4LNRB 1IC5H 3MX0A 3K3QA 4OSUH 1FNGA 1FH5L 1NFKA 1WBYB 2XICA 4BK5A 2BOBB 4LAJH 4BH8B 3L7FA 3ALWA 4QCIB 1T5XA 2HT3D 5DUBA 2HYMA 2ITCB 4RAVA 5E0QA 5HHXL 2D7NA 4X98A 1OP3K 4NC2B 2FGZA 1FL6A 2EC8A 2XA8H 1MVFA 3FQUA 1DANU 1TQCB 3ZKQD 2Z8VC 5GGTA 1H0DB 1JPFA 1RQ5A 4KDTC 1FAIH 4WV1B 3ULUE 4XVSH 1MCHA 3VG0H 1EHXA 1CI5A 4LMQE 3BN3B 4NKDB 5E8NB 4CNIA 4ZDHB 4DGVH 3Q48A 1LD9B 2X89D 5GRJH 3KXFB 1CFVL 2H2PC 5C0GB 4M5YL 2E9BA 4XP9H 5AEAA 3VFOB 2R2BB 2I26N 2VQ1A 5KSBE 1BD2A 1GGTA 4X83A 1T4KA 2EE6A 4KJWC 4XNQA 1EV2E 3F65A 4HIEA 1DFBL 3LEVH 2YUZA 4GLRH 4NQXA 4H5SB 4QRRB 1MFCH 1S5HA 1RUPL 5D7LB 1W2KT 5D9SA 3MLSH 2HT3C 4XCYA 2VXVH 1NL0L 5JIPA 2R56L 4LLAA 4IMKA 4JRYD 2F8OA 5I71B 1A9EB 2HRPH 5DFVD 1FIGL 4BYHA 5ISZD 2X1QA 4QXUL 3R8BB 5B8CC 1NCNA 3LEYH 5HHOE 3GUTB 1FGVH 1U42A 2Z92A 3NGBB 3HNTL 4I9WD 4QRTB 4YXLL 3SE8H 3G5ZB 2R1WB 2GITB 3BAEH 5I8OH 5GSRA 1X44A 5FCSH 4EOWL 1VERA 4HC1L 3P0GB 2FRGP 1A7NH 1ND0A 2MNUA 5JQ6H 1CDYA 4Q2ZB 4Y5YA 2X41A 2VLME 4M1DL 4WEBH 3EHBC 3WSQH 1CLYH 3UEZA 3TYGH 1MJ7L 5C6WH 5HDBF 3TT1L 4EBQL 2YPKB 2F58H 3U4EA 4L8CA 2L4OA 1FNFA 1TETH 2H9GA 3KLHD 2IFFL 3HE6D 5JTWA 2F53B 4JO1H 4KROB 4NNYA 3UDWC 4ETQB 2WBKA 1RK1B 2P8MA 3LKOA 2BNQA 1R5IA 4JRXA 4P9HH 4WO4B 4NC0B 3KPOA 2R9HD 3M1BB 1MFDH 1GGYA 3KPOB 2M26A 5C7XL 3MV9B 1XF5B 2ZG1A 5HYSB 2Z31C 2OK0H 4OZGF 5C0EA 1FNSH 3TBYB 4FNLL 2D0HA 1G0XA 4QHLA 3P2TA 2F53A 4XHQA 4X6BB 4OQTA 1EXUA 2H32B 4KY1H 4XWOC 4NC1C 4XTRD 4L8SB 3TO2A 2E6PA 2N7BA 4MCZB 5ESVB 3BHBB 5FDYA 1NDGA 5C0AE 1YC7A 5I75B 4XPFH 4GS7C 1JZ5A 1RULL 3ESVF 4PJEA 4Q2ZA 4Y5YB 4DUXA 4LRNH 2R0KH 2NW2A 1IGIH 3TP4A 3L1OH 5L6YH 3C6LA 1V3KA 5HYQA 4G80A 3KVQA 4XP6L 4OZGE 2BDNH 3NCYS 1DVFA 3GI8L 1LO0L 1YY9D 2FEEL 4XPBL 4UIMB 3LQAL 2D4FA 4TTDC 5CJXA 3PHQB 4NNXB 4PJ9D 4TOYH 5JIIA 1OW0A 3SJVA 4XP4L 3ARDC 2DQUL 3WFHA 1RIUH 4I0KA 2BSSB 1I7RA 3TH3T 12E8H 2GQHA 4MAYA 4CAGA 3GMNA 5JW4N 3V5DA 1AQDB 3QIBD 2Q7YA 3FB5A 4M7KH 5AWNL 4LFHG 1D9KB 2FX8H 3JV0A 1EGJA 2CMRL 3MZGB 1FFOA 5CD3B 4DKEH 3SQBA 4LPVA 5T3ZE 5AZEL 3SE3C 1NC4A 3ZYOA 1T22B 4P3CL 1MNUH 3D69A 1LD9A 3GSUA 1Y18A 1AY1H 3TN0C 1IC4H 4RX4D 3ZL4H 1DTUA 1J1XH 1FBIH 4KZEH 2FZ3A 3O2VL 5HXMA 5IVXF 2Q1EA 1MFNA 2VN4A 4NRYB 43C9B 4UT9L 4DQOH 3MRPA 5FK9B 3QJHB 5EOQL 1RZFL 4UMGA 1IGYA 3C09B 5IB3B 4QF1A 4U1GB 1K8DA 4JGJA 1NCUA 4F7MA 1RMFL 4OZ4B 1M7IB 1TLKA 5I1HH 5L9DL 4JO1L 5KVMC 5K9JL 5TH2B 4DKFL 1CL7L 5EWIH 4YHPB 1OTSD 1CLYL 1T5XB 1HZHH 4K7PL 4H20L 4S2SB 5KSAB 3CVHA 4OLWL 4OFPA 3PV6B 3RL2B 3QA3A 3T8XA 3IAPA 4BM7A 2PW2B 3JWDL 4MMXC 1TVHA 5F9OL 1UM5L 3EZ8A 5DVOA 4RDQG 2HMID 2W1NA 1FZJB 1XGYL 2HVKB 4MCYB 3IKCB 2AJYL 5C0BB 4YR6B 2BK8A 2DDQH 3PV7A 3T04D 3PJSB 1N59A 3JV6A 1DBJL 4RDQF 5FGBC 4E41E 1NPUA 4DAGL 3SGDH 5ECJE 5DRWB 2OSLA 1ADQA 4FFYL 1FVEA 1NLBL 1F4HA 4R96A 3EBAA 3MRLA 1LMKA 3THMH 3GSQB 2VABA 3O6FA 1EMTL 4PGCA 5I1DA 1RIHH 1BFVH 2V2WA 5SV3A 4XP9L 3I2CH 1IC7H 4XRCB 5B4MD 1RIVH 5SX4I 1GGBL 2WUBH 5CSZA 3RY5A 2VLLB 4Q9RH 3GGWB 4OSUL 1IM9D 4MCYA 3FOLB 3FO9B 3S4SB 4G7VH 3Q2CA 1XFPA 5F9WC 1UC6A 1CICB 4UTBL 1JNNL 1H15B 1VFOA 4U3XA 5JOEA 1JGLL 2JELL 1URLA 3MRIB 4OTXL 3X13B 3NZ8A 5BMFL 3QDGD 5F8QC 4U05A 5BV7C 2CUIA 4YIQB 4AIZB 5A1AA 4NNPL 5GS0L 4RFNB 3PXHA 4G8GA 3TO4C 4F15B 4W70A 1EJ6A 4FTVB 2D31B 1MI5B 3KPNB 4F3FB 3WXWH 4YBLC 3KDMB 4F7CB 4D3CL 2MHAB 2OXGA 1DEDA 3QJHA 4WHTB 2DI9A 4IDLA 2AEPL 4Z9KB 4PJ8C 3BH9A 2YOCA 3VRIA 1NAMB 1QA9B 4R26H 3LKPB 5FUCC 2CXGA 2WIIA 5DO2C 4PIRF 1OB1B 4Y19D 4XPAL 4YDKL 4JDTH 5D1XB 1JGUL 5KANG 4M43L 1EXUB 2H32A 4WHCA 4OV5A 5CINL 1MHHA 3O3DB 4WUUA 1VPOH 4CVZB 3FQRB 1QVOB 3DVFA 3C60D 3V7AG 3IB4A 1GH7A 2OS7A 4RFEB 5H37G 4HGWA 4AH2A 3WNMA 4CN1A 1KXTB 5JUEH 4KQ4L 3SBWA 4GXVL 1RFDH 4UINL 4EXPX 4ZAKD 1JPSL 2Q7YB 1H3WM 1CD1A 3O3UN 1AP2A 4J4PA 3D0VA 3IXTB 1RK1A 2OR7A 2P8MB 3SKNB 2VC2L 3S7GA 1CXHA 1OWRM 5IVXA 1UWXK 5EBLB 3DIFA 1QFWI 4WUKH 3QI9A 4U1IB 5B3NA 1GGCL 2W60B 4ZQKB 5DD3L 2C26A 4H0HB 2ZWLT 5DVMA 2VSDA 3QAZC 5F3HA 4G8GE 5A40E 4WU7B 5DD5H 3LPGA 5DA0B 3SDAC 1VPOL 3MV7E 4QRPA 1ZHLB 3SDCD 5CBAA 3RA7L 4ZS7H 4FXGA 5BXFB 1QVOA 3MRFA 2NY3C 1NCAL 3FT4A 4YDLB 2HFFB 4QNPE 3EYQD 3TA3C 3I9GL 2NY4D 3JTSA 1IARB 1A1MA 2HRLA 1H5BB 3GBMH 4L9LB 4J3WA 4YEFA 3O6FD 3TBYA 5C0EB 1N4XH 3MA7A 4C4KO 2XN9E 3U4AA 1P6AB 3LKPA 1IZJA 3VA2C 2YMXH 2OL3H 1YMMA 1CFSA 1WBXA 4MAYD 4POYA 1MY7A 2AJSH 2BC4A 3VJ6A 2BVPA 1NAKL 1T21A 3TIDA 2FNBA 3BZ4A 3PWUA 4GSDH 2VO5A 2VQ1B 4JDTL 4QXTB 3BGMB 4XXCA 4QXGH 5FYKH 2JCCB 2RGSA 4LCUB 2ATKA 1I8KB 2J8HA 1V5JA 4P46C 4D94A 1HINH 5AUMA 5TGBA 3PHOA 1G9ML 4TPRL 3UPRB 4JPVH 1LO5A 3H9ZA 4OFDA 4ONGL 5JPMA 1P2CB 3IF1A 1LEIA 4JFOA 1KEML 4O58H 5I71C 4XNUH 2P48B 5FYKU 1A3RL 3C2AL 3QO0A 4FQPA 4CDGC 4ENEC 4NWUL 4OZGA 1DL7H 5DS8A 2WUCH 3GNML 1KG0B 1MJ8L 3QB7C 5IT2H 1KIRA 2ESVA 4KQ3L 5BO1H 4F7PA 3FOMA 2DM2A 2ICEB 3KYNB 1WJ3A 1NBZA 1CBVL 4LNRA 4I8DA 2Y7QA 3T0WA 4UNTA 4LK4A 5D70H 5I8EA 5KVDH 1G7IA 1MIML 4MA8L 5KSUA 2ITDA 4FN0A 2PW1B 4DUVA 4EUPG 1OAUH 5DA4A 3ZDYF 2BVQB 4XHJC 3TO4A 4NBXB 2AJZB 3TBSB 3PWVA 4UOJA 4ACPA 2A6JA 3WS3B 1D5MA 4TUKH 2GY5A 5EULV 1BOGA 1OSPL 4MQ7A 4GG8A 4IEFB 3CNKA 3GMOA 5JXEC 2LFGA 3T0VA 4RIRB 1JI1A 3WE6A 2XI9A 5DRNA 4CVXA 5FHAH 2F9BT 3P11L 3B9KC 4C56A 4MYWB 5I18H 1BD2E 3QUZD 1FSKB 3SJVD 3LRSA 1QKZL 1WFNA 3NN8A 4IRJD 3HMXL 4U1NB 2VKWA 4MNHA 4I18A 3T4AB 4CU6A 5EC1A 4HFUH 3G6JA 3RUGB 2Y5EA 4X4XA 2CIKB 4YNYA 3G5XB 4UT9H 4PJ5B 4BZ1H 4IRSA 5D72L 4BZ1L 2YBRA 1A6VH 1S7SA 2A6IB 5LQBH 5IQ9B 3SKMB 1TCRB 1RZIB 2A73B 3QQNA 1J1XL 3C09C 3KHQA 1P7KA 2GI7A 4PGEA 3CZFB 1U8PA 4O2EB 2DBLH 4ONFL 5F96H 4C56D 4G8GD 4JZJC 4XHJD 4UQ3B 4FQ2H 5CBEB 4MGXA 5MENA 5F7WC 3VFVB 1MFAH 3QG7L 3CXDL 4ZFGL 2P46B 3P11H 3EJZC 5EOCH 4LCWE 3NAAH 5DDHB 3HE7B 2JIXA 3ARGC 2X7LB 3M8OH 3PWPA 4XNXH 5E8DL 5DFWH 4M7ZC 3TCLB 8FABB 4HIXL 5J6GA 5EU6E 3N06B 1E4XI 4HC1A 3ZHDA 1RIUL 1XH3B 5DGRA 3U7AA 3CLEH 1AQDA 1BVLB 2DJSA 2UY7A 3MR9B 1NBVL 1JZ2A 3M07A 3SOBH 3VGGA 4TOYL 4GW1B 4I77H 3D2UD 5HGGS 3SJVB 5F7NC 3WLBB 1L9MA 4JG1H 4QOKB 5D7KE 4FZEH 4ZAKA 3FO2A 1CBVH 3HLAB 2AABL 2R1YA 2DWEA 3MNZB 1DQMH 2LAGB 1KF9B 3GMLA 4OKVA 5IT2L 4Y2OA 3QXAB 3GSVA 3VGAC 2MSPA 3P4OA 1BQHB 5D96B 2X1PA 3UZVB 3UC0L 5IMOA 1Q38A 4HWEL 4NQVA 1MF2H 4JG0L 1KLUB 5TDPA 2P5WB 5ACZA 5KG9B 1LWRA 3MRDB 2XQYG 4ZFZB 2WBJA 4LKXB 1J1PL 1ZHNA 1S7VA 1V7NH 3VGDA 4ONOA 3K81A 2IF7A 2VXQL 4M1CC 4TRPL 1UKTA 2R0KL 3IU3A 2LU4A 2ARJA 2QQLL 4WI2A 2IQ9L 5DDHA 4PJBB 4PJFB 5I19L 5BVJB 1R5IB 2BMKB 2F54D 5L0QB 1CK0H 4OLEA 2FB4H 3O45A 1U8KA 3OV6A 3QRFM 1UCTA 4P2RE 4XNZC 3WO3B 4GSDL 2AJXL 2P8LB 4UT6L 1S9YB 3VI4E 3MJ9H 4CMMB 4J2XA 2H9GB 3S3PA 1K6QH 1GOFA 3WLWD 4R0LB 4Y7MA 2L0DA 2YBRB 1MEXH 3VXUD 3M45A 3CGTA 1S7TA 1XGUA 4OD1L 3L5HA 5DC0A 5IEKB 5M7QA 4K7FB 1R6VA 4YHMH 5D6DA 5E7BA 1I9RL 1T0NB 1GAFH 1KTLB 1UZ6E 1CR9H 4NO5B 4U6VL 2QQNL 4UBDC 5EU6D 2W0LA 3TBVA 4G8EB 1F6AA 4R4BB 4IBLT 1AR2A 3B2VL 5DQJA 5LWYL 3DVNB 3DYOA 4DOHE 2YK1L 5A3IC 4G43A 4MX7B 2H1PH 1FNEB 5D1XC 3OAUH 3TV3H 1IAIM 2PYFA 1BPVA 4PD4K 1N8ZB 1I1RA 1O5DT 3VWJB 4QTIH 2QHRH 4XBPA 1A7BA 1IGTB 4GG6E 1D5XA 3HS0A 1YEGH 1H3UA 1F3JA 2SEBB 1RV6X 4UV7H 2GTZB 4C56E 2OJEB 3QUMH 5TDOB 2CR3A 3WNOA 4CVUA 4RWHA 1ZA6A 4HH8A 1S3KL 4P5MA 1ZS8A 3N1QC 3K7UA 3QFJE 4WHYG 2W9EL 4HLZH 4NSKA 4M8QB 1QUNA 3OKNB 3QQ3A 3V6OA 4L8BB 4PJAB 4KDTA 5DUPL 4CU7A 4NPYA 1ZLSL 1UH3A 1JE6A 2NY0D 1WEJH 1JRHI 3TCXA 4XVUD 4CN6A 5I1KL 3NCJL 1OGAB 2H45A 3PE9A 4LSTH 1K4DA 3HMXH 1QNZL 1A4JB 3SO3B 4Y4HA 5HHXH 4LHUD 5GRJL 1IE5A 5EOTB 4X8JA 3T0EC 3FB6B 1FL6B 3L95B 4KUCF 1AGDB 5DYOA 2NY3B 4XAKD 3D85B 3JUYA 1U8OA 2BVEA 2BSRA 1MCEA 3ET9F 3O9WB 5FO8B 2ICWB 4BH8A 5IWLC 5JPNA 4X5XB 1A2YB 1C5DB 4ZO6A 1AD9A 5K59E 3LDBC 5F6HI 4PJXE 1FYTD 1ZEAH 4YDJA 3TM6A 2BNQD 2QADB 3GSNL 3PWNB 4APQD 1IKFL 1ZHBA 3BVNB 3SDDB 2PO6C 4Y2DA 1ORSA 4L9DA 4OTXH 4ELKA 4JCLA 4AEFA 2PUQT 1GGIH 3LMJL 4X6FB 4AENA 1FE8L 3CDGA 1KV3A 3VXRB 2IG2H 2D03H 3MYJA 3ULSA 4JFDE 2XZCH 4L4VE 3S4SG 5GRYA 2VL5A 3OTTA 1P1ZB 3KYOA 4HG4J 3ARBD 2NTFA 1P5VA 4Y4HD 5GGQL 4KGLA 4J12A 3H42L 2XN9B 4QWWC 3R1GH 3QP3A 1IT9H 2W38A 3T77A 1FPTL 1FC2D 1ORQA 1T03L 2PTTB 3W11D 2RCSH 1NLBH 5CSGA 2G2RA 5IP4A 1B0WA 1AXTH 4ZO9A 2A38A 3LDBB 1G7LB 2ICCA 2JE8A 1U92B 4WIQA 4YDIH 1RZKH 5F1KC 1AFVL 1RHHB 2HJKA 5KN5A 4XCFL 1JNLL 4P5KB 1U8NA 3MLRH 1IBGH 4M7LT 1LO2H 5LAXB 1ZT7A 1MLBB 1B4RA 2HTKC 1X4ZA 3ZTJG 1HKFA 3BDYH 2C3WA 4XVTH 1C5DA 2VUYA 2EDHA 5KOVC 4DOHB 1W8NA 32C2A 1ZSDB 2FR4A 2NY1C 1YY8B 1OF2A 4KV5F 4YHIA 4H20H 1JTPA 1R3JA 1MCIA 1FP5A 3NACH 3ZDZF 3MRNB 2CDEB 4QYOA 4GW1A 4HZAA 6FABL 4XCCL 4XCCH 4HGKC 4M6MH 3B2VH 1FJ1B 3IVKA 4PRIE 4PYHA 2NY2B 1MHEB 3MGTA 3SE9L 1RMFH 4OGAC 1T80A 3UTZB 2DLIA 3WN5B 2GJJA 4YHIB 3T2NL 2XWJB 3I50L 3G5VB 1QFWM 4Z77B 1A02N 4MQXC 3VXOB 2DQJL 3GJEA 3G6JF 4A6YL 2WV3A 4NQCA 3DVGA 3OQ3B 5DLMH 4JFED 3MJ9L 4J3VA 1S9WA 5AYQA 2B1AH 4NO0A 5A2IH 3HRZA 7CGTA 1KCSL 5F9AC 3RGVA 4AIOA 3U1SH 3ECBB 2I9LA 3QEGL 2YPLE 1WIOA 1BP3B 4OIIH 5HHVL 4NGHH 3T1WA 1I3RA 2A6IA 5LCVL 4ZUSA 3VXMD 4PR5B 4ZTPL 3DGCR 3H2WA 3MXWH 4BZ2L 4ISVB 1KC5H 1BWWA 5K9KB 2CIKA 5GQBA 4ODUB 5FM4A 3O9WA 5FO8A 2NZ9D 2QSCH 4O9HH 8CGTA 1NSNH 2HLAB 2HT4D 2XFXA 1JGEB 1A1NA 1L0YA 4KVCL 2HFEB 2D03L 3MLTB 4X8JB 1FL5B 4G42A 3WN5C 4JM4H 4HUXB 2KPNA 5KW9L 4Z7QE 1A4KA 1KJ2H 4KMLB 4TSCH 1O7VA 1OVZA 1HDMB 5DHVA 4LRNL 4TVPL 5CMAB 3S37X 4UUJB 5H94B 4CMMA 2IPUG 4MQ7B 4HBQA 4JR9L 3U46A 4HXBH 3A67H 1NAMH 4JJHA 3SOBL 3LV3A 3QXUA 1KEGL 4F33B 1JI2A 1EO7A 3OKNA 1A6ZA 5HPMB 3P30H 1MLCB 2YEZB 4OCNC 4HUNB 4PJXA 1GHFH 4U6YA 4DW2H 5E6YA 1S7VB 4Y5VC 5J1TC 3L3IA 5F7YC 1BEYL 3FAXA 3WXVH 1U8JA 4N8PA 3E6FB 1F3JB 3QJFA 2X5PA 5IMLB 1BD2D 3INUH 2Q86B 3WHXB 4B5EA 2PF6A 5LBSH 3LY6A 1F8TL 4JCMA 3PIQA 3DXAD 1EERB 3REVA 3DVNA 2V2TA 3QNYB 3THML 1DQTA 1S9VA 4QRSA 5EU4A 2W9DH 3BPOB 1KJVA 1U8QB 4ETYA 5HHOA 2XRAH 3QUMB 2OYPA 3QQ4B 25C8H 1HSBB 1DBMH 5L2KB 1A6WL 1H8SA 5JW3H 3JWDC 1SJVA 3V8OA 1HWHB 2DKSA 5TFSL 4GRLA 5AAWA 1TMCB 4LARL 4LPYA 3B5TA 5ITBH 4KWUA 4OD3L 2GT9B 3H7BA 4ZUWB 5HI4D 2W9EH 5I18L 3O81A 1IMHC 2XZAH 1T04A 4FQXD 4J4PC 5CZXD 4ZXBB 2EDJA 1YJDL 3MO1B 1D9KA 2XWTA 4JKWA 3FT2A 2XG4A 4M02A 2J5LC 1ZA3A 4UV7L 4JPKL 3P4MA 5J3HD 4N0UB 3VRJA 3E3QE 5E4IA 3QDHA 2MCPH 1GC1L 3PP3K 4L9LA 3DRQA 3HHRB 3MRDA 3HNSL 3UROR 5ISZB 3T0AA 2X70B 2EO1A 1IFHH 3MFFB 4XWOD 5IEHA 3OKLA 2VR5A 4Z0XA 3CC5B 2VDPH 3VDAA 1QHPA 3IAQA 4HK3N 2VMFA 5IIEA 1XGTA 2EE2A 3NGBC 1NANI 2Y23A 1MEXL 1JPTH 1YNLH 4TUJB 4PUBL 4QHNA 3BPOC 2NY6D 4OKVB 1CG9A 1IJ9A 2IAMA 4ZUTB 1TFHA 3X11B 5CD5D 4L3EB 4FABL 4XMPH 4PGBB 1BQUA 2ADGB 5FGSA 5IKCB 4P4KA 4QOKA 5TF1L 1RZGA 3REWA 4NDMB 1U8KB 4M93B 3BP7A 4OIAA 1YQVL 3V4PL 5EOCJ 3B4NA 1PY4A 5M95B 2VZUA 1BZQK 3RWFA 4YH6A 3U2SB 1H3PH 1HI6B 3RL1A 1IC5L 5DJCB 1I1FB 5HYSG 4M7KL 3P4NB 2YPVH 4U1HB 1WIPA 4JRXB 1J9CT 4J1UB 1YPZB 4I5BA 4RA3A 3JBG7 4YFLF 3Q5YA 5F6HJ 5HY9B 5EZIH 1KTRL 1N0LA 3FB7B 4F9PA 3RY6C 5ANME 3QHZH 4XAWL 4P2OA 1HHHB 3BZEA 4PY7A 3SKOA 5D7JA 3K0WA 4L29A 1NBZB 4P59H 1KTKE 1MCOL 1SYVB 3DXAB 1R3KA 4GAGH 2JJTC 2Y4SA 2EDFA 1NMBL 4LQFL 3OL2A 3SKMA 4AT6A 2MHAA 5BW7A 1D6EB 3VE0B 3TPKA 5I66A 1JRHL 1CGVA 3FO2B 3B43A 4ZFOB 2NXYB 1I7TB 1CXEA 2J88L 2V17H 4QKXB 2DKMA 5F1IB 5HYJB 1IAKA 4B41A 4UAOB 1I7ZB 2OMBA 1UM4L 2YSSA 1P5UA 3HUJB 1A9BA 3QWOA 1S5HB 1N5AB 1VB9A 4ZTPH 3UZEA 3MV9D 3BKCH 1RJLB 1D5BB 4DGYL 5I1AA 1E28B 4Z76B 1PKQE 4OIIL 3MACL 8FABA 1N2RA 1LK3H 2AJ3A 3C5ZB 4POZD 2ZUQC 3ZZ1A 1T1WB 1HH9B 1PY9A 2JCCA 3S37L 3UTQA 4HSQA 3GMRA 3H9SA 3CLFH 5CP7A 4LGPB 4DUWA 5JDJA 2P42B 3TIDB 5EZJB 3WIIL 4K3DL 3L7EA 5D7IA 3UZQA 4P2QB 2IANE 4YEEA 4A6YH 3TO4B 2OTPA 3BH8A 4LARH 2BSTA 1U8PB 4I4WA 4JDVB 4YHLL 1MIEH 1XF2B 3I6GB 1U58A 5LVEA 1RFDL 4WGWB 1JGDA 2XRAL 4N0RA 4TYUA 5EIIB 1V7ML 3K2MC 4DZBA 1XR9B 3LRHA 5C0BE 4OZFG 5ICZA 5AYUL 3VXSB 3SDAB 1ADQH 4NM4H 3BEWB 4U0QB 1QSVA 1F8TH 4YFLI 5BXFA 5DWUL 2FECI 4L4JA 1FO0L 4CADB 3H8NA 3NN8B 1CIUA 3BIKA 3MRJA 3MOBL 4YR6A 5SX5K 3IF1B 1NCBH 3IFPA 5FHAL 1W0VA 5IVXE 4PY8J 3KG5A 4POZC 4JQIL 4FS0A 4JHAL 3BSZH 1M7DB 1IEBB 4U1IA 3NFSH 3RL2A 4P46A 1GHFL 2H8PB 1A21A 1CLOL 1QTYT 2P5ED 3RWHB 2BFVH 3RWIB 3TN0D 3SKUD 3UTSD 1WFOA 4DKAA 1KCLA 4YDIL 5CILH 2JELH 3CVIL 4K8RH 1X5LA 4P4RB 1I1AD 4ZO7A 1T21B 3V8CA 4MNQD 1TPXC 2ED9A 1DL7L 3O2DH 4HD9A 4XBEH 1KN2L 5HDOA 2ERJC 4HDIB 3KPQA 2DICA 1I7UB 4O02H 2D7TH 4JHZA 1T83C 1Y18B 4X7DC 4LOUD 1U3JA 2J4WL 4QRQA 4O9HL 5FECB 2J4WH 3HG1A 2C3HA 3NCEB 3Q1SL 3UYOD 1T22A 4J6RL 1XF3B 3DV6B 4XMKH 2OLDA 1BFTA 4X6CE 3KDMA 1QR1A 3DVIA 1LO5B 3U4BL 1JVKA 2KQNA 1A14H 2FD6H 3RBSA 4F7EA 3LKNB 3FB5B 1MWAB 1A47A 1EZVX 3KJ6H 5LKNA 4WFGD 1JWMB 2R39A 4JN2B 2XZQH 4HJGB 4U7MA 5IHUL 1N6QL 5CILL 5ID1B 1N0XL 4MJ5B 3ULVD 3CUPA 3DO3A 2UZIH 3MNVA 1AD0A 1CFTA 5TPWL 1BX2B 3KPPA 4G6ML 1NAKH 3CFJA 1M1SA 4K3JL 2BVPB 4FQQA 4KUCD 2J3SA 3FOLA 4RGMB 3HNVL 4JHAH 3QEHB 3U0WH 3IDYB 1AGEA 2R23B 2B7DT 3ME0A 3IDUA 2GSGA 3HI5H 3SDXB 3H0TB 3C8HA 2PN5A 4PRIA 4Y8DC 2NW3B 1ODAA 5KVEH 2A6KB 1H8NA 1GPOH 4M9PA 3FN0L 4FQLH 5DQDH 4KMTL 1JWUA 1GZPB 3S5LA 2N56A 4EDWL 4ZS7L 4AEIH 3BGFB 1OB1A 1RZFH 1QQDA 1VEOA 3CMOH 4OI8A 4QRPB 4FG6D 3CFEB 5GXBB 3I3BA 5BQ7A 2OSLB 5D71L 2F54B 4PTUA 2VDQH 5D2NE 3D5OF 4ERSL 1EH9A 2BNQB 4P2QA 1EDQA 1L9NA 3CFJB 3PDOB 5ALCL 1C12B 3WIIH 3G9AB 4M6NL 1PLGH 1KXQE 5T1LA 1FG9C 4N90E 3S37H 3QEUA 2VSCA 1MFEL 1TNNA 3UYRH 3CLFL 3V4VL 5ALCH 4NQDD 4R4FL 1F4YL 3D39A 3TYFB 3V0WL 3MRIA 5IESL 1D5BA 3TZVA 3EDJA 1RJZB 3CSPA 3S88H 5T5FH 2E7BA 3FQWB 4CADA 4AEIL 3JTTB 3P73A 3QDJB 5E8OA 3EYOB 3Q6GL 4N5UA 3FO9A 2Z92B 2YK1H 3S4SA 3C9NB 5GGUB 5KBNC 4YDVB 2HTLD 2J88H 4PJ5E 3DO7A 3AB0C 3DLQR 3HG1B 5MEQB 4NHCH 4AYFA 4GAYA 4YDLC 4HT1H 4EUPB 5CJBA 1J5OL 5T3XH 3BIBX 2NY2C 3DURA 2DLGA 4NN5C 5IB5B 5FK9A 4L4VA 2W0FA 3CXHK 4GRWE 1NAMA 1UVQA 1NANH 4YHYB 1U58B 3I6GA 4U1KB 4OQTL 2DQFA 3LCYA 4GG6F 4Z7VA 4P23C 1I1CA 1KPVB 5ACLA 2APWA 5D7JB 4F7CA 1UJ3C 3MV8B 5D96C 4J3XA 3FB7A 4WFFE 2A6DB 5ETUA 4AY0A 4M48H 2BJMH 5CUSL 3MJ8B 1KGCD 3HFML 2X4UA 1CDHA 4OF0A 3ARDB 1INEL 4BQ8A 1FNSL 5CD3A 3DI3B 4BUHA 4HWBL 3WHE0 2B4CL 3MJ6A 4ZPVB 5C0JB 3IDXH 5JIKA 4O00A 4LF3B 3HE6A 4RGNB 5HI3D 3WUWG 2V5RA 3IDIA 5EFIB 5FA3B 1DUZB 2EH8H 5E7FA 3RVVC 3Q1SH 4V1DA 5GS2H 4Q97A 4OAWB 2VLLA 5L88H 2AXFA 2WP3T 2H6PA 3O11A 1DVFC 1LQSR 1UENA 2C7UA 1EJOH 1IM3B 1MCQA 3ROOA 1EMTH 2AS5M 3QZWA 2BOBA 4GLRI 4X0KB 3RKDD 3V7MA 2AJUH 5CFHA 4TN9A 4PRAA 4Y88A 2OR9H 3RVUC 3OHXB 4WWKA 5IIEB 5EZLB 1P6FA 3MRPB 4EIZC 4I18C 3V6OE 2VLMD 2C3VB 3BKYL 3KNBB 2OJZH 3TNNB 1X5GA 3KPLA 4JFXA 2OQJA 1QLRB 3S96A 4OCXL 5BRZB 3QUXA 2DL9A 2GSGB 2VXUH 1NCCH 1C16B 3PJSA 3RVWD 4HIXH 5H35B 3QNXB 2Q20A 3HPJB 1J87A 3HZVB 3QDAA 3JWDH 1KJMB 5F70A 1QOKA 1FFOB 3VXMA 1IAIH 3C5ZC 1GYAA 1AD0B 3MNVB 5CIPH 1I3UA 3OBAA 5CEXA 2V5SA 4NRZB 2FIRT 1CDJA 4NQDA 1PZ5B 1X5HA 3D18B 1HHKA 3SQOL 4KI1A 4YBQD 3W9EA 5JW3L 1A6WH 3RNKB 1OAKH 5C0IA 4IHOB 5C0AD 5KAQF 3U36B 2BP3A 1M7IA 3RAJL 1DQJA 3AGVA 2D4DA 4JHBA 5IFAH 2B1HH 4CJ0A 5DMYA 4M6AA 3BE1L 1NCTA 1A5FL 4RGNE 2IPTH 4FQJL 1F2XK 3DXAA 1K6QL 2ZPKH 2H26B 1YEEL 1YEJL 3RNQB 3WHXA 3ALXA 4K3DH 1T7XA 3KPQB 4U0RC 3BHBA 2FYYB 4ZPTA 2QL1A 5DVNA 4OCRL 4Z78B 3JZ7A 1Q72L 1EEQA 1HQ4A 1AJ7L 3PNWB 4JQXA 5BZDB 3C5ZD 4JREB 2V7NB 2ZUQB 1BEYH 3VFOA 3GSRB 1MRFH 1G6RH 3WUWA 5DEFA 4RAUA 4IOIA 1DBBL 4ZSOB 3CPLB 3VFNB 4F33A 4MAYB 3C6SB 4LLMB 2DLHA 3GRWL 3V0VB 3PWLA 5T3ZL 3S96B 3HZYB 1LP9B 2VDMH 1R3HB 4OLXL 3UBXB 2EEAA 3QUYC 5E2TH 4L8SC 4BZYA 3HUJE 3QULA 4PGBA 3EOBB 2BDNL 3LKRA 4Y5YC 4HMEA 4WFFD 3VA6A 4JRWA 5DI8A 2F5BH 3EO1B 2EDTA 5CWSA 1A6UL 3SDXF 4NKIH 3FO1B 4PJXF 2O5YH 3VGAB 1Z2KA 3C8KB 1GOHA 2Y5TB 4HIIB 4NRXA 2FIKA 3ROOB 2ERJB 3ZMRA 1INDH 1DQLH 5I9QB 3GB7A 1J7VR 5E2UH 3HG1D 2AK4A 4KY1L 1ZHKB 4X6BA 4HK3J 2JJUA 1XCTB 2H41A 2UV3A 3OKOB 5EU6A 2X44D 5LCVH 2R0LH 4GKSA 1I85C 3O8XA 2YN5A 1VADB 3MA9L 3P4MB 1T1ZB 1MLCA 3MRQA 3DHJA 3VXUA 5FAAA 4A6YA 4YHOL 3C5JB 5GPRA 1YY9C 1IEHA 1KCSH 2HN7A 1G9NC 1FLRH 3QG7H 4ORGA 3EFDH 1W0YT 1MJ7H 4ZFFA 3P9MA 3IFNL 1HOCB 1J10A 3P9LB 2HVJB 1P9MA 3U4EB 4L8CB 3ZYIA 1FQ9C 2VXSL 3CFBA 5DD1H 3BPNB 4V1DE 1II4E 1BAFH 4X6EB 4WJ5A 4UDTB 4X9HA 1YNLL 1QSFA 4QGTA 1FV1B 2J8OA 4OB5H 1U3YA 2CLZA 3T2NH 2Q8BL 2X4QA 3G5ZA 4PV8A 4QYOB 1NL0H 3L6FB 4JFQA 4MSWA 3KYKL 5I9QC 4KMTH 1VGEH 3SGKA 2HRPL 3FN0H 4FQLL 4ISVA 4EI5B 4QXWA 3HA0A 2WW8A 1QKZH 4U1MB 4MNGE 2EIZA 3DX6A 4KI5D 5E8OB 4RFOL 1MI5D 4L5FH 3S5LG 4Q6IC 2JCCF 4HH9B 1NFDF 5D7LA 1PX3A 3I85A 1JHTB 3RU8L 3BN9C 3WDIA 4NN7C 1F45A 5F9JA 5HHPB 5FO9B 4PRPE 2VLRB 1F3DH 4KFZC 1U8NB 1YEDB 2VXUL 4H8WC 5IBLD 3E0GA 2RFXA 3SGEH 3GHEL 2ARJQ 5F1SA 4NQUA 1IBGL 1BBJA 1SBSL 3CDFA 2ORBL 4KI5F 1MIMH 4MA8H 2F74B 4MD4B 5JO5A 5JOFA 3IDJB 3D3VE 4PJHA 4UT7L 4LCIL 1MCCA 3O8XC 3WEXB 3JUZA 4NQED 4N9OB 4XPGL 3FB8B 1Q0XH 2V2XB 2EZ0C 3QEQB 3GM0A 4GKZA 4G42B 3ARFA 2X4TB 4NWUH 3ZDYE 2VAJA 4W81A 3D39E 3T0EB 5HYJD 3NIFE 5FF6A 1RD6A 1YY8A 3R0MA 3KPTA 2Y36H 4QHMA 4XNUL 3WDJA 3MJGX 3FAWA 1GSMA 2VZSA 4NN6C 2XKNA 3L3JB 1EO8H 2R4SL 3WJJA 4BH7B 3OB0K 1DSFH 3C8DA 1DSFL 2V7HB 3GSNA 3WXWL 4NKOB 1FNHA 5EU5B 2BVOA 2YKLL 2ZCHH 3AUVA 3QCVL 5FYJD 1BVKA 3HKFA 2L7UA 5HHNA 1YUHA 4NHUA 2I9LB 1OWWA 4M7LL 5TQ2H 3ZSSA 3FFDB 1MHPL 3MNWB 1BBDH 4K55A 1T7YA 3U0PB 5L7XH 1C08B 4P2OD 5CUSH 3UTSB 2DI8A 1XGQB 3MLZL 1PG7X 4B50A 5FYLE 2P5EB 3MROB 3HI6H 3O3BB 4F15C 2VLKD 1RJYA 1LEKB 2IH1B 2VE6B 4PP1C 5C9JB 1AO7D 4C57C 2Z35B 2EDLA 4KRPD 1XCQA 2R2EB 3MRCB 1QPXA 3HC3H 1R3IL 3S36X 3BUYA 5ILTH 3LKQA 4KVCH 4Y4KC 4NZUL 3PL6B 1XF4A 5GGTL 3UJJL 2ZUSA 5E8PA 3DUUA 3BDXA 4NHCL 4LPWA 3CD4A 5DWUH 4X80H 2IQAA 3V6FA 4FQCH 5JHDD 2NXZC 4LNVA 1EX0A 2Z93B 4NM4L 3QUKB 2OMNA 2PYEA 4V2BA 5T5FL 5E00A 1Z9SA 3T0DA 3B6SA 1WITA 4NQEE 1S7WB 3DX9B 3HMWL 4WWKD 3AAZB 1ZLSH 2LQRA 2VLKA 4D9QE 3QXDA 2HJFB 4E41A 5GGVY 5DZNA 4HPOH 1MFEH 3DGGA 3ULUH 3FL7A 3QRGL 2DQIH 3HR5A 5JORB 3VFMB 5IVZB 4NFBA 4CMHB 1OP3H 5FYJU 1S8DB 2CRMA 4M6NH 4UV4H 1UA6L 2JJSC 4G9FE 3F58H 5HSFA 3QIBB 1JHTA 4R90H 5DLML 3FCTA 4MLIA 1F4WH 4KRLB 4HS3A 3A0OA 4DTGH 3OZ9L 4GFTB 4HIHB 5AD0A 1OGTA 1I85A 4NZJA 3PWPD 5HGAA 4L4TD 5GGRB 2ZUXA 1QSEE 5INCB 1WFUA 5EWIL 1KFAH 3IETA 5J56B 1MY5A 3O4OC 3BIAX 5F3BA 3F12A 4YDKH 1KTLA 3D6GA 2V17L 4GRMA 2VQTA 4GKNA 3MRKB 3UXFA 3TBWB 5FV1L 1ZLVK 4BFIA 4LPXA 3MA9H 3KGRA 1OM3L 3SPVA 5HVHB 4OD1H 5DUML 1DUYA 2ZUTA 5JDSB 5HJ3B 1CF8L 5KAQG 3SDCB 5EPMA 3QO1A 1HXYB 4O51A 4TSBL 2GEEA 4JANA 1F4XL 1QBLL 1QP1A 3RGHA 3SGEI 1ZS8B 3G04B 4ZUVA 3VXQB 1P84J 5CGMA 5HGBA 1UZ8B 1U2CA 4YHZH 3D1MC 1CK0L 1MPAL 3P40A 5E2UL 4H1LA 4YXKH 2UYLA 1PQZB 2QQLH 2D9QB 1I3VA 3QUZA 2HFGH 1A0QH 2DKUA 1R5WB 1I8MA 4KROD 1NKOA 4PG2C 1I8IB 2MPAH 4MNQB 5C0RL 5ADOH 2P1YA 1I8MB 4LLQB 4ZFZA 3LS4L 4G7YH 1E28A 4G3YH 4Z76A 2XWBA 4R7DB 1BIIA 3BOVA 3GO1H 4D9QD 3QEQE 4XP4H 4UDUB 1R0AL 5E1HB 5FKAB 3DETC 2C1OA 4RMUA 2FH6A 2I24N 5EC2B 3JV5A 4PV9A 3W0WD 1VEMA 3T65B 4BFIB 2IPKA 3ZKMC 3S9DB 4AM0A 2AEIT 1DLHB 1YECH 1OAYH 4BSWA 4CKVX 1LK2B 3CSGA 3STLA 1QO3B 3UTSE 1A6TA 5CGTA 5ANMA 5F3BB 3LSOB 4L4TE 4PJHE 2LTQC 4ODTH 3D2UA 4UQ2A 3CK0H 3LB6C 3PWLB 4XC1H 5E56A 1NC2A 4FQIH 3JWOC 5E8PB 1PYWB 3RVXD 1G84A 1MCNA 3L3GA 1YEEH 2R0ZH 2X42A 1OF2B 3UX9B 4KKBD 4FQXC 4PJGE 2KUTA 3EW3B 2VJXA 2DYPD 2E9JA 3U7WH 4ENED 3TJEL 2DBJA 2P5WE 1XR8A 4PRPA 5IB4A 1U93B 4GBXD 2FL5B 5C07B 1RJYB 4TVPE 1BQSA 5IFAL 1WTGT 3O3BA 2HFTA 1HI6A 1GL4B 1VGKA 5D7LE 5DJYB 2APVA 5MI0C 1OAKL 3DGGB 1N8ZA 1T0MB 1KYOJ 2ZUVA 3BKMH 5E2VH 4NO3B 4P4KC 5L8LB 4RWYL 5H37H 4ZG1A 2VLKB 4DKFH 4UILL 3VH8A 2VIRB 1YEJH 2IAMC 1A7NL 5F96L 3B6SB 1FZMB 1PG7L 4XZUA 1S7RB 1S7SB 2HJLA 5DTFA 4LSTL 2VRAA 4O2FA 1A6VL 4GQPH 4BQCA 2WINA 3N50A 2R69L 1JF5A 1PKOA 1T0NA 3KWWA 3WDHA 4Y4FD 4DQOL 3R0NA 4HWZB 3AC0A 2QHLA 5D5MA 4R0LA 4KZEL 1NDMB 1WF5A 2EH7L 3OG4B 3QEQD 5C6TH 2HP4A 1DLFL 1E4WH 1ZGLM 2GSIB 4H25A 3PWPE 4XH2B 2P24B 3VFSA 3TCLA 3GMMA 3AY4C 4ODTL 2B5IC 4YC2B 3CH8A 4TVSa 5F7EL 4JZNA 1JV5A 5IBTL 5EUOF 1H9VA 1KBGL 4GBXC 3FMGH 4WO4C 3SHSA 5IQ7H 1ZTXL 2C3GA 2WQ8A 1JMXA 5GIRB 3G08B 2XWTB 1YYLL 5E9DD 1CGSL 1G7QB 4W6XB 4XH2A 1B4JH 5C08E 4M5ZL 2QKIA 2GK2A 3SGJA 4PJIE 2ZSVA 3TH2T 4Z7VF 1G7IB 5KSUB 4KHTH 3B5HA 3DX8B 1EGJH 4FQIL 1BM3H 1SEBA 5DJZB 3K46A 2Y7QB 5KSAD 4RFNC 1YN6A 1J0YA 3ARQA 4HPYH 4W68A 4LGSB 1I4FA 4X4XB 4OCSH 2AQ3A 1ZXQA 1MQKL 4Y4FC 1U8IB 4X9IA 1U3HA 5EC1B 4XCEB 5C0RH 3DTXB 3FO0L 5EZOL 4H26A 2BSRB 4EI5A 5C0AA 1CQKA 4XI5C 3UBXI 1DJSA 2E8YA 5D7LD 2XZZA 3RIAK 4O58L 4YGVA 1P69B 4Y4HB 3X12B 1FH5H 2EEDA 3LKSA 2Q86A 5DURB 4CVXB 3WE6B 3L3DA 4UDUA 2GW5A 4EN3B 2P8PB 1J18A 4NN6B 4EI5D 4R7DA 4ONHB 2VDNL 3PHOB 2FL5A 1T66C 3KXFD 5IJVB 3JXAA 4NPYB 1V7NL 3GSWA 1AHWB 5CEZL 5IFHH 3IU4L 2RIKA 1PEWA 4QRRD 1E4KC 3L3GB 3RPIA 4FQXA 3SCMD 3RIFK 1K85A 5KSVB 5C0CB 4HK0B 4APQB 5IJKC 3TT1H 1E6OL 5BJTA 1T6WA 4PRNB 5GRVK 5H94A 1CF8H 2APBA 2VXTH 4W4OC 3G5YB 3TT3H 5MENE 2YZ8A 3W5NA 3O8XB 3KHOA 5J7CC 2IJ0C 4P23A 2DQTH 5E03A 1MJJB 4MA1C 5DJXB 4NYLA 2EIZB 3EHBD 3LH2L 4YHKL 4XI5D 1N6UA 5L2KE 5ENWB 1A1OB 2VDPL 4P5TD 4U31A 5GRZA 3GJFA 3HC4H 1LEGA 3EYOA 4JVWA 1DBKH 3MCLL 2Y9RT 4YWGH 1LEGB 3O6ML 2MMXA 4TVPD 1D6VH 3FQWA 3MGAA 3TBVB 4OM1L 5EUOA 3PGFH 1S7UA 2W07A 4ODUA 3BW9B 4U6XA 3AM8C 5JNYB 1CGXA 3EDKA 3GMPA 2X4SA 4CGTA 4NYLB 2XQYK 1WTLA 5I73B 2R15A 4HIJB 1FVDA 2E7CA 3QT2A 4Y1AE 4ZTOL 2J8UE 2XACC 4P57B 4K94L 2MKLC 1FYTE 2CLVB 3P9MB 1BOGB 3BXNB 4Y5VA 3HZYA 4HQQL 4LSQH 5KVEL 4A6YB 2OI9C 1Q9KB 3QO1B 2A1WL 4CN4A 3ORJA 1I1AC 4EDXA 2I07A 4KZDL 3AAZA 2HG5A 5I8EB 2DQTL 5CEZE 1BQLH 4YXHL 1GZPA 3S5LB 5GJTH 5KG9A 5DJDB 3QUKA 2CLRB 3WBDA 2UZIL 4EDWH 3MGTB 2IQAB 1J8HE 3V6FB 4GMSH 4LOUC 4LSVH 3VFPA 2CKBA 3O2DA 5EG6C 5LGHH 1EHLL 4WVRA 3FT3B 4H26B 4ZNEA 4W4OA 2PXYA 2R1XB 5I15L 2NY0C 4PTTB 1AIFA 2YXMA 1M4KA 3T4YA 1SYSB 4I3GA 5T1DH 3RZCD 3VFWB 4JPIB 5GJSH 4K71C 3MR9A 1OCWL 1KB5H 5GS0H 2HMIC 4ZUUA 2EC9U 4E42A 3GK8L 2OL3A 4P99A 4GUPB 5JHLH 4GRWF 5BZWA 5GRUL 3WL9B 2X7LA 1KB5A 4MDJB 2X4RB 4CVZA 2XNAA 1FIEA 2DQCL 2ZOKA 3OMZA 4NFDA 5E94B 2X6MA 1G7HB 4RGNC 5MHSD 3NA9L 1Q9OB 2H26A 4PD4J 1Y0LB 3KNBA 1HK6A 3QWRA 2YD3A 3HZKB 1TENA 3AXLA 1AGFA 5ICXB 5HDQH 1QRND 3OKKA 5IVNA 3V5KB 3Q3GA 5JW4R 1Q0YL 5B4MC 3F62A 3PGCA 1BJ1H 2VE6A 1ITCA 5DK0B 5IQ7L 3DWTA 2NY0B 3FHAA 4KRMB 1NCBL 4JGUA 5F3HB 1LGVA 1EHLH 4HFWB 1RUQH 4LKCB 4YIQA 3W9DA 2C7UB 3IFLH 5F1NB 5DTFB 4I18B 3OKMB 2IMNA 4NWTH 3CFIC 4OAWA 2FJGB 1UKSA 4LSVL 4XP5H 3RBGA 4XBGB 3LRSB 1LNUB 3OWEA 2XQBH 4Y2DC 1EK3A 1IGFH 4I3RL 4U1JA 3IXTA 4N1HB 3VXNB 4K3EH 4DZ8A 5ESAB 1BQLL 1CS6A 5T3XD 1HSAA 1SVZA 2VDKH 3HPJA 2QBWA 4TSAL 3T8XB 3U7YL 1FYHB 2OL3L 3TESA 2PXYC 3ARGB 3GGWA 5ELIA