1XF4A

Structure of ligand-free fab dna-1 in space group p321 solved from crystals with perfect hemihedral twinning
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A01
3KNBB 1XCQB 1CGSL 5TF0A 1MCWW 1WBYB 3ELAT 4R3SA 1LP9B 2UZIH 2VRAA 1FO0A 4RA3A 5I76B 5C0AA 3OPZH 3F7YB 7CGTA 2GYSA 4JDVA 4K23H 2HYMA 2E9JA 3SEPA 4S2SA 1NC2B 1GC1H 1OP5K 5D1XC 2AEPL 3WL9A 3O2DH 5DK2A 2NY7L 2B1AL 2R0LL 3TYFB 2BHUA 1DBAH 3EYUH 1SYSB 1INEH 2HFFB 1TPXC 5KN5B 4PD4J 3O6MH 1WF5A 1EZVX 3CPLB 4JPKL 3Q5OA 3ZT5A 4X80H 3O9WC 4MWFA 1CIDA 4OZ4B 4BQCA 1SBSH 4FG6C 5DO2C 4Z95L 5EU5A 4U1SA 1JYWA 2G75B 1UCTA 4WI7A 1Z3GL 3RVTC 3MGTB 2F53B 2IFFL 5IJKC 3HE6C 1K9TA 3BZFB 4MJ5A 3EHBC 1RU9L 2VXUL 5C0IA 1UB6A 4YQXH 3U7YH 1BIIA 5C1MB 1BVKB 5EO0A 3TN0D 1II4E 1B2WH 1KLUB 4JFFB 4LF3A 4DK3A 3FFCE 3UPRA 2AJVH 1TJIH 4EBQH 1CU4L 4Z7UE 3I02A 5FF6B 1XF5A 4QHUB 3WN5A 4ONGH 2P45B 4DZ8A 5B38B 1QA9B 4NO3A 4JY4A 2NW3B 5C08E 3X12A 3S37H 1JGDB 3AY4C 5KSVA 1JF1A 2G5BA 2WV3A 3PNWB 2D7OA 2E9IA 4ELMB 2IPKB 1DQDL 2VH5L 4JHWL 5INDB 2Y6SC 3KXFA 2P5EB 4L3EA 2VC2L 4PJ8B 3VD9A 1HHGB 2WP3T 4Y4HB 3EJZD 2FZ3B 4HHAA 1YNLH 2VDRH 5KVGH 5L2JA 5H35B 2IPUK 4X9BA 2XA3A 2DLFL 2VLKD 5J1TC 4R97B 3CVHL 1MLBA 5D2NB 2FR4A 1FG2B 5KS9A 2XWBA 4PGEB 3SCMA 1J8HA 1V3JA 3T2QA 1EDQA 4Z77B 1SEQL 1E4XI 2FH6A 2IEPA 1F3JA 1MPAH 1UB5B 1BJMA 1UQSB 3B9KA 3RWGA 2EE6A 2X4OA 2Z92B 1YQVL 4B7IA 5ACZA 3IJHB 2FECL 4DKAA 4KTEL 1QOKA 4OFIA 4EUPA 5ENWB 4LOUC 3VXTA 1N8ZB 3D48R 4RDQG 2BK8A 4QTIL 3B6SA 3C6LC 1FO0B 4XMKH 2VDKH 3O3UN 1N5AB 5EU6E 2R8SH 2GFBA 4QWWC 5HDOA 3VI3F 5DRWA 4RMRA 5KVDH 4UILL 5C9KA 1OTTD 4PRHB 4UB0H 2JCCA 5HYSG 4PRID 4JO4H 4F15B 2FO1A 1BAFL 3QCVL 3DGCR 4OB5L 3HC0A 5H37G 4QHNA 2BNRD 4YFEA 1CL7L 4ZO6A 5HHXL 3G6DL 2EIDA 3LB6D 3TNNA 2EKJA 3W2DH 2IANE 3O81A 4M3JA 1BZ7B 5JW3H 4LLYA 3ZLQC 1J0IA 5GS0H 4MWFB 4BQ6A 4R90H 3HTLX 3SKJH 3QHTC 4KRPB 1DBML 4U1SB 5E1HB 1KFAH 1NKOA 2QQQA 3RWHA 4NWTL 4Q2ZA 2BSTA 3TBSA 4XHJD 4V1DE 1RSFA 4M02A 4QRTA 5DR5H 1CG9A 4HUXA 2PYEE 4YHOL 5C0IB 1UB6B 5HDQH 4ZMAT 1RK0A 1CE6B 1FFOB 1IC7H 4K71B 1G7PB 3FB7A 2X7LA 1A7OL 5TE6L 4LF3B 1BOGA 3MXWH 2W9DL 3QJHA 3P0YL 1XF5B 2WNGA 1JTPA 2DRUA 4YK4B 3BOVA 4MA7H 5IR1B 5JPMB 5D7IA 3BZ4A 3KJ4C 3VFSB 1MHEA 3B8SA 1FV1B 4HIXH 4DZ8B 2FLRT 4OD3H 4NO3B 3MLUL 1OAKH 4GJTB 5C3TA 3TC9A 1T1XB 3L3OB 2IGFL 3M1BA 3EDKA 3LDBC 1JF1B 2G5BB 5I71B 3CVIL 3LEVL 5GRYA 2JK5B 4YE4L 1A4KA 2DWEB 4DQOH 5DQDL 4NQCB 5SWQB 5JOEA 4ZSOE 1E4WH 3RX7A 3KXFB 1OD7A 2ADIA 2FX9L 1KSRA 3T2NH 5KAQF 2FJFB 5L2JB 2Z91A 1PY9A 3MV9E 1P2CA 3ARXA 1MCBA 1MQ8A 5FUZL 3D6GA 3BKYH 4PJXE 3KYOA 3V6OC 4XP5H 1PZ5A 4XXCC 1MLBB 3U48A 2FYYA 2XWBB 3VE0A 4F80A 4UAOB 4APQA 3SCMB 3E8UH 1J8HB 1WZMA 1OGAD 1NANI 4O2EA 15C8L 2E9BA 1IGCH 4X5WA 1F3JB 1FE8L 5LG1A 3BJ91 1A14H 3SE8H 4JG0L 2R2HA 2A6KB 1ND0A 1FVEB 1MCQA 2DLTA 2LU7A 2BNQB 3S5LG 4EUPB 3KR3L 4D0CA 3K8LA 4NN5B 4Z76B 1MHCA 2J3SA 3VXTB 1HINH 3O8XD 3DTXA 4H20H 1RZGA 1MAML 3BRGC 3DRQA 4HBQA 2GFBB 4CDHA 3TBTA 1CGUA 3K2MC 1TTUA 2GQHA 5DRWB 3C60A 1CGXA 3QEHA 2XV6B 2VUOA 4IRJC 3E3QE 5FECA 1T5XA 1LO3L 3MOBH 1GRWA 3WFEH 4F7CB 4F57H 1ZT4A 2DQEL 4GBXC 4W4OC 4YUEL 1YEDA 2MNUA 3ARFA 3TNNB 3O6FA 5EUOB 4ODUA 3MFFA 4YGVB 3GO1L 4LLYB 1TVBB 3A6CH 1BLNA 1DQMH 5ECJE 5DSCB 1Q38A 4WU5A 5KSBE 3TO4A 2J6EA 4GXUN 1CIUA 3DUUA 3UTPE 4N8PA 3RWHB 4Q2ZB 2BSTB 3TBSB 3MRPA 3RVWD 5FB8A 1EFXD 2OTPA 4OZIE 1PG7X 4HUXB 3MPCA 1KB9J 2VQ1B 1RK0B 1UWEH 4PP1C 1QO3A 1CGSH 3FB7B 2D3VA 2EC9U 2OYPA 5I8OH 1BOGB 1MFAL 3MUY1 5FO9A 4ONFH 1RUAL 3QJHB 3QQNA 4LCWA 3C2SA 3V9FA 4NCC2 2B0SH 3QNZA 5ISZA 1ERNA 5DJ8A 2NY7H 3BN9D 1QSFE 2JJVA 2R0LH 3FQNA 3W9DA 1AE6L 1FYTA 1IQDA 2HJKA 1S9KC 3VFRA 2YSSA 1U3HC 1JPTL 3LMJL 1A4KB 3H9SD 5F7EL 5IVXF 1BD2B 1VFBB 3L5WA 4FTVE 2PW1A 1QYGL 4DKFH 2VJXA 3L1OL 3SDXA 2ADIB 4RMSA 3V6ZA 3QXVA 4J23A 3ZHLA 1OP9A 2P46B 4DAGL 4HXAL 1P2CB 1BQHA 3FOMA 2EDFA 2IFFH 3KYOB 1MI5B 5F70A 5F8RC 1T7XA 4I77H 4JN1L 4ZNEE 3VE0B 4U0QB 1UM4L 4XB8A 3X3GH 4APQB 1KCRL 4EXPX 4O2EB 3IDIB 4Y1AB 3NPSB 3BYTA 1RUKH 1T0MB 4X5WB 4OSUH 2Q8BL 5I9QB 4Z18A 1CU4H 3RUGB 2GHWB 1WT5A 3N85L 43C9A 5IBUG 3GSRA 2Y7QA 1ZGLB 2AJYL 1D6VL 5F1OB 4DVRH 3DV4A 5ERWA 3VXME 1WQVT 4D0CB 3VWJA 1U2HA 4GKSB 2YUZA 5DVKA 2M1KA 4AEHL 1CDCA 5L88L 2ARWA 3DTXB 1BJ8A 1KPUA 4JR9L 3IKCA 5IIEA 2J4WL 5ALBL 2J1KA 4EJ1C 1QQDA 3DRQB 5B8CA 3F7VB 4MXVF 5EZJB 3TBTB 4EKXA 3O6LH 3QEHB 3MXVL 2VLLA 4BYHA 5A1AA 5BVJA 1PD6A 1UGNA 1SY6A 3MV11 4TUJA 4Z6AT 1SQ2N 1TDQA 4P2RE 1ZT4B 3E2HC 3FKUS 4LLMA 4XTRD 1JHKL 4OI7A 4LDLB 5D1ZD 3ARFB 1ZLVK 1KT2B 3O6FB 4ODUB 3OZ9H 3CVHH 3MFFB 4U6YA 4QNPE 3LZFH 1M6OB 2MWCA 5EIVA 5HPMA 2GK0A 4K8RH 3CFEA 4X7TB 5CD5D 5HYFA 4KKBD 4RZCB 5HGBA 3MJ9A 3S5LA 4HFWA 1MEXL 3V2AR 5BRZA 1ZA3B 3E6HA 1MCSA 2FB4L 4QHKI 5J89A 1HEZA 3MMEA 3RVVC 2WUBL 3VMNA 1QO3B 1EPFA 4GOSA 1MCDA 5TE7L 1T0PB 3GSQA 1J86A 4RSVA 1BM3H 2BZDA 4QCIB 2QQNL 1I1AD 2PTUA 5FO9B 1WWBX 2R9HD 3KHOA 5HYSB 4LCWB 4DVBB 1A7RL 4XNZC 1WFOA 2OSLA 1A3LH 3QNZB 5ISZB 5K59E 5I1HL 5DJ8B 2W65A 5DEGA 1QSED 5C0BB 1Z9OA 2IPUG 1YMME 3W9DB 4N0FA 4HPYH 5F97E 1CL7H 3BKJL 3VD4A 3VFRB 4TYUA 2YSSB 3THML 4PJ9A 4FFZL 1JCKA 4LL9A 3K80A 3WNPA 4XXDA 1Y18A 3BP6A 4WEUD 5BV7L 3L5WB 1I85C 1J18A 1DEDA 4MD0B 2PW1B 3OB0K 4D9QE 5B39B 5HHQA 3SDXB 2WK2A 5E70A 2AJ3A 3V6ZB 3VXUE 1JYXA 2EYTA 3SGKA 2WIMA 3AB0C 2B8OT 4LCYA 1OW0C 1G7MB 4NWTH 4TSBH 3MODH 3N50A 4P2OA 3FOMB 4XPFL 5KOVC 4DTGL 2E9WA 2D4DA 4JY5L 4RMWA 8CGTA 3N1PC 2VB5A 5SV3A 3MNWA 1EBPA 5HHNA 5ICXA 1A2YA 4OCSL 3HAEH 5T5FL 1D5MA 4PIRF 1DVFA 3QEUB 2ZUXA 1KELH 2W9DH 2ICWA 43C9B 3GSRB 2Y7QB 3PGCA 3RY6A 3V0AC 2V2WA 2R69H 5KW9L 3DVIA 1MRCH 3MOAL 3DV4B 3OQ3B 3KG5A 4POZC 5ERWB 3BDXA 3EW3B 4KJQD 3VWJB 2NX5D 3IGAB 2OJZH 4WI3A 5DURD 4U31A 3TIEA 3MYJA 6FABH 4MJ4A 3IKCB 1OAYL 2DQGH 2NY0C 1WIOA 2K9UA 3TFKC 3PXHA 3GGWA 4QRSA 4NPYA 3LEVH 4R4FH 1QQDB 5B8CB 1HSBA 4YIQA 5DQDH 3VXSA 4P4KC 4WU7B 3BP7A 4NRZB 1UH2A 3BH8A 3KPLA 4JG1L 1T7VA 1JZ3A 4ELMF 5BVJB 1ZSDB 3TV3H 2J88L 5H94B 3SBWC 1QLFA 5IQ9B 4TUJB 4EN3A 4ODSL 3IF1B 2GW5A 3K8MA 5FUZH 5FYJU 4BUGA 3VFMB 2F54D 2DQDL 3O2VH 4HWUA 2H3NA 3NIFF 3MV7B 2DTML 4U6YB 2OQJB 1OQXA 4BQBA 1OVZA 3QULB 3GKWH 3CFEB 5D7LE 3UTTB 4ONOA 1A4JA 3S5LB 4X4MA 4HFWB 3V4VL 1MF2L 3EDDA 3E6HB 1JNLL 3QAZB 4XAWL 4YXKH 2G60L 2C3XA 4LSUH 1HEZB 4R9HA 4A6YA 4ORZC 3O4LB 1MY7A 4WHDA 2CKBH 1BREA 3OR6B 4NHCH 1PJ9A 3GSQB 4Z0BL 3G5VA 4YHPB 4PRPA 1JRHL 3KWWB 4MNQE 2QSCL 3UTQA 5C92A 1D5XA 3ZL4L 1P7QD 1VGKA 4PJDF 4XRCA 4NBZB 1SJEA 2W65B 3R0NA 4JE4B 4OFDA 5DEGB 4EQ2A 5I1JH 3GI8H 5J13B 1LO3H 4PLKC 4OLZL 4YNYA 3LD8B 43CAA 3NAAL 2DQEH 5D1XA 4E5XA 4YC2C 1OP3K 2Y07H 4PRDA 4EXKA 1D7FA 1Y18B 3BP6B 3GO1H 2ERJC 5DJ0A 2R56H 4W6WB 5ITFB 4KJPD 2EDYA 4TQEH 5HHQB 1EJOH 5DFVD 4M7LH 1CDIA 4AT6A 2EE3A 3GM8A 3VMPA 1F4HA 5E8OA 1CXLA 4YHZH 2M8XA 5TQ2L 1CFQB 3NA9L 2B39A 2DJUA 1V3MA 4KPHL 8FABB 3C5ZC 3MLWL 5K9OA 5ID1A 4ZFFA 3I75B 4K3GA 4M43L 1I9RH 2YD2A 1MQKH 3MNWB 5HHNB 1I8LC 3CDGB 1KB5L 2B20A 5IJKA 1EUTA 2VDOH 3HE6A 1MFAH 4W81A 3LV3B 1DVFB 3L3DA 5LXGL 3ARBD 1UWXK 3PWNA 3WFBH 2ICWB 3ZTJG 5ICYA 3PGCB 3WFCH 2V2WB 2DQCL 5C0CA 3T0DA 4P3DB 4TOYL 5I18L 2V7HA 1S7WA 1MFBH 3L95A 4XPHL 4HX1A 1D5IH 5HYJD 1GYAA 2AGJH 2Z31C 4I18C 3GGWB 4I3SL 4NPYB 2E7HA 2OK0L 1JPTH 3JVGC 1DLHA 1U91A 1J0JA 1HSBB 3LMJH 4RIRA 5F7EH 2Y06L 3WDJA 3BP7B 3UTSE 3BH8B 5I1LA 1B4RA 4NO0B 3AY4A 3OF6D 4B7LA 2AKRA 4UT7H 4GMTL 4HBCL 3MO1B 3Q6GL 4CADB 1MCOL 2NXZD 4FXGA 4D9RE 4KTYA 3EUUA 1NAMB 1RUQL 1CZ8L 4MLIA 2ID5A 3BW9B 4IM8A 5FDWA 5EOCL 1E27A 4TUOA 5KS9F 1RJLB 5IBUB 4ODVL 5IFJB 3T04D 4HULB 4BSVA 1A4JB 5D8JL 1F8TH 2FO4A 1X7QA 5DD5L 3DXAA 2AJYH 2XT1B 5C7XH 4MAYD 3LEXA 2CMRL 4AM0A 2ZJSL 4YGAB 1X5FA 3RA7L 2DJSA 1WFNA 3G5VB 3BE1L 32C2B 4PRPB 1PKOA 2J4WH 4LVHB 2CDGA 2A74A 4LDEB 4CMMA 1WC7B 1G7HA 4LRIC 3MXVH 3UTQB 4MQ7A 2NY6D 5E08L 5I66A 5J1AA 3BI9X 3S6CA 4HUNB 4H0HB 4LSPL 3U4BH 4JPIB 1NMAL 3C6LA 1A22B 3OXRB 2B1HH 3RTQC 3MV8A 1CDUA 3SDYH 2JCCF 3LQAC 4ZUWB 4NQDE 1VEPA 4FHBD 4YNYB 43CAB 5FGCB 3WNOA 1I1FA 2KQNA 5D1XB 4E5XB 3QG6A 5DLMH 4TUKL 3GMQA 5DJ0B 4RFOL 1MNUL 4N9OB 4X6DA 2PO6C 4GSDL 3PXJA 2CKNA 4HIEA 1CTOA 5HYEA 4KY1H 3MUJA 4HAFA 1Q0XL 5GZND 4CJ0A 3KPQA 4KTDL 4LVOC 5K9OB 4ZUTA 2VNCA 5HDLA 3LS5L 2D0HA 2HVKA 5K9KB 4X7CC 3BYYA 5DJDA 4TNWK 1E4KC 2K7QA 4DJMA 4G6JH 5E8PA 3C5JA 3OX8B 1DFBL 4HJ0C 3PWNB 4OZGF 2HRPL 4WW1A 5ICYB 1BWMA 1BQSA 5IB1A 5C0CB 5EU3A 3QHFL 5AYUL 4U3CA 3QIUC 1BHGA 1Q9WA 2V7HB 5TF1L 5I1HH 5L7XL 1S7WB 5D7IF 3ZDYF 3AS0A 3UAJC 4NQXA 3AS3A 2HH0H 4HX1B 5JZ7D 1AGFA 5JW5B 1GGBH 2A77L 2EDXA 4GMSH 1DQJB 4TULH 5D7JC 4QRRA 4U1GC 4HGWA 1DLHB 1U91B 2XFXA 3BGFC 4RIRB 4WENB 3GK8L 4U1NA 2WWKT 4ENED 1CFVH 5IVOA 3O0RH 1P84K 1EFQA 3GM0A 3HG1E 5SX4H 2O61B 2EZ0D 4M6OH 2AKRB 1JWMB 2DN7A 3MV9D 5J12B 4OQ1A 4JZJC 5HD8C 2V5TA 1CVRA 5T3ZH 2PN5A 5DT1H 4XPFH 4HWBL 2VZOA 4DTGH 4M7LT 3HCVA 5IFAL 2A73B 1AD0A 4TPRH 3PL6D 1FZOA 3GSXA 5FDWB 2XN9A 1EUUA 5L9DH 2BRRH 3ARUA 4DW2L 5L6YH 5TJWK 3LIZL 1CE1H 1LEGB 2X4PB 3KDMB 4KC3B 4XXCA 2YPVL 1P4BL 2FO4B 3CZFA 5DJYA 3DXAB 2ARJA 4WY7L 3MOAH 5TQ0H 2GY7B 1PKQE 2V9QA 5GSVA 3LEXB 2I27N 1YY9C 4GW5A 3OKLA 5C0GA 1XCTA 3QI9C 5IP4A 2X4QA 3QUXD 3N9GH 2CDGB 1MCLA 5SX5K 3S4SG 1NCAL 3K2UH 2A74B 1HCVA 4CMMB 2VITB 3AU1A 4MQ7B 3BGMA 4YHNB 4LAQH 3VGFA 5I66B 5CAYB 4WEMB 5J1AB 3CFCH 1O7SA 4ZPVA 1OTUD 3MV8B 1M4KA 2EE9A 4R26H 4E42A 5BOPA 2PR4H 5E2TL 3UZVB 4ODSH 4YXLL 1MCNA 2C7UA 1I1FB 3TF7C 4YPJA 3WJLC 4IRJA 5IKCA 2NLJB 3QG6B 1VERA 2VN7A 5AG9A 2W0KA 4RAVB 1F00I 4PRIB 2BY1A 1B0WA 4LHJB 1GJIA 4HCRA 4X6DB 4GBXA 4W4OA 5FYKU 2X2YA 1WBXA 5CD3A 1O5DT 1FIGL 3VRLE 1MF2H 5F72S 1W0VA 3BIKA 2D31B 3KPQB 4CAGA 5L0QB 3ULVF 4ZUTB 4ZOEA 1B6DA 2G60H 3RX5A 2HVKB 3T2PA 3DSNA 2JJSC 3ES6B 1GGYA 5LBSH 3LS4L 3TH3T 3WNKA 2HN7A 1G9MH 1QKZH 2QQLL 3VGAB 3F58L 4FQCL 1HYSD 5E2VL 1JRHH 1TZIB 3C5JB 5CLTA 5TE4H 3ZDZF 1JZ4A 1RUPL 3MBEC 5IVXE 4BQ8A 4RRPG 3QDGD 5EU3B 3ZL4H 1I3UA 1T21A 4OD1H 1Q9WB 4OFYA 4LQFL 1QSFD 2YD6A 3QUMH 1QLRA 1EEUA 4MVBC 3FZUC 1FFPA 1AGFB 2Z35A 4OCRH 5B22A 3W0WA 3NAAH 1K8DB 1I7UA 2ED7A 3QB7C 4QRRB 4LLQA 4HGWB 2XFXB 1U8QB 4FTVD 3L7FA 3I2CL 4P46D 4WVRA 4RMQA 3LDBB 1XR8A 1U3HA 3WBDA 4KMQA 3OKEA 2IBZY 3VDAA 2A9NH 4LMQE 4NKDA 1OWRM 1C1EL 1IEAA 4ZFOA 1T20A 3V6FB 1V3LA 4MXWL 3TYGL 1RZIB 3H8NA 3MLWH 3UJTH 1OAXL 4NKQB 1RURH 4YZFF 2D7TL 1AGCB 3GSXB 3ESUF 3QFJA 5CEZE 4G8GB 4BK4A 1KB5H 4H5SA 2MMXA 5ETUB 3TJHD 1KPRA 5HHPA 5A2LH 4RGMB 5LXGH 2AEQL 4MXVE 3HRPA 1GC1C 5F7DB 5DJYB 3VXMD 2ARJB 1VFOA 4PJAA 4IIQB 5I18H 3STZA 1U93A 4UI2A 4JJ5A 4X6FA 5GSVB 1NC4A 1N7ML 1NCBL 1BQLH 2FEDD 3OKLB 4GW5B 3KPMB 4JY6A 2X89D 1LEKB 5E6ZA 4NN7C 3TN0C 4G3YL 1XCTB 3LCYA 2YK1L 2X4QB 4LARL 4CVZA 5ACMA 2QV2A 1KIRB 3RZCD 2ED9A 3AU1B 1ACYH 4HJJL 5MP6H 3LSOA 4PTUA 1I9EA 1MAJA 4ZPVB 1JPSL 4F2MB 4KKCD 2NW2A 4E42B 4LSQH 4U05A 2PTVA 3B9DA 5I73C 4P2RD 5I19H 2C7UB 3QCUH 1MWAB 4YDVA 4MD5A 4DEPB 1RUQH 4LPUA 4LIQL 4N9GA 1MJUL 2CGRH 2OTWB 4JQIL 4BZ2L 1A7BA 1A9EA 5EO1A 2ZP0T 4I13B 1G6RL 4GBXB 4O02H 4PBVC 5DEFB 4ODVH 3P9LA 4XMPH 1WBXB 5CD3B 3WNLA 5D8JH 5I6XC 1LP9E 2QADC 3D69A 1W0VB 5DD5H 4PY8I 1QHOA 3T3MF 3SKOA 4WUKL 1RZKC 4XP6L 5E4EC 5J3HD 1S7SA 4EDXA 3KYAA 2DM3A 4TTDD 2CMRH 5KZCD 2ZJSH 2RCSL 4GG6F 5F6HJ 4XPTH 3WKML 2R15A 4D8PB 4YBQD 4LKXA 3U46A 2OTUA 3K4DA 5F7WC 1EFXB 3BD4A 1K4CA 5GJTH 5SWSE 3DI3B 4MCZA 1N6VA 5DHVH 1F3RB 2FECI 2WW8A 1QLRB 1YMMD 5EZLB 1HH6B 1UZ8A 1FFPB 2Z35B 4NKIL 3W0WB 1WTLA 1I7UB 2VL4A 4OKDA 2IAMD 4LLQB 4OCWL 3DRTA 5KANG 4S1SH 4X5XA 2F53E 3L7FB 5FKAA 4LHUG 4D9QD 4RFOH 1ZXQA 2NQCA 3NGBB 4BZ1H 1OTTC 1MNUH 2GI7A 3LQMA 2ZOKA 4FFYL 2NYYD 1XR8B 4GSDH 1U3HB 2JF1A 1BMGA 3OKEB 3V8OA 5HYIA 4NKDB 4JFFE 2E3VA 4JFDA 1I85A 4ZFOB 1PVHA 4XCFL 2RIKA 4X7SH 5IUSA 1CL7I 4Y4FA 5FCUL 3U4AA 5CP3A 3ULVH 1G0XA 2BNUA 1OW0A 3QFJB 3SDDD 1ADQL 4H5SB 1NUNB 4DOHB 5DMKA 4XP1L 4RRPA 3RWJA 5IW1B 1KPRB 5HHPB 4NJAH 5IMMB 1CR9H 4XP9H 1VFMA 2HRPH 4PV9A 3PHQB 3ZE2F 1FAIH 3WYRA 3STZB 4ELME 5JUEH 1U93B 3FFDA 4JJ5B 3SGDH 5T1LA 4OAWB 1NC4B 2VZTA 1LO2L 4JY6B 2BSSA 4I48B 4M1CC 2GJ6A 4CVZB 2FJGB 3H7LA 4NQEA 3QIBC 4Z7QE 1D5BA 3GK8H 5TDNB 5GS0C 3NIFE 4NM4H 5CZVH 5FYJH 1G0YR 3ARRA 2DLHA 3TA3C 4PTUB 1T6VN 4PFEA 3ARGA 1T89C 2NW2B 3QNYA 1EK3A 1P4IL 2AI0L 3O41A 4MD5B 3WIIH 3BZDA 1HKLL 3U82B 4CNIA 3SBWA 4Z8FH 1S7QA 4N9GB 1SEBA 5I16A 3IXTB 1UA6H 4DW2H 5T3XL 1A9EB 1AO7D 3E2HB 5ADOL 3ULUH 5FUOL 2JE8A 3JUZA 4FQXD 2V5YA 4GFTB 3D69B 1V8HA 5C0AE 1FH5H 3QWRA 3SKOB 1NGQL 2AJSL 3FAWA 1KENL 4NHUA 4PUBL 4XP4H 4U6HA 1Y0LA 2ESVD 1V3KA 4U6VL 3S4SB 1YY8A 2O5XL 2P8PA 4X4XA 2LAGB 3C08H 5K93A 4MNQD 5INCA 1AXIB 1X5JA 4NT6B 5IVNA 1SJHA 1J8KA 3NA4A 3I6KA 1NCAH 4LKXB 3U46B 5D1QD 3HR5A 3CH1A 2W92A 1K4CB 1NCDL 3RWDA 1MFDL 3EO9H 3V7AE 4MCZB 3SE4C 3OAUH 3HN3A 4G6AD 2VXQH 4LK4A 5T3ZE 1R5IA 2DKUA 5CEZL 1A6UH 3O8XC 5EBGA 3QDHA 4GKOA 1CQKA 4N5EC 5DJCA 4R2GB 3FMGL 3TJEH 4Y0GA 3MRFB 3OJMB 3UTOA 3OMZA 4G9FA 2HT3D 3WE6A 5DUML 3WV0A 1QSEB 3VD5A 4WW2A 3NIGF 3D85D 2DS4A 3JWOH 3GIZL 2HMIC 4HG4J 4PLJD 1FIGH 4L1DA 4JFDB 4IS6B 5EIIB 5DVOA 3QXDA 5JHLH 4PJHA 4MJ6A 4I0PA 5F7NC 4Y4FB 5C6TL 1IFHH 1TZGH 3FT4A 2CQVA 4GAJH 2A2QT 3AB0B 4MAUH 2BNUB 3DECA 3EJJX 1H15A 1EAJA 1R3LA 4R96A 4UNUA 4UDUA 3QPQC 3RWJB 1ZS8A 3C5ZA 1CFNB 4O2CA 4Z7VB 4NKOA 1MFNA 2VOTA 9CGTA 4XVJL 4XNQB 1AQDA 5DRZB 1JK8A 4PV9B 5IFHL 2C1OB 4AIZB 3RVWC 1I8LA 3HE7C 3FFDB 1ZLWH 2OR9H 2BCKB 3VFNA 5T1LB 3FN0H 3C8DA 1JGVL 2EEBA 3FFCA 3KXFE 4L3EE 3LN4B 4LHUA 2CLVA 4GRLC 4Y5YB 4OUUA 4F7PB 1MHHA 1P84J 5D70L 1D5BB 2Y36H 3EFFA 4N90E 1AFVH 1I9IL 1MVUA 3DX9A 4N1EA 4XPBH 4JKMA 1IM3B 3U0WL 5HYQA 5C08A 2NY0B 3UCRA 4I18A 2Z31A 5KS9E 1RIUL 3ARGB 1REIA 5DURB 2OJEA 3K0WA 3QNYB 1YYLH 2W38A 3TESA 3X11A 1R5VA 2X09A 4D9RD 3O41B 4P4RA 1R5WB 5FDYA 3RGHA 4P59H 3TCLA 4MXWH 1S3KL 3TYGH 2PXYC 1OAXH 4KJYA 4CNIB 1BBJA 1QNZL 1V05A 4U1MB 3VFOA 2D7TH 2J8UA 2CR3A 4OLWH 1S7QB 3VG9C 1BJ1H 1IT9H 1TVHA 5I16B 3IDGB 1YC7A 1T66C 1CBVL 1FZJA 3WIHA 1FL3A 1QP1A 3I6LD 1U6AL 3IFLL 2AEQH 3BP5A 4XVSH 4YBHA 4FQHA 5E2WH 1DBBH 1RJYA 4KZDH 4FMFA 4LLDA 4QF1A 5DS8A 4MDJB 3HNVL 4PG9A 2EIZA 1OGTA 5BJTB 4U1KA 1O0VA 4NHUB 3FTGA 1ZT7A 4QHLA 3WUWA 5DTFA 2DIAA 2BDNL 2JCCE 1YY8B 3HI1B 2P8PB 4X4XB 5CIPA 4DKDC 1F4YL 4RX4A 4K7PX 4AEIH 1UJTA 3KLHD 3MLYL 4M1DL 5E8EA 4JPWH 3IB4A 5IBLD 1KIUA 2PTTB 1MCKA 3CH1B 3CX5K 5JW4N 1H5BA 3F62A 3RWDB 3VXRA 1CQYA 1L6ZA 4RFNB 4MQXD 4RAUA 1N64L 1B0GA 5GRZA 4IMLB 4NQDD 3ZT6A 4KAQL 1R5IB 2OZ4L 4NSKA 3I50L 4NM8L 4LRIA 3HPJA 2BC4A 1Z9LA 2D7MA 3FQUA 1FBIH 3U79A 5BZDA 5DJCB 3RTQA 1NGWA 1P7QB 1MJUH 5F1IA 4OZHF 5DK0A 3M8OL 4JQIH 4HV8A 3WE6B 4P23D 3X14A 4WW2B 1IAKB 3S37X 3QIWC 5DRXB 3VCLA 4X6DF 4Y2OA 1MIEH 1OP5H 3S36L 2IANA 3QXDB 3G6AB 4XP6H 2ICEB 4I0PB 1HILA 2APBA 1XZ0A 2FWOA 3LKPB 3DYOA 3FT4B 3I6GB 3ABZA 2GSIA 5D7IE 3ZDYE 1FCCA 1H15B 4J4PD 4O5LH 1FZMA 4UDUB 3LEYL 1ZS8B 5LQBH 2VAAB 3QYCA 4O2CB 4WEBL 5CJBA 4NKOB 3ZKXC 3U9PH 1AQDB 2PYEA 4W68A 4OQTL 3WD5L 5AAMA 2HJFA 1MJ7H 3F65A 1QRNA 3RGVC 1E4KA 5FYLE 4RBPH 1IKFL 1ZA6B 3R1GL 4NFBA 2X1QA 4HT1H 4RGNE 3FFCB 1KEML 2P7TA 2VDQL 4BFEA 2AV7A 4Z7UB 1SYVA 4GS7B 3H9HA 4LHUB 1H0DA 2CLVB 4N0CC 2ZZUT 3IFNL 2I60L 1I1AC 4OCWH 1CD8A 1T2JA 4L8SC 1T7WA 1OAZH 2R9HC 4LCUA 4FABL 5I1EH 1FO0L 1HHHA 3CFDB 4D3CL 2OL3H 3SY0A 1MVUB 2RQ8A 3HG1D 1W8NA 3LRSA 5C08B 1FGVL 2HLFD 1ZHNB 3L9RA 3MCKA 2Z31B 3W5NA 4FFYH 1Q9OA 5D7JA 2OJEB 4P99A 4H0IA 4H1LA 3X11B 4P4RB 4FP8H 4EVNA 3TCLB 4ZSOA 2WBKA 4RCAA 1PYWB 4OGZA 2C9AA 2AK1H 4HMCA 3ALXA 2J8UB 3RVUC 1A7NH 4QRQB 2F5BH 1JYNA 3SJVA 2AJZA 2FIKB 1A7PL 1FZJB 4F58H 1FL3B 1H3GA 5D93C 3QNXA 1JTTA 3O45A 1NGYA 5SX4I 3WHE0 2NXZB 3DI2B 1DBKH 4TRPL 4KZEH 4L4JA 5E6IC 1IBGL 4LLDB 4QF1B 5DS8B 5EUKA 3TPUA 5D6CA 2EIZB 1LDPL 1OGTB 4YDLC 2A9ML 1ZT7B 4QHLB 5DTFB 3V4UL 1LO2H 2Z9TA 3EOAA 3BAEH 1IM9B 5CIPB 1U8KA 1INDH 3KLAA 2HJLA 5HVGB 3VXNA 3ESVF 1H5BB 2M2DA 2B2XH 3RL1B 3SGEH 3VXRB 4N0YH 5J6HA 1P53A 3QI9A 1C12A 4RAUB 4JLRA 3AAZA 5IMKA 1IEBA 3WCYA 4NSKB 5EU6B 3BQUC 3HPJB 2BC4B 2AI0H 1OAQH 2YN3A 4JM4L 1HKLH 5FYKH 3SDAD 2F8XC 2PW2B 1FORL 3G04B 1KIPA 4L8DA 1GOFA 2R2EB 3ULVE 3RTQB 2NY6B 3C6SA 4OM1L 5LGJA 1F97A 1IAOB 1T7YA 5F1IB 1E6OL 3T4YA 3EFDL 2C5DC 4R7NB 2V5SA 4U2YA 5DVLA 3SO3B 1WV7T 3QRGL 4YHLH 2EDDA 3NCCB 5ILTL 3WJLA 1J5OL 3QQ3A 4XBEH 3OWEA 4ZO8A 1UYWL 3ZDZE 2IANB 3GSVA 1V7NH 1IC4L 2R1XA 2V2XB 5GS3A 4WO4B 5D96C 4FNLL 4LCWE 2EXYC 1HILB 4XPAH 1KCKA 4PUBH 5A16A 2FWOB 1A8JH 4S0SD 4GQ9H 2GSIB 1XGUA 5F89A 2BERA 3HUJA 1X6NA 2CRYA 2H8PB 3DV6A 3WHE1 4LPWA 1XF4A 4V1DB 4UZGA 3NN8B 5CKAA 1EV2E 3FQTA 1FYTE 2V17L 3RNKA 5AEAA 3L5HA 4HC1A 5GS2H 2PYEB 3GI9H 2JJSA 3M17A 4XBPB 5JW4R 5T3XD 3U4EA 1NCDH 2W0FA 3SE3C 2NXYC 3VG0H 4PJIA 5D71L 4KH2A 5F9WB 2DMCA 4WUUA 3EO0B 3SDXE 3WFDL 1EO8H 4G7VL 3MBEA 1SYVB 5TFSH 4WTWA 4ETYA 4QO1A 2DQHL 5IESH 4LCUB 4YZFE 3FMGH 1JRHI 5TDOA 3SY0B 1DUZA 1MH5A 3LRSB 1GL4B 5H8DA 3UZQA 1UEYA 3GIZH 3KPOB 3Q5YA 4U1GB 3SDCD 3R8BB 3BGFB 2Q86A 3DURA 2NY4B 3H42H 2DYPA 3ARED 4S0TD 4KI5D 3GRWH 3VFWB 4EVNB 4ZSOB 4PPTA 1G9NL 3S96A 1KCUL 4FQ2L 5CEZD 2JTDA 1MJ8L 5EOCJ 4KHTL 3SJVB 2AJZB 3AVEA 3MV9B 4PTTA 4HS6A 3QNXB 5EBLA 4GXVL 4JGUA 4PJXB 5JHDD 3IS1X 2BHZA 5IFHH 3D18A 5EUKB 3TPUB 1SM3H 4JO2L 5D6CB 1S9XB 1U3JA 1VDGA 1ZWIA 2K3TA 4WWKD 4GW4A 3D0LB 5CGYD 4PJAF 3EOAB 3IAPA 4JQXC 1U8KB 1NL0H 3MRMA 3V5DA 3KLAB 3UPAA 5B4MC 2VIRA 5CP7B 3G9VA 1FIEA 3S35L 3NFSL 1L0QA 4G42A 1QFWH 4HLJA 1EEYA 3QI9B 4FXLA 1RIUH 1BX2A 4DKEH 5IMKB 1IEBB 3O3BA 4JRYA 4KVCL 3RX8A 3VH8A 3Q5TA 4LEOB 4PLOB 5CSZB 2HT2C 3L3GA 3AFLA 1S3KH 3JV6B 4L8DB 3T3ME 1A6AB 4F9LA 5BRZE 2WUCL 1JGUH 1NJ9A 3C6SB 4ETQA 1CDBA 3KPRD 5LGJB 4AL8L 4JFZH 3QUZA 2W60A 1CBVH 4ZTPL 5FYLL 3QQ3B 3ME0A 3TCXA 3HC4L 3GMLA 3IFLH 3QP3A 4DN4L 2NZIA 3GSVB 4YDKH 2FLBT 4UINL 2NY2C 3TT1L 3HNVH 2WAHA 4Q9RH 1CFTA 1NC2D 5A16B 2CDFA 4PJ7F 4AK1A 3Q3GB 5EZIL 5KSBB 3CUPB 4JKPH 4OM0L 5JIIA 5F89B 5GRVL 2C3VA 2GAZB 1F4YH 2CO6B 4QHMA 1JN6A 3MLYH 2XWTA 5KVEL 2XOTA 3FQTB 4BK5A 3RNKB 5LVEA 4NO5B 1U3ZA 5CINL 4FA8A 4DGYL 3UTZA 4P9ML 1C5BL 3RNQB 3U4EB 3MACH 3QRFM 2W0FB 2MSPA 3MRRA 1D9KA 3O3AA 1N64H 4MAYC 3VMOA 4KAQH 4WUUB 2OZ4H 2GTZA 2FX7L 2NR6D 1S9YA 3I50H 4M8QA 4NM8H 4UT9L 4LFHD 3ET9F 3MLRH 5K9QI 4K3DH 2F53D 2H2SD 2XQBL 1AY1L 3MR9A 2X10A 4IMKC 5TDOB 5MENA 1DUZB 5I1CL 3OJDA 1S78D 4XHQA 3SGJC 1H3VA 4KROD 1AI1H 5DQ9A 1W72H 2VN4A 2BJMH 3RWIA 2R0ZL 3RIFK 1ED3A 5L8JB 4JFFD 3DURB 3KPSA 4NP4L 2DYPB 4QRPA 4ZG1A 5J0BA 1WCBB 2X9WA 3DUSA 1F90H 1G7LA 3ZE2E 1NAKL 4U4BA 5E9DA 1P7HL 2IPTH 2BNRA 3VDBA 4PTTB 1NGXA 3LEYH 5L2KE 5EBLB 1ORQB 3T0XA 3EOBA 5EA0H 4O2FA 1A21A 3CSYA 5FHBH 3WD5H 2QJDA 3D18B 3NCYS 1YEJL 4JVPA 3VXSE 3NZ8B 4JDZA 2EDJA 2P5ED 4PJ8D 3VXOA 5I1GH 5DD0L 3FOLA 4KI1A 4XVTH 4Y4HD 1NEZG 1KEMH 2I07A 4TSAL 2EXWD 3CLFL 1RIVL 2VIRB 5I1KH 3BISA 2I60H 1MFEH 3EO1A 3BJLA 4P2QE 4FABH 3MLSL 4D3CH 1MCEA 1I9JL 1GPOL 3ARPA 2MQ0A 4NN7B 1X5GA 1FGVH 2ZPKH 5DD6A 5CGMA 3TM6A 1BX2B 4C58B 1BFOA 1A6WL 4OGAD 3QIBA 4JRYB 3ZE0F 4EI5A 5LWYH 5AZ2H 3D1MC 4HQQL 1UACH 3L3GB 5AZEL 1RJZB 2VWEC 3TA3A 4HJGA 4X4ME 3LQZA 3RU8H 3HI5L 1T89A 3BMVA 5DZNA 4ZXBA 2FGWL 4ENEC 3OKNA 5I73B 3QUZB 2W60B 2ARJQ 2YZ1A 5MEQB 2JJWA 4LGSB 2DTSA 3VJ6B 1RUML 2EZ0C 3W5MA 3GMLB 2GK2A 5C0AD 5IHUL 1PSKH 1FPTH 4PRPE 4UBDD 4TN9A 1X4ZA 3VDCA 4IRSC 1CFTB 4U7KA 4LPCA 2CDFB 3V52L 3UBXG 4PRHD 5JOPE 3V4UH 4HF5L 5D7LA 4QRUB 2WINB 2P4AB 5I1AA 3CX5J 5GQBA 1WEJH 4OGXL 3HC3L 4KK5C 3R0MA 1A3RH 3TP4A 1NMBH 3OKKB 4OT1L 2E7MA 4UTBL 3REVA 5DJ6B 1U0QA 4DGVL 5KZCB 1D9KB 3NIGE 4OZFH 4KRPD 2GTZB 1S9YB 4D0BA 3S34L 3FL7A 3I85A 3CCHB 4XAKE 3PP4L 3QUXC 4H88L 2H9GB 3SE4A 4YWGL 3MR9B 5EORL 1ZLSH 1VENA 5F9OH 2O5ZL 1S7XB 2NY1C 1KGCD 3O8XA 5DQ9B 3TBWA 3HNSH 3RWIB 1RAMA 1YMMB 5ILTH 1JHLL 1XGPB 2J5LC 4KUCF 5I8CA 4XZUA 2DL2A 5KAQG 3KPSB 3LN9A 1SY6L 4QRPB 4WWID 2XA8H 3V4PL 3QEQA 3VFPA 2IAMB 5T1DH 4OV5A 4H25B 1JPGA 4JREB 4PJHF 1EEZB 2EO1A 4BH8A 1J05A 3VXUB 1WAAF 5E9DB 4NZTH 1NDMB 2NTFB 2ZUSA 4XWGH 4J2XA 4NZUL 1NGXB 2DI9A 1GGIL 1MSPA 3IDXL 3QDMA 2OLDA 2DBLH 3MLZL 3T1FB 4GAGH 4O2FB 2CXGA 5FA3B 1F45A 3MJ9L 4XT1C 4WI2A 3UJIH 3W11C 3KXFD 3VXOB 4L3ED 4FQ1L 2VL5A 4Y2DC 3FOLB 3N1FC 4OF6A 3EJYD 2I07B 4EI6B 1CF8H 5GGSY 3QEGH 4HMDA 4QXTA 4N90D 3HE7A 4Z5RB 3AMKA 1XEDA 3EO1B 2MCPH 4FXKA 2YD5A 3R06A 1TFHA 4Z7NF 3BXNB 4XVUD 1NLDL 5E5RB 3FQRA 4GRLA 3MNVB 4M62L 4X6CA 1J8HD 1YJDH 3SCMD 4F9PA 4ODHH 5EZOL 5KVFH 1NPUA 3SQBA 4EI5B 1LD9A 3B9KD 4YR6B 2HFGL 3QDJE 3TA3B 4HJGB 1TNNA 3NTCH 1F11A 1IGYA 3LQZB 2NTSP 3ARDC 4E41E 4F33B 3WIFA 2AK4E 2YMXH 4ZXBB 3NZHH 3OKNB 2UZYB 4I2XA 4P46C 3QPXL 2J8UF 4YDIL 5CJQL 4P9HH 4DFHA 4X83A 1U95A 2PXYA 4GXVH 1LHZA 3H9SA 5GGRY 4UV7L 2ZSWB 3MNZA 3UMTA 4EQ3A 1NEZA 3NOIA 4JO2H 1MRDL 4LEXH 1JWSA 1QPXA 1S5IH 2IMNA 1SHMA 1J1OH 4MCYA 1CXKA 1GAFH 2R1WA 3PJSA 5D7LB 3I9GL 2ZOLA 4XCNB 3HAEG 5I1AB 2UV3A 3MV8E 3DO7A 3RY4A 2ATPA 1T2QL 1JPFA 3UYOD 2CIIA 2X1XR 3NFSH 1P6AB 1T1ZB 4P3WA 5BO1H 2CRZA 1U8HA 1NMCB 3IT8D 5MEOA 5GRJL 4HUUA 5CUSL 5CJOL 3NCEB 3IJYA 3FONB 1XF3A 1KC5L 1A6TA 3FB5B 4KVCH 1WVZA 3QXUA 5IROC 3JWDL 2FEDC 5F7HA 4X6DE 5ESAA 4OFVA 1HN1A 4FFVC 3LKSA 3FCTA 5HY9A 4ZTOL 5M7QA 1Q1JH 2YEZA 3RZCC 2HA1A 3C8HA 3F5WA 4AL8H 4OCYH 4C54A 3LKOA 2NNAA 1HSAA 2BVUA 3MA9H 4J7RA 4KJWD 3LKQA 5I8CB 1YPZA 4XZUB 4JQVA 2H26A 3QEQB 5C9JA 1CK0L 2GIYA 4UINH 1IC5L 4IJ3C 1JPGB 3TT1H 4BA8A 2I5YH 4XNUL 5ACLA 1LO0L 3QIWA 1YYML 1NAML 4BH8B 1J05B 3CX2A 4G43A 3VFGH 5GZOC 4HIHB 4L1HA 4HXBH 2VXTL 1GSMA 1NBQA 5DMIL 3QDMB 3UYRL 4D9LL 2R39A 2GTWA 5GHWL 3QO0A 3SKNB 4PBWD 5FGSA 5CINH 1XH3A 1BD2D 4QRRE 1IGJA 5LCVH 5FYLD 4AJ0A 2P1YA 3VGDA 3EYFB 2VL5B 4TTDC 2DL9A 2B5IC 4XWOD 5GGVY 1GGCL 2Y72A 4UT9H 3HE7B 4JZNB 4LPYA 2MJWA 2ZUQC 1KBGH 2XZCH 3RGVA 2XQBH 4FXKB 4S1RH 1KEGL 3PV6B 3R06B 1MI5D 1TITA 1ZHBA 4I5BB 5I1CH 2DQTL 5DJZB 5BQ7A 1FLTX 4APQD 4GRLB 1FDLL 5I8EA 2XN9E 1YEGH 1U8LB 1I1AA 4Y1AD 3IDYC 2P47B 3CVHA 4L8SA 4Q6IA 1LD9B 4M5ZH 3CXDL 1HE7A 3B4NA 3NCFB 2FBJH 4G6ML 2HT4D 3UTSB 2VYRE 1IZJA 1F11B 4LAJH 1PG7L 1TENA 1IGYB 3QH3A 5T1KA 3QG7L 4YPGA 4I2XB 2XZAH 2X41A 2VLJA 3BVNA 4ISVB 3X13A 1FP5A 2NYYC 4BSWA 4XPGH 1E28A 3CFBB 3BSZH 1AJ7H 1XF1A 4X6BA 3VG9B 3MNZB 1Q0YH 3X3FH 3FRPG 1NEZB 2F9BT 1YEJH 1DDHA 3CGTA 3A6OA 2D9QB 4OF8A 1FRGH 2R1WB 1H8NA 4YJZL 4KKAD 2ZOLB 3MREA 4GUPA 3SDDC 4IRZL 1M71A 2GT9B 1HQRA 4HGMA 5E6IA 3VGEA 3WLBA 3DO7B 3AUVA 5I8KH 1UKSA 3IJSB 3MRGA 5F1KC 1JPFB 3ARFD 4MSWA 3O6FD 4Y8AA 4HEPG 3ZKND 1VPOL 1MRFL 3G5YA 5ESQA 2BY3A 1UWGL 1TJHL 3IU4H 1XF3B 1B4JH 1A6TB 4XI5D 3VXQA 4ERSH 4GQPH 3ZKSD 1T3FA 5AZEH 3H0TA 1W0WA 3FCTB 4KMLB 4JANA 1F3DH 2YEZB 2FGWH 4TTGA 2Y5TA 4TVPH 3BQUA 3B9VA 1HSAB 1BGXL 4H0GA 1WIPA 2VDNL 1J0HA 3LKQB 3P30L 3SGEI 1YPZB 1WFUA 3QISA 2H26B 3RAJL 3UBXB 4MNHA 5C9JB 4YDJA 3QXAB 1F02I 1UVQA 4LCWD 5CCKL 2UUDH 3CSBA 35C8H 4CN1A 3HAEA 3V52H 3GBNL 1JFQH 5GRWA 5ISZD 4P23B 2HLAB 2QQKL 1BWWA 1JWUA 3V0VA 1A1OA 1T22A 2WWKO 1Y6NR 3HUJF 5I30H 4FQXC 2D03H 1Z0NA 1XH3B 4JM2C 1EHNA 4OT1H 3TH4T 1IGJB 1HZHH 1N4XH 1Z2KA 4AMKH 4MXQD 1ETZB 3S98A 4PJIF 3MC0A 3MUGA 3S34H 3MOQA 4GW1B 1IE5A 4WJ5A 1JGLL 3PP4H 5EFIB 3RGVB 4H88H 4H26B 3HMXL 5D1QC 4LMQI 3GSNB 4OBRA 1KTRL 4LCCB 4HKBA 4Y16C 3ULUC 5I8EB 3V5KB 2J12B 4OLYH 12E8L 4MA1C 4NJ9H 4Q6IB 5KOMC 4DOHE 1KN4H 1CXEA 2VDLH 1F6AA 1LK3H 1IILE 1MIMH 3QH3B 4WI4A 5T1KB 4CN6A 2V6HA 3HG1B 3HPLA 4U1IA 3R8QA 4PJAE 3VWJD 1NFKA 3VD7A 1AIFA 2HT3C 3HMWH 4AYFA 1FVDA 3BD5A 3BVNB 3HB3C 4JKWA 3OKDA 1RV6X 4O51B 4BSWB 4BSJA 1A1MB 3IDXH 3RJDA 3BKCH 3OKOA 4PLJC 5IW6A 1S7TB 3LKNA 2Y1VA 2CKBA 3B83A 5HVWA 1OPGH 3ARVA 1B88A 2LU3A 5CILH 3BPNC 2DMBA 5D93B 3WFZA 3L7EB 5IMLA 4QXGL 4G8IB 4JRXA 4MJIE 4GUPB 5JXAL 4M93C 3WLBB 1HQRB 5E6IB 3CFKA 3FN9A 4KDWA 5JA9A 3OGCB 3OBAA 3MRDB 3MRGB 2HKFL 1U8OA 1NGZA 2Y5EA 3M07A 3U30C 1PKQB 4MSWB 2OR7A 4N0UA 4NN6B 4JQXA 4DGIH 3G5YB 5ESQB 3IS0X 4OLVL 5IB3A 3WXWL 1RZFH 5EZOH 3DVNB 5IG7B 1HXMA 4NRXA 4KWUA 1KUMA 3DUHA 4UV4H 3H0TB 1JYVA 5HI4C 4Q0XL 4UTAH 3P9MB 4XX1G 4JANB 4Q97A 3OKYA 1AHWB 1ONQB 4H1LH 4P3CH 2Y5TB 2WQRA 1OL0A 2DQUL 3BQUB 4YDIH 4YHML 2NY3C 1HYRC 5B3JF 4OTXL 1SVCP 1DEEA 3ZTNL 1X5IA 4OLEA 4X99A 1JIBA 1I8KA 4MNHB 3U1SL 4YDJB 4FQIH 4YXHH 1HNFA 1UVQB 3RWFA 1MRDH 3HAEB 5C09A 2Q3ZA 2JB5L 4R4NC 1KXQE 1A3QA 4KRMB 1K8IA 1RULH 1T22B 1TIUA 1I1YB 5D96B 3MRNA 3VFVA 3H3BC 2EDOA 3D9AL 4ALAL 2BMKA 4PJ9D 4ZS7H 5BS0A 5JMRA 5CZXD 2ZCHH 4ZAKC 2CLZB 4J6RL 1QSZA 3G6JF 5CUSH 1EIBA 5CJOH 1QFPA 1NDGA 5GGQH 1KC5H 1A6PA 3PWLA 3JWDH 1CDYA 3MUGB 5HI3C 3ILPB 4AIXA 5IVXB 4WJ5B 3T0VA 1FNSL 1S7RA 2NXYB 3ROOB 4RGOL 5IBLC 4U7MA 1HCFX 4YBLB 5BXFA 1L9MA 1GOGA 2LFGA 1S9WB 2PCPA 1ZLWK 3FB6B 4KHXH 1TJGL 3U7WH 1OOAA 4IMKA 1DVFD 5EN2A 5GGUA 1N3NA 2H1PL 1CK0H 3SGJA 1F6AB 5DD1L 1IC5H 3ZHDA 1CLYL 2CR6A 1PG7W 2VZ1A 3AS1A 4ZUVB 3WO4B 2W9EL 2MKLC 1MWAL 1LO0H 3BN3B 2APXA 4MMZC 1YYMH 4U1IB 5DDHA 1VKXB 4NQVB 4AY0A 2DMKA 3TVMA 1AIFB 3SDCB 5F9JA 5JDJA 1FVDB 5CJ8A 1BBDL 3IDMA 3OKDB 4UOJA 1YEFL 1V7MH 2W1NA 3U0PB 5B3NA 1IAIM 4KK6C 3AREB 4HCRL 1XGYH 1OY3B 3QA3A 2GJ6E 5IW6B 3LKNB 3P73B 2CKBB 2WWMC 1YN6B 1T0NA 4NQEE 3VXSD 1F6LL 1VCAA 2XPGA 2VXSL 2JJTC 4M7JH 5IMLB 2R0KL 1OCWH 4JRXB 1T80A 1AKJA 4AZ8A 3ZE0E 4EN3D 1DBJL 3CFKB 3HZKA 2O5YL 3LHPH 4JRWA 1NGZB 5D4QA 1X5YA 4DUWA 2Z8RA 2HTLD 4L4TA 4N0UB 5J6GA 1NBVH 4O4YH 2X4NA 5IB3B 3FO0L 4E0RB 3MRJA 3TO2A 5HTSA 4L5FH 3WDHA 1HXMB 5MEPB 4NRXB 4Y5VC 3DX7A 1A6ZA 3RDTC 5DJAA 3T1WA 2A1WL 1BZ9A 4NZJA 5BZWA 4G6MH 1HHKA 4HAGA 2DICA 5ITBH 4XMLH 1PG7H 2FX8L 1Z5LB 3SPVA 3HR6A 3NACL 3PIQB 2Y23A 1FNGB 4URTB 3CFJA 1P9MA 2AV1A 2HLFC 1DEEB 1SJXA 5I1DA 1DL7L 1DSFH 4PRPD 1I8KB 5J56B 3QQ9D 2P24B 3RWFB 1IGFH 4ZFOL 4G8EA 5KJRL 3INUH 5C09B 2NZ9C 1M7DA 1K8IB 1JE6A 1J87A 4X0KA 5J9PA 4POYA 2ADFH 1YC8A 4IRSA 3VFVB 5D1XD 4UNVA 2BMKB 3JTTA 1FJ1A 4PJDA 5BS0B 1BVLA 1LE9A 2ITDA 5F96L 3GSUA 1DLFH 2Q6WA 4G5ZL 1TJHH 1NDGB 3HZVB 1IRAY 1MUJB 4G9FE 4YO0A 3U2SB 3GNMH 3BEVB 3EYSH 4XAKD 3CDCA 4X9GA 4HH8A 4ONHA 5JPNA 4E9LA 1FNLA 1HNGA 5SWSB 4LVNC 4OF5A 2DB8A 2BVTA 3DYMA 4KK8C 4FG6D 4PJHE 5BXFB 2Q8AH 3DSFL 1WAAE 4CDGC 1XGTA 4MA3B 5HVHB 2OCFD 3BDYL 5JOFA 3LH2H 2VDNH 3QHZH 3RVTD 3ECBB 2PCPB 1LMKA 1IL1A 1ZTXH 4OJFL 1N0XL 4RBPK 2WBJC 2AEWA 4U0RB 1T1WA 3U9UB 5GGUB 1RHFA 1N3NB 5DHYA 2EDEA 5CBEB 3O3EB 3SDAC 3C87A 3DX8A 1NFIA 5C0CD 5JORA 5JQ6L 2CJUH 1C7TA 4KROB 3DHMA 1NUDA 3L3IA 3PWVB 4CBPA 2SEBA 3TVMB 3CU7A 3RWEB 1KJ3H 3HS0B 3NVQA 5F9JB 3IDMB 4LLWA 1I3GH 4LASH 3PQYA 3NFNA 4LPVA 1T03L 3NFPA 3QA3B 2F58H 4ZFZA 3Q1SL 2UWEA 1T0NB 1N6UA 2JB6B 2FCBA 5D2LA 1RZKH 2XPGB 4HPOL 1NLBL 4Z7NE 2D7NA 2VLRA 1KOAA 4PBXA 2VDML 2DQJL 4C59B 4UIKL 1QR4A 3S7GA 3HZKB 1K5NA 1T83A 5GGVH 3EAKA 1KXVC 3U0TB 3HMXH 4Y2DA 3P77A 4G6KH 4L4TB 3C2AL 3RPIA 2ORBL 5GS1C 1XIWC 1ZANL 2J8UE 2X4NB 5MI0C 3MRJB 3TO2B 2A0LC 2RFXA 12E8H 4X6CF 4LSDA 4C55A 1OQOA 1C5CL 4ZD3L 1YEKH 1A6ZB 3DX7B 5DJAB 3PHOB 4HKXA 5BZWB 1RZJL 1HHKB 2E27L 1E4XL 3DXAD 3HA0A 3SPVB 3P0GB 2QHRL 3MUZ1 1JNJA 3H7BA 1G1YA 4XH2A 4PJ5A 1AQKL 5CEYA 1BOYA 1CLCA 4M6ML 4EDWL 3QXTA 4MHHG 1MCPL 3ARDA 4ZUSB 1TQCB 2A6IB 4KI5C 3TBYB 3O11A 5IGXH 4LOUD 2XRAL 3WUZA 1MFCH 5DJXA 5D72L 1K6QL 4PRAA 2YD7A 3LVEA 3T0EC 3VXRE 3JSSA 1YEIL 3MV8D 5B21A 1UCBL 1OM3H 3FN3A 4R3SB 1I7TA 1M7DB 2C3WA 4NO2A 4X0KB 5D6DC 2O26U 3FRUA 4IEFB 2BVEA 5C0AB 1FG9C 3MRLA 3QUMA 4S1QH 4JDVB 3Q6FA 3JTTB 1FJ1B 4PJDB 1OSPL 2Q3AA 1BVLB 3TZVA 1LE9B 4S2SB 5E2JA 4BQ9A 3WL9B 2KBGA 3GSUB 5DK2B 4WWKC 4QXWA 1A0QL 4M1GL 5GGTL 4YO0B 3BPOB 3I3BA 2MPAL 2VAJA 2F19L 2F15A 4ONHB 2YOCA 1TVDA 4Q0XH 4NNXA 2B4CH 3DBXA 5IROA 2EE2A 1QFWM 4U7SA 1RD6A 2DQUH 2EDTA 3RBSA 5JOFB 1FCGA 1BF2A 2VQUA 1D3CA 5EU5B 2YXFA 2XTJC 1KN2H 1UM5H 2EYSA 3KJ6H 5E2UH 1KPVA 1YPZF 2FHCA 1YEHL 2NY1B 2YA1A 4N8CL 2FHFA 5DHYB 2IQ9L 1KB5A 4GKNA 4JO1H 3DX8B 4MJ5B 3U6RA 3ZZ1A 2X4UA 2JB5H 2HWZH 1BIIB 3L3IB 1BQHG 1FC2D 3EOTH 1QRNE 5IBTH 5EO0B 2L4OA 3ZO0A 4NBYB 1A64A 1X5HA 4LLWB 3UPRB 4OZGA 4M6NH 1VGEH 1Q72L 2RJMA 3PQYB 1UM6L 4ALAH 3I02B 2P44B 4LNRA 4QRRD 3FO2A 5BVPL 3WN5B 4ZFZB 1I3RA 2QTEA 4XGZA 1WWCA 2VLRB 4JY4B 2CUHA 4KDTC 4FZ8H 4Z78A 3X12B 1QLEL 4C4KT 3BKML 4M48L 4LDOB 5KSVB 1K5NB 3P0VH 1FSKC 5C0EA 1FL6A 4JKKA 5FHAH 4Y2DB 2G9HA 3P77B 4PB0L 3RPIB 2AXFA 1EHLL 4L3EB 2ITCA 2XN9D 1NCNA 4PB9L 3X17A 4G8GD 4HHAB 4GKZA 3SJVE 2OR8A 3S3JA 3CLEL 3K81A 4PJFF 5EBMA 1CN4A 4RA0C 4JO3H 5DD1H 5J4MA 2W9EH 1MWAH 2KZWA 2QR0A 2FR4B 5KS9B 5A43C 3ZE1F 1LO4H 3H7BB 1NGPL 1YMHA 4XH2B 4LU5H 2DWDA 1P5VA 25C8L 1U8PA 4K94H 3B9KB 2AJXH 3ARDB 4XC3H 3RWGB 4NOFA 1F4WH 3QCTH 2X4OB 5TPWL 1I8MA 4HIIA 3A6BL 5ACZB 4XNYL 2FJHA 5JIPA 3HFML 5EOTA 5DJXB 4PRAB 3DHJA 3RHWK 5F9AC 5J11B 4UT6L 3MLTA 1K4DA 5EWIL 3ZYIA 3B6SB 4LBEA 2O5YH 3FRUB 3CK0L 4JCLA 3QUMB 5DHVA 3Q6FB 3TLRA 2FL5A 4IRJD 2ZNWA 4GT7A 5AD0A 3TZVB 5C71A 1P69B 3HZYA 4G9DA 4R8WL 1RFDL 2JCCB 5DWUL 2YPLA 4PJ8C 3DWTA 4GBXD 3HC0B 2R29L 4Y4HC 4QHNB 4X8XA 2EXWC 2VDPL 1MJJA 3BRDA 3PF2A 3RVXC 4BFIA 3P40A 1TCMA 4HUWA 1FNHA 4PS4H 1J9CT 4NNXB 2E6PA 4WIQA 3NCJL 4Q9QH 3FJTA 3HI6L 2EYRA 3TNMA 1DP0A 1LNUA 5D2NC 4O00A 1KCVH 1DL7H 4OGAC 2EYSB 2NY5L 2P5WA 3HUJE 2EEAA 1Q9KA 1KJ2H 1KPVB 3DMMC 2GSGA 4WFFE 4QRTB 3OG6B 4PP1D 4GKNB 4V2BA 3NABH 1CG9B 1VACA 2BVQA 2Z93A 3CMOH 4NNYA 3U6RB 1CLOH 2X4UB 1R24A 4OFYD 4XC1L 1GGTA 4NCC1 3WJJC 2X7LB 4PJIE 2XKSA 3PP3H 4IJ3B 4OZGB 3W0WD 2IBZX 4WUUE 4DN3L 4LNRB 4U6XA 5FKPA 2D0FA 3IFOA 1PFCA 4ZOBA 5D7IB 3BZ4B 2AEPH 4X5LA 1MHEB 3BX7C 4XGZB 4H8WL 5JXEC 4G5ZH 4CMHB 4R0LA 2B1AH 4Y88A 4FQXA 1U3HD 5C2BL 3M1BB 4Z78B 5BW7C 4LSVL 1ZLUH 2KUTA 5I17A 1MCIA 4JM2A 4Q6YA 1R3KA 5C0EB 3QUYC 4PJBA 2G9HB 3MJ7A 4JPKH 2V9RA 4RGNB 4KMTL 2AXFB 3HNTL 2ITCB 1N2RA 5ADPL 2HKHL 4NDMA 1RK1A 3QFJD 3ZKQD 2ZUQB 4Z95H 4GG8A 1IJ9A 1C5DA 5AYQA 1F58L 4K3HA 4KRPC 2Z91B 3QWQB 5D1QA 1HIML 1R0AL 1Z3GH 5EBMB 3IU3A 1ZVYA 5JDSA 1EGJL 1CICC 4TSCL 1CTNA 4Y16A 4NBXB 5DMGD 4RWYL 3QJFA 1RU9H 2VXUH 1PZ5B 2QR0B 4JPVL 3UJJL 2JIXA 2FYYB 1YMHB 3C9NA 1NC4D 1DZBA 1RIHL 3UX9B 1G0DA 1T03H 3KYMA 4HEME 2PUQT 1FC1A 3BRFA 4UQ3A 2R2HB 2FJHB 4YK4C 1ND0B 1WSST 2Z0BA 2FIRT 5E5MA 3UPCA 1NLBH 3D85A 1P1ZA 1MHCB 4JAMA 1AP2A 1UH3A 4IOFC 5FEBA 3MLTB 1RMFL 1RZGB 1K4DB 1NBYA 4JRYE 5HI5C 4LBEB 3P3YA 2XQYK 2QL1A 5DHVB 3GIVA 2FL5B 1WUNT 4WNQA 3C60B 2Y9RT 5AD0B 1DQDH 2VH5H 1I75A 3HZYB 4JHWH 4G9DB 4GXUM 2VC2H 1HKFA 1MCCA 2ICWJ 5KSAA 5F7FA 5FECB 3MRQA 1T5XB 5DD3L 3EJYC 1Z9MA 1MJJB 2N1KA 4BFIB 4JHAL 4HUWB 1YEDB 2DLFH 2E27H 1A5FL 4WFGE 4HMEA 2OI9B 2QHRH 5IHZA 1BLNB 4ZODA 3T65A 1A7QL 4HFUL 4XVUC 2Q87A 4M6MH 1SEQH 3SCMC 4WU5B 2IH1A 3TO4B 3A0OA 2XZQL 1UXWA 2P5WB 3DUUB 4IDJL 1Q9KB 4ZOCA 4FQQA 3MRPB 2GSGB 4K2UL 1YQVH 3RVVD 2XRAH 5FB8B 1BECA 4G8FA 1T2XA 1VACB 2Z93B 4KTEH 4GG6A 2DIBA 1U41A 3Q2CA 1J1PL 1PW3A 4NN5C 2LTQC 5E0QA 4QTIH 1HHJA 1JVKA 4FQLL 4AEEA 2VXVL 4JZOA 4U6XB 3RIFF 3QQ4A 4RAHA 2WZPD 4R2GD 3NCBB 3BWUC 2K7PA 4UILH 2QLVB 1YJDC 1BFTA 4OF0A 1BAFH 4R0LB 3QCVH 5MENE 4M4PA 2EICA 2FBOJ 4OB5H 4K3EL 4PREA 4HUVA 2BRQA 3MJGX 3FQNB 5I17B 3T0WA 1IQDB 1FYTB 2HJKB 4ZAKA 5HHXH 4JFDD 1R3KB 3G6DH 4Y4KC 3KPSE 2FGZA 1G9NC 4QRPE 4NGHL 2IH3A 4GAYA 4U2ZA 3MJ7B 5KBNC 3T3PF 4Y4FD 1KLGA 2IG2L 1QBLL 4JN2A 4P9HC 1N2RB 4MNGE 4NDMB 1RK1B 2CK0L 5E9DE 4HS8L 4EZMA 1DBMH 3QO1A 1C5DB 2BNRE 5IT2L 1G7QA 5A2KH 3IU3B 1BQHB 5JDSB 1T5WA 4HDIA 2OP4L 4Y16B 4UU9A 4PD4K 4YHOH 2JIXB 1N5YL 3C9NB 5T1LD 4Y7MA 1QPPA 1A7OH 3VWKA 4F7TA 5TE6H 2H2PD 3A67L 5JQHC 2GJ6D 2FD6L 2JELL 3P0YH 3KYMB 1NEUA 3Q0HA 4NQED 4POZD 3D39A 4UQ3B 1UG9A 3S97C 3MLUH 2DDQL 2NY0D 1FQ9C 3TFKD 3ARGD 5L2KA 4BZYA 2IGFH 4J3XA 1OARL 1KPUB 1XGRA 5IIEB 4X4YA 1NBYB 1TXKA 1ZAGA 3MBXL 5FOBA 2EEDA 3CVIH 2A83A 4YE4H 5EPMA 2JJTA 4WNQB 4UDTA 1DTUA 2VLLB 3V5HA 1KXTB 2X5PA 3DETC 4HC1L 5FGBC 2FX9H 1CS6A 4PJGA 4EEEA 4P5TA 4KKLC 3LKRA 5KSAB 3IETA 3MRQB 2BSRA 1H3UA 1U3YA 1N6QL 4XWOC 3U30B 4P2QA 5IEHA 2R4RL 4LLMB 1D6EA 1G6RA 3PUCA 5JIKA 3L5XL 5IHZB 1TTFA 1RZ8A 4Y5VA 15C8H 3RDTA 3L3HA 5HPMB 2GK0B 5M95B 4LSRL 3GJEA 4QKXB 1Y6MR 1FE8H 2HTKC 5HGBB 1UXWB 5FV2A 4PJEA 5I9QC 1OTSD 4R7DA 4JG0H 5BRZB 1EAPA 1X5AA 2NY3B 3HFMH 4L3AA 3KR3H 4GG6B 4OGYL 3MMEB 4QOKA 1HH9A 3H3PL 4XNXL 4XCCL 4P57A 3CSPA 1H3TA 1B0RA 2CK2A 1HHJB 1H3WM 1MAMH 4C56A 4JFEA 2OXGA 4X4ZA 3ARZA 4JZOB 5F1SA 4M8VA 2UVFA 3QWOA 1U42A 2OSLB 1WZKA 4RMVA 1RFDH 4PLKD 4G9FD 1H9VA 3Q48A 4I3RL 2E7CA 2UZIL 3GSWA 3MRCA 3GJFH 4HUVB 2OL3A 5F3HA 5EULV 4N0FB 3AROA 3K74B 1GGUA 4ZAKB 4YUEH 4PJ9B 1ODAA 3NMEA 3NCJH 1AR2A 5AUMA 3QEQE 3O2DL 2H41A 4GAYB 4I0PD 4XXDB 1U36A 5BMFL 4TNVK 3ARFC 4PG2C 1KLGB 2AP2A 1KNOA 4JN2B 4NFCA 5EH1A 4OD2A 2DKMA 5KVMC 1WGOA 2AJ3B 4WV1C 3L5IA 2EYTB 3EYUL 3QO1B 4ZS6C 4K9EL 2NY5H 3C5ZD 1G7QB 4LCYB 3O9WA 1VADA 4P2OB 4WHTA 3QDME 3OG4B 4UU9B 4ZDHA 1SBSL 4OV6F 2WBJA 2WMPA 5ICXB 3FFCD 1A2YB 3VWKB 4F7TB 1VFUA 4K7PL 3SDAA 1D5MB 1NKRA 2DJ4A 3VRIA 2QSQA 4LHUD 2EKSA 1RUAH 3FQXA 3QBTB 3D39B 3MLPA 4LCIL 1JGEA 5FAAA 3U7YL 1YNTA 1M1SA 1HHIA 2HVJA 2E8YA 2UWEF 5DGRA 5C08D 5I2IA 2BXYA 1B2WL 5D2LF 2Z31D 5L2KB 3T0BA 3W82A 1TJIL 4X6CE 3TIEB 3MYJB 1LEIA 4L9DA 4X4YB 1AE6H 4J3UA 5FOBB 4QRSB 3BIBX 5FO8A 2A83B 5HGHA 4CL7A 4ONGL 4YIQB 4OZIF 3VXSB 2EDBA 4UDTB 4QLRA 3KPLB 3V5HB 4KMTH 1QYGH 4PLNC 3L1OH 3ZYOA 1P5UA 1QLFB 4P5TB 3LKRB 3S37L 4I2XE 4OF3A 4RMUA 4EN3B 4Y19A 4DAGH 4HXAH 1HIMH 1J11A 4ZO7A 4P2QB 5FIEA 5IEHB 4L4VA 1XIWA 1EGJH 2DM4A 3OAZH 3H9SE 4XNMA 2H3NB 4JN1H 1UM4H 3PDOA 1KCRH 2Q1EA 1RZ8B 1ZV5A 1U2CA 3RDTB 3L3HB 2GUOA 5KVGL 2XXMB 3N0PB 2VQTA 3GJEB 1IM9D 2Q8BH 1G84A 1S8DA 5F21B 3QDJA 4RX4D 2X9XA 3BUYA 3N85H 4E41A 3VI3E 2AK4A 2ICES 3L6FA 1D6VH 1EAPB 4FRWA 1KACB 4OFKA 3VXRD 4QOKB 5CSBA 4O58L 4A6YB 1MPAL 4AEHH 5L88H 2VZ3A 4JR9H 3ULSA 5EU6D 3PE9A 3TGXA 4C56B 4JFEB 5ALBH 3QDAA 1EXUA 3D2UA 1KTDA 4ZYKA 3QWOB 3T0EA 5C07A 3RTQD 1D5XB 2I9LA 2XACC 1VGKB 4XRCB 2W0LA 2UUDK 1SJEB 4MB5A 1L0XA 3GSWB 3MRCB 2FEEI 2J2ZA 4XMKL 2VDKL 2OL3B 5JHDA 4WCYL 4XB7A 1LE5A 2Z8VC 3STBA 2YC1A 3ZYJA 1YPZE 5J57B 5T5NF 2IAND 1JHKH 5C8JA 5KVDL 5HHVL 4PRDB 4G7YL 4OZHA 4WWKA 5AUMB 4HWNA 4WO4D 5C6PB 4NWUL 2YR3A 3F12A 1AGDA 4JO4L 4L29A 2ADGA 5FA4A 4RMTA 1KNOB 3GRWA 4OD2B 5EB9A 1TPXB 4TVSa 2P49B 4AT6B 4ODTL 3L5JA 2J7LA 4NUGL 4LVNB 5E8OB 4V1DD 3O9WB 1MEXH 1DQQA 4K2UH 4WHTB 4NC0B 2PYED 5ID1B 4ZFFB 2FB4H 1QBAA 4C83A 1UZ6F 4R4BA 3QAZC 4P0DA 3SKJL 2WUBH 4JFQA 3MGAA 3KGRA 1J1PH 2XQYG 5D7SL 3NCYP 4Z7WF 1KFAL 5TE7H 4DFIA 1P7KA 4HJ0D 4CVXA 3H9YA 3HE6B 5F7LB 2QQNH 3BH9A 3L3DB 2EKSB 5DR5L 3FQXB 1A7RH 5GRXG 1JGEB 4QNPF 1UJ3C 5HDQL 1ITCA 1AXSA 2UVEA 3R4DA 1HHIB 1IC7L 1XCQA 3SQOL 2UY7A 3LPWA 5I2IB 3L95B 4JHZA 5LKNA 4K3EH 4PGJA 5HHOA 3VGBA 1CGWA 3MXWL 1LEIB 2NY4D 5FO7A 2NMSA 3SOBL 5J13C 3BKJH 3THMH 5FO8B 4FFZH 4MA7L 3WDIA 1PBYA 1T6WA 5BV7H 4OD3L 3D5OF 5I1LB 1OAKL 3ZE1E 5CZXC 1QBLH 3ZKMC 4FFWC 2LU4A 4OZFG 2F5AL 3SJVD 2ZG2A 4Y19B 2VLJE 3JWNC 3BMWA 4DQOL 4FXGB 3ZT7A 4L4VB 1JZ7A 4JY5H 1QBML 1E4WL 4XNMB 2A38A 1GOHA 3ZMRA 3PDOB 3T2NL 5HVFB 1E27B 4TUOB 2GUOB 4OCSH 2APTA 4X7FC 5T5FH 3ILQC 5C2UB 3V6OA 3QDJB 1UKQA 4BSVB 4NUJA 3BKYL 3DOSA 4E41B 1DVFC 2FDBP 1X7QB 2AK4B 5KW9H 1P6FA 1E6JL 2W91A 2DDQH 1LILA 1KTKE 2LAAA 3MYZA 3QI9D 3JWDC 4AM0B 3VRJA 4Y89A 2AS5M 3ULSB 3BPLC 1F4XL 1OAYH 1YQ2A 2NCMA 1F6FB 1A14L 1EXUB 3D2UB 4ZYKB 1G7HB 4OFPA 2OZ4A 3T0EB 1QA9A 5CJXC 4JG1H 3FT2A 1LO5A 2J88H 1HINL 3C6LB 4H20L 1U8NA 5GIRA 5E56A 5E99L 1LE5B 2H32H 2YC1B 1L4IA 5DC9B 1W72A 5SWZA 2DQDH 4OZHB 3NIDF 1ROWA 1PGRB 3L5XH 4YHIA 1HHGA 1AGDB 3CD4A 2YUWA 2DTMH 3GMQB 2FZ3A 1KULA 1CVSC 3QFDA 3E6FA 4S11A 3MOBL 3UTPD 5EDXA 3MFGB 3N1MC 4F57L 2MQ3A 4HIEB 4NZDA 4WFFD 3V4VH 3MV01 5C0FA 1YECL 5C86A 1BF8A 4S1DC 4B41A 5EO9A 5D2NA 1JNLH 5ALCL 1FG2A 4XAWH 3A6CL 4C83B 3KLDA 1DQML 4JFQB 1GCFA 3RKDD 2C1PA 3DMMA 4WUUD 1P7KB 4Z0BH 5DJDB 3MBED 1PLGL 3BH9B 5E8PB 2BSED 2QSCH 4LVHC 4WW1B 2FATL 1Q94A 5IB1B 5ENWA 5F8QC 1UWEL 5J06A 1AXSB 3FZUD 1WK0A 1R3IL 5KSUA 2MQCA 4I3RH 4J3OC 4NQXB 5I8OL 5HHOB 2VR4A 4OLZH 1N5AA 5FO7B 4ONFL 4I0KA 2DYPD 3BPCA 3KJ4B 1K3IA 2EH7L 5JXEA 4JM2F 3AGVA 2B0SL 1BFVL 4PRHA 4U1NB 5BMFH 5EOQL 4PJBF 5BW7A 3OHXA 3J7HA 2DD8L 3CIQA 1FSKB 3QUYA 4K9EH 5FM8A 5DFWH 5TQ2H 3NA9H 2WQ8A 5IV2A 3OGOE 2YXMA 4KPHH 1BZ7A 4M9PA 3HCVB 4BKLA 4NOBA 4M43H 1AD0B 4DKFL 1FZOB 1FFRA 2XN9B 1CXFA 5HPOA 3ULUF 4L9LC 4K7PH 2CDEA 1CICA 1XMWA 4JRXE 3EKCA 4M6AA 4NUJB 3CZFB 4LCIH 4I77L 2DQCH 3KPTA 3D3VA 4TOYH 1CE6A 1FFOA 3X3GL 1Y6KR 1YUHA 1G7PA 1ZK9A 4N0UE 1RUKL 4X8JA 4XPHH 1E4JA 4OUOA 4OSUL 3VRJB 1MCWM 4JRYD 3DVFA 5C0GB 5ANME 1TMCB 4I3SH 4QYOA 3ETBF 5IR1A 2OK0H 5JPMA 3VFSA 4OZFA 4DVRL 1FV1A 2Y06H 2PKDA 2LABA 3BGMB 2WIIA 3FT2B 1LO5B 4J3SA 4MJIA 1T1XA 3L3OA 2J8OA 3QUZD 4KGJA 1U8NB 1R3HA 5GIRB 4LPTA 3NBNA 2Q7NA 2R4SL 3MRBA 4GMTH 4HBCH 5D9SA 5HYJE 3Q6GH 2JK5A 5EU7C 5J12C 1MCOH 2DWEA 3G5XA 3O6LL 4WFGD 4NQCA 1W72B 5SWQA 4IRJB 4YFLI 1CZ8H 5SWZB 5IKCB 2C26A 4YHIB 4MJ2A 3AM8C 4CU6A 5EOCH 2QKIA 2EDKA 2FJFA 3QFDB 3E6FB 5C09E 1TQBC 2QADD 3GSNL 3EJZC 1B3JA 1VEMA 5C0FB 3OZ9L 3BIKB 2E5EA 5EO9B 4PJ7A 3LZFL 4LHQB 5H2BA 1EMTL 4OKVA 5BS0E 4YFDB 4O58H 1NCWL 4K8RL 4NCDA 1D9KD 4N8VG 5JO5A 2C1PB 5HBBA 2EH8L 3RA7H 3DMMB 4BELD 2HN7B 3BE1H 3DJ9A 5CWSA 4DCQA 5IB4A 1R3JA 1FN4A 3BFOA 3S8WA 1X5LA 2A6KA 1FVEA 3KS0J 2BNQA 5IB5A 3T3PE 1Q94B 5E08H 4Z76A 3TBVA 1T21B 4LSPH 5MEND 1NMAH 1MAKA 5KSUB 2YPKA 1BM3L 2APFA 2ZUVA 4WCYH 4KRNA 3GMMA 4NQSA 3KPSD 3G9AB 3BPCB 2R0WL 4QRPD 1YEEL 5HHVH 4G7YH 1A3LL 4NWUH 4CW1A 4TUKH 2YKLL 3OHXB 3VXUD 2HFEA 5E9DD 5ID0A 5JMOC 4Y4KA 3QUYB 4ODTH 4HPYL 4F7CA 4NUGH 3IFPA 1IEAB 1Q0XH 5IV2B 1T20B 5EUOA 4F7EA 4KTDH 4YGVA 4BKLB 1TVBA 5A3ID 3LB6C 2Z4QA 1PEWA 4X98A 3LS5H 2ZCLL 5L0QC 4AG4L 5DSCA 5HGDA 5D7SH 4M00A 5B39G 2CDEB 1CICB 4TSBL 3MODL 2V7NA 2YD8A 3VGAC 1DFBH 2VR9A 4JVUA 5C0JA 5JR1L 1AC6A 3RL2A 4XHJC 3FT3A 2VQ1A 4KUZL 1Z9SA 3QHFH 3D3VB 5AYUH 4PJAB 2X40A 2NPLX 5TF1H 3TH2T 4X6FB 1YUHB 3SQOH 5L7XH 4L4TE 1RHHA 4M1CD 4X8JB 1ES0A 3QIBD 5ICZA 1KELL 2A77H 3SOBH 4EI5D 4PV8A 3WUWG 5GS0D 5F6HI 4QYOB 2B4CC 2R69L 1DCLA 3I84A 4OZFB 1MRCL 3TA3D 1OHQA 5DK3A 2WIIB 4ZXBD 2OJZL 1MCFA 5D5MF 3LSOB 1PQZA 1YA5A 3ALPA 4MJIB 1X4XA 2F5AH 6FABL 1R3HB 2BVYA 2ZSVA 2DQGL 5I74C 4PJGF 2VABA 3MRBB 5D9SB 4P4KA 4R4FL 1CD1A 4JCMA 4YDVB 2VWEE 3ARSA 3VFTA 3G5XB 1MHPL 3OB8A 1BD2A 4D0DA 4HWBH 1VFBA 3VA6A 4GRWF 5FGBA 1QBMH 5IFAH 1MREL 2C3HA 4PGBA 1CXHA 3TV3L 1DANU 3EZ8A 2XICA 1H3XA 2ZNXA 4BUHA 2QKIB 5D7LD 5EO1B 4U1HA 5GXBB 3LIZH 3P9LB 1EO7A 1URLA 2YPVH 1RVFL 1MI5A 1P4BH 1TZHA 3O2VL 4RGMC 3HRZA 3EYOA 1D5ZA 1F3DJ 4PJ7B 4PJEF 4WY7H 5H2BB 4PJDE 1S7SB 1E6JH 4OKVB 4YEEA 4EDXB 1ZGLP 3IDIA 1N26A 1G7JA 1SVZA 3GKWL 4IIQC 4Y1AA 1T0MA 1M05A 4NZRL 5JO5B 5E4IA 5HHMB 1RPQA 1F4XH 3RUGA 1AGEA 1SMOA 1VA9A 5CWSB 4DCQB 2KPNA 5IB4B 4XX1E 1R3JB 1ZGLA 2OTUB 1FN4B 4YXKL 4LSUL 5IB5B 4ODWA 2LTQB 4GKSA 3TBVB 3UROR 1DR9A 2Q20A 2CKBL 1AD9A 2YPKB 4NHCL 4ZNCD 1UZ8B 2A6JA 5E2TH 4YXLH 3GMMB 5E99H 4N5ED 4XNZB 4NQSB 3F7VA 5EZJA 3QEQD 2BY2A 5DYOA 3DRTB 4DEPC 1EVUA 4CW1B 4X5XB 5FKAB 3GDBA 1S7UA 5AWNL 2HMID 5I1JL 2HFEB 3GI8L 5F7MC 4WI8A 5ID0B 2ZOKB 4Y4KB 2RAMA 4K94C 1FNEA 3IFPB 3QDMD 2Y07L 1KT2A 1YECH 4K55A 4PG2A 4F7EB 3PQYE 4N8VA 5ALCH 1FAKT 1WAAA 2DQIL 2R56L 1M6OA 2Z4QB 4H1LG 4WV1A 4X98B 2E7LC 4TQEL 2UWEE 1EJOL 3QPQD 4X7TA 5DXWA 5HGDB 5KANI 4M7LL 5F71A 5D2LE 5HDBF 4M7KL 4RZCA 3KYKL 3LS4H 2VLRE 2QQLH 4YHZL 3F58H 5DMKB 4FQCH 5E2VH 2V7NB 1PLGH 4WI9A 1ZA3A 4Y5XC 1JV5A 3HE7D 4HW6A 4F8QA 5C0JB 1RUPH 2FATH 3RL2B 3GMPA 3FT3B 3SO5A 1I9RL 1R3IH 1MQKL 1X9QA 4LQFH 1RHHB 4GRLD 2VDOL 1ES0B 4QCIA 5D7KE 2BSSB 5ICZB 2CH8A 3VRLF 5HYSA 3VW3L 2GJ6B 4PV8B 4DVBA 3WFBL 2EH7H 4NQEB 3WFCL 1QFOA 3UTSD 1BFVH 1JF6A 2RR3A 3QDGE 3I2CH 4J1UA 5EOQH 1MFBL 2VKWA 2HAZA 2VUYA 5C0BA 1PQZB 2DD8H 1D5IL 2ZWLT 3NGBC 3BN9C 2ZSVB 2HG5A 3JVGA 4PJ5E 2AGJL 5BOZG 2PXYD 2VABB 1C1EH 4P4KB 1CD1B 2RGSA 3VFTB 4EIZC 4D0DB 4MD0A 4AEFA 4W4NA 4PGBB 1T66D 3BGAA 5DMYA 5B39A 1SEBB 4OLUL 4UT7L 4U1HB 1G7MA 2GEEA 4QHKJ 5DFTA 4HLZH 1TZHB 3HRZB 3EYOB 1D5ZB 5DMGC 4U6HB 4F7MA 1TLKA 3U36A 1Y0LB 3OR7A 1G7JB 1N7MH 1NCBH 1M05B 3QEUA 4G3YH 1F8TL 1AGEB 2YK1H 1RI8A 5FOJA 5INCB 1LVEA 4LARH 1ACZA 1GZQA 1SJHB 4KI5F 3I6KB 1X5ZA 5C7XL 3HR5B 4HJJH 4ODWB 2N7AA 3IGAA 3REWA 1JMZA 1AD9B 2H45A 1JPSH 5MHSE 5FCSH 1V5JA 2A6JB 2R4SH 2HP4A 5F6IC 2JKXA 4WU7A 2OMBA 4JFOA 4MGXA 4NRZA 5DYOB 4PGCA 4LIQH 3PP3K 4N0RA 1UZ6E 1ZSDA 3U4BL 3IDJA 5H94A 1S7UB 4GRWH 2B1HL 3QIWD 5IQ9A 1MLCA 4G9FB 3SDYL 4J3WA 4BZ2H 4Z7WE 1G6RH 3IF1A 3GSNH 2V5MA 4YC2B 4HIJA 4WTXA 2M26A 1FNEB 1NUFA 4M03A 3VFMA 5DLML 6CGTA 2ERJB 4OZGE 5M94B 3DGGA 4PJHB 3MV7A 4N8VB 4WUKH 4XTRC 1ZLUK 4MJ6B 1HWGB 1CYGA 2OQJA 4WV1B 5D1ZC 1EMTH 2D0GA 2PO6A 3O6KL 3QULA 1NCWH 2X42A 2Z8WC 1RQ5A 2RCSH 2X1OA 3UTTA 4KXZI 2EH8H 3SN6N 1R3LB 4R96B 2RB8A 4KY1L 3WKMH 5CD5C 3C5ZB 4KKBC 2WP3O 1JV5B 2COQA 1I1RA 3GB7A 4JFYA 3RGVD 1JK8B 3GMPB 1VB9A 1QR1A 1J88A 3O4LA 4LSTL 2QBWA 3VFNB 3OR6A 4YHPA 4N0CD 4G6JL 3U83A 1G6VK 3KWWA 4NKIH 1LP9F 1RZJC 3KLSA 4X9HA 1UJ3A 3OKMA