1XF4A

Structure of ligand-free fab dna-1 in space group p321 solved from crystals with perfect hemihedral twinning
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A01
5I8CA 4YHLL 1N59A 1Q9OA 1MVFA 4HUWA 4S2SA 5DD0L 2CXKA 3TPKA 3PWUA 1WFOA 2JCCA 5J11C 5ANMA 4ZAKD 2PW1B 5FM8A 3PDOB 5E2WL 1FSKC 1VACB 4OBRA 3NZ8B 3SCMD 2EDYA 4GW5B 4PRBB 1DQLH 2BVUA 2Q7NA 4XNZB 1IC7L 3BXNB 1VADA 3MOAL 1JYNA 4E42A 3D25B 2NY5C 2Z91A 1R5IA 3P4MB 3VFSA 1FBIH 2ZPKL 4PLKD 5DC4B 1BVLB 2VQUA 3OAUL 2GSGB 4W4OA 3ZTJH 4BZ1L 1X5LA 2FATL 2XIDA 1FC2D 2XQYG 4BSJA 5IMOA 4PTUB 2R69L 4O5LL 3GJFH 1CK0L 2NNAB 5C08A 5MI0C 1U8MA 4WTWA 2CR3A 5FCSH 4KDTA 3ULVC 5HYIA 4QHLA 1L7IH 1G9NL 4JG0H 4P46C 4ZD3L 2GKIA 3PP3H 4U7SA 2ICWB 3KLHC 1XEDA 5A3IC 1MI5B 1E6OL 1FC1A 4KI1A 4UV7H 4KPHL 1T2QL 4P9HL 1ZHLA 3W0WA 1A2YA 5IB2B 3M8OL 3C5SA 4YFLF 4YXHH 3BAEL 3L7EA 1QD0A 4JRYA 1BOYA 1QP1A 4NRXB 1EHXA 3QCVL 5JA8B 1AFVH 4XI5C 1D7FA 3UTPE 1RZGB 4FABH 1EH9A 4U6HA 1YNKH 4LASH 2DQHL 1U6AH 3MFFB 2EDJA 2ORBL 3WCYA 2X4RA 4YBHA 4N5ED 4PJBA 3QDJE 3RP1A 1IGML 3BE1H 1JHTB 2X1QA 2NW3B 4MHHI 2FIKB 1HKFA 5DMJB 1FHGA 1SMOA 4P5MB 5F7DB 1MUJB 1UA6H 4WU7B 1PZ5A 1YUHB 3H7BB 4YDLB 3VRJA 5CEXB 1BF8A 1OD7A 1TCRA 3PWLB 4N1EA 4XGZA 3CLFL 3CUPB 1IL1B 5D1QC 1OAYL 2K9UA 2H9GB 2Y6SC 3RY4A 3T1FA 2O61B 4PJFB 2LQRA 3M1BA 3TJHC 3G04A 1J0YA 5IBUB 1MFEL 1IJ9A 1F11A 1H3WM 4ESKA 3MBEB 2KKQA 4K7PX 4OLZL 2P8PB 4PJ8D 5T1KB 4NZUH 1E4XI 1IFHL 1H15A 3U79A 2X4OA 4I18B 3NBNA 2IQ9L 2A6KA 3TC9A 4TTGA 3G9VA 4Q9QL 4BFEA 2YZ1A 3OR7B 4N0UA 4HH9A 4D3CH 5FYKH 4ZS6D 3TIEA 3KXFD 5KSBB 2HWZH 3U4AA 2VLRD 1KJMB 1KBGH 3T0DA 5TGBB 4QHKI 3WNOA 3NPSC 5FKPB 5HDBE 4D9LH 2WIMA 4HWZA 1CXIA 1WBYA 3GSQA 3HI6H 4JFFE 4PJHE 4Z0BH 3NOIA 1HOCB 2NR6D 1KENL 4DUWA 4OIBA 5C8JA 3TZVB 5J9PB 1OLLA 3MRPB 4KWUA 3GBNL 2AK4E 4FZEL 3G08B 4DKAA 2IANA 1RU9L 1CF8H 3NIGF 1YEGH 3T0ED 4R4NC 3CH8A 1G6VK 2JB6B 1CGVA 5DWUL 3MA7A 1Z0MA 4LHQB 5FCUH 4KRMB 5SWZA 4K9EL 4L9LC 4IOIA 3MRCB 3BKMH 5EZLA 2GUOB 1JWMA 1S7VB 3QEQB 5TF0A 3RRQA 5KSAC 2QSVA 5CZVL 4X6DA 2LFGA 5J8OA 1BQHG 4X80H 4NKIL 2NW2A 3QXDB 3QDMB 4O02H 5JDJA 3TBTA 1WWWX 1WZMA 3E2HC 3QQ9C 3H0TA 3B5HA 3B8YA 5DJDB 2HKHL 3ARFD 2BFVL 2Y4SA 1AO7A 1XIWD 3GZKA 4JFDB 1EVTC 3I50L 2C4XA 3Q48A 4PGCB 5T3ZD 1EEUA 3SDDD 1BFSA 3OKMB 3HI1B 4OKVB 3W11D 4LKXA 3T04D 3TGXA 1KXTB 1QRNA 2HJKA 5KG9A 3QBTB 1A9BA 5IUSA 2VITB 3MRGB 5EU7C 5FGCB 3SKMB 3U7AA 3GMMA 3RWEA 1OLZA 4L8SC 5F7HA 4UT9H 1CE6A 3FO1A 5C09D 2W0FA 2VZ3A 2BSRA 4KGLA 3IGAA 5EUOB 1VFBA 3MLTB 4AQ1B 4K55A 4ODTL 2VIRB 1UH4A 1I75A 4R2GC 5CSGA 4NN7C 4KVNH 1M71B 4WUKL 2CLZB 4BFIB 5INDB 5JZ7C 4KI5D 2HLAB 5FO9A 5CILL 4YFDB 4ZPVB 1NCCL 3D39D 5EWIH 3SQOH 1U42A 4JO3L 1KJ2L 3DLQR 1YEKH 3CX2A 5EU3A 5E24E 1U8QA 1XF4B 2MJWA 4AENA 2NY4B 4DZBA 3UJTH 5LCVL 4WUUD 4AIOA 4GS7C 1N6VA 1X6NA 1MVUA 3J7HA 3QCTH 1FFPB 3VRIB 4YXLL 3S35X 4M7LT 2DTMH 3X11A 4ZAKC 5A2LH 5I2IB 2P44B 4NKDA 1KT2B 4Z77A 4NKMA 1QBLH 3O6KL 3MJ9L 3SCMC 4XAWL 3QYCA 4UQ3A 5MHSE 4WY7H 5GGRA 3FONA 4IJ3B 4PLKC 3MV9B 2ENSA 2NY6D 4KQ3L 5DEFA 1LEIB 4IRZL 2ZCKL 4HUVB 5K59F 2DMBA 2YHGA 4LFHD 3FFDB 3BISA 1A6VL 1NCAH 1QLRA 1NEZG 5K9JH 3MROB 3CSGA 5C07E 1YY8B 3HG1D 3WFHB 3P0GB 4O4YH 3MLVH 3T0AA 4I2XA 3CAFA 5H8DA 3ETBF 4Q74A 4XBEL 4PRPD 5EA0L 1S5HB 4LNRA 4R96A 1ZXQA 4MQXD 1ZGLM 1UWEH 5ALBL 2YD4A 1PLGH 2ESVA 2XQBH 1S9VA 2BCKB 4CVZA 1T83C 3QQ4A 1AE6H 2CIKA 4QRRB 3DUSA 4I4WB 2VL5A 2VLMD 5DQDH 3LVEA 5DHVH 4N5EC 3SPVA 2QKIA 3AXLB 1LDSA 5EOCL 5B8CC 1BFOB 3P0VL 4HFWB 2P49B 1A6ZB 1MCSA 2VN7A 3BX7C 4PG9B 1NANI 1LD9A 3CFJB 2P45B 5LGHL 3LD8B 1W0WA 3WNKA 1BD2E 1FJ1B 3PQYE 4JHAL 4N9GA 5HGDA 5C0FB 1L0XA 2IFFL 4K23L 1CLYH 1TETH 3ARDB 4X7SL 3QIBB 5DYOA 4GQPH 4XTRD 3HAEG 1SVZA 2WBKA 3QH3A 2DYPA 1JP5A 4RNRA 1E28B 4JO4H 3VXQA 1BIIA 3WV0A 4G6ML 3MCLL 4M7JH 3STBA 1A6UH 4PJ8C 1JPGB 5L0QC 3VXRD 1BF2A 3S37L 1QSEE 5ENWB 5MENB 3LOWA 3N1MC 1F4HA 5F9JB 2OR8A 5E0QA 4ZS6C 4ZO6A 4G6FD 4PJHB 5JQ6H 3MODH 3HS0B 4D0BA 3UTTB 2Z0BA 2A83A 3L5JA 1CT8A 4ZUSA 2FEEL 1PGRB 3GI8H 3T8XA 5I30L 4XCCL 5KAQF 1JF1B 4ZPTA 1NMBL 1X7QA 1MOEA 1E0OB 3D3VE 1XGYL 1JWUB 1A6PA 2NR6C 2UY6A 5HDLA 2Q3AA 5C70A 3MLWL 3SDXB 2FD6L 1I7UB 1MJUH 3E6HA 3I2CL 4PJ7F 4ZO9A 5JW5A 5FA4B 1L6XA 5T1MB 5C6PB 4UDUA 4MS8D 1VEMA 4PJAB 4XNXL 3OKEA 5HVHC 3T0EC 4WHTB 1LO2L 4XNUH 2ZOKA 1CDUA 2MHAB 5D4QA 4H0GA 5H94B 1EZVY 2VDKL 3Q6FB 4Z7NF 1O7VA 2ADIA 3GJFB 4JN2B 4OD3H 5E8DL 4H5SB 5E99H 2YPLD 3LZFL 4YK4C 4TUOA 1GAFH 4J2XA 4NQCE 5IB1A 5JOPE 1MRFL 1KLGA 2V2WA 2IFGA 3TT3H 5M94B 5FYJU 4R0LC 4OZIA 3MV8B 4QXGH 3I3DA 1I1AB 1YPZE 2DL2A 3R0MA 4PY8I 4GMSL 3ARFC 2I07B 4LSPL 1XIWC 1EEYA 4NOFA 2HJLA 3MV7A 4NP4L 4HIJA 3RL1B 2W0LA 3SDDC 5KOMC 12E8H 3RA7H 3QUXA 2NXZD 4PPTA 3WFDL 5BVJA 2LV4A 3C5JA 4UTBH 4M43L 4XX1G 4XAKE 1RHHA 1ZT1B 3AY4A 4LDEB 1MCEA 4JKWA 3FTGB 2VYRE 4JZJC 2YD9A 2E9IA 1OAKH 1TFHA 4BM7A 4JHWH 3U9UB 1YN7B 2EDHA 4YHMH 4GRLA 1S5IL 3F62A 2DMCA 1SMAA 3VXNA 4G6JH 3C09C 4S1QH 3WKML 4ZFOL 2QADB 1S7QB 2DD8L 4L4JA 5F1KC 1UWXK 3OHXA 5JHDE 4EI5D 4KI5C 4E9LA 4RFNC 2CJUL 5I8EB 4PGEB 5EBMA 5EU5A 1FYTB 5IW6A 1OAXL 1I9RH 1RMFL 4S1RH 3GSXA 3LIZL 1NGPH 4R4FL 1V7NL 4RFOH 3HNSH 1I7TB 4NYLB 3AAZB 4IEFB 3V5DA 3C5ZA 5GS2D 3SDCD 1QLEL 4PLJD 3WXVH 1FO0L 1YN6B 2DQIL 1JWSB 5F7EL 3T1WA 4XPAH 1RZ8B 3QG7L 4HKBA 4PG2A 5IMMB 1CD1B 3O2WL 3C87A 1AIFA 1NFKA 2IBGA 5TJWK 3TBVB 1FPTH 4ZUWA 2DI8A 4NO5B 1ZE3C 4Q97A 1UB6B 3U0TB 4NQEB 4CDHA 2VXUH 4J3XA 4G7VL 2VDPL 3O45B 4M1GH 2F15A 1U2HA 1MWAL 2VLLB 4ZFFB 5F3BB 3VJ6A 5DJ2A 5ADPH 4Z7VA 4QTIH 4YDIH 4K7PY 1BM3H 4OZGA 2NY6C 2E6QA 2PW1A 1JUFA 4HF5L 2CLVA 4NO2B 3LQMA 3KHOA 3RUGF 4XBGB 4DQOL 4XX1E 4WNQB 3VGAC 4G5ZH 2YSSB 2D7PA 4J6RH 4Q6YA 4XNMA 4PJIE 3GGWB 5JPMB 2EDEA 1IGTA 4RAVB 3DURB 4CAGA 1GOFA 3U0PB 2A9MH 2R2EB 5CKAA 3LEVL 2D31B 2OJEB 2BVOA 2IAMB 4GKSB 1Z9LA 5CZKA 2ADJA 3H42H 1NDMA 4DKEH 4MQXC 1T7ZA 1GRWA 4PTUA 4RMVA 4CN1A 2BVPA 4PJ9B 4P23A 2DLGA 1NBYA 5L88L 2J88H 2AJZA 1JL8A 3CVHA 3MYJA 2R29H 1U8IB 5J0BA 5ILTL 3WJJA 2AV1A 2HH0L 3QA3A 5C0ND 2VTFA 4NM4L 1J1OL 1X5HA 3EO9L 1BD2B 4WO4D 5EC1B 2OZ4L 3MO1A 1GIGH 2GI7A 4QYOA 2PXYD 4ZMAT 3HMXL 3MC0A 3MXVH 2BOBB 4KTEH 3SKUD 4H26A 3DO7A 1LGVA 1RZKH 5I17A 2HFFB 4NRXA 4Z78A 1RJYB 3RWCA 3V8CA 1Y18B 4GW1A 3W81A 4Y1AB 4HG4K 1BBJB 3RTQD 1MHCB 1RZFL 2I9LA 1U91A 1ZS8A 1Q1JH 3VD3A 3RIFK 4OCRH 1MHEB 4NNXB 4QRPA 5ICYB 4XTRC 1K4DA 2BNUB 3LS5H 4YHOH 1HSBA 3EHBD 3IAPA 3TBWA 2W59A 4DVRL 5EC2A 3GKZA 3QNXA 4WU7A 4IMLA 1N2RA 3GMPA 1BX2B 5F88A 3TVMA 1ZT7B 1MAML 4BKLB 5F1OB 4HIIA 2Q8BL 3ARGD 1T21B 4ODUB 5I15L 2P47B 3S34L 3BEVB 1NLDL 4PJEB 3CFBA 1NLBL 3PWVA 1DQQB 4JQVA 3RDTD 4H20H 1G0YR 5JW4R 8CGTA 1CR9L 2F54B 5JTWA 2OK0H 3BD4A 4XH2A 4FXKB 3H3PL 4U05A 2UZXB 3CH1A 4ELKB 3MJGX 5TF1H 4P4KD 4ZUTA 3MLZL 2WBJA 5IR1A 3D69A 1ADQL 3ZL4H 5IVXB 1EAPA 1RY7B 4G8IA 3FO0H 4TSAL 2R15A 4J8RA 1AR1D 3DX8B 4E41D 1OARL 3H9ZA 4JN1L 4L4VA 4MS8C 3NCFB 4JE4B 3ZZ1A 2B5IB 1IQDB 5I76B 4YUEL 1RHFA 5HHOE 5HYJA 2VQ1A 4FMKA 1M4KA 1ZHNA 4G7YL 4I3SL 3CFIC 3E6FA 4CW1A 5IFJB 3QUML 3SDAB 3KS0J 4MDIA 3VFRB 4OCWH 3PABA 3VWJA 3WS3A 4PJDE 3NA9L 2J2ZA 3ZDZE 3KPPB 2P24A 5DGRA 2CDFA 4OB5H 5KANI 4L1HA 3O2DA 5K9KA 5D6DC 1EERB 3RWDA 4FOMA 4WDIA 2UVEA 4UOW0 3IFPA 4HHAA 4QCIB 1FNSH 1J86A 1G6RA 4BZ2L 4ZFGL 3OX8A 3QEQA 4HJJL 2EICA 2NXZC 3D85A 4O00A 2FGZA 4Y2OA 3QWRA 3ARZA 1U92A 3MRBA 2I25N 4XP1H 3K4AA 5CP3A 4GUPA 1MIML 3GSNH 2NY7H 3V4VL 1OF2B 2H32H 4U2YA 3BN3B 5I1JH 2ZSVA 3SKOB 4RRPG 2H8PB 1BGXH 4R6UA 4M8QB 4EI5C 1F2XK 1FZJB 4WFHD 1P4IH 4YPGB 1QSFA 3SO3B 3EGSB 1B2WH 3BD3A 1U8LB 3KJ6L 3F7QA 1KULA 3L3OB 4IDJL 1MLBA 3STLA 3DX6A 2R56H 4P2QE 4XP4H 1OY3B 3SDCC 4LCUA 1IM9B 2JE8A 4PLJC 4HULB 1T03L 4BSWB 4FP8L 4UZGA 1LO4H 2YRLA 1R3LB 1OVZA 2L7UA 4M93B 4LGRB 5EFIB 5DHXB 2IH3A 3S3JA 3TN0A 5FB8B 1KN4H 1Y6NR 2X4UB 3WUWG 4OTXL 1QEWA 5DUML 1EEQA 3NCCB 1IVLA 2X9YA 1IAKA 3UO1L 2DN7A 4QGYA 1NL0H 4ZFZB 4IMKA 1P5VA 2YD5A 4HXAH 1T04B 1QR4A 3MNZA 4WW2B 1FGVH 3QIWD 2AXGB 1CFSA 1KELL 1I1YA 2C7UA 4PGBA 4IHOA 1D9KD 2DBJA 3EAKA 1CXKA 4XP9L 4X98A 2YR3A 1BAFL 1NSNH 5FECB 4EOWH 3B6SA 1VSCA 4HKZB 3T65B 5LG1A 1KLUB 2Z93A 3U30B 2BRRL 4EDWH 4QKXB 1P9MA 4PUBH 1TXKA 5KSUB 1YQVL 2JELH 1H0DB 4YDJA 1LO3L 2HLFD 2ZOLA 3HZYA 4QTHB 4JFXA 3ULVE 3HN3A 3WIFA 1U93B 4PIRF 5JDSB 3AREA 1XF3A 3HPJB 1L7TH 3ARBB 5E6ZA 3L9RA 5IJVB 2CRMA 1TJIL 3MROA 3GMOB 3IF1A 3VFUB 4EN3A 1CS6A 1NGZB 2DLIA 1UC6A 1U8KB 1EO8L 5C0NC 4V2CB 5CBAA 1ZEAH 4GBXA 4WO4C 4Y2DA 5CP7B 4OGYH 1OPGH 2PXYC 2ZWLT 2XZCH 2O5ZL 4Z7WE 3VH8A 1I3RA 1AY1L 5ESQA 1Y0LA 4ELMF 3HUJF 3QDJA 4M9PA 3C60D 3UYOD 1WVZA 1LK2A 2B4CL 2BCKA 3TIDB 4WFFE 3JSSA 4PYHA 4YNYA 5KVDL 4DGIL 3I3BA 5DTFA 3RTQC 2X70A 3NN8B 1F3JB 5HGHB 1JF6A 2X4TB 3QUYD 4Z7OF 4LPYA 4CADB 4JFZL 4FXGB 5FUOH 1UADC 3EHBC 4AMKL 3O3DA 4JPVH 5DK2B 2K7PA 1TQCB 4IRSA 4NGHL 2AKRB 4MAYD 2XYCA 4G8EB 4YHKH 5D2NB 4LSSL 2CUHA 2UZIL 5I1KH 3FQXB 5IK3A 3ARGC 3ARDA 3KAAA 3MTRA 1H3GA 1IKNA 1OSPH 3CSYB 5DGQA 1KTDA 1OAQL 1N6QL 1A7OL 3RDTC 4NT6A 5MEQB 1S9XB 4LHUB 4R4BB 5EO0A 5DMIL 2C3VB 2GTZA 1FZMA 4KKCD 4CMMA 3PHSA 1UH3A 2X41A 3RBGA 3WLBA 2B39A 4JFFA 4P4KC 4PJHA 4YHLH 2OMBA 5EPMB 4AY0A 3V0VA 4X4ZA 3D48R 4WI6A 2HVKB 2P5ED 5D70L 3REVA 5DD0H 5GPRA 5IEKB 1W0VB 5IWLA 5E8EB 3N85L 5C0AA 1XGUA 2AK4A 1GOGA 5E2WH 4H88L 1U58A 5DD5L 4GSDL 1L0QA 4D9QD 3G6DL 2BY2A 3DECA 2AAVA 1IC7H 3KHQA 3MOAH 2ED7A 3M17A 2ZPKH 2PTTA 8FABA 2EDFA 4GG6E 4S1DD 1YYML 3OAUH 1OTTD 5CHNB 4BZ1H 1Q9KB 2Z31D 2FATH 3MRRB 1J12A 2EC9U 3DGGB 2UWEE 2R69H 3NCEB 4O5LH 1KXVC 1CK0H 4JRXB 4X99A 2X4SA 2WINB 4I0KA 1FN4B 1G9NH 3PWNA 4ZD3H 5EZIL 5L6YL 3ELAT 5B39B 4NQDB 1E6OH 3LDBB 4PRID 4NO0D 1F4XL 4KPHH 2R1WB 1T2QH 4P9HH 2B2XL 3M8OH 5BJTA 4MB4A 2B0SL 3BAEH 4G8GE 5SX4H 1ONQA 4L3CA 1OD9A 4PGDB 3QCVH 4Q9BA 2OYPA 5ID1A 3F7YB 3MJ8B 3ZO0A 4GKZB 2ICWJ 5TPWL 4HAGA 4PR5B 5HYQB 1D5IL 2YPKB 5EU7E 3LKPB 2DQHH 3SE8L 5E2TL 2ORBH 3ZKSD 2DQFB 2D7MA 1OP5H 1IGMH 1A7PL 4F8TA 1V7ML 4HCRL 9CGTA 1C16A 4BUHA 5IJKA 3JTSB 5HGAB 2H3NA 4C55A 1XGRA 5AAMA 5I1DB 2Z4QA 3LEXA 1OAZL 3CLFH 5KN5B 3MREA 1KGCD 2EE6A 1R3KB 1OAYH 2PYFA 4P2OD 5BOZG 2RGSA 3VXUE 2EKSA 2Y7QA 2XTJB 4C59B 2JTDA 4F58L 1NGYB 5J11B 1MFEH 5FYJE 3HR5A 4LEOB 4UMGA 4LPVA 4OLZH 1MFCL 1IFHH 4G43B 4LBEA 1JTPA 2BSSA 2IQ9H 4PBWD 4X4YA 3O9WA 5AG8A 4Q9QH 5JMOC 3QIUA 1H3TA 4NHCL 4UILL 1I7TA 4YBLB 4BH7A 5JR1L 3IXAB 4MXQD 4HKXA 2OS7A 1BQHA 3LV3B 3HCVA 3MMEA 1JHKL 3CDGB 3GSWA 1CICA 5EZJB 4UIMA 5J13C 3DMMA 3QIWC 1UB6A 1DQTA 4LVOC 1RZKC 5MI0B 4MVBD 5F97E 1MCRA 2XN9B 4JFQB 1D9KC 1GJIA 2OQJA 1TJHL 4P46B 5TDNA 2H6PB 4C4KT 1KENH 3W5NA 3WHXB 4XCNB 4XRCB 4J4PD 4Z7UF 5C07A 1HH9A 3X3GL 5F7MC 3GBNH 2XV6B 4FZEH 3UC0L 1F5WA 2R23A 1RU9H 2HLFC 4NO2A 1Z5LA 3L3IB 4Z7QF 3WIHA 4Z7WB 4F9LA 5DWUH 3QDHA 1ZLWH 5JPMA 4K9EH 3HPLB 2YBRA 4MMXC 4TNVK 5CZVH 5DMGD 3VFOB 1OW0A 4LRIA 4NWTL 3DRTB 4NKIH 1HYSD 3P73B 3RIFF 4P2RD 1I8IB 2AJ3A 15C8L 5E1AB 5IB5B 3C60C 1UFUA 5JOFA 3MRMA 1AXIB 3FOLB 2HKHH 2BFVH 5GGSB 4ETQA 3I50H 1KCSL 1VKXB 3TA3D 2B1HL 1NBQA 2W60A 2YA2A 3PQYA 1I7ZB 3QUYC 2H32B 4X83A 1PQZA 4KXZI 2FJGA 3C6LD 3HB3D 4Y4FA 1R5VB 4KV5F 2Z35B 3TP4A 2Q7YA 4PJGB 4MAYC 3KPSD 5ALCL 4U0RC 5L2KD 3LCYA 4JPWL 1N0XL 2DJUA 2C1OA 3Q5YA 5DEGA 1QSEA 4ODTH 3VD7A 3BZ4B 1NJ9B 4CNIB 5HPOA 4WUKH 5KVEL 2YOCA 5CILH 4N90D 3NPSB 3BD5A 3VXMD 1NCCH 2JB5L 1NEZA 3MFGB 2IPKA 3G6JF 4OZ4B 1SJHB 5CUSL 4WWKD 2I9TB 3KXFE 3A6CL 4JO3H 1KJ2H 1XR9B 2VLRE 2VZUA 4KKCC 3SGKA 3E8UL 1QLFB 3F7VA 4MNQB 1Z9MA 4GO6B 2I26N 5L2JA 3CDYA 1TDQA 3D18B 3D3VA 3ZKQD 2PYED 5LCVH 4UNVA 4B41A 3ZKND 1DE4B 4YXLH 3NGBB 3VFWA 4HIHA 4B0MM 4IRJB 1KF9B 1E4JA 3F5WB 1U2CA 3CU1A 4NM8L 3T4AB 3UPRA 4QWWD 1EVUA 1G7JB 3HMWL 5I0DA 2X7LB 3V8OA 5GRZA 3O6KH 5KOVC 3MJ9H 4XAWH 2NX5B 4MJ5B 1EFQA 3RY5A 3JUYA 3T0EE 5BZWB 1I8LA 1X5JA 3DX8A 4XWGL 1LNUB 4S1DC 4U1GC 5F89A 3HZVB 2YD7A 5EDXA 4M5YL 1EV2E 5GISL 1OTTC 3BWUC 4G9DB 4KQ3H 3BH8A 1N7ML 4NQCA 2Z31C 4IRZH 3WL9A 3BP6A 1MNUL 3L6FA 2ZCKH 3S88H 1A6VH 4YGVA 3AMKA 1RAMA 1FAKT 3HAEA 2J8HA 1YPZA 3VFRA 3CZFB 3FQNB 1KIPA 2XWJA 1VGEL 2IPTL 5D2LE 2DM2A 2I60L 5ITFA 3UTSD 4XBEH 4Z7VF 5EA0H 3DO3A 1R5WA 4L8SB 5ADOL 3C6SB 1EXUA 2D4DA 4M7ZC 5ALBH 4HXBL 4YHIA 5DQ9A 1UWGL 1ITBB 1MJ7L 5T3ZE 4E5XB 1D3CA 2YD3A 1U0QA 4Q6IC 1A1MB 3STZB 3VXPB 1G7HA 5HHNB 3MRDB 2X10A 5JPNB 5GHWL 1Z3GL 3F58L 5A2IH 4LSVL 4MDJA 3VXUB 3MGOA 5C09E 3QI9D 5BCAA 5JHDA 3PGCA 5IW1B 5EOCH 2AK1L 4ZODA 3P0VH 3O6FD 3PV6B 1BJ1H 2V17L 1S7SA 5LGHH 4PJ5D 5AZEL 4KI5E 5E5UB 4P2OC 3GRWA 4JHAH 3D39E 3V4PL 2IFFH 3VFVA 2Z92B 4K23H 4X7SH 3ZHDA 1XF2A 2Y36L 2LVEA 3MZGB 4X8JA 1RZIB 4G6MH 2D0HA 5GRVL 3MCLH 5IEHB 1YC7A 4OM0L 2HA1A 2HJFA 2FHCA 4PJXA 1CTOA 3NACL 3HC0B 3S37H 2B1AL 4WUUE 1A1NB 3KLAA 1RUAL 4MXQC 4OCNC 2OTWA 1DEEB 1J8HB 1U8NB 5IB4A 3FB8B 2XWTB 1HXMA 3CPLB 4EUPH 5DEZA 1IEAB 4TRPL 5I30H 2YD8A 2IALA 4O2CB 3QXTA 4XCCH 1AI1L 3M07A 1I8KA 1DANT 1NMBH 1MH5A 3N50A 1U36A 4MVBC 4XCEB 3FQUA 5C6WH 3L95B 5F7KC 1XGYH 5T1DL 3BZEA 4K3EL 2VZVA 1ED3B 4HQQL 3EO1A 4PJIA 4J4PC 4BQ8A 3CXHK 3MLWH 3NA4A 4I5BA 5F9DC 5KS9F 3PXJA 2FD6H 3I2CH 3HC3L 2D7QA 4F7EB 4QNPF 3OG6B 4XNXH 3QEGL 5GSRB 1OWRM 1L4IA 5SWSD 1LO2H 1P53A 3HG1E 3RWGA 1MAJA 5ERWB 3NCMA 2VDRL 1QTYT 1S7RB 3ZT5A 5MEPA 2VDKH 4XPGL 7FABL 4FMFA 1EFXA 3LQAL 5DURD 4HKZA 3RWJB 5KSVB 1I3VA 2X1WL 4JZOA 4DGVL 5E8DH 3EOAA 4ZNCD 5I1EL 3OF6D 2R1YB 1JGLL 3LZFH 3PJSA 3DHJA 1DLHA 1BEYL 1TTFA 5SX5H 5DMGC 4LVNB 1CYGA 5B8CB 1UXSB 1MRFH 2ADGB 1P1ZB 1WIPA 3DYPA 5D7IF 3D1MC 5J1TC 4IIQA 2RCSL 1HYSC 3QEHA 4MD0A 1DBAL 2VLME 3ARBA 3TBSB 4IS6B 4YZFF 4GMSH 4LSPH 2GCYB 1NGZA 2QSQA 4NP4H 5E94A 1Q38A 2A6IA 3TA3C 4QEGA 2CDEB 2A9NL 1K4CB 3DJ9A 4N0YL 3U1SL 3WFDH 4OF6A 3VXTB 4MQSB 2APXA 4M43H 4XNQB 3QG6A 1U95B 3C6LC 4FHBD 1LEKA 3ULUL 2XOTA 3CFKB 1AGDA 3W82A 4DKFL 3MR9A 2VR4A 4YIQB 1T7VA 1AGBA 3PV7A 1ACYL 1ZAGA 1S5IH 1I8MB 4JHZA 2AGJL 4TQEL 1JGEB 3WKMH 4WEMB 3FB7A 5HGHA 4PFEA 5TH2A 2DD8H 4XT1C 3VXRE 2IQAB 3FO2B 4FXGA 1X5KA 1JMZA 5K9OA 2CJUH 2FSEB 5E7BA 4X0KB 4QRSB 2G5RA 1J87A 1NCDL 1OAXH 3O8XA 1NFIA 1RMFH 4WWKC 3QQ3B 1HYRC 1G7IA 3NCJL 3LIZH 1QACA 5D5MB 4R4FH 2AQ3A 1BHGA 1P2CB 3RNKB 1V7NH 2PF6A 3MNVA 2PTUA 3FQXA 4QXTB 1AQDA 1ZA6A 3BRDA 2DLFL 2O5YL 1QLEH 1G9NC 4A2LA 1FO0H 2DQIH 5F7EH 3K0WA 3QG7H 1JNHA 1E4WL 3O2WH 3ZKNC 5DFWH 1FLRL 3U4EB 1AHWA 1TMCB 3BT2L 5I1IL 5HHXL 4GG8A 2OXHA 4QWWC 4U1LB 1UEYA 5HY9A 1TCMA 2FZ3B 5HHOA 4OCYL 4G7VH 2J8UE 1MQ8A 2VDPH 3OKKB 1MWAH 4NN5C 4HC1A 4YK4B 2CUIA 4HWNA 4LPWA 4CBPA 4QOKD 1OTSD 5E6IB 4RIRA 2FBJL 4PJDA 3TO4B 1QFWI 5D2LB 1VERA 3NIGE 4HF5H 1A6TB 2J5LB 1QQDB 4DQOH 1D6EB 2YPLE 3NCYP 2DTSA 3TCXA 1IAOB 4YH6A 3SGJA 2IH1B 3S37X 2F19L 1JMXA 1FQ9C 3B9KD 2WLYA 3LEVH 1TVHA 4FQXD 4UDTA 1KIUA 4HWEL 4M7LL 4U3XA 1XMWA 3DNKA 5BS0A 3GBLA 4JZJB 3VXSB 1DBJL 4Y4KA 1EHLL 2PO6B 5KVGL 4OFYA 1VFOA 1T66D 1JV5A 1CFNB 1CFVL 1UVQB 3INUL 2XZAL 1KEGL 5L88H 1DUYA 1P7QA 4QHUA 1FNEB 5DLML 4HPOL 4MCYB 1T2XA 5ILTH 2HH0H 4PJCE 2VR9A 4NM4H 1J1OH 3BPLC 1LWRA 3IJSA 4G9FD 3EO9H 2OZ4H 2V6HA 1A8JH 1UKSA 3HMXH 3QI9C 2HKFL 3JV4B 1UJ3C 1J05A 3O6FC 3FB6A 4NNYA 5JQHC 4OLEA 3MJ8A 4N1CA 3TV3L 4M1CD 4ODBD 3QDGD 1FVDB 1RZFH 1WBXA 3BQUD 2G2RA 1ORSA 2DI9A 2HFGL 2EKJA 4M61B 4D0DA 2E7MA 4P2QA 1PAMA 1YMMD 4IDLA 4G80B 4KK5D 2DQDL 4ZS7L 4DVRH 4Q9RL 1FZOB 4NRZA 4IBLT 1MJJB 3G5XB 5KN5A 5H37H 3HNTL 1MAMH 1T4KA 4F15C 2Q8BH 4K9EC 1KJ2B 5I15H 2VE6A 4PRHB 3S34H 1NLDH 5E00A 2CRYA 5E70A 4M6AA 5I8KL 1N8ZB 1NLBH 5GZOD 5IOPB 3V9FA 1BQLL 4LEOA 1AKJD 1KYOJ 1MHHA 3VGGA 1CR9H 3EYOB 1JGVL 1CGYA 3X14B 3DIFB 3H3PH 5ITBL 3PGDB 3K80A 5SWQA 1A5FL 3ILPA 3IXAA 3HG1B 1CGXA 2XKNB 3MLZH 5DRZA 1AD0A 1ADQH 4KDVA 4XPTL 3OZ9L 2WIIA 2ZP0T 2N1KA 3H9SD 3EJYD 1K5NA 4TSAH 4JFOB 5EZJA 1IGJB 1WCQA 1HQRA 5DJXA 1OARH 2MKWA 4JM2B 5IB3B 4JN1H 2E27L 4YUEH 3RZCD 4FQQB 4I9WD 2R0LL 5K59E 1WC7B 3WDHA 1TQBC 4P5TD 4QXUL 4TNVF 2GIYA 5IF0B 4G7YH 4I3SH 4JJ5B 4P46A 4XPHL 4RMQA 3S5LG 4TVPL 3L3JB 3WHXA 3QUMH 4AL8L 2VLJD 4XCNA 4LLYB 3K1KC 3ALXA 4JFEA 4NBYB 5KAQG 1JYWA 1R24B 4OQTA 3NA9H 1RQ5A 5EUKB 2HT2D 1SYSA 1G1YA 5H35B 3L5WA 4Z7WA 4MJID 3O2DL 2C3GA 3BGAA 1EAJA 3MRHA 1IZKA 5F70A 3FHQA 3GHEL 4BZ2H 4ZFGH 4V1DB 1XGTB 2EIEA 4HJJH 2X4NB 1ZVYA 3MRFA 5GS1B 1SBBA 5BZDA 5I74B 3MRNB 5HPMA 1CD0A 5FM5O 2MWCA 3WUWA 1JHLL 4WV1C 4DEPC 5FM4A 3BGMB 2JKXA 4MJ6B 1FV1B 1CDIA 1QFWM 1HE7A 2APFA 2CXGA 1Q0XL 5D1QA 1TTGA 2NLJA 2DOCA 1MIMH 1WWBX 3V4VH 4B7LA 5F3HA 5J89A 1RJCA 3UZVB 1KC5L 2WUBL 4NQSB 1N64L 5FGSA 3WN5B 1A22B 3GIVA 2R4SL 3U9PL 1NUDA 4DK3A 5FM5M 4LDOB 3DX7B 3P77B 4JZNA 1P84J 2P42B 3I9GL 1NC4D 4FN0A 5CD5D 5I9QB 3KJ6H 3QO0B 1VPOL 4IDJH 4Y19D 5ISZD 2QLVB 2CDGB 3MX0A 1CFQB 5IBTL 1D5ZA 1T03H 5LVEA 1MJ8L 3FFCB 4FP8H 4X5WA 1OAUL 4GQ9L 1ZLSL 1PDKA 1BJMA 2E7CA 4YC2C 4Y4HB 5F7FA 1U8HB 4NN6B 5C0IB 5F21B 2OLDA 3MQIA 4OTXH 3VFMA 3LKRA 5DUMH 3O4OC 1HH6B 2C4FT 2OCFD 3UO1H 4E41E 1RZJL 3EO0A 3ARTA 4LHJB 1OP3K 3AGVA 2FJHA 4PJ7E 1DUZB 4M9OA 2MCG1 3BRFA 43C9A 1OTSC 5JW4M 4GG6A 5JIPA 1HHJA 2RAMA 4F7MB 1KELH 3PL6D 5BQ7A 3UMTA 3HE6B 2KZ1B 4L9LA 4X4XA 2E7HA 3LRSA 4NUJB 1TVBA 2UWEA 4Z7NE 4XP9H 4LCCC 1BAFH 1CG9A 2GTWB 4EEEA 3KYNA 5E1HB 1F6FB 3KPMB 3ZT7A 4A6YB 5KSAA 1CN4A 5ESAB 4HGWA 3B9KC 5BZWA 5CD3A 2BRRH 1FL5B 4J12A 1G9ML 5HGGS 2LU4A 5J6GB 1YQVH 1ETZB 1LO3H 2H45A 2JF1A 4OZFG 5DDHB 2BRQA 3O11B 3OKDB 4TULL 1T66C 3KNBB 4G8GA 2EYTB 2XA8L 1TJIH 3U4BL 4KUZL 3FQNA 2FJFB 1EO8H 3MRIB 3RL2B 3ARQA 3CXDL 3NH7L 1UM6L 3DHMA 1D5MB 5C9JA 2O5ZH 1VFAB 3IFNL 2AXHA 1AY1H 4HS6B 3O4LB 1O0VA 3OKNB 5F1IA 4AEFA 2B4CH 3MNWA 1WQVT 4M1CC 3STZA 5KVDH 4DGIH 1KTLA 5HHNA 4ALAL 3BQUC 1EO5A 4WFHE 4JDTL 4Y5XC 3RGVB 3JV6A 4CVXB 2VSCA 2HFTA 1SJEB 4JLRB 7CGTA 2EXWD 4JFZH 1FVCB 2X05A 2DF3A 2ZCLL 4ZFOB 4AMKH 4KK5C 1VHPA 3RX5A 5HHPB 1CXHA 4NGHH 2OR9L 4LLWA 1P69B 3BHBB 3I75A 2Z9TA 4LSSH 5D1ZB 4GRMA 2UZIH 4NO3A 2M2DA 1YDPA 5C0BD 3OAZH 1CDGA 4LCWE 4LVHC 5JNYA 3SGDI 3WEXA 4ZAKA 5GZOC 5FYKU 1OAQH 1N6QH 1A7OH 3GMNB 1FO0B 1KCLA 3HZMA 3RJQB 3SCMA 1ZT4A 3BDYL 5DMIH 1AGCB 3CSPA 5J1AB 2P7TA 3KPRB 3MRJB 3ET9F 4QT5A 1U8NA 2EYSA 5CWSB 4Y16D 2P5WB 4QRUB 4U1JB 4KY1L 5D70H 3CPLA 1HQ4A 3EJYC 2H26B 2DQCL 1INQB 2GFBA 3N85H 4Y5VB 4RDQF 3G5YA 2UUDH 3RZCC 3C8KA 3RUGE 2ZG1A 3VRLF 4H88H 5DD5H 4GSDH 4P5TC 5TE4L 1MCDA 3HE7D 3G6DH 4M00A 4NQVA 5DS8B 2EIBA 4ZUUB 5DSCA 4ZOAA 4LF3B 1LO0L 2WW8A 5CJBA 4GMTL 3FB5A 1QVOB 1YYMH 3REWA 3PWPD 2JIXD 5BMFL 1BOGB 1J9CT 1MCQA 5FV1L 2HT2C 1AXSB 2X4PB 1DCLA 1RJLA 1T83A 1N5AA 4Z18A 4X6EB 2DJ4A 3LHPL 4LMQE 3OB0K 5EZIH 2NY1B 5L6YH 4HZLB 5AD0B 3DXAD 3OR6B 3RJDA 5B8CA 1F4XH 5D6CA 2B2XH 3PHOB 2X44D 4PY7A 1RUML 4EVNB 4AIXA 4HUXA 2B0SH 3BW9B 3WNMA 1JNLL 2GJ6B 5C0CD 4P57A 4AJ0A 3L3HA 3MV11 1KPVA 2A73A 4WGWB 1JPFA 2GCYA 3MLYL 5TPWH 2Q8AL 5D7KE 4LQFL 2YPVL 5A2JH 1D5IH 5E08L 4MB3A 2BMKA 2DI7A 1T1ZB 4J3TA 1YPZF 4C57C 3ZKXB 1JK8A 4QHNA 4OUUA 5E2TH 1CFBA 3SE8H 3AB0C 4PJ8A 2P8LB 3S6CA 3TO2A 5CS7A 1A7PH 1CTNA 1UACL 1FDLL 1V7MH 3EOBB 4HCRH 3V5KA 5I6XC 2NY0D 4YJZL 2GAZA 1M05A 5GZND 4DOHB 5CD5C 1XGPB 4XP5L 3KXFA 1OAZH 1NC2D 4DTGL 5BV7L 1UXWA 4MCZB 2VLRA 3P0YL 4JJHA 1UA6L 2YWZA 4F58H 3PG2A 1C5DA 1LDPL 3A67L 1P7KA 3OKLB 2FSEA 4H1LG 2ATKB 4ZXBD 1MFCH 4X5LA 3QUZD 3P4LA 1NMAL 2ENYA 2EE9A 1XGQB 4NHCH 4UILH 3PNWB 4JAMB 3UPCA 3LY6A 5JR1H 3BEWA 4BA8A 1JGDA 2RIKA 2ILLA 1JHKH 3THML 3MPCA 3WFZA 2MQ0A 3T0EA 4D9QE 3LN4A 2PUQT 3L3KA 3QXVA 3PL6C 5D9SB 5I71C 5IKCB 4P48A 1Q9WB 1U3HB 4PJXF 1OSZB 3IDUA 5T1LD 3L3DB 1TJHH 3TH4T 2EZ0D 1LO5A 2FX8L 2YRPA 4F57L 2H2SD 2YEZB 3IXTB 4B50A 2QQLL 5C3TA 3X3GH 4W68A 2V7NA 3UC0H 4P5KA 2KZWA 1FFOB 3MV01 4R0LA 3V7MA 2HRLA 2GK0A 3SKNA 5E8OA 3ARFA 4N0RA 3DROB 1XIWA 5CIPB 1DLFL 5KANG 4N8PA 2FWOB 4WI7A 4HIEA 4I3RL 4PRIE 1B0RB 3OJMB 3SDDA 5EOTA 2X9WA 1OGTA 4MA1C 2F53D 4HJGB 3GSUB 1T20A 1C1EL 2C9AA 4JZJA 4KDWA 2EYRB 2IPUK 1ES0A 4NWTH 3R0NA 4KKAD 1C08B 5C09A 4X8XA 1UEMA 1SBSL 15C8H 2PN5A 1EPFA 2DIJA 4OLYL 4X6CE 3EDDA 4XNYL 5ID0B 3O3BA 2HMID 1KB5A 4L29A 3NFNA 1KCSH 3ZDXF 2B1HH 3IKKA 3NABL 2P8MA 3X12B 4APQD 1T0MA 3D39A 2EXWC 1NUFA 4OAWB 4WI3A 4X4MA 4LCWB 3V7AG 3NIDE 1KGCE 1MCCA 3LPWA 2F74B 3PHQA 5DRWA 3N1QC 5ALCH 4JPWH 3P9WB 4WUUA 5E9DD 5FOBA 2AJSL 3TWCL 3KPQB 1SYVA 4OZFB 4D8PB 1TLKA 5KVEH 4JFYA 1SM3L 3O6ML 2JB5H 2BNRB 4L4TD 1U8JB 5CGTA 5CUSH 3G5ZA 2AJXL 3A6CH 3BPCA 1C12A 3X3FL 3E8UH 1PKQA 1KLFA 1U3JA 1VDGA 3EZ8A 4Y16C 3G5VA 4LAQL 4UT6L 4Y5YC 1I9IL 4RQQB 3EYOA 5INCB 1QSZA 4LQ1A 1IM3B 4NM8H 3B8SA 1YEJL 1DFBL 2BC4B 3HMWH 5T33L 1UM4L 2HN7A 3HE7C 3HG1A 3BP4B 2PR4L 3I6KA 4PP2A 3MLRL 3P3YA 4N0UE 2XPGA 2Q87A 1S9YA 2F8OA 2R1XA 1KB9K 4U1IB 4PRPA 4XWGH 3VE0B 3DUUA 1KXQE 5HYSB 4M5YH 5GISH 1U8OB 2FR4B 1N7MH 1S7WA 5D7JD 5IIEA 1MNUH 4U49A 2GITA 2CUMA 3UTZB 5BRZD 1BWWA 4L3ED 3OXRA 3D2UD 3V7AE 2G9HA 2NTFA 5K93A 1F02I 1VGEH 1G7PA 5DJZB 3ZDYF 4P2RE 2IPTH 4AEIL 2R0WL 2DLHA 2I60H 2W9EL 4NBXB 4F33B 3SGEI 3TBYB 32C2B 5ADOH 4ELME 3HUJE 4Z95L 2IANE 4HXBH 5FA3B 1UWGH 1MJ7H 5DI8B 4U6TA 4CMHB 1JZ4A 3IT8D 2Y07L 5IVZB 1KIQA 1LEGB 1RUPL 5GHWH 1Z3GH 3F58H 5EIVA 4LSVH 4M8VA 3KPSE 5C0JB 1UG9A 3X13A 3VXRA 2AK1H 1FFQA 2NY0C 2V17H 5GZNC 2XY2A 2YUZA 3GMLA 1NFDE 3GMRA 5AZEH 5DXWA 4N90E 3V6ZA 5GGTL 3B3IB 4LRNL 3VXME 3V4PH 2ITDA 4NQSA 1QNZL 3KPOB 4KU1A 3FRUB 2Y36H 2VISB 4BFGA 3UJIL 3FQWB 4GRWF 1ZSDB 5HHMD 4U6XB 4OM0H 4ZXBC 4X9HA 4GH7B 4MX7A 1C5CL 1ZHKB 3NACH 1KCVL 2E8YA 2B1AH 3D0LB 2PYEE 3WD5L 1RUAH 4U33A 5MERB 2Q6WB 1TZIB 4MSWA 1OGAD 3BGFC 3HRZA 5HI3D 2J8UA 3EYFB 2CLRB 5DJ6B 3DTXB 4QGTA 4TRPH 3QISA 5JQ6L 1N59B 1Q9OB 1AI1H 3SE4C 5FDWA 3RU8L 3R8QA 1PY9A 2CD0A 4HUWB 4S2SB 1BLNA 5C9KA 3MGTA 3PWUB 2JCCB 4WWID 2ICCA 2B4CC 3R06A 3B2VL 5ANMB 2HG5A 4R7NA 3SJVD 4MA3A 5T1DH 2EZ0C 4K3EH 2YPLA 1JN6A 4HQQH 4NNPL 2H2SC 4MD5A 2Q3ZA 3UZEA 5TE6L 4DN4L 1REIA 3HC3H 3BSZL 3L5XL 3GJFK 1S3KL 3H3BC 3K1DA 2C3HA 3QZWG 5D6DA 3QEGH 4PB0L 1VADB 3ISWA 4E42B 1URLA 2Z91B 2WP3T 1R5IB 3VFSB 4KKNA 1RVFL 3PP3K 2VDRH 4CL7A 1HXYA 4XPGH 7FABH 5EIIA 3LQAH 3KPMA 2C3XA 4DGVH 5I1EH 5IMOB 1N4XL 3F6IA 2ICWI 3UTQA 2Z8RA 1ORQA 1JGLH 5C08B 1IGCL 4LGSB 5KTEL 1U8MB 1BEYH 1CDJA 1H3XA 4PJCA 4JO2L 3JZ7A 1K8DA 4KKAC 2BNQD 2GJZA 2RCSH 4TUKL 1DBAH 2PW2A 2X4QA 3KPTA 4X7CC 1ZHLB 1A2YB 3EUUA 3C5SB 1YNTA 3VFGL 3ULVF 2HMIC 2A2QT 3L7EB 5F6IB 4KROD 4EI5A 4JRYB 1HHGA 2A9NH 5FIEA 3U1SH 4N0YH 2APBA 5JIIA 4APQC 3C2AL 1VB9A 1ZGLA 4YWGL 2YMXL 4PJ5E 3ULUH 2P46B 4DKFH 3MCG1 4ONOA 1IT9L 1ACYH 5A2KH 3VG0L 2X4RB 4C56D 4PJBB 3BOVA 3SDCA 2AGJH 4TQEH 5AYUL 5KJRL 2D0FA 4JLRA 1PZ5B 2VDML 3U7YL 3T2OA 3VRJB 1TCRB 4XGZB 1I9JL 5GQBA 4QRQA 2WM0A 1NCDH 3T1FB 3BKYL 3M1BB 2KQMA 3NCJH 3G04B 3GB7A 1F11B 3JV5A 4W6YB 4JREC 1H15B 2AEQL 2X4OB 2Y5EA 5BXFA 1HINL 4XXDA 4OI7A 2A6KB 2DLFH 4FNLL 1AH1A 2O5YH 5DHVA 1E4WH 5EB9A 4N0UB 4HH9B 1QA9A 3TIEB 3LN5A 1FLRH 3GMNA 1PX3A 3O3EA 3BT2H 1AC6A 3W9DA 5HHXH 2CSPA 2DBLL 4X7FC 1AGCA 2DM3A 4OCYH 1HCFX 4KTDL 2XG4A 4HWZB 4QRUA 4Z7UE 1WBYB 1YMHA 3VG9C 4FTVD 2OTUA 1KPUA 5SWSE 1INQA 2E9BA 3L3GA 4KRPD 2FBJH 1PG7L 3B9AA 4S11A 5ICZA 1XH3A 4PBVC 5J12C 5D7JC 4Z7QE 4P4RA 1B90A 1J10A 1DANU 5C8JB 3QFJD 3RPIA 3SDYL 1DSFL 1G0XA 3DBXA 2IANB 3I6GA 4NUGL 3IDGA 2F19H 4WO4A 2PXYA 3PP4L 1F3RB 3B5GA 4HWEH 4M7LH 1EHAA 3MA7B 5SWZB 3NAAL 4IOIB 3GI9L 5EZLB 1DBJH 1EHLH 1JWMB 5KVGH 5L7XL 3WNLA 1BREA 3KPSB 3RTQA 1CFVH 3INUH 2XZAH 4X6DB 1KEGH 4W6XB 3WE6A 5DLMH 4HPOH 3IU3A 4PJFF 1T5WA 3TBTB 4YO0A 2HTKD 1FORL 3H0TB 4RBPH 2CRZA 1F45A 2R29L 3PHOA 1AO7B 3RIAK 2ARWA 2HKFH 3BW9A 3ESUF 4LKXB 1QRNB 2HJKB 5KG9B 3TV3H 1A9BB 3ARGA 1OCWL 4MXWL 5KSBF 3GMMB 1KYOK 2JJSC 2UZYB 3RWEB 1T1ZA 1CE6B 2W91A 2HFGH 3FO1B 5CJ5A 2W0FB 2BSRB 3IGAB 3RDTA 1VFBB 4GFTB 5CLTA 2CKBA 2HAZA 2DQDH 3G6JE 4ZS7H 3CFEA 3S5LA 4Q9RH 2BVYA 4EUPG 5DO2D 5H2BA 5FO9B 4P4KA 2CMRL 4LSQL 4POZD 5T5FL 3HNTH 3LB6D 5D93B 5CGMA 5F9WC 1FL3A 5HI3C 1IEBA 3VWKD 4E41A 4I0PD 1A4KA 5I8KH 5E8NA 1BQLH 2F8VA 5EU3B 1U8QB 4BELD 4AENB 4DZBB 4PJ7A 2X6MA 1KPRA 2ZUUA 1JGVH 2WWKT 3JVGC 5ITBH 5HBBA 1T5XA 1A5FH 3R4DA 3X11B 4QOKE 2HVJA 2NY5L 4XPTH 4NKDB 3OZ9H 4Z77B 4QHMA 4NKMB 5DK0A 1MCOL 3BJLA 2E27H 1FG2A 4UQ3B 2ITCA 5D9SA 4U1SA 3ULUD 2HT3D 4MNHA 5GGRB 3FONB 1J5OL 2R0LH 4OQ1A 1QKZL 4QXUH 1OSZA 4GXUN 3EYSL 1TZHA 2AXFA 4XPHH 3GSVA 4TVPH 2VUOA 5DEFB 4AL8H 1HIML 2YEZA 4I1NB 4NCDA 1CWVA 1QLRB 3DVFA 5IM7A 1FFOA 4DN3L 1IAIL 1S8DA 4BJLA 2GJJA 4OQTL 2ZUQC 1X4YA 4UAOB 4NSKA 3DROA 5EUOF 5C0EA 1B3JA 3O2DH 4I2XB 1BZ7A 4BK4A 4G9FE 1HDMA 4LNRB 5CBEA 3GHEH 3BZDA 4KROC 4EI6A 4HLJA 4QY8A 1KJ3L 2WZPD 2ESVB 2COQA 4CVZB 1S9VB 5I0ZA 1I85C 1DVFD 1JHLH 5C0DA 1Q94A 3DUSB 2HTLD 3QDGE 4CGTA 1B4RA 3D0VB 1JI2A 4Y7MA 2WUCL 1NCWL 1QZ1A 1WTGT 1DR9A 2DWEA 1Q0XH 1HKLL 3SPVB 4I77L 4Z6AT 2QKIB 4KK6D 1JTOA 1NMCB 1YMME 5D7LD 5CP3H 1KC5H 2WUBH 1N64H 2X89D 3ARRA 3BP7A 1LD9B 3CC5A 5I16A 3TT1L 1W0WB 2R4SH 3U9PH 5ICXA 1UQSA 5HGDB 4N9GB 5SV4A 5J6HA 1WWCA 2BVQB 3K2MC 5DYOB 3I9GH 4I3GA 2F74A 3O0RL 3QH3B 2DYPB 4RNRB 3EYQD 1BIIB 1CL7I 5DHYA 4UNTA 1VPOH 5HD8D 4BUGA 2OL3A 5JO5A 3RGHA 4DUVA 5IBTH 1MJ8H 3QIWA 4U1KA 3QB7C 1OAUH 2VR5A 4GQ9H 1ZLSH 1KG0A 4YHYB 1GGTA 1GH7A 4D0BB 1P4BL 5CJXC 5CINL 3QNYA 4UIKL 1D9KA 4POYA 2A83B 4ZUSB 1CT8B 3RUGA 3T8XB 1ACZA 4UQ2B 1RZJH 1JZ3A 1DTUA 3U83A 4ZPTB 3B5TA 1X7QB 2EO1A 5KS9E 4I9WE 5IFAL 4JVUA 4KRPC 5AYQA 1WCBA 1MI5D 4X7EC 3MCKA 2VLJE 5I1CL 3E6HB 5JW5B 4N8VG 2GT9A 4UDUB 4OI9A 2YK1L 1ZVSA 1MCLA 3OKEB 2ZOKB 2NXYB 4WI2A 1ZTXL 4HUNB 1G9MH 1B0GA 4MJIE 3WS6C 4YEEA 5DQJA 1DEDA 1H5BC 2ADIB 4JKLA 3C60A 5D7IE 5TDPA 4NKQB 4TUOB 3TJEL 4TULH 1UZ8A 5F93C 4YXKL 5IB1B 2XA8H 3C8HA 6FABL 3OAYK 4K94C 4KUZH 5F6HJ 3U4BH 4B5EA 2V2WB 3KPLA 3QUYA 4OZIB 2QL1A 3S3PA 1JIBA 2HTKC 4HW6A 4ZYKA 3CXDH 3NH7H 1UM6H 1EEYB 2HJLB 3MV7B 2BDNL 4ZUVA 3IFNH 4HIJB 2XXMB 5CEZE 3WFCL 2F9BT 4MAYA 1QPXA 3QUXB 3MBED 5T1KD 5BVJB 3G6JB 3C5JB 4ZOEA 5E95B 5DD6A 3DVNA 1T7WA 5FYLD 2F5BL 4ALAH 1KNOA 4QHKJ 1HSAA 4JDTH 5I1LA 4MAUL 4GRLB 1YJDL 5F96L 5FHBL 3VXNB 1J1PL 2ZCLH 1FVEA 5A43C 2A6DA 4Y19E 5ISZE 3OHXB 5DO2C 3O4OB 2OR9H 1VFMA 4POZC 1RJZB 3LB6C 2P5EA 5EBMB 5EU5B 5IW6B 4TVPD 3VWKC 3GSXB 4HS3A 2ICEA 4I0PC 2FL5A 4N0CD 4J3OC 4QOKB 4KI5F 3TZVD 4PTTA 2Q1EA 3MBXL 3V5DB 3C5ZB 1ZHKA 4Y88A 5E4EC 4XVSL 3D0LA 3BDYH 3FQTA 3IDYB 3UCRA 4HKBB 1AIFB 3GSNA 1HHIA 5F44A 3VGBA 1QO3A 4ZUWB 2ED8A 1LP9E 1NPUA 5IVNA 1CIUA 2VN4A 4KY1H 3VGHA 1E4KC 4OGZA 1TPXB 2DQCH 3QEQD 2Z31A 2MPAL 1S7XA 4OCXL 1YEFL 1EZVX 5TDOA 4OCSL 2BY1A 4AH2A 4R7DA 3VJ6B 5DJ2B 3ULUC 2HT3C 4Z7VB 3QDMD 5TE4H 4I48A 3GIZL 4OZGB 5CSZA 2C4FU 1JUFB 2CLVB 4PRIA 4NO0A 1LO0H 4JFDD 4GMTH 4XNMB 5BMFH 3V0AC 1IGTB 1K8IA 4YHNA 5EIQA 3P4NA 3ARPA 3RWHA 5EBLA 5A16A 4Q6IA 4XC3L 2BVOB 4J3VA 4O51A 3BESR 2ADJB 2ZNWA 5DUPL 5C1MB 1NDMB 4X6CA 4H1LA 3QJFA 3LHPH 4XBPA 2BVPB 3WNPA 2H1PL 3P40A 4P23B 1DVFC 1NBYB 2AJZB 3CVHB 2OR7A 3MYJB 4NQUA 5EO9A 3V6BR 3AUVA 4EQ3A 2EDOA 1RUMH 2HTLC 2AV1B 3EFDL 3QA3B 3MUHL 1JNLH 4H8WL 3MO1B 5MEOB 4O2EA 4QYOB 4P2OA 3MLYH 2Q8AH 1EUUA 3DRQA 4H26B 3DO7B 3CD4A 4KK6C 4LQFH 2YPVH 5E08H 1RFDL 4ZDHA 5I17B 1J0ZA 4Z78B 3KWWA 3RWCB 2NY4D 3VMPA 1I7RA 4WTZG 4GW1B 4RX4D 4LOUD 4OLWL 5DC9B 2I9LB 1UACH 1B4JL 1FDLH 1U91B 1ZS8B 4HK0A 4GAFB 4YPJA 3IDIA 2RJMA 4QRPB 5HHQA 3ZTNL 5I18L 1K4DB 4XP5H 3BVNA 1DN2A 3EYQC 4OZHE 5C0BE 3VDAA 1HSBB 4DTGH 4PB9L 3TBWB 5BV7H 5HD8C 3N9GL 3P0YH 5EC2B 5LGJA 1VENA 3QNXB 2C1PA 4IMLB 4XNZC 5F7LB 1N2RB 3GMPB 1LDPH 5F88B 3TVMB 3A67H 1RI8A 1CIDA 3NZHL 3MV9D 4HIIB 5DJYA 1NMAH 1PYWA 4NZRL 4MNGE 3CFBB 2EDDA 3PWVB 2ZUTA 2PTVA 4J4PA 1TTUA 4HUKB 4XH2B 4KHTL 3THMH 4GW4A 3IETA 1JYVA 3CH1B 2IMMA 3UTPD 4FFYL 4ZUTB 5CEYA 2WBJB 5IR1B 3D69B 1C5BL 3B4NA 1EAPB 1P6AB 3BIAX 4G8IB 4KH2A 1F00I 1WITA 1UYWL 5JORA 4J8RB 4GLRH 4ISVB 2GK2A 2IC2A 4L4VB 4EJ1C 2ZUXA 3PWPE 2FX8H 1OTUD 4F57H 5EBWA 5HYJB 4QRRD 2VQ1B 2QQLH 1T7YA 1ZHNB 2XTLA 2J8UF 2WSKA 1T1XA 2FYYA 3E6FB 1X44A 4CW1B 3PGFL 4P2RA 4MDIB 3MYZA 1I1FA 3PABB 4L1DA 5C0AE 2BXYA 3VWJB 3WS3B 5FFLA 1H3VA 2VXTL 1DLFH 3HUJA 4ELMA 3Q5OA 3NCYS 3RIAF 3DXAE 3C8DA 2P24B 2CDFB 4I3RH 3TA3A 2FX7L 4YDLC 5T3ZL 5K9KB 4JEGB 1VGKA 1INEL 3RWDB 1C1EH 3OWEA 3C6LA 4WDIB 5C0CE 3IFPB 4HHAB 3F12A 4JKKA 5D96B 4K2UL 3QIBD 3BH9A 1G6RB 3OX8B 1A6WL 3U6RA 3KPSA 2NCMA 3CDFA 1SBSH 5L2KA 3MBEC 3GSOB 3D85B 3VFNA 1RUQL 4I18C 5C86A 4OLYH 4X6BA 3K4DA 4XNYH 4L9DA 2FECI 5MEND 1NFDA 3ZE0F 4PJEF 2RFXA 3U2SA 4AIZA 2EDTA 1KB5L 1U92B 3MRBB 3NABH 3VXMA 5ECJE 2D0GA 3UTTD 4GUPB 4RGND 5HGBB 5DJAA 3HRPA 5CMAA 1RIVL 4WWKA 1CVRA 3HKFA 2ZSVB 3N1GC 4PJCF 3QPXL 4P3CL 2W1NA 1XZ0A 3FCTA 5IHZA 1MFNA 4NRYA 2BHYA 5IVXF 2AQ2A 2PYEA 1QSFB 2AJSH 4U4BA 3TWCH 2E6JA 1XCTB 4EDXA 4N0CC 2ARJQ 5FHAL 2VUYA 5C0GA 1FNFA 3TZVC 3UAJD 1SM3H 3O6MH 1MLBB 1XT5A 3STLB 3DX6B 4LCUB 2AJXH 3X3FH 1BP3B 3ARSA 4DWHA 4XVUD 3QAZB 3KDMA 2IH3B 3TN0B 3S35L 3LN9A 5DC0A 4WJ5A 3T0WA 1QEWB 4EQ2A 4BQ9A 4LAQH 1IAKB 1IE5A 4UT6H 5C0RL 1I9IH 4G6KL 1RZ7L 1KN2L 4H25A 1YEJH 4PY8J 4BFBD 1DFBH 5T33H 1UM4H 5E8PA 2LTQB 4D2NA 3MNZB 2K1MA 3MV8D 2PR4H 2PNDA 3MLRH 2R2HA 4JCMA 1I1AD 1AGEB 1CFSB 4HFUL 1I1YB 2C7UB 1JTTA 4YGAB 1YEHL 4PGBB 3UTSA 2JLLA 4IHOB 4J1UA 5AUMA 1JRHL 1MCNA 4X98B 5SV3A 43CAA 2AJYL 3IDNA 4F37F 3B6SB 5DUBA 2QJDA 3CGTA 1DQML 1QPPA 2Z93B 2WANA 2F53E 5B38G 1A9EA 4R97B 4NC0B 4M03A 2APVA 4YDJB 2ZOLB 3HZYB 3FN9A 3HAEH 4JFXB 3S88L 3WIFB 3TLRA 3LKOA 4RDQG 3AREB 1XF3B 3QI9A 4AEIH 1WUNT 3L9RB 1UJ3A 1G1CA 5FKAA 2R0WH 2QADD 2W9EH 3IF1B 4O2FA 4EN3B 3O6FA 1ZHBA 1Y6MR 3FOMA 2BOCA 4XCYA 4DAGL 4AQOA 2ZSWA 4XZUA 5IQ7L 4Z95H 1U8PA 5CBAB 4PJ5A 3TNMA 3KR3L 3MRKB 1FYTD 4GBXB 2GQHA 4U31A 4Y2DB 2R2BB 4CJ1A 5FOJA 3QFDA 4ORGA 1I3RB 3VH8B 3ARWA 1NDGA 1T1YA 2Y07H 1Y0LB 5ESQB 5ACLA 5C0BB 3B83A 3QDJB 1RZJC 1LK2B 2NY4C 1RUPH 2V5RA 4LOUC 4YNYB 3JBG7 3LKNA 5DTFB 2X70B 5FYKD 4Z5RA 3T4YA 3D0VA 2N7BA 1T22A 4ZO8A 5E9DE 4YX2L 1QFUL 1FYHB 4NQED 3S97C 5DT1L 3O3DB 5GGTH 2V9TA 4LRNH 4HUUA 3QZWA 4IRSB 1GC1C 1TZGL 4OV5A 4R8WL 1QNZH 3UJIH 2GY5A 1SVCP 1G9MC 4IJ3C 4OF7A 2B7DT 2BVQA 1KFAL 5IK3B 1HWGB 1C5CH 1JPST 4XHQA 1KCVH 5E03A 1KTDB 5DVLA 4JDZB 1F4WL 3TPUA 4NT6B 5B22A 1JYXA 3WD5H 5EO0B 1PW3A 4EIGB 2GTZB 4MGXA 1FZMB 3AM8C 4GAYA 4CMMB 4Z7UA 5I75B 4BQBA 4U6YA 3WLBB 4JFFB 1QBBA 2XWBA 5SWSA 5JW4Q 2IAMD 1MCWM 4P3WA 2Q86B 3V0VB 4KAQL 4NWUL 3RU8H 3REVB 4X7TA 3VRLE 2AP2A 4FFZL 2LU7A 3R1GL 4I13B 4JANA 2DAVA 3B2VH 2XRAL 4UQ2A 5C0AB 4PJ9D 3LPGA 1XGUB 2AK4B 3OF6A 1OTUC 1JGUL 4NNPH 1S7TB 1U58B 1X5ZA 2APTA 1M7DA 5TE6H 1JFQL 4DN4H 5BRZE 3BSZH 4L3EE 3L5XH 2NY3B 3WHE1 1BD2D 1S3KH 4PB0H 1F6LL 3M17B 3RY6C 4R26L 2PTTB 3RKDD 1RVFH 2V2XA 8FABB 3H9HA 5AWNL 1RD6A 1U3YA 4Y1AD 4AEHL 3LD8C 1DDHA 2JJWA 3P9LA 1N4XH 4JY5L 5D7SL 3EDFA 3DV6A 4A6YL 4WV1A 5TE7L 4L5FL 4X99B 1IGCH 5KTEH 4LCYA 2X4SB 3QIBC 1R3IL 4JO2H 3PWNB 5CLWA 4TUKH 3WKNA 1E4XL 1L6ZA 1KIRA 3DWTA 4PRNA 3MJ9A 4N5UA 3ULSA 2EEAA 4C4KO 5BJTB 3VFGH 3MA9L 4HKJA 4AG4L 1ONQB 1OP5K 5FGBC 4L3CB 4TPRL 3OXSA 1YEEL 4HX1A 5ID1B 3LKQB 4CUCA 1UB5A 3C2AH 4RGNC 2V9QA 4YWGH 1QFPA 2YMXH 3UYRL 5JHLL 5KW9L 4TVSa 2G75A 3OAYH 4XB7A 3W11C 3G6JA 1IT9H 2F54D 3VG0H 3OJDA 1RPQA 5CJQL 1CLZL 5HHME 1S7UA 1C16B 1CDYA 4XXCC 5AYUH 3DVGA 5KJRH 2RB8A 2H3NB 1HHHA 4L8CA 1XGRB 1T1WA 4BH8A 5DFVD 2VDMH 3U7YH 2HRPL 2Z4QB 1BZ9A 5BV7B 5GGVL 3LEXB 3B9EA 5GRYA 3MREB 3UAJC 3WJLC 2D7NA 2PYFB 4YHPA 1I9JH 4HT1L 1FNGA 2EKSB 2Y7QB 3BKYH 5IHUL 1OGAE 4LMQI 5EG6C 1RJZA 4WHYH 5JOPD 3HR5B 5I73B 4JY6B 1KJVB 4LBEB 2AEQH 3IJHA 2BSSB 3RI5K 1HINH 4X4YB 4FNLH 3BZFA 4UINL 3SDAD 3O9WB 5E56A 4QOKA 5JOEA 3QIUB 5HI5D 2EDRA 4BH7B 5KBNC 2V7HA 4HKXB 1BQHB 4PREA 1UENA 3U46A 5F7NC 3SJVE 2DBLH 2SEBA 2DIAA 3HCVB 3MMEB 3GSWB 3RKPA 4LCCA 1CICB 4PJXE 4UIMB 4XAKD 3DMMB 5I1AA 3B9KA 4KTDH 1I1AC 3TF7C 4NKOA 4FQXA 4J3UA 2D7TL 3GBML 2VKWA 1SY6A 4KFZC 1S9KC 2OQJB 4PV9A 1UJTA 5TDNB 5I1GL 3BYYA 1YNLL 1PG7H 1QSVA 2AS5M 1Z6JT 1K2DA 4C83B 1ZVHA 1ZLWK 1AC0A 2PETA 5DZNA 2MNUA 5C07B 1HH9B 4PRDA 4NHUA 3SDYH 2JJVA 1DSFH 3NVQA 3T77A 3O2VL 4M6NL 1Q9LA 4D9RD 3H3KA 1HHKA 2R23B 3TCLB 1Z5LB 3IDJA 4UOW1 4G9FA 4NUGH 3DVIA 4W81A 2EDBA 1OOAA 3IFOA 2BNQE 4OBSA 3PP4H 4EUPA 2QADC 3NAAH 3BUTA 4D0CA 3GI9H 5L7XH 1PEWA 5J1SC 3WHE0 2YBRB 3QDGA 5IMKA 2V5TA 3BQUA 4W70A 4GAJL 4Y5XA 4HDIA 1G7LA 3SQBA 4BYHA 2DQTL 2AJ3B 3ZDXE 5T3XL 1FZKA 1YMMA 1FORH 5JOFB 4PD4K 3L1OL 3MRMB 3H6JA 1IM9D 5IMLA 4C56E 3RZWA 4ETQB 3VA6A 4WFED 2ZCHL 1MELA 2W60B 2NPLX 2YN3A 3PQYB 3QULB 3G9AB 4M3JA 5MEOA 3BN9D 1PQZB 3PIQA 2FJGB 4UUJA 2IADA 1OCWH 4MXWH 4Y4FB 5F72S 4OGXL 3CNKA 3CX5J 2GSIA 2Q7YB 2ATPA 1AKJA 3QQNA 3ARUA 2C1OB 3D87B 5DEGB 4RMWA 3FKUS 1QSEB 4JHBA 1AGFA 2CKBL 1A14L 3QRGL 3RNQB 4FQJL 3OV6A 2CMRH 1A6AB 4LSQH 3T2QA 2F5AL 5T5FH 1NEZB 4DVBA 2IPKB 1LE5A 3UROR 3H9SA 2BXZA 5LBSL 4LIQE 2DRUA 1IC1A 4XPFL 3F7VB 4P9ML 5KS9A 4YEFA 4KZDL 2OI9B 3LRGA 3RZCA 5L2JB 2IAMC 4LSDA 3D3VB 4P5TA 4YBQD 3N0PB 4WFGD 4RMUA 5DJCA 3O3AA 4FQHA 3PF2A 3HNVL 3VFWB 2VLJA 4HIHB 2ZUVA 2QQQA 2X1XR 4PJ9C 1P4LA 3UPRB 4F2MA 1WWAX 2NY5H 1BVKA 2EECA 3FO9A 3RWFA 3EOYG 3QFJE 1BVZA 4G6AD 1MCOH 2Z8SA 4RZCA 1DQJA 4MJIA 3LQZA 3GO1L 2A1WL 1GPOL 2BZDA 2E6PA 1DN0A 1J5OH 5CJ8A 5HVGB 1QKZH 5D7IA 3RKDC 3WO4B 4ISVA 4EKXA 5F89B 3EYSH 3ZT6A 5AG9A 2QBWA 2AEPL 3BH8B 4NQCB 5GRXG 3BP6B 3WL9B 3L6FB 1HIMH 4NQXA 4HS8L 3T3PF 3ZDYE 1XCQA 4YGVB 4DKDC 1E6JL 5K33A 2X9XA 3HAEB 1K3ZA 1HK6A 1NKRA 4DN3H 1IAIH 1YPZB 3J8F7 4OQTH 1KIPB 1JBJA 1H3UA 2XWJB 5J56B 2XA3A 3FAWA 5ITFB 1RIHL 1R5WB 1EXUB 5F9AC 4YHIB 5DQ9B 1KJ3H 5IHBA 1J1XL 5DJ8A 3QXAA 4UB0L 2R0KL 3BPNB 2BVTA 4Q0XL 1G7HB 4O58L 4L8DA 1NC4A 2E3VA 4OLVL 3IYLW 5BS0E 6CGTA 2FX9L 2WUCH 3GSOA 1NCWH 5CAYB 2VDQL 2HFEA 1HKLH 1PG7X 4MDJB 3MGOB 4LHUD 2ICES 4Y19A 4QRTA 4I77H 4M7KL 3PGCB 5ISZA 5JHDB 4KZEL 4K3JL 1MRDL 3O6LL 4FQ1L 3FT2A 1A0QL 4X6CF 5LXGL 1S7SB 5DFVC 5HGBA 4GRWE 3TT1H 4MXVF 1Z2KA 5HSFA 2W07A 3I6LD 3C9NA 4N8VA 2FIRT 3AU1A 3VFVB 1JZ6A 2A6JA 4UV4L 1XF2B 2K3TA 1V3KA 2B5IC 4LNVA 3O0RH 4X8JB 3BKJL 1EK3A 4TTDD 3NIDF 2HJFB 1G7QA 2VQTA 4PJXB 1XCTA 1T3FA 2OL3L 3SDAC 5HI5C 1LP9A 3KLAB 3MGAA 1SEBA 3HMXA 3MOQA 3PL6A 2OTWB 1CU4L 3RFZC 2X2YA 2QR0A 1P4BH 3BMWA 5IB4B 3DV4A 5CINH 3HR6A 4UIKH 4PRAA 5B21A 1HXMB 4NDMA 4HMCA 1XF5A 4FQ2L 3UDWC 2IALB 3JTTA 1I8KB 4JRXD 4RGMB 4JFHD 2ARJA 5HVWA 5F9OL 2IMNA 1MH5B 1JF5A 1MLCA 3FQUB 3ULUE 4IM8A 4NJ9L 5IFAH 2LE9A 4NQDD 3BZEB 1C8PA 2NMSA 3TESA 5EN2A 1IARB 3EO1B 4PJIB 3Q3GA 3VFPA 4I5BB 5I1CH 1BPVA 4JQXC 5JXAL 4HH8A 1AGEA 2YK1H 1A1OA 5SX5K 3RWGB 2IGFL 2R39A 3SY0A 1ZTXH 5MEPB 2C5DC 1FNAA 4HAFA 1EFXB 3BPOC 4FFVD 3TH2T 4JZOB 3EOAB 1I3GL 3PJSB 3MOBL 3TJEH 5B3NA 1CGWA 3SO3C 1DLHB 4YXKH 5LWYL 6FABH 2AERT 4M48L 5SX4I 1ADQA 4UU9A 4IIQB 3QEHB 4MD0B 1QHOA 5F1NB 2J7LA 3CJJA 3FQRA 4KMLB 4JB9L 3BWAB 3BIBX 4JFEE 2L7JA 2XTJD 4R90L 3LPFA 1WBZA 2BDNH 5E94B 1VA9A 2A6IB 3WFCH 5D7LE 2YA1A 2AV7A 1DQDL 3MJ7A 4M93C 3MRKA 2YC1A 2R2BA 4ZSOE 4PLNC 3BN9C 4XMPL 1T80A 1II4E 3QG6B 1LEKB 3P4OA 3BUYA 3QUMA 4OZHA 1CCZA 2F5BH 1AGDB 5C0BA 3MR9B 3V5HA 1OB1A 2J3SA 1LMKA 1AGBB 4K3DL 4MAUH 2NY2B 1YJDH 5F96H 4LLVA 4KUCF 5FHBH 5C2BL 1J1PH 2H41A 1JZ7A 3UBXA 3FB7B 4WW2C 4C54A 5TH2B 2BHZA 5IBUG 4J3SA 5K9OB 3LEYL 3QSKB 4MNGA 3A0OA 4Y16A 2XN9D 4U0QB 1X5YA 3BKCL 1NFIB 1NEUA 1GGCL 3O8XB 3PDGA 1N26A 1G7IB 4P46D 4Y5YA 5KZCB 1NFDF 1XR8A 1RK0B 1WT5C 1H9VA 3MNVB 3U30C 3MBXH 3OG4B 4YR6B 4LCIL 1AQDB 5D1XD 1ZA6B 2DQUL 1A4JA 4YBQC 1NAMA 3HE7A 3HA0A 4XVSH 2DKMA 1JNHB 4MD4A 4LLAA 4JDZA 1N0LA 1K9TA 1AHWB 3SO5A 4GG8B 3W39B 5ACZA 1MI5E 2F8XC 1PFCA 1X9QA 3PWPA 1OP9A 2JIXA 4R3SA 5HY9B 2DWDA 5HHOB 4OCXH 2MPAH 4G6AC 1YEFH 4M4RA 4YAQA 4WIQA 2Q86A 4OCSH 4JFPA 4PGZA 1F90L 1AR1C 1CE1L 2DQJL 4WTZA 2EH7L 4KHXL 3GIZH 4RIRB 4PJDB 3HI5L 4WW1A 3DXAA 1S7TA 2WV3A 1S9WB 2FB4L 5C0CA 3OGCA 4DW2L 4HK3N 3FT4A 2EE2A 4MWFA 1T0NA 1TVHB 5DVMA 2W65B 4UDTB 4XC3H 1TQCC 1Q72L 2XZQL 5BS0B 5E5MA 4ODWA 1NUGA 2CPCA 3QEUA 5DUPH 4PJFE 4Y4KB 4X6FA 5D2NC 5J57B 2H1PH 1JV5B 4JDVA 1A21A 3BP5A 1DUYB 1P7QB 4QHUB 3P9MA 2IPUG 1ZLUH 3OKOA 5FYLE 3EFDH 4H8WH 5D5MF 3IJSB 1NC2A 1MCIA 1Z9SA 3BI9X 4JGMA 4ONFL 3SKJL 4HGKC 5KSBE 3WYRA 3LKSA 1J05B 3VWKB 2V2TA 1RFDH 1F3DH 4MNQD 5IV2A 3FB6B 4NNYB 3MLXL 4EBQL 5I8OL 1WEJL 2VKXA 3LKQA 2A77L 3UYPA 4ZXBA 2OTPA 4OLWH 2DIBA 2VABA 3QUZA 1WBXB 1B4JH 4N0FA 4KQ4L 2G2RB 1ORSB 3RI5F 2RHEA 4IRJD 4TVPE 3ZTNH 5I18H 4D0DB 4P2QB 5AEAA 4PB9H 4TTDC 3N9GH 4K71B 4NRZB 4RGOL 1DL7L 4U1MA 4MQ7A 2NX5D 4K7PH 4L8BA 4MB5A 1J0JA 3SE4A 2HT4D 5DRNA 1DBKL 1T4KB 4HLZG 1ZA3A 3NZHH 1NGWA 1A7QL 4URTB 2VE6B 3RVVD 5DMKA 5E00B 4NZRH 1R0AL 5T1LA 1WISA 4FQIL 4KRNA 1MHHB 4JY6A 5JIHA 1FSKB 1KJVA 4O9HL 2KBGA 3NPZB 3P30L 1MFBL 4KHTH 5SWQB 3ILPB 2CGRL 3EYVA 4U7MA 3QDME 2FNBA 3HHRB 4FFYH 5HDQL 5DRZB 1C5BH 1AD0B 3LDBC 4CU7A 2WIIB 3GUTA 1K5NB 1UYWH 1LE9A 1HQRB 3JUZA 4JFDE 5DJXB 4F8QA 2F53A 3W2DL 1IGFL 1G0DA 5J7CC 2BVEA 4PV8B 1SJVA 4F9PC 1IGIL 5FGCE 4OLXL 3PGFH 3IAQA 4C83A 1WIUA 2DLTA 3VXUD 4JFEB 4TNWK 1FFNA 5EUOE 3QNZA 4JY4A 4K3HA 2VXTH 1RULL 3TCLA 3PXHA 1F58L 3JWNC 1SYSB 2FX7H 5F8RC 4ZSOB 4APQA 5T3ZH 1DBML 2CK2A 1F4YL 3L5WB 1INEH 2MMXA 3MRHB 4P3DA 3ZMRA 1CVSC 1EEZA 1NCBL 1UT9A 2XTJC 4K2UH 2YD6A 4BQCA 3V4UL 3KLDA 1A6WH 1EHNA 3MRFB 4XC1L 5BZDB 1YC8A 5HPMB 1RUQH 2XFXA 3WUWB 4K7FA 3I84A 4LK4A 5E9DA 1FL6A 3JWOL 4OJFL 5MP6L 4YBLC 3L7FA 1KB5H 1J8HD 5D1QB 2NLJB 3GHBL 2LABA 1ZLVH 4L4TA 5F3HB 5JLZA 1RIVH 1RURL 4Y8AA 3QPXH 3AFLA 4P3CH 3QULA 1WF5A 3LH2L 3FHAA 2ZKHL 4KUCD 2QHLA 3GIVB 1AP2A 4ONGL 3IDMA 4HV8A 4JZNB 4ZTPL 3I85A 3MV9E 4NQTA 4JM2F 1Z9OA 4JQIL 3F8UB 5B38A 5FHAH 5GS3A 3A6BL 1W72A 5D1XC 5CGYD 3GNML 2VXVL 5FUCC 3RNQA 1D5ZB 2FLBT 4X5WB 1R3HA 4GKNA 1A6AA 2FEEI 4LSTL 3U0WL 1V5JA 3CVIL 1QR1A 3CIQA 3SEPA 4M1DL 3S35H 5CCKL 4P49A 1QUNA 2VZTA 5DVOA 4OIIL 3VFMB 3LKRB 5IT2L 5D7JA 3HTLX 5C0RH 4G6KH 3O81A 4HCRA 1RZ7H 3V95A 1KN2H 5BRZA 4RMTA 4L3EA 3EO0B 1BIHA 3D2UA 4RFEA 2QSCL 2FJHB 4QRRE 3KJ4C 43C9B 3QO1A 4P2YA 2VAJA 4GG6B 1HHJB 1J8KA 4YDVB 4HFUH 2PCPA 5BQ7B 1YEHH 3ZTJG 5F6HI 4L9LB 4X4XB 1ZWIA 1JRHH 3CCHA 1FFRA 1TVBB 3LRSB 4Q9CA 2UWEB 5BW7C 3TNNA 1CG9B 2AJYH 3DSFL 3KYNB 5KSAB 4ODSL 1DQMH 2EIZA 4HGWB 5FO7A 5CD3B 1E27B 4S1SL 1YEDA 2AXJA 3E2HB 2E9WA 3DGCR 1A3RL 3VGFA 4HIXL 4RAUA 3QUKA 4G8GB 1K3IA 1G7MA 4JO1L 4RWYL 4DAGH 5IQ7H 4JVPA 5MENE 4MZ3A 3RVWD 3KR3H 4V2BA 4EIZC 1SHMA 2BY0A 2JJSA 2WQ8A 5C9JB 3UTTE 4RGNE 3RAJL 5IQ9A 5F1IB 3IS0X 3MNWB 1JZ5A 3MUJA 3ZE2F 2ZNXA 4R2GB 4CU8A 4LFHG 4NN7B 4CJ0A 1KTLB 4CVUA 3PWJA 3NGBC 3JV6B 2Y23A 4IRJC 1WV7T 3PE9A 3S4SG 4YX2H 1QFUH 3OAZK 1OGAA 5DT1H 4Z0XA 3B43A 2APWA 3SDXE 1TZGH 4R8WH 4LLWB 3I75B 4LPCA 5GSVA 4PJAE 2HT4C 4GRMB 4NO3B 4GS7B 4NOBA 3JVGA 1KFAH 5E6ID 1YDPB 4X4ME 3RVVC 3TO4D 3QDAA 5JNYB 3NMEA 1V3MA 3SJVA 3WEXB 1EBAA 4ZAKB 3VCLA 4LLDA 1F4WH 3GJEA 4WU5A 1FGNL 2XNAB 4YDKL 3HZMB 3SCMB 1ZT4B 4LLQA 2UUDK 4WI5A 5HYEA 2P7TB 3ARVA 4QT5B 1L9NA 4RMRA 3MV8E 3UZQA 1FIEA 2EYSB 4KAQH 4NWUH 2VLKD 3VXSD 3WFEL 1HQ4B 4FFZH 2PO6D 3EFFA 2GFBB 3R1GH 1IGYA 3MLUL 2XRAH 1ND0A 4NZTL 5C7XL 3G5YB 1PKQE 1WAAF 1JGUH 3C8KB 3F7RA 1YEIL 5DD1L 4ZOCA 4FS0A 4JPKL 4JPIA 5F7YC 4NQVB 1RK1A 3UX9B 1JFQH 3BO8A 2BNQA 1EO7A 3RWIA 2J12B 5GRUL 2P1YA 1C7TA 4Q2ZA 1YJDC 5DSCB 3BJ91 1ZV5A 4R26H 4LLUA 3FB5B 4I0CC 3REWB 1JJUA 5AWNH 4RAHA 4WEBL 4AEHH 4ENED 5GGSY 1I85A 4KJPD 1RJLB 2QSTA 1N5AB 4JY5H 4LPXA 5D7SH 4A6YH 5TE7H 4L5FH 4KMTL 4DGYL 1FYTE 5DVNA 5L9DL 4XVTL 1R3IH 3DETD 4PRPE 1NQBA 1N6UA 3T3MF 4C56A 1DZBA 3DUHA 1E4XH 5GIRA 1F8TL 5D6CB 4PY7B 1NGQL 4X5XA 2L0DA 3MA9H 4HUXB 4KJWD 5F1NA 4AG4H 5FYKE 2AQ1A 3EZJB 4B7IA 1BQSA 4P57B 4TPRH 3BWAA 3L3HB 4DZ8A 1YEEH 1KPVB 2A73B 1KTRL 1JPFB 4X9FA 4PRHD 4OD2A 2OSLA 4NQEE 3UYRH 5JHLH 1NCUA 5KW9H 4BSVA 2BMKB 5CFHA 2VSDA 3IFLL 1JK8B 4QHNB 4OUUB 3V52L 4PJ8B 3OB8A 3TO2B 2BSTA 3HB3C 5CJQH 5L0QB 1CLZH 3V5KB 5GS2H 1FE8L 2GAZB 2I27N 1M05B 4HZAA 3HFML 3AMLA 2HRPH 3KXFB 5GGVH 5LAXA 5CJXA 3FN0L 1I9EA 1UXWB 2VLRB 4ONHA 4HT1H 1Z0NA 5CGYC 4JM2D 1F6AA 5IHUH 1GZPA 1C5DB 1X4XA 4N68A 4Z8FL 1P7KB 1IQWL 3JWDL 1X6LA 1KEML 2R0ZL 4XP6L 5ETUA 4FTVA 4NFCA 2W38A 1M7IB 1KSRA 3UP1A 4AM0A 4UINH 1RK0A 3KYMA 4UOJA 3IVKA 2BJML 3ZHKA 4F7CA 4KJYA 1BQUA 4YR6A 3ROOA 5DD3L 3QFJA 3H9YA 3BEWB 3LSOA 3IS1X 4GXVL 1JGDB 4LVNC 2VAAA 5FF6A 3SBWC 4H8WC 4ZTOL 5BO1L 3BIKA 1A3QA 5HVHB 3T0EB 4QF1A 4P9HC 2IJ0C 3LN4B 3L3KB 4HWBA 3W39A 1D5BA 1EIBA 2D7TH 3GBMH 3WS6A 4N8CL 1H5BA 4V1DD 2A0LD 3V6FA 3TFKD 1SY6L 3QJHA 3VI4F 1LO5B 5I1GH 1YNLH 1LP9F 3I02A 3RBSA 1KUMA 4YQXL 5DJ0A 4Y1AE 4F3FA 2V7NB 3O2VH 4M6NH 5JMRA 4P5KB 4R0LB 1VCAA 3U36A 3UBXI 2Q76A 5JA9A 5FXCH 2GK0B 4FZ8L 5E8OB 3SKNB 3ARFB 1S9WA 1XIWB 4EZMA 4RGNB 3CFDA 4HIEB 3SDDB 1T89C 2N4IA 5EOTB 1OGTB 4G3YL 4LSUL 3FT3A 1T20B 2W65A 3RVWC 1CD8A 3CX5K 1A64A 4GAJH 1ES0B 2DQTH 3ZE0E 2GEEA 5C09B 4PJEE 3T2PA 5T3XH 2UY7A 2CIIA 4OFKA 1F2QA 3C09B 2AABL 3L1OH 2EXYD 5DRXA 2F54E 3FFCD 3CVHL 3O3BB 3IKCA 1KB5B 4L29B 3NFNB 2A74A 2X40A 5D72L 3SOBL 2ZCHH 2P8MB 4RFNB 3QHFL 1T0MB 1CFTA 3D39B 4Y4HD 4A2MA 2WBWB 1L0YA 5IVXE 2Y5TA 3VWKA 1M6OA 4I0PA 4OGXH 5FK9A 3K8LA 3GSRB 1HCVA 2YKLL