1XF4A

Structure of ligand-free fab dna-1 in space group p321 solved from crystals with perfect hemihedral twinning
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
b'ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A01
1D6VL 4M1GH 4QRSB 5FO8B 3KAAA 1S8DB 1Z3GH 1K8DB 1Z9OA 4ODVL 2DM4A 3KPOB 1I9EA 2YBRB 5KVEL 4HKZA 4L8SB 2APVA 1GYAA 3CMOL 1EAJA 2GJZA 5IB1B 1HXYB 1KXVC 1RQ5A 4NJ9L 2AXGB 4ZD3L 4O2EA 5BXFA 3BO8B 3ZDYF 4DN3H 5I6XC 1DQML 4H8WL 3NZHL 1NCBH 4PJIA 4OZGE 2RJMA 3IDYB 2B5IC 3QXWA 3TGXA 1LEGB 1UT9A 1KXQE 1X5AA 2G75A 1HHGA 1AQDA 2COQA 2IANA 3LKQA 3KLHD 4OLZH 4M62L 3TBWA 4WJ5A 5J57B 1BF2A 3U7WL 4BFGA 5CIPB 5FCSH 1A7PH 2R2BA 5DJ0B 3G6JF 4JO4L 4PGEB 1P4LB 5EZJB 2C4FT 2CK2A 3ZO0A 2YPLA 4UBDC 2DMBA 1JZ5A 2EDDA 1E4WH 4JPWH 5C6TL 1I7TB 1JHTB 1FFPB 2P1YA 2WWMD 1CG9B 5HYIA 5KS9B 2NTFA 3G9AB 1CLOH 3LN5A 5KSVA 5KANG 4LOUD 5HHOD 4PB9H 3OBAA 3LKRA 4QT5A 1N2RA 4PGDB 4XNMA 2NPLX 4M6OL 3QIUA 1NMAH 4CVXB 3ARBD 2GTWB 3EFDL 5E2TL 3X3GH 4XWGL 3PWJA 3VJ6B 3GO1H 7FABL 2YXMA 3BEVA 4A6YH 4LIQH 5DMGD 3B8YA 4KZDH 5HYSA 1IE5A 4MB3A 2Q87A 4UDTA 4M1DH 4HAFA 4Y16D 1KNOB 35C8H 5KSAA 3V9FA 3C2AH 4ZUSB 1DBMH 3IETB 3DVGB 3O41B 3G5ZB 1P9MC 3BVNA 3QYCA 4KV5F 3NVQA 5DT1L 4LBEB 3IAQA 1CFNB 3VDBA 2FBJH 2W9EL 3SJVA 1Y0LA 5E7FA 3FQRA 1U41A 1TITA 2H1PH 2NQCA 2ZG2A 3I75A 4ZTPH 5E2JA 3VRJA 4WY7L 4KROD 5CLWA 1K6QL 1PLGH 4NC1E 1EPFA 2NY5H 4XHJD 2IPTH 4FNLL 1EVUA 2D9QB 5CSGA 4PJ9C 1QA9B 5I75B 1YEFL 4JRYA 4RMUA 1IBGL 1TZHA 4X7DC 5EWIL 4K3GA 3PGCB 4PJXA 4LLWA 3INUH 3WUWA 4YXHH 1A64A 3M45A 4G6FD 1G9NC 3O45A 5DVOA 5D5ME 4DVRH 3MGTB 4K3EL 4PRPD 5I76A 2YKLL 1NBYA 3RX7A 1A7QH 4IS6A 5MERB 4WTXA 2AJYH 1TIUA 3HG1D 4M7JH 3HNSL 2AQ3A 4YGVB 1MHEB 4OV6F 1FNEB 4X5WB 4KH2A 4M9OA 1BEYL 4IMLA 2DJSA 4HWNA 2APFA 3T0ED 4X4MA 1EUTA 2BC4B 1MPAL 1BWWA 3QZWG 3MV9E 4NO0B 2ZSWB 4KKAC 4K9EL 1U8QB 2EIBA 1F8TL 4F33A 4UILL 4HQQH 2Y07L 3MSPA 5FECB 1F90L 1PD6A 1KEGH 1ED3A 5IIEA 1KCRL 5DZLA 4XPFL 3AMKA 4P23D 4P4RB 2XACC 5C0AD 4J8RA 2A73A 3VFNB 4BH8A 1BJMA 3UDWA 3BZFB 1CXHA 3VRIA 1UB5A 3WL9B 1I8KB 2VDRH 4NOBA 1LO4H 1NC4D 2BNQB 3LQAL 4UB0L 1IC5L 2A6KA 1VFOA 3HI5L 1I1CA 3VA6A 3DETC 1QFWI 1M05A 4YHOL 4PRAA 3QFDB 5GISH 4BZ1L 4O2FB 5C0FB 3DX7A 3WKNA 4LSQH 4ZDHA 5AZEL 4G6ML 1D3CA 4XBEH 4TULL 1IZKA 4P3DB 4QXUL 2ZKHL 3Q6GH 3RDTA 1DUYB 2H2SC 5CEZD 1J8HE 3DBXA 2DQJL 2V2XA 4W6YB 3PWPE 4OZFB 5B22A 2BK8A 2MKWA 4D9RD 5CJOL 5FUOH 1KLFA 3MBEB 1U8HA 4M4RA 2FJGB 5TH2B 3WKMH 1M7DB 1FNSH 3VD3A 1OTTC 3MV7D 4JFYA 2H32B 3BAEL 4KUCD 4U1LA 4JO1L 2V17L 1OT2A 4EBQL 1ZMYA 4RMVA 2UY7A 4R2GC 1JMZA 4ZUUB 3MRIB 5T33L 5JORA 4MQTB 2PXYC 4ODTH 4Q6IB 5FKPA 3D3VE 2HN7A 3MJ7B 4FFZL 1RJLB 5HHVL 4LSUH 5CJ5A 5CCKL 2WSKA 1FZMA 5I66A 2W9LA 4ALAH 4PP1C 5GRWA 4IRSB 4JFFD 2HJKA 3C8KA 3WUZA 1T1XB 4JKPL 5A2LH 1YEEL 3WSQL 1WUNT 1BM3L 2VUYA 2ZUUA 2HFEA 5JDSB 3RGVA 5HGGS 4EVNA 5EC1B 4K7FA 2A77L 4PIRF 3P9LB 3TO4A 1KPVA 3AAZB 4M8QB 3TCLB 3NAAH 2ATPB 3BP7A 4Z7UA 3U4BH 3SE4A 1YYLH 3WS6A 3WNPA 5I9QC 1XFPA 3RWFA 5I1LA 1JHKL 3UTZB 5JTWA 1MI5A 1N0XL 4WDIA 3GMMA 4NKIH 1MCJA 4XTRC 4LNRB 2X89D 1FZKA 4NIKB 3TVMD 4F9PA 2R2HB 4CKVX 1KIRA 1CICB 3HRZA 5D93B 4Y5VC 3NIFE 1TFHA 4KDTA 3PL6C 4P9ML 4PRDB 3WLWC 1U8OA 5LCVH 3RVTD 4WFEE 3N1FC 4Y4HD 5D1QD 3QEQB 1C7SA 4JO3L 4JFEA 3LEYL 2D03L 4Z9KB 4NYLA 3RNKA 1SM3H 3MV8A 1LP9B 3D85B 5BOZG 2ID5A 4S1DD 3VXUD 1UM4L 2W91A 4OF5A 1FLRH 3SE8H 2FRGP 2HT3D 4PJCA 4CU8A 3MR9A 4NRZA 2JJSC 3QXUA 5SWZE 2EXYD 1QFUH 4HIJB 1PSKL 3WHXB 5FYJU 4PBWD 4LSVH 3PGFH 2R56H 2VH5H 4RAUA 1LD9A 5IBTH 2XTJE 4JKLA 5I1JH 1OAUL 3TIEA 5IBLD 4DAGL 3RWEA 5K9JL 1FYTA 1BFVL 1A0QL 1RURH 4AEIL 3HI1A 5CIPH 4PGZA 4DKEH 3BKYL 3STZA 2HLFC 1J5OL 3EGSA 2N7AA 4XP4H 1FBIL 4YXLL 2HG5A 4N0UB 3RU8L 5JNYA 1F3JB 4MXVE 4IIQC 2FATH 1UH3A 1BVKB 3HE7A 1IAIH 4PREA 1Y6KR 4X6BB 4TUOA 3T0WA 2NX5D 4DQOH 1TTUA 4XNUH 1S7WA 4HIXH 2HTLC 2LU4A 3OB8A 4LCWB 5ESAA 3PQYA 5MEQA 3OJMB 3ABZA 1I7RA 3KLSA 4PJFB 3LKNA 1NCAH 5BRZB 2ZG1A 2WINA 2R1XB 2Y4SA 3ZT6A 3O8XC 5F9JB 3RWCB 5DD1H 3GSWA 2DD8L 5E7BA 4RMSA 1XGYH 2W0FA 4APQD 3BKJL 3ALXA 4OQTH 4PJIE 3B6SA 4OSUL 3O6MH 3VI3E 1VGKB 3EFFB 3QXDA 2GJJA 3WN5A 2R8SH 3TZVD 2X6MA 2VQTA 5I16B 3VGFA 4NQVB 2IANE 3CDFA 4U1HA 4NT6A 4D9LH 4XPAL 3SQBA 4C54A 2WUCH 4EDWH 4J2XA 4AQOA 4NC2B 1ACYL 4C83B 5IVXA 2AKRA 5GGTH 1JGLH 4Z95L 3UTTE 1DCLA 4BK5A 3JTTA 3O4LB 1D9KC 4KJYA 4I5BA 3I02A 2YPLE 5I18H 2ATKA 3TYGL 3ZZ1A 2IH3B 4U1JB 1S7QB 3FO9A 4O9HH 1U95B 2PF6A 5JQ6H 3CPLA 4X5XA 4N0FA 3ULVC 1HHJB 5CP3H 1IT9H 3UX9B 3LDBC 3MMEB 3G5XB 3FZUC 1ZLUK 5E6IB 5GGRB 1UM6L 4DTGH 1ZWIB 4RMWA 2NY1B 4HULB 32C2A 3V4UH 1JN6A 2BHUA 3TT3H 2YD2A 5EUOA 1VPOH 4K7PH 1CTOA 4MCYA 4FP8L 4XVSL 1ITBB 3OF6D 4HG4K 1KG0B 3V5HA 1PKQB 4MNQA 4JHWL 5TE7L 3S36H 1JUFB 4LPUA 5IEHB 1UJ3C 5DVLA 3HFMH 2OR8A 1FGNH 4ACPA 5JW3H 5A2FA 1AI1H 4WU7B 3QJFB 4DFIA 4ZOBA 3SJVE 3W5MA 2Q76A 1I85A 1FSKB 3MRKA 1PX3A 3LS4L 5I1AA 3C5JB 5E2UH 3MV9D 4BFBD 4RFNB 4DZ8A 1ROWA 1UM5L 1BAFL 2CK0L 5LAXA 3QI9D 1ADQA 5CP7A 3MROA 2FD6L 4JRYE 5I2IA 3MBXL 4LDLB 3ALWA 3O6FA 4PJXE 1A6PA 2NW3A 2HKHL 3GSRA 3E6HB 1AGBA 3GMPA 1JI2A 1EDQA 3NTCL 5EIQA 1FG9C 2IAMC 1MFCH 3MLWH 1B88A 1G6RB 1A7NL 5JIPA 3CFCL 5E2VL 3QUKB 2OM5A 3WFCH 4DKFH 4HS6B 3FCTA 1A8JH 1D5XA 1F00I 4P4KB 3LSOA 1EJOH 3IFOB 1YEJH 1YNLL 2BOBB 2VRAA 3E0GA 4X6DF 3VGHA 2QLVB 2YD1A 4L4JA 4R7NB 5ETUB 3WHE1 1ZKAA 2ZUQB 1TJHL 2QHLA 2QQKH 4X4ME 3MTRA 4LHUG 4JJ5B 3MLXL 2WUBL 5E8EA 4YHNA 3VD4A 3ZDZF 4FQXD 1J8HD 5ALBL 1CDHA 2FHFA 4OZFH 4Z7WA 3PWPD 4MAYD 3VWJD 4LLDB 2R4RH 4J4PA 3V0VA 4S1QL 1MCNA 2W65B 1WTGT 4AENA 4MQXC 1RD6A 1JWSB 1Q72H 1LILA 3REVA 4OD1H 2OTUB 1FVCB 1XGRB 5FGBA 1YNKH 4JY5H 4LSDA 1KB9J 5F21B 4U0RB 2ED8A 3DX6B 1MCOH 1XF5B 2DIAA 3VXTB 4RGNB 5EUKB 3CFEB 1MHCA 1PQZB 2O61B 3DYOA 1U3HD 4XP9H 1JGVL 3DV6A 4QTHB 2V7HA 1MFDH 2Z8RA 1GVIA 5FGRA 3RWHB 1J18A 1T1WA 1YUHB 5F1KC 4H26B 3UPRB 4MD4B 2O5ZH 4M03A 3GUTA 3OJDB 3CD4A 3CIQA 3U36B 4HX1A 2AQ1A 5HVHB 1LDSA 1U3ZA 3T0XA 2DQIH 3BJLA 4EUPG 4KHXH 3OGCB 2OR9L 5DK2B 4OUUA 4PJ5B 4CMHC 2GEEA 5DJ6A 4JVPA 3V6ZA 3PV7A 3L3KA 4MWFA 3IAPA 3N1GC 4YDJA 3AS3A 2EDYA 4NUGL 4F7PA 1I8MB 4EN3A 1DBKL 1H8OA 1UCBL 2VXSL 4YLQT 3EO9H 3B9AA 1XR8B 1KJ3L 2X4NB 4JM4H 2F19L 2AJUL 1PY4A 4FTVD 4CUCA 4OI7A 3BGFC 5TDNB 5DJCA 5LGKA 3WDIA 4NZTH 1JWUB 5BV7L 4KRMB 4OZIA 2MOVA 4ZUTA 2WLZA 4LVHB 1L0QA 1R3KA 3QEUB 1I9IH 5GGVL 3NABH 5T3ZD 2RBLA 3IRPX 5IROC 4MVBD 1VFAB 4I77H 1H3PH 3K0WA 4ZAKB 3MREB 4Z7UE 5A40E 3TH4T 1UADC 1P84K 4N5EC 3TA3D 1C12B 1B9ZA 1MI5E 4DUWA 3NCYP 3NIDE 3SGDI 2XTJD 3GRWL 3H3KA 5C86A 2AK4D 5I8CA 4OGAC 2QADB 5IB5B 4WV1A 1YJDH 3P77B 3BXNB 4OF8A 1CXFA 3GNML 3FJTA 1GOHA 5IQ9B 1YYMH 2YUWA 1F58L 1B0GA 3UAJD 4JFEE 4ZFFA 4G6KL 5DURD 4NP4H 4PRNA 1T4KA 3D2UD 4Z0XA 1ZS8B 5ELIA 2OL3L 3VG0L 4U6VH 4K71C 3GI8H 1KPUB 3JZ7A 3MV8E 3S88H 2AJVL 1YMHB 3FHQA 1KN2H 5A16B 3U46B 1C5DB 3BDYL 4OV5A 3ARXA 3QCVH 3NFNB 4AIZB 4H20L 3SE9L 3HUJA 1W8OA 1XGUB 4NFBA 2AV7A 3GI9H 4PJCE 1UKSA 2XA8H 5K59F 3RI5K 1NGXB 5E4IA 1ZGLB 5F1NA 2DI8A 5AYUH 5EO0B 3MZTA 1QBML 4M4PA 1D5ZB 3IB4A 4FQHA 1JHLH 1A3LL 3ILQD 3W0WA 2BSRA 4J3SA 1GJIA 1A6AA 4PY8J 2V7NA 3PXJA 3BPLC 3IDMA 1R3JA 2IAND 1FYTE 3DYPA 5DC4B 4QCIA 1INDL 4WVRA 2ADFH 5EFIB 1OQOA 2X7LA 1N6VA 4ZOAA 1FNGB 1HKLH 3LPGA 4P59L 1WZ1H 4GQ9H 3SPVA 3P73A 1WITA 3GM0A 1QEWB 1GC1C 2RQ8A 1K5NA 1KT2B 4PBXA 5ERWB 2YPLD 4L8BA 5HYQA 1PZ5A 4RRPA 2V2WB 4Y4FC 2BRQA 5C9KA 1F6FB 2FO4A 3PQYE 4JZJB 2ZUTA 4IRZL 2F58L 4RNRB 5KSUB 3BUTA 2G2RB 1CDCA 3CUPB 3QISA 5HVWA 5CFHA 4PGJA 2PETA 3GB7B 1IC4L 2NXYC 3G6AB 3LH2L 4LGSB 3QIUD 5TF1H 2A74B 2OZ4L 3I50L 1DQJA 4K8RL 3UCRA 5D9SA 4P9HL 1MIEH 3HMXA 2KH2B 5D1ZB 2IPUG 1SY6L 3OKYA 1IKFH 2NR6C 1J12A 4WO4A 3QO1B 4MZ2A 4F7MB 1NGQH 3RHWK 1U93B 5KSAD 1RU9H 4M1CD 3RTQA 1MCHA 3FT4A 1PG7X 1AGCB 1UXWA 2D4DA 3H42H 4CNIB 4X83A 3UTSA 1EXUB 3SJVD 4UT9L 1JPTH 1GGYA 3SHSA 2ZUSA 1A1NB 1UZ6F 2EYSA 2NY2D 1IGJB 2E27H 4N8VB 5MI0B 1RUPH 4X0KA 1VEMA 4JRYD 5F7DB 1HK6A 4W4NA 1IRAY 1MAML 2VLRA 4ORGB 4DGYL 4S2SB 2HT4D 1F2XK 3D9AL 2BVEA 3KPRA 1JZ8A 4U05A 3TO2B 2Y25A 5LWYL 5JW4Q 3RKDD 5EUOE 4YBLC 3AGVA 3LIZH 3REWB 5C0DB 1A4KB 3SGEI 3GMLA 4I0KA 1MH5A 2XPGB 3C5ZB 5C3TA 4NKDB 2C4FU 5I74C 4MNQE 3MLSL 1UG9A 5ACLA 5DJXB 4O5LH 1AKJB 4Y5YA 3QNXA 2CRIA 2J8UB 4JR9L 4LK4A 3TM6A 4X7SH 3ZKMC 1FV1A 4YHPB 4C56B 1IQWH 4QO1A 5C0CB 5CD5C 4U1SA 2Z0BA 4JPVL 5AYQA 4NBXB 1WLHA 1WFTA 3RWIA 3U6RA 1QZ1A 4XI5C 3JXAA 4OD3L 5HSFA 5DI8A 5EC2B 1RJZA 4KJQC 1JFQL 5JW4M 4MSWB 1HH6B 4LARL 2I26N 1B2WL 1NFDB 4MA8L 3MUZ1 5GS1C 1WK0A 2X10A 1A5FH 2GJ6A 4P2QA 3VGGA 3ZL4L 1NFIA 2E7LC 5A2IH 3W39A 3DRTB 1BX2A 5D7LA 1X5JA 1Q9KA 4U1NA 4W4OC 5IQ7L 3H9HB 1I1FB 5E6ZA 5EZLA 5GJSH 3UTPE 2X4SA 2EZ0C 3KS0J 3RBSA 3DSFL 4L4TE 3HR5B 3JWDH 1GGTA 2X05A 2XZCL 4LCCC 4NQDB 2DQTH 5IJVB 4I48B 2CDGB 4CL7A 3HNVL 5EOTB 3DURB 4AEHH 5JW5A 5B8CB 3QUYA 4F15B 5EBWB 2BCKB 3H8NA 4WWKA 1EAPB 3RDTD 1XGTB 1AY1H 4KU1A 3VXQB 4PJDF 3TT1L 5ICYB 4Z7WE 5JZ7C 4KY1H 1GOGA 4QXWA 3SGJC 3WFBH 1SJEA 2CGRH 3KLHC 3BEWA 3QCTH 4JREB 1BQHB 3IYLW 2CUIA 5HHPB 2CLZB 5DK3A 4LSRL 2VLMD 3F6IA 3CVIL 1WGOA 3MRBB 4M48L 4ONOA 4NFCA 1TPXB 1V7MH 1G0YR 5CILH 1NKRA 3TBVA 4HBQA 4UNUA 1DQDH 4P57B 1CXLA 4UIMB 4KTDL 1XEDA 1X4ZA 2Q86A 4RFOH 1ZHKA 1FG2A 3ARGB 4PTTB 5FM5O 4LOUC 1MRFH 1RUMH 1SVZA 4ONFL 3RVVD 3GSQA 2AAVA 4LLUA 4GT7A 2V9TA 4X6DB 2JJVA 1B6UA 2BDNH 4Y19D 1RVFH 4M43L 3TV3L 3ARBC 1S9WB 4NM8H 3QCUH 1OW0A 1CDBA 1KFAL 5IF0B 3MRNA 3DGGA 2VL4A 1I3RB 3ORJA 5D72L 5GRUH 2B1AL 3RGVD 5EU5A 4OIBA 4YUEL 1F4HA 5DSCB 1ZE3C 3TO4D 1S3KH 2FGWL 3OL2A 1FORH 1P4IH 1RSFA 4F9LA 3IS1X 1V3JA 1W0VA 4Y16C 3TN0C 1IGCH 2HH0H 3BE1H 2C3XA 4OKVA 4DJMA 4QRTA 5F6HJ 4WW2A 5FDWA 5F71A 1MEXH 4XT1C 1G7IB 1MI5D 5D5MF 1SMAA 2YPKA 2XTLA 4UOW1 4BH7B 1RJCA 1J05B 2HFGL 6FABH 2GY7B 3LMJH 5BZWA 1DSFL 4GQPH 1ORQB 1RK0B 3DVNA 1KEMH 2QV2A 1FYHB 3WIHL 4HWBL 4XHJC 2Z92A 3B2UC 2JB5L 3D0LB 3B3IA 2FNBA 4BA8A 1FC1A 3CXHJ 1NCWL 4JFED 4V2CB 4PJAA 2X70A 2OXGA 1JGDB 5HHME 3U0TA 3VU2A 4JM2F 1HYSD 4OZIE 1IAOB 4R97B 4YC2B 2WANA 3KPNB 5L7XH 3QNYB 1MCFA 2Y23A 5D8JH 1L7TL 3P0YL 5CD3A 5IT2L 4QRPE 5HHOB 5C0RL 4PJBA 4BUGA 5I73B 1AXSA 4P3WA 4CVUA 1LO0H 3KYAA 2J8OA 3I3EA 4YHZL 1LEIB 1FP5A 4HBCL 5C09E 2QKIB 4JFZL 5DHVA 2GKIA 5FUZL 4QOKB 1FYTD 4XMLL 5L6YH 3IKCB 3K74B 2CMRL 2DM7A 1EX0A 1XCQB 3LEXB 5TDPB 3DTXA 1YPZB 4WU5B 2ZSVB 4MXWH 5ITBH 3IAGC 5LQBH 5CJXC 1MFBH 2E7CA 4PP2A 5I17B 1A2YB 3HE7D 3VFOA 3PNWB 2Y6SD 3Q2CA 4P23C 4GUPB 4WFFD 2FH6A 4QRQB 3GKWL 5F7NC 1UQSB 4KROB 5GS0H 2IQAB 3HUJE 2CKBA 1CWVA 2DQUL 5C8JA 5IMLA 3CFJB 3GJFB 3MZGB 3A6BH 5J1AB 3K1KC 1F3RB 2BHYA 3O4OC 3W0WE 3V6BR 5IFHH 1S5IH 3TYFB 1ZGLP 3Q6FA 1JYWA 4ZYKB 3OSKA 4P46C 1OAKH 3B2VL 5HI5D 4OZHF 1T3FA 2VWEC 4X7CC 2C5DC 4EI6B 5GRZA 3H3PL 4KFZC 2PYFA 5CS7A 4G8EA 4AT6A 3MLUL 5F88B 4XNXL 5D2LA 5FUCC 3T0EB 3F7VA 2HYMA 5BVJA 3C5SA 5INDB 2OTWB 4D0BA 1KJVA 4S1SL 2VLKB 5GSRA 4UNTA 2VC2H 3BDBA 1TVBB 2PN5A 1ONQB 4J3WA 1GZQA 4L3CB 4K23H 1CGSL 4FFYL 4B7IA 2C7UB 3MFFA 1TETH 1FNFA 3CSPA 1DFBL 1L7IL 4ZOCA 2XWJA 3DJ9A 4RGOH 3DPBA 2ADGB 4FXKB 1UVQB 1EGJH 1IEAB 1LK2B 2YD4A 5DQ9B 3RVUD 2J88H 3H9ZA 5DJAA 5C0AB 1S9VB 5I8KH 5DJYA 2PR4L 1NGYB 5LGHH 5EIIB 2OMNA 5FKAA 4FQCL 4DGIL 5DWUL 3UTOA 4GS7B 3I2CL 3GSNA 4MNQD 1X5GA 2EDOA 1VB9A 2VZ1A 4OLYH 2X40A 1UEMA 3MRGA 1FJ1B 4L8DB 2AI0L 4N9GA 4GAYB 3EYUH 3AB0C 3SBWA 3CZFA 2VQ1B 3HB3D 3UTSE 2R0LL 5DEFA 2VDOH 3WHE0 1M7IA 4PRBB 2NYYD 4ZFOB 4BQBA 2R2EB 1KIQB 4PJGA 3VXSB 2UYLA 1U92B 1UGNA 4HUKB 3WO3B 2FZ3A 2D7MA 3S3JA 5DJZB 5DD3L 1WCQA 9CGTA 2X1PA 4GAFB 2QBWA 3RNQB 2LFGA 3MRMB 4WHTA 3UJJL 2PTTB 2VLRE 4Y4HC 5D1QC 3SKNB 5DRZA 5E08H 3KPRE 1HEZB 3DV4B 4YHIB 1INEH 2OTPA 3EYSL 3QG7H 3M8OL 4CDHA 4OLUH 3UTPD 4DFHA 3LVEA 4S1DC 4AK1A 4JZOA 5L88L 4IEFB 4BSJA 4J12A 2AV1A 2ERJB 2H6PA 4HJJL 5EU3B 4EJ1C 2PUQT 2P49B 2HT3C 4LLYA 1F4XL 1IAII 1MRDH 1JK8B 5I8OH 1GPOH 3T2OA 2ENSA 4JFFB 2WZPD 3FFCA 3ARQA 4M9PA 4NN7C 4Y5XA 4PB0L 3J8F7 1CR9H 5TQ0H 2JLLA 4U31A 4WW1A 3FO2B 2JK5B 5IBLC 3AS2A 5FHAL 4PYHA 4L29A 1FFNA 4J4PD 1RUQL 3D1MC 4UU9B 3QZWA 3NACH 5F97E 1IL1A 4PLJD 2GJ6E 1TQCC 4P2QE 4XVTH 1NCCL 1LO3L 2ICWI 3NA9L 3STLB 1ZLVH 1VADB 2WLYA 1IGYB 4GBXC 2VLJA 2YZ8A 3TVMB 4AIOA 4LCIH 4M3JA 2VR9A 1QVOA 3OAUL 4YDKH 3MNZA 4KVCL 3G04A 5IOPA 3S5LB 3LQZB 2EXWC 5HHQA 1AGFB 2DQEH 2CJUH 2Y7QB 5FYJL 4NN6B 3FB5A 4U6HA 3IDJB 3CX5J 1P9MA 4APQC 5F8QC 5JIKA 2ZUXA 3VCLB 4JG0H 3HZMA 5T1LA 2VUOA 3TZVC 4JFPA 1LK3L 1RIHH 2Z93B 1P69B 4HUWB 1VHPA 2O5XH 4XCYB 4OFPA 2H2PD 2CIKA 3BW9A 4ETQA 1LEKB 4KK9C 4JN1L 1ETZB 3AVEA 3P4NB 3V7AG 3QSKB 4PJ9A 3IDIB 3N0PB 1BBJA 3O0RH 2R69H 4PV9A 4Z7VA 5JA9A 5HYFA 2R23A 3D48R 4OZGB 1UA6H 1CLYL 1K2DA 1CU4H 3OKNA 4EN3D 5F72S 4X6CA 1ZLWH 1DE4A 3IU3A 1TJIH 1NLBH 5H2BB 1FZJA 3IFLH 1MUJB 3N9GL 3V6FA 2WWKO 4OZFG 2NY0D 3CU7A 4U49A 5HHMD 3BZDA 1JF1B 2EYRA 3ECBB 2A9ML 1FFOA 1KBGL 4YPGB 1SHMA 5EU6A 1FO0A 3EO0A 1IGML 1S7UA 1P7KB 4LSTH 5E94A 3OKDB 3TCXA 4OCLC 3MUGB 5C0ND 4FQ2L 4EOWH 1YQ2A 5ILTH 4LRIC 4IRJC 4D8PB 3RA7L 1BVZA 2YEZB 5KW9L 2BMKA 5C71A 2L7JA 1J9CT 4CDGC 5I1IL 2FEEL 3U4EB 4YHKL 4GRMB 1SYVA 4YHLL 4AH2A 1SEBB 2PO6A 3OJVC 1KELL 1YJDC 3HAEB 3O3UN 2GTZA 2P48B 5GPRA 1J1XH 3TBSA 3LHPL 5JLZA 3QI9C 2GHWB 4AZ8A 5HYJB 3IJYA 1KJ2L 4NNXB 1DLFL 1J1PL 2IH1A 3IDGB 4PJAE 1PZUB 5C08A 3FB6A 3PUCA 3LKSB 4ZPTB 1UENA 5ALCL 1JNNL 3EYOA 2R0WL 3QXTA 4P2RE 5JHDA 4S0TD 2D31B 1XCTB 1BZ7B 2Z8SA 1I1RA 4OB5H 4D3CL 1CXKA 4PJBE 1NGZA 3NA4A 3R0MA 4KZEL 1YNTA 3MXVH 3QWRA 4TQEL 4XMKL 5F7EH 2F5BH 1TZIA 3BN9D 4TOYH 4OZ4A 4M6MH 2W0PA 4YIQB 3VFVA 3W0WD 1NEUA 2BNUB 4DOHE 1OHQA 5IMOA 4GAGH 1D5MA 1UWXK 1TTGA 5D5MB 4FQXC 2V6HA 5F89B 2EKSB 3G6DL 5F9OH 4UUJB 1R0AL 3KJ4B 3LQMA 2XRAL 4Y8DC 4UV4L 3VWJC 2PXYA 4RMTA 3GMQB 3HLAB 1V3KA 4UTBH 4V1DB 1LE5A 5TPWH 1YEDA 3DRQB 5LBSH 2A0LD 4YBQD 4GMTL 5I1KL 1WCBA 3MRHA 3E3QC 5GIRB 4X4YA 3BMVA 4JM2B 4MA1B 5F3HA 3GBML 1V7NL 1QQDA 3BD5A 1WFUA 2QSCL 4JKMA 5IB4A 4HUUB 3TBTB 3BH8A 3CSGA 1QSZA 2P7TB 1HYRC 3DROB 2H41A 3FQUA 1YY9C 2NW2B 2A6DA 2RFXB 1U3HC 3WFEL 5SX5H 5SWQA 4LEXL 4PGCA 3RQ3A 1EEUA 3KPPB 1EFXB 1YEGH 3JV4A 3MLTB 3P30H 1KTKE 3QFJA 1VACB 5ICXB 3QQ4B 3TEUA 4FS0A 1DQQA 4BSVB 4HHAB 5KSBF 3T4YA 5FYKU 5ENWA 2JTDA 4WO4D 5C7XH 1PKOA 3PL6A 4QLRA 4I18C 4XC3L 3RTQD 2LTQB 4ZODA 3MLVL 5GGSY 4HWUA 1WJ3A 5D2LE 5E00A 3UTSD 2NCMA 3SKUD 2HVJB 5GGQL 3G08A 1RULL 3OKOA 1RK1A 3FB7B 4OBRA 4Z7OF 3VW3H 3WIFB 1J8HB 3U2SB 1NBZA 3S3SA 3UJTL 3E6FB 5DTFB 4HCRL 1T20B 1TLKA 2F53A 2F74A 5E9DE 2JCCF 1YA5A 1QFHA 4UDUB 4L3EA 4PTUB 5FB8A 3VRLE 1F3DJ 2ESVD 4O2CA 4S1RL 1F6AA 2VLRD 1CGUA 5KVMC 2CKBL 5E8DL 2YOCA 2JJSA 3KPRD 5C0BB 4LKXA 2WQRA 1OTUD 4HUXB 1D6VH 5DLML 2Z31C 5DEGB 1GAFL 4JN2A 3ZKXB 2LV4A 3D3VB 1IGFL 4JKWA 3RWDA 3I6GB 4MVBC 3SQOH 3CVHA 4Y4KC 4JPIA 4PLOB 5MP6L 3CFDB 5KVEH 2HJLB 3BZEB 3GMRA 3MC0A 4IIQA 5DR5L 3BPNB 3BPCA 4GKSB 2VZTA 4WNQB 4YK4B 3K2MC 2YZ1A 4ZD3H 3TA3C 1WISA 2BERA 4PJGE 2YS4A 4H8WH 1DBJL 3QDJE 5HI3D 3NCFB 2XTJC 3NZHH 3QRFM 4RQQB 3K4AA 1HSAB 1I1AB 4GG8A 1T5XA 1BD2B 4NQSB 3O8XA 2YD3A 3WNNA 2RCSL 4HS8L 4M62H 4HSQA 2GJ6D 2NY4B 4P2QD 3U7WH 3BISA 3WFHA 1Q9WB 4XMPL 5CBAB 1KXTB 3EOTL 2NXZD 5D7LD 2GUOA 4KKBD 4ORZC 3ROOA 5IB2A 1FN4B 1KSRA 4ODHH 3JWDC 4J3TA 3VXME 3V2AR 1TMCB 1WF5A 5DDHB 3NCMA 1LVEA 2P4AB 5L0QC 1U2CA 1JWMA 3WEXB 3BP6A 3QUYD 1D9KA 4MAUL 4G42B 2MHAB 5C0EB 4ERSL 3GSNL 3QNZB 2BNRA 3FFCE 3T3MF 4E42A 4GW5A 1IGTA 1U58B 4M6OH 1AFVH 3V8CA 4LVNC 3PHQB 1S7XA 2I9LB 3EFDH 5CUSL 5IM7A 4XWGH 2W92A 3HPJA 1FRGL 7FABH 2DYPB 4WUUB 4R3SB 4HIEB 2XFXA 4MNGB 3L3GB 4P3CL 4Z77B 3OXSB 1VENA 3QPQD 1JPGB 5JOPD 5SWZB 1JNHA 4XX1E 2H26B 1ZT7A 3DUSB 3MJ9L 2DMKA 4QHMB 1BLNB 4Y2DC 1OAQL 4ODUB 2VLJE 2J1KA 3T4AB 4XNYL 4L5FL 3EIFA 3DNKA 2D7TL 4UOW0 5DT1H 3VFPA 4YFEA 1DANT 2FECI 3R1GL 4HJGA 4Q6YA 2ORBH 1P4BL 2J6EA 1S78D 1Y6NR 4O02L 4WY7H 1K6QH 1JPFA 1IZJA 5DURB 5E1AA 3D2UB 1YECH 5IFJA 2G5BA 4FN0A 4N9OB 2IQ9H 1YEFH 5B39B 4OTXH 1QFWL 1BQLL 3A67L 5IUSA 2X09A 4KKCD 4LPWA 1B3JA 1BBDL 2BP3A 4G8FA 1MHHA 5J1TC 1WBYB 5KG9A 4O2EB 4K3EH 4HV8A 4MQSB 2YKLH 4QWWC 4Z7VE 4GG6A 4AMKL 2FO1A 1HOCA 3C6LC 3HNSH 2C3HA 3HAEH 1Z0NA 2QQLL 4X6CE 1S9XA 4YFLF 1AQDB 2IANB 2IAMA 1BEYH 3TFKD 4HDIB 4WJ5B 3G5VB 1J0JA 1LGVA 4QY8A 3BRGC 3ULSA 3MRFB 1K4DA 2VE6A 1CN4A 3TPUA 4ZXBC 3UTTB 3DXAA 1F8TH 1T03L 4UILH 2Y07H 4IMKA 1F90H 4MDJB 1KCRH 1MFNA 2HT4C 1S7SA 4H25B 3Q5OA 4XPFH 1EO8L 4R90L 3R06A 2NTFB 3RKDC 3B9KB 1FDLL 1UKQA 3BWUC 5ESVA 1U8JA 5KSVB 1YQVL 3O11A 3BWAA 4PJHA 5I71C 1IC5H 3QIUB 3HI5H 3BN3B 3S37X 2BRRL 2HJFA 1ZT1A 4HKJB 2R29L 4YHOH 2MQ3A 4BZ1H 3CCHA 3T77A 5J3HD 4G43A 2Y72A 3BEVB 1T21B 2AGJL 5AZEH 4G6MH 4MXQD 1CFTB 4TULH 1AO7A 1BP3B 4UDTB 1VEOA 5KSAB 2DQJH 3O6LL 3S9DB 1G9NL 5C08E 3GBNL 5JOEA 3BVNB 1HN1A 5CJOH 5IK3B 5DEZA 3OXRA 3WXVH 3VFGL 3EW3B 3MNWA 1R3IL 3RGHA 3T0BA 5DJDA 3HPLA 1YY8B 4OF6A 1Y0LB 1IGIL 3QHFH 5JHDE 5GS0C 3I75B 5FYLE 3NZ8A 3V4PL 3BAEH 3V0WH 1A7RL 2BVUA 3KLDA 3PV6B 2ICEA 1FIGL 1JVKA 2V17H 5C0JB 4EBQH 1HH9A 1BZ9B 1BGXH 1F42A 1KIPB 3ME0A 3VI4F 5T33H 1TZHB 4YE4L 5FA3A 4ZFZA 5J12B 4FFZH 1T1ZA 5IVZA 5DXWA 1T0MA 1D6EB 5FOBA 3WUWB 5BJTA 3D39A 3HZYB 4ZS6D 3QPXL 2YD7A 3U79A 4POYA 2IADA 3TJHD 4FABL 4HWZB 4J3UA 5DRNA 5I76B 4F3FA 1NPUA 2PTVA 1DDHA 1YEEH 5EA0L 4IS6B 1BM3H 2YD5A 3VWKA 2YD8A 5F7UA 2A77H 2VDKL 4LLQA 4DUVA 5F96L 3WFZA 2GK0B 3W9EA 3F62A 1S7VB 2AXJA 1ZANH 5MI0C 1JHKH 1XF4A 4JFXA 5J7CC 2DB8A 1N0XH 1KTRL 3QIBA 3IDUA 5E8OA 3CDYA 4PV8B 5IIEB 2ARJQ 2Y06L 3QWOA 3S96B 5IG7A 2K3TA 1H9VA 1FVEA 4P9MH 4QHKI 4HJ0D 3QBTB 4J8RB 4BH8B 1RUAL 1G9ML 1UB5B 3RY6C 2ZCHL 4JO3H 3QFJE 4XCFH 3JWOC 3LEYH 4YZFE 4HXBH 3Q5YA 3WJLC 1QLEL 5J89A 2F54A 3AREA 2AS5M 4TVPH 3NGBC 3RGVC 1UACH 5BV7B 3VDAA 2V5SA 1YC8A 3BSZL 3GIZL 4GOSA 4PRAB 4Z7NF 2DKSA 2MPAL 3DX7B 3MFGB 5SV4A 4HH9A 5H8DA 4ZDHB 2R2CA 3BHBA 3WS6C 1L4IA 2DWDB 1GOFA 4Q7DA 3MRPA 5F8RC 1UJTA 1AXTL 3PDOA 4MZ3A 3SGKC 4I0PB 1U8PA 5D7JA 3IFNL 2AVGA 2SEBA 4ZFGL 1WZLA 5B38B 5IKCB 2YUZA 1OAUH 1E4KA 4H88L 4DAGH 1R5IA 3SE3A 4L3EE 5K9JH 1U8HB 1BFVH 1OAYL 1A0QH 4H5SA 4AEIH 2D3VA 4R4NC 1MREL 5I1GL 1CTNA 3BKYH 4G7VL 1J5OH 2XI9A 3MLRL 1FBIH 2YD9A 3L95A 3RUGF 4YXLH 3RU8H 3V6OC 1O0VA 1AD9A 2CXKA 1OVZA 1UWGL 4JDZB 1GZPA 4LDOB 5IB3A 3Q48A 4F7CA 1BFOA 5I1HL 3WJJA 2KDGA 1FZMB 2APXA 3HCVA 4NDMA 5I66B 3FO0L 4LSPL 4N8VG 4X99B 5EPMA 3EBAA 2DD8H 1CE1L 3OR7A 4HD9A 3L9RA 1Q0YH 3OG4B 4OUOA 4FQQA 2XT1B 3K4DA 1VERA 4OSUH 3MRCB 2GT9A 1WZKA 4EVNB 2I5YL 1HQRB 3P9MA 3QQ3B 2O5YL 3TO4B 2C3GA 4CU6A 4EI5A 3U30B 5C1MB 1NDMA 1Q9OA 1JNLL 3FT2A 3NPSB 4LF3A 3KPSA 3ZHDA 4XPAH 4LAQH 3MOAL 1R24A 4U6YA 3RWFB 5I1LB 5EULV 3T2NL 4WDIB 3SCMA 3GMMB 4Z95H 2Y6SC 1S7TB 5DD6A 2VLJD 5A43C 1MCEA 2WW8A 4A6YA 2AEQH 3UBXB 4UAOC 1VKXA 3D18A 4X9HA 3HC3L 3OPZH 2WIMA 1U8OB 4MYWB 1CDUA 4PJ8C 3A6OA 5E95B 4MD5A 4NYLB 3RNKB 2BNRE 2BX5A 1NAKL 4NGHL 3IXAA 4ZG1A 3CVHL 5T1LD 3T1FB 1RUKL 3MV8B 1VFBA 3WE6A 1A7OH 3LV3B 1UM6H 1AHWB 2C1PB 1NGWB 3S35L 5JIIA 3K8LA 2OYPA 4OCYL 1X44A 1B4RA 2DQFA 4Q74A 4PJCB 2JIXA 5EZOL 2IALA 4FP8H 4U1IB 4XVSH 3T09A 1KCKA 5HVGB 5K9QG 5E03A 3MR9B 3EHBD 4NRZB 5TE7H 4PRHE 3RIFF 5KVDH 4XVUD 4AYFA 3LEVH 4R0LB 1LD9B 3GSOA 2DIJA 1NGPL 3RI5F 3RWEB 3IFPA 3UO1L 3ULUE 4IOIB 3HI1B 4PY8I 2EH7L 1F11B 2X4QA 1MJ7L 1UM5H 1BAFH 1RHFA 1WAAF 1BVLA 4YDLC 1T2QL 3HE7B 4PREB 5C2UB 4LGPB 1BQHG 4X4XA 3MBXH 3WBDA 4LLMA 1S7WB 5EU6D 1CZ8L 4I8DA 3PQYB 1BIIB 1IC7L 1I7RB 5GGSB 3LKNB 5C0IB 2HKHH 3UYPA 4LU5L 2WINB 2WIIB 4DVBA 1G7PA 2G9HA 1H5BC 4ELKA 3K2UL 1A7NH 3QO0B 5E2VH 5D1XB 1W72L 4U6XA 3GDBA 1MF2L 1X5KA 2N7BA 4YXKH 2VB5A 1CDYA 4NWUL 5GS1A 4GG6E 1PDKA 2VKXA 3B6SB 3JTSA 4ZUWB 1G6RL 4G8IB 3ULVL 3KLAB 3PP3K 4W4OA 4JZNB 5EDXA 2EDRA 1I85C 2PO6D 4LQFL 1MCQA 1TJHH 1MNUL 3C87A 2OCFD 4NT6B 4OCRL 4Q2ZA 4CMMA 2E9IA 3MLXH 2WUBH 3BUYA 3S7GA 1Q1JL 4LCCA 5ALBH 4HPYL 5EU4B 2FBOJ 3DXAE 1H15A 3GSVA 1N5AB 4BSWA 2EIDA 5C08D 2EDJA 4M5YL 4R4FL 1IEBB 3PWUA 4I5BB 3I02B 1VFMA 4S1QH 5DC0A 2FDBP 4B50A 2FWOB 3S34H 1RZFL 4BYHA 1MVFA 2H2SD 3FO9B 5FYLD 5DGRA 3JV0A 4N0FB 4U1MA 4GRLB 1OSZB 3LRSA 2E6JA 5C07D 3SGJA 1ERNA 4KQ3L 4I2XB 4PJHE 4UT6H 1G84A 4MDIB 2X5PA 1CVRA 3QWRD 5CEYA 2X4OA 1ZXQA 4Z7QF 4M93C 5SWSB 2FSEA 3GSXA 4LL9A 1EA9C 1OTTD 1JGVH 32C2B 1KTDB 3OKMA 1OGTA 4XNZC 4TSCH 1JN6B 2G60L 2EDEA 4J6RH 5INCB 3SO3C 3WO4C 3R8QA 5ID1B 2IWGA 4MCYB 1AO7E 3FKUS 4FXGA 1KYOK 5E1HB 2PXYD 4MNQB 4NQUA 3QUZC 3I84A 4RIRA 1OB1A 3BPOC 1HHIB 3S3PA 5FO7A 3GHEL 2WBWB 4R4BA 4PLJC 4KJPD 3FRUA 4PP1D 2VQUA 5DUML 2BSED 1MWAH 2Q76B 4HZLA 3ARBA 4NHUA 4GW4A 5I1AB 4MGXA 5DVMA 1MLCA 3I9GL 3MODL 5B3JE 2X41A 4XPTL 4NUGH 2EDFA 1ZVYA 1DBKH 1UCBH 2VXSH 2VO5A 3V5KA 1KJ3H 1U91B 2F19H 4RZCB 5DHXB 4Y16A 2NMSA 2EDNA 1V8HA 4HFUL 3TN0A 1RJYB 3OKLA 3O6FB 2NTSP 4HXAL 3GMPB 4KQ4L 1QR4A 1D5IH 4OCSL 1I7ZA 3QFJD 3IXTA 4U7MA 2AEPL 2EH8H 3MXWH 1JGEB 5BV7H 2H9GA 3FCTB 3GMNA 4L4TB 1D5XB 4HEME 2Q3ZA 3PL6D 3LB6D 4G8IA 1T7WA 2JE8A 5GGVH 4K3JL 4Q9QL 3K8KA 4NZUH 4QRSA 5FO8A 4JFOB 4N0CD 5KAQF 1FL5A 2HMIC 3OAYH 5E8EB 3KPOA 1A1MB 3VGDA 1QFPA 1NAMH 2YBRA 4Z7WB 4EN3C 5KBNC 4RFEA 3TIDB 2F53D 2VAAB 1ZTXH 1SEQL 1B4JL 3V0VB 1HXYA 2VYRE 3GRWH 3HMWL 3BO8A 4L3ED 3C9NB 3AU1A 3REVB 3C6SB 4FOMA 4BQ6A 3DO3A 3HE6C 3MA9L 3MLYL 5GRYA 4JO2L 1F58H 3LAFA 4GMSL 2NY0C 3LRGA 4GKZA 4NRXB 4G6KH 4WENB 3AS0A 2YK1L 2OL3H 3VG0H 2F54E 1CIUA 2ERJC 5CIPA 4MA7L 3QDMB 2AJVH 3MACL 2D0HA 4U33A 4ZO7A 3DV6B 4PGEA 2V7HB 1CL7I 3BDYH 3SE9H 4N90E 1T1WB 4NO3A 2YA0A 1BOGA 3GUTB 3U1SL 1MRCL 1I7TA 4P23A 2DTMH 1JHTA 4LFHD 5KS9A 4HC1L 1QBMH 2HVKB 3O2VL 3RWGA 2M8XA 4WV1C 1NC4A 2YC1A 3O8XD 3LN4A 1W0YT 3RKPA 4KPHL 1A6ZB 2ED9A 1C1EL 3BQUC 4X98A 3N1MC 1INDH 2GTWA 4OQTA 1ZVHA 3V6ZB 3VFMA 3L3KB 2JELL 4YDJB 3M17A 4P59H 4F7PB 5JOFA 4P46A 5EOQL 1J87A 2A6JA 5AWNL 3CFBB 1KTLA 3OHXA 3LCYA 3MCLL 2W9DL 3QHZL 3MGAA 5FM4A 3IETA 5GGTA 3VFSB 1JV5A 1QFOA 4NZRL 3O41A 4OIAA 2WMPA 1J1OH 2F58H 2R0ZL 5K93A 5DJCB 3VFWA 2GSIA 3HZKA 4LBEA 1D9KD 1CFNA 4GH7B 4F7TB 1IC4H 3VMNA 4OZIB 5I15L 1CQKA 2OZ4H 4O4YL 1R3KB 3I50H 4UI2A 1Y6MR 4QRPB 4P9HH 1QA9A 4M1GL 5CP3A 2DN7A 2PCPA 1Z3GL 5J11B 1SY6H 4HUVA 3KPSE 3KJ6L 2QJDA 4PYGA 3IDNB 5F9DC 5C09B 3FZUD 2A0LC 2NZIA 4YBQC 1P7HL 4KRNA 1BQSA 3MGTA 4YHYC 4YFDB 4QEGA 1TENA 1IILE 4LIQE 5F7FA 2BJMH 5H35A 3ULUD 3H7BB 3N1PC 5MERA 1RFDH 4UT9H 4ZQKA 1HILA 4BM7A 5DK0A 1NMBH 5BVPL 1MHEA 1B0GB 2PNDA 1FNEA 4PRNB 1T4KB 4OLZL 4J3VA 3FQXA 2E9JA 2J5LC 1YEHH 5FM5M 3Q0HA 4NO0A 3RIAK 1MAMH 1QP1A 1U8QA 4W6WB 4DGYH 4YH6A 1A3RL 3D9AH 2UUDK 2X89A 4W70A 4WTZA 5FECA 3HUJB 5LWYH 2UWEA 2FB4L 1GC1L 1NMCC 4LPYA 4WO4C 5I19L 4P4RA 5F1NB 1TQBB 3RTQC 3S5LG 3T8XA 4PJ7F 3O3BA 3VFNA 4MA3B 3BZFA 1FAKT 2AP2A 1EZVY 1IAIM 3P4MA 1A6AB 3DX8B 2A83B 1HXMA 1RZIA 2BNQA 2V7NB 3IDMB 4BQ9A 2IAMD 3SOBH 3UZQA 1MFAH 3RZCB 3B4NA 3CJJA 4WI5A 3VXUA 1T83C 2X4RB 4JPVH 2X7LB 4O2FA 4OD3H 3GO1L 4OGYH 1TTFA 3DXAD 3P73B 1JFQH 4XXDA 4LARH 4C58B 1B2WH 35C8L 3MJ8A 4MA8H 3C2AL 3ZL4H 2FO4B 3CXDH 1HQ4B 4GW1A 2XIDA 4OZFA 3RVWD 4NSKB 2P5EA 3CFIC 3LPWA 5IQ7H 2VDNH 3L3DB 5DMJB 4HGKC 2FBJL 4NCDA 5K9KB 3LN9A 5ANMA 3DSFH 4M61A 1NCDL 3T2PA 2XZCH 2LABA 4IJ3C 3GK8H 1DQJB 3HNVH 4P2OB 2NX5A 3MRIA 4HZAA 5FOJA 1FVDA 1MJJA 4GBXA 5E5MA 5AD0A 1RZ8A 3MJ7A 4X6FA 1AO7D 5IHUL 3CH1A 3FOMA 4Q0XH 4CJ0A 3TT1H 3F6LA 3ARWA 4WGWB 4EXKA 3FT4B 3KYOA 4IRSA 1UXWB 3ZLQC 4KK5D 4POZD 4OBSA 1T1XA 3L5JA 3UTSB 3D69B 4HPOL 4APQA 1EBAA 4O51A 3ARFC 2MQ0A 5JDSA 4M48H 1XIWB 2NY6C 4PY7B 3D25A 5LXGL 4KKBC 5ITFB 4D94A 2EYSB 4M8QA 3TCLA 3NCYS 4LKCB 4KVNL 5E2WL 3E2HB 3P4LA 1N5YH 3HAEG 5IBUG 2QTEA 1CLCA 2VDQH 4TTDD 2VLRB 1EZVX 5DUPH 3KPRB 3F5WA 3D39D 2R2HA 3ELAT 4JHAL 1BECA 1KC5L 2J4WL 3ARZA 1MH5B 3KXFB 4M43H 2XY1A 3TV3H 4PRDA 2OK0L 4QGYA 1MFEL 3MUJA 1KFAH 3FB8A 3QEQA 4X7TA 3VWKD 2B1AH 2VDRL 3QNXB 3QWQB 4YUEH 4AM0A 3C08L 3FL7A 5D96B 4DEPB 1P1ZB 2FGWH 1K85A 4RDQF 1R3HA 1NKOA 3D85A 3EO1B 2KQMA 4U1SB 2B4CC 2QSQA 3RWIB 3U6RB 4WHDA 5DI8B 3RAJL 3AY4C 4IOSD 3QIBD 5TE4H 2HFGH 3PWLA 1T80A 3BP5B 3Q6GL 1DSFH 2CUHA 4G9FB 4BQ8A 5J13B 1NBVH 1S78C 4IRJA 4LRIA 4NO5A 4BJLA 2GJ6B 1E4XH 3WIHH 4HWBH 3BP4A 2JB5H 1BX2B 1KENL 5F9WC 2NXZB 1Q9KB 4U1NB 1NCWH 5LKNA 5EZLB 5CINL 1QNZL 2VERN 3O3EB 5HJ3A 2ZG3A 1OW0C 2F54D 4XNQA 3ARED 1KPRB 4XHQA 4KKCC 3BRDA 4RX4D 2I9TA 2IEPA 1OGAB 1L7TH 4N90D 4R8WL 3QUYB 3G5YA 4JVUA 4Y8AA 5C0RH 4WWKB 43CAB 3MRQB 3F7YB 4NQCB 4LRNL 1JMXA 4X4ZA 3WLBA 4EUPH 4NN5B 5CAYB 4PJFA 4HBCH 3KHOA 2PYEB 4TNWF 5CGYC 1UCTA 3O3AA 2R1XA 12E8L 4PJEF 5D7JD 4JE4B 1F6LL 1CFQA 1SJEB 3E8UL 2FYYA 3BEWB 5FUZH 3TFKC 3QDAA 1GGCL 4XMLH 2VDPL 2GIYA 2CMRH 4YJZL 3NBNA 3EFFA 1FAIH 4LSSL 5IEKB 1T04B 1FGVL 5I16A 3SDXA 3EYFA 4NQVA 3TBVB 4CW1A 3MQIA 2AK1H 4C83A 4KI5E 2CKNA 4I3RL 4CN4A 1FG2B 3KPQA 5IHLB 4M6NL 3ARPA 4LPTA 3VXRA 3PIQB 3GSQB 2CRYA 2DQUH 1UH2A 4LLUB 5SX4I 2OX5A 4JDVA 5IV2A 2V5RA 5E5UB 2XQBL 1E28B 4WIQA 4U1JA 1X3DA 5KS9E 5KZCD 1TVHA 4ELMF 3MRNB 5EU7E 4UQ3A 1IM3A 2AABH 4OIIL 5L2KB 4MX7B 5T1MA 2W0LA 3MMEA 4U1GB 3WIIH 4EI5D 3B2VH 4Z76A 3VFUB 5EBLA 3DECA 3KPSD 4P0DA 5E6IA 5TQ2L 4W68A 1AR2A 4NOFA 1FFRA 1I7UB 3X3FL 1QLFA 3SCMD 3FMGH 5ICZB 2YPKB 4QYOA 3H3PH 4WUKH 1LP9F 4NPYB 2YSSA 3MLUH 4Z8FL 2DLHA 1QSFD 4XNXH 1PKQA 1QFUL 5IEHA 3E1F1 2CIIA 2VWEE 4S1SH 3BT2L 5IBTL 5I1JL 4D9RE 4WU7A 2EICA 3G6JA 4UMGA 4PJAB 2CRMA 4M7ZC 5HI4C 4YQXL 4FFYH 4PG2A 3U0TB 5AG8A 5D71L 1L7IH 3MV7E 4XP4L 1A9EA 3C5JA 1DJSA 4P2RB 4TPRL 5JIHA 2MCG1 1CT8A 1IAIL 3TJHC 2PR4H 4U2YA 2VXVH 4PJBB 2F8OA 4K3HA 2BOCB 2JIXD 4HIXL 4I13B 4FTVA 4DGIH 3NCEB 5DWUH 1OLZA 2WM0A 1N6UA 1TXKA 2FR4B 5DD1L 4DOHB 4LMQI 2H3NB 2Z4QB 1DBAH 3MA7A 2AI0H 5CSZA 5CJQL 1XGYL 4HS6A 1R3LA 3DMMD 1T1YA 2Z31A 4LASH 5D7IF 3U9UB 5GS2H 3L1OL 4A2MA 3T0DA 1Q0XL 4XCEB 1A4JB 4NKQB 3X13A 4P5TD 3C2SA 4Y4KA 5JXED 4ZO9A 3Q3GB 4PP2B 5HPMB 1DEEB 5CEZL 4EIGB 2ADIA 2BY0A 4EDWL 5DD3H 4DCQB 3EDKA 4IM8A 3MUY1 5GGTL 1VDGA 1JGLL 1EK3A 3UJJH 5CD5D 4LLDA 1ZOXA 3VGAB 1WQVT 1JGUL 3FONB 2P5WB 4XI5D 2CKBB 5DQJB 3RX5A 5C8JB 2UWEE 5IMLB 3BD3A 3EYSH 4KJQD 3DIFB 4YDVA 5I18L 1JWSA 1FVCA 1OPGH 1XGRA 3SDCB 2WBJC 1OQXA 4UV7L 4X7EC 5L88H 2VJXA 4B5EA 4Z6AT 1P5VA 1DTUA 1YC7A 4IOFD 1NUFA 4HJJH 3SBWC 4O00A 5IP4A 1XF2A 3V7AE 3ZHKA 2BNQE 5D2NC 3VXTA 3MYZA 2MTPA 3X14A 1F4XH 5J56B 5DS8A 3QUML 5T5NF 3S35X 1OWRM 1T3FB 1Q38A 2EZ0D 5B39G 3VXUE 3ZE1E 4PB0H 4XH2A 1A1OA 3RWHA 3TT3L 4H26A 4K7PL 2FLBT 4R7DA 5FHAH 2PYFB 4X8JB 4G8EB 4AT6B 3OJDA 2W60A 5E4EC 1RUQH 5D2LB 1PG7L 1SJXA 3BYYA 3U36A 1NUNB 3F7VB 2XQYG 3C5SB 1KJVB 1F13A 2XYCA 4NFDA 1NCCH 4ZOEA 3NA9H 4KAQL 3EOYG 2P5EE 4OFDA 3QDGA 3OGCA 1MJUL 1GZQB 3U9PL 5JZ7D 4PJ5A 5E9DB 4OFYA 3MFFB 4F58L 2K7PA 4KVCH 1KB9K 5ANME 2XWJB 5E2UL 3CC5B 5CBEB 2R1WA 3ZT7A 5DJAB 5FYJH 1I8MA 3FO1A 4PJ7B 3MV01 5DJYB 4Y2DA 2NX5E 2XXCB 2X4NA 1I8LC 2Z91A 3SKJH 4K2UH 4OFKA 4Y5XC 4F7EA 2A9NL 1KN4L 4LVOC 3GSNB 3KR3L 2UVEA 1QSEA 5TDNA 2D7OA 1LK3H 1P53A 1U6AH 3C8HA 4NNYA 1GRWA 4J3OC 5C70A 3K3QA 3P11L 4JN1H 1I8IB 5DEFB 1EJOL 1M7IB 4M7KL 5EBMB 2JJWA 1M7XA 3QEUA 3OAZH 5BW7C 3QDJB 5DRXB 2N1KA 3O6KH 2UYLB 3ULVF 2HFTA 5F7KC 1NCUA 1CLYH 3RWJB 1PEWA 2FZ3B 2NY3D 1A6UL 4ZAKA 2VR5A 3MREA 4PFEA 2WNGA 3TBYA 2FIKA 4XPGL 3TN0D 5IW1B 5DRZB 5I6XB 3P0GB 2R4RL 3LD8C 4HFWA 1EEYB 2GYSA 2B5IB 3C6LA 1ZT4A 5IB5A 3P77A 4DKAA 3BXNA 2X4UA 4JEGB 1MCLA 4JZOB 4MJIA 2A9MH 4JY5L 3VXMB 1KBGH 2J7LA 3U0WL 3QEQE 3THML 4ODWB 2H6PB 3B2UD 5CZKA 4KMTL 4LLYB 1ZS8A 4ZXBA 1EH9A 4ZO8A 4FQ2H 2YN5A 3UZVB 3EHBC 3FFCB 3RA7H 5KANI 3SDDC 1C5DA 4XVUC 5KW9H 5KOVC 4OLVL 3RFZC 5I1IH 3QRGL 4YHKH 3WUWG 4YHLH 4L29B 5JMRA 5DUBA 3IU4L 1NGXA 2WK2A 2YA2A 1KELH 2CR6A 3QH3A 5EO0A 1IL1B 2DKUA 1LDPH 1RV6X 3KPTA 2DQIL 3LHPH 4C4KO 1NEZA 4KK8C 3JWNC 4YNYA 1KJ2H 3NIGE 3UMTA 4O58L 5FFLA 3RL2A 4EQ3A 3MNZB 3G04B 5ALCH 5IOPB 3WCYA 5DJ8B 4KI5D 4X9BA 5HDBE 2VISB 2R0WH 2QR0A 4KK6D 1FNGA 3ZYZA 4ETYA 2IGFH 4NNPL 3ZSSA 3FB5B 5KJRL 4LP5A 4D3CH 1KT2A 4OLXL 3T3PE 1URLA 4KZEH 5EIVA 3L3JB 4TQEH 4PJFE 1AJ7L 3JSSA 4RNRA 3UJIH 4G6AD 4JFPB 1T5WB 1MIMH 2KZ1B 2PO6C 1FL3A 2DLGA 3NPSC 4HMDA 4NZTL 4ETQB 3VG9C 1G7JA 4JLRB 1JZ7A 1CD0A 1DP0A 1KGCE 3N85L 4PJ9B 2UZYB 1R0AH 2XRAH 4UV4H 4PV9B 4Z7VB 4M6AA 2R23B 3LOWA 3SDXE 3I3DA 4ZSOB 1K2DB 4I77L 3MCG1 1VGEH 1H0DA 4P46D 4X6CB 4GMTH 1HIMH 2C3VA 5I1KH 3U7AA 1IARB 3IU3B 1U93A 5EOCL 1BIHA 1E27A 3CDGA 4RISL 3VFTB 2Q6WB 3VXRE 4MB4A 1M6OB 3V6FB 2VXQL 4JDTL 2QSCH 5B38G 5IR1A 1UWEH 2KQNA 3WFEH 1YYML 1FFOB 1RZKL 3E3QE 3H6JA 5EN2B 3TJEL 3K7UA 3D87B 4LEXH 5B3JF 2F5AL 1DR9A 4NP4L 3EO0B 1A14L 3WNLA 1IGJA 4N8VA 1OARL 1S7UB 4P9HC 3QXAB 4B7LA 4HUMB 4PJEB 2ZCKL 4YR6A 4ORGA 3U83A 3ZDYE 4S2SA 1WWCA 2BMKB 1ZLSH 1EGJA 15C8H 3IDXL 1ZA6A 5IHBA 4XC3H 1TCRA 4KJPC 4AH2B 1WV7T 2P42B 3REWA 5C0DA 1A4KA 2UV3A 2XA8L 4Y19A 3MLVH 4TSBL 2XPGA 3C5ZA 3RY6A 4D0CA 1N59A 4NKDA 2M26A 3WJLA 1ZHLB 1PKQE 5GGQH 1RULH 5DJXA 4QHLA 1CXEA 5JLZB 5DJ2A 3UJTH 3SKMB 1XGPB 2F8XC 1WIOA 1RZJH 4OM0L 5IJKC 3G6JE 1G7LA 4HCRH 4KJWC 3FB6B 4JFHE 5JHLL 4C56A 5C0CA 4KKLC 4ODXA 1EMTH 5I8EB 4GKNB 3HC0B 4NO0D 4XB8A 5ECJE 4S1RH 1N64L 5EC2A 5JHDB 1WZ1L 5E8DH 2B0SL 3F12A 4ELMB 3SGKA 1UB6B 5D1XC 5F93C 3VXOA 5DLMH 2X9XA 1YNTB 4FTVE 1GAFH 2GSGB 3UBXG 3LB6C 1KB5L 1TZIB 5K33A 1RZ7H 4OZ4B 1IGFH 4PG9A 1I1FA 1ZK9A 5IMOB 4P48A 1VESA 3MLZL 4N0CC 2V2TA 4HUNB 2BNQD 3V6OA 4TUJB 5DR5H 5TF1L 4R2GB 4NQDA 5IJVA 3ZTJH 1E6OH 4I48A 1MCCA 4R26H 2PXYB 5T3ZE 5IWLC 2C9AA 1DBJH 4G9DA 4KHTL 5EBWA 2BCKA 3LZFL 4KV5E 2EIZA 1WCBB 1EAPA 1XGTA 2FECL 3VXQA 4HS8H 4HK0A 5ICYA 1RU9L 25C8L 1OAXH 5AAWA 1BFSA 4FZ8L 3QQ9D 4XMPH 1QQDB 2P5ED 4YEEA 3EOTH 1EHLL 2AK4E 1XH3A 1BQHA 5HHPA 1ZLWK 1X5XA 1CGTA 3BFOA 3MRBA 2YPVL 4HWEH 3DX9B 3LS5L 3V0AC 5SWQB 1MCSA 5I9QB 4EEEA 3PGDB 3JV4B 4XGZA 1IAKA 2B39A 2CPCA 4MMXC 4QTIL 4UIMA 4GBXD 4MAUH 1DQQB 1QKZH 2PW2A 2VDLL 3ARGA 2IPKA 4PTTA 5ENWB 3PG2A 2IJ0C 4H0IA 3RJQB 2X4TB 4Y5VB 5IMKA 5AZ2L 3L3OB 3FT3A 3PL6B 2DBJA 2EXWD 2Y5TA 3OKKB 5D7IB 4GRWF 3KYMA 1NJ9A 4X6DA 5HGBB 5CUSH 4IRSD 4PJ8A 5L8LB 3A6CL 1U8NA 5E00B 5JPNA 5MHSD 5T3ZL 4P3CH 3G08B 5IF0A 2AJZB 3I6KB 1RK1B 4O5LL 1I3RA 5LGJA 2VIRB 3QDGE 1P6AB 3MJ9H 4X7SL 5B4MC 4XNYH 1INQA 4KK9D 4L3EB 1UFUA 5EORL 1QLRA 4IHOA 5FB8B 4O2CB 1F6AB 2J8UF 1G7IA 4G7YL 3R1GH 1FNHA 1C5BH 4O02H 4BH7A 5MENB 1J05A 2Z35B 3NH7L 5D6DC 4BZ2L 5I1DB 3RPIB 2XKUA 1X6NA 1I4FA 5TDOB 4JN2B 5BMFL 3EDJA 4ODSL 2DIBA 1QFWH 1CF8L 1QSEE 3QEQD 4G8GA 3RWDB 1BQLH 3CVHB 5GJSL 4JPIB 1NFDF 2D7QA 4IIQB 1BBDH 3BPCB 4XC1L 2BY1A 1A6VL 3O9WC 3D85D 3KPNA 5GRJL 3QNYA 2FJHA 4CJ1A 3NCCB 4HK3J 4KRPC 5DQDL 4AMKH 3EOAB 2ZJSH 4GLRH 2X1XR 4GG8B 4WHYG 2GCYB 3ULUC 5E99L 3L5XL 5JXAL 3O8XB 2QQLH 5JW4R 1AY1L 3KPMA 1H5BA 4FQJH 1A3QA 1CS6A 1PY9A 1WTLA 4IRJD 3WFHB 1OSPL 2CGRL 2CD0A 1JBJA 4X6EA 4QOKA 1DL7L 5E8PA 4NKOB 2GUOB 1T03H 3ROOB 1YEIL 1DLHA 5GQBA 1XCQA 3LEXA 3CXHK 4MJIE 1QRNB 2ZSVA 5HGDA 1EO8H 1WFOA 1AGEB 1UZ8A 3CFKA 1DQDL 4LQ1A 5I17A 4UINH 1Z2KA 1T66C 3FFDA 1JWMB 1T22A 2JB6B 2KL6A 1YQVH 1D9KB 2HRLA 1P7QB 2BNRB 1ORSA 4N0YL 4E42B 1WT5A 1F2QA 2X4PA 1IGTB 1CLZL 2ADJA 4GW5B 5SX5K 1MRFL 2Q8AL 3O2DH 1W72B 4U3HA 5BRZD 3ZE0F 5IFAH 2BRRH 1S7XB 5DD0H 1EVTC 1QG3A 3HPJB 3ARDC 4J3XA 1U3YA 2XFXB 3LDBB 1PVHA 3GJEB 2AGJH 1KGCD 4ISVB 2BXZA 2XKNA 1BFTA 5GRUL 1CFBA 3WXWL 3TYFA 1JNHB 2AJ3B 4PRHB 3O6LH 2E7MA 4IMKC 1S3KL 3HZVA 3PHOA 4ESKA 5JA8B 1G9NH 2HWZL 1DBBL 5CWSB 2BSSB 3GBNH 3X11A 2L0DA 4FQIL 1A6TB 3KPLA 5FGSA 5C92A 2GFBA 1RI8A 4AJ0A 4FFVD 1FPTL 3VFGH 1R3IH 4TSAH 3RVWC 1IGIH 3QJHB 3B9EA 3QIWC 3S6CA 3QUZA 3O4LD 1JPFB 3V4PH 1CGXA 1UJ3B 4OFIA 3VXRD 1A7RH 1U8LA 5E1AB 4AL8L 1FIGH 5F88A 2WP3T 3QUXC 1JJUA 2MCPL 2H32H 4QXGH 4OM1H 4XWOC 2VLKA 2I60L 4YE4H 3ZE2F 2GITB 5EB9A 3Q1SL 1TVDA 2C7UA 3SY0B 5HDQL 5FHBL 1NLDH 1N26A 3QPXH 4G8FB 1MHHB 2ADGA 4FXKA 5KG9B 1IEAA 5E6ID 1JTTA 1LK2A 1YY9D 5DQ9A 1N0LA 1U8MB 4HV8B 3C60C 5EA0H 4GG6B 4KK5C 3OV6A 3VH8G 4L1DA 2BZDA 4POZC 5EIIA 1HOCB 2XNAA 1RHHA 1IKNC 4P5KA 2VDKH 2IAMB 3EJZC 1MQKL 5TF0A 4HGMA 1TZGL 2P8PB 1RMFH 1FJ1A 2VE6B 4X9IA 1WBZA 4Q9RL 3TPUB 4GAYA 3KNBB 3DUUB 5J6HA 2J2ZA 2VQ1A 3KGRA 4JFHD 5L6YL 4NO2B 2VLME 3CSYB 4WI4A 4TTDC 4BKLB 5ACZA 1QYGH 4MXWL 4OAWB 3VXSA 4FZEL 1GHFH 3MRDB 1U92A 4Y89A 1SMOA 4URTB 1XZ0A 1G9MH 2ZCHH 3RNQA 1YPZF 3HNTH 3BWAB 4PJHB 2JJTA 1QLEH 3MRRB 1G7MA 4YO0A 1JF5A 3VWKC 1HEZA 3DV4A 3DARA 1E4XI 1MCPL 4LPCA 3HE6A 1ZT1B 1I75A 2A6IB 1LHZA 3VE0A 4N8CL 2MPAH 1IJ9A 1SQ2N 4Y19E 4JANA 1KCVL 2CXGA 5IMMA 2FX7L 3HHRB 2HA1A 4HW6A 1WEJL 2Z31D 1AO7B 1YEKH 5HGHA 5EU3A 3MGOB 4NBZB 1JI1A 3QIBC 3QEGH 1CBVL 4Y4KD 3IFNH 2VMFA 5D6CB 3EUUA 4ZFGH 2DM3A 4C56E 5C0CE 4H88H 2FX9H 3MNWB 1OAYH 5DJDB 1DVFC 5I1GH 3BOVA 1T7YA 2APBA 3BI9X 3L6FA 3NZ8B 5HGAB 3MLRH 2K9UA 3SN6N 5E24E 1HH9B 3AREC 1M1SA 1UWGH 4CMHB 3ZDXF 3BQUA 4K7PY 2AJXL 2MSPA 4ZFZB 5I1HH 1T1ZB 5IVZB 4NRYA 3S97C 5BJTB 1TETL 1BWMA 1HSBB 3T04D 3V6OE 1YZZA 3FO0H 4LSPH 3ZKSD 1WSST 4JQVA 1TCMA 4NQDE 2B8OT 2J88L 2RB8A 1AGFA 3VMPA 2E3VA 2Y7QA 3ROLB 5D7JC 2ZUWA 2R1YB 3BGFB 1E4KC 2DM2A 1MLBB 3H2WA 3JWOL 1U0QA 3SE3C 3BD4A 1MJ8H 1PGRB 2ZUVA 3VCLA 4LLQB 5F7HA 2Q3AA 3OZ9H 3W9EB 1JNLH 4OF3A 4MJ6B 4FXLA 3MOAH 4HUWA 4HF5L 4XCYA 4L9LC 4JFXB 1T0NA 1X6LA 3QDGD 5K9OB 3RBGA 1LEKA 1ETZA 3P4NA 4BFIB 5B3NA 4PJ5D 3H9SA 4OFYD 3IDIA 2OSLA 1XF3A 5E8OB 3L7FA 5IG7B 3WJJC 1FVEB 3HC3H 1J11A 1JZ6A 2DL2A 4XCCL 1ZHBA 4LLVB 4RWHA 4Y2DD 3QULB 4WFFE 2E9BA 3SDAC 2F54B 1HDMA 5H2BA 3CVHH 4RRPG 1RUKH 3CX5K 4WI9A 4RBPK 1QSED 3QG7L 2R4SL 4X6DE 3S35H 4EI5C 4OKDA 4OCYH 4HH9B 3PWNA 3BHBB 1WBXA 4KUCF 4YPGA 5EZOH 1ZEAH 4K71B 1W0WA 3MRPB 3TWCL 3SCMC 4NQEB 3ZDZE 4PJDA 5AG9A 1P7KA 4KTEH 5FV1L 2GAZB 3WFDL 1GPOL 1JPSL 3IS0X 1NGPH 4ZAKD 2VXTL 3UEZA 1R5IB 2YEZA 5GJTL 2I27N 3ZT5A 1AQKL 4GKOA 2Q1EA 1CR9L 3UO1H 5IVXE 4K7PX 2DQCL 2EH7H 3CLEL 3U4EA 2VZUA 4GRMA 4L3AA 3BGMA 4QWWD 3L95B 5KVFL 1SEBA 4LCUB 3S36X 5IGXH 5EO9A 3C6LD 3NACL 1T2QH 4HS3A 3BPLB 1A6WL 1G1YA 4MB5A 5IB3B 5HYJA 4MJID 2NY5C 1CZ8H 3PJSB 1T83A 4G8GE 3IDGA 1IC7H 2HFFA 4DW2L 3LKSA 4JB9H 4ZPTA 4ZXBD 4LU5H 3HCVB 4YDKL 2KUTA 4GRWB 2RHEA 4I0CC 2ESVA 4PRIA 1W72H 4Z5RB 4F57L 1G0DA 1MF2H 2Y36H 5FGCE 2Q8BH 3NMEA 4Y4FB 1RAMA 3O81A 1G6RH 3ULVH 3KYNA 2X42A 5ISZB 2P47B 4IDJL 2HRPL 3DMMC 1T7ZA 4HGWA 1NDMB 3B5HA 4MD0B 3P0VL 4LF3B 4LQFH 3KPSB 2DBLH 4OCRH 5F7LB 2NXYB 1E4JA 4YIQA 1R24B 3B9DA 4P5TC 2BNUA 4U6YB 5JXEC 2DLFL 1Q1JH 4UQ2A 4QOKE 2B1HL 3MO1A 5D5MA 4XRCB 5DD6B 4PUBL 2EKSA 4R4FH 4PD4J 1IQDB 3SDYL 3O0RL 2F15A 2R69L 5HY9B 5HBBA 1VKXB 3DSNA 3GMQA 1MCRA 5ESQB 3W9DB 1UA6L 4V1DA 3ARUA 3AMLA 1RZFH 1CU4L 2OXHA 2EDQA 3DRQA 4X9FA 4XBPB 4MD5B 4KQ3H 4Y1AA 2ED7A 4JM2A 4OZGF 4EIZC 3VXNA 2HKFH 3IXAB 4IOFC 4TRPH 5M95B 3ARFA 1VFBB 5T3XH 3WE6B 3BIBX 5BS0A 2CLRA 5GS0D 4CRPA 3EYVA 1GIGL 2P7TA 1IM9B 4X80L 2G60H 5E6YA 2NW2A 2RFXA 2DQFB 3IJSB 5DA4A 1CCZA 2YHGA 1NBQA 5DD5H 4C59B 4BUHA 4FMKA 4RAVA 3RZWA 1EFXA 4L4VB 4QRUA 1EERB 2UZXB 4GXUN 4LSTL 3SGDH 3WYRA 3GHBH 5ICXA 4BSVA 4HHAA 3GHEH 1HZHL 2YRLA 5H37H 4YBLB 3ZKQD 4NJAH 5DUMH 3IF1B 5GRXG 3VFRA 5I74B 1JZ2A 2X4QB 3ESVF 5IW3A 3AFLA 1DN2A 4UT7L 2HT2C 3I9GH 1N3NA 3J7HA 4GSDL 4XPTH 1FQ9C 2HVJA 2EDBA 4JY6A 3FB7A 3WIFA 2VLKE 3FAWA 4LLMB 2DWEB 1CL7L 4HFUH 5ADOH 1ADQL 5DTFA 4OI8A 2OI9C 4X8XA 3AY4A 1Z5LB 1RIUL 1NL0H 2CSPA 3M1BA 2AEPH 5K59E 1CI5A 4U6XB 4JKKA 3TNNA 1N8ZA 5GS1B 4XP1L 3MCKB 5C0BA 3JTSB 2BY2A 4H1LB 1DUZA 4K3JH 3S37L 2ZCLL 2VZSA 1K8IB 1U42A 2XWBB 3C5ZD 1ZV5A 5I0DA 2XOTA 4XBGB 2VL5B 4CMMB 2A38A 4Q2ZB 4OZHA 1I9JL 2OJZH 5DHYA 5HPOA 1ZVSB 5KAQG 4LCCB 4CVZA 1E6JL 1RZJC 2GI7A 3CFDA 4WFHE 2HJLA 2NY3C 4PPTA 1H15B 3QAZC 5F9OL 1SEQH 2RAMA 4C56D 3HMWH 1OP3K 5C0CD 2P8LA 3VXSE 2ZPKL 1N7ML 1RIVL 5FYKD 4XPBL 2AW2A 3MA9H 5TPWL 1HSAA 1I1AA 1KLGB 4GMSH 1BD2A 2VDMH 3ZYIA 2BVQA 3MV11 2DLTA 5F7WC 3BH9B 1Q9WA 5CBAA 4R4ND 5GHWH 2FSEB 3GSXB 5TFSH 2ITDB 1I3GL 2WBKA 3OKMB 1OGTB 2VN4A 1WICA 1NUGA 1N6QH 1MVUA 5HDBF 4D0DB 3U1SH 4NQDD 3OG6B 1MRCH 5JO5A 4L8SC 4K3DL 4QHUB 4F8QA 1YEGL 4HC1H 3QA3B 4RIRB 4M5ZL 4XCNB 3WEXA 3O2VH 2E9WA 3D0VA 2ENYA 4G42A 5C0EA 3QNZA 4R4BB 5E8NB 3FRUB 2Y1VA 2R15A 3IDYC 1C5CL 2CDFA 1C1EH 3ARBB 3PHQA 4FHBD 2I9LA 1MLCB 4OCMC 5I30L 1O7VA 3GIVA 4WUUA 4R3SA 4FQ1H 4MNGA 2AEIT 3GSUA 3L3GA 4KI5C 3F65A 3S8WA 5EOQH 3HC4H 4Z77A 1UXSB 2EO1A 4KK6C 3GFUA 4Y16B 3OB0H 3TN0B 1SVCP 2W9DH 3OKLB 4YBHA 5DMYA 1BJ1J 1SJVA 3DUSA 2AJSL 4ZNEA 4GAJL 4NZRH 3A0OA 4S11A 4OCNC 2IC2A 3T4AA 2IBBA 2R0ZH 4WCYL 3JV6B 3SGEH 1Q94A 1ZSDB 4UIKH 2GW5A 3ARGD 4G6AC 1HINL 5BO1L 2H9GB 5EU7C 1I3UA 4TNVK 1D5BB 2JJUA 3IT8D 4PJ8D 4RA3A 5B39A 4JFQA 1C7TA 1FL5B 3K81A 3KJ6H 1UH4A 2ZOLB 4JCMA 3SQOL 5DMIL 1CGVA 43C9B 1O7SA 2BFVL 1ND0B 4G6FB 2MKLC 4RFEB 1CFSA 3VD9A 1YDPA 1WBYA 2NZ9C 3H9SE 2E7HA 1ZA3A 4PRPB 3AU1B 5TE6L 3TPKA 4FFWD 4XVJL 1CD8A 3HG1B 3UC0L 3ZTJG 5BVPH 5JUEL 4GKZB 4I3GA 2XZAH 3T65B 3EOBA 4HDIA 3ALPA 3G5VA 3FQNA 1EJ6A 3MRFA 4OT1L 4JGUA 3UTTA 3WS3B 4G8GD 5I75C 1A3RH 5BQ7A 2ICCA 4XZUB 4GRWH 4ZNCD 3L3IA 5IESL 3PABA 4ODHL 3EDFA 2XWTA 3RL1A 4NO3B 1X5IA 2FB4H 1GC1H 2VR4A 4MDJA 4MS8C 1BOGB 4H25A 5I19H 2M2DA 4P23B 4BFEA 5MEPA 3LKPA 3B9KA 4PJDE 1JRHL 1D7FA 1MAKA 3RWGB 3VGEA 3CMGA 5IHZA 3NIFF 1NC4B 1V05A 2YC1B 1EIBA 2R39A 3LN4B 1AFVL 4X98B 2WBJA 2LE9A 4NZDA 4HKJA 2ICWB 4MCZA 5DYOA 3VFMB 3O4OB 1F4WH 3SKOB 3M17B 5HHNB 1OD7A 4QOKD 1T21A 5D2NA 5JOFB 4P46B 2A6JB 1CFTA 3TLRA 1KTLB 2DTSA 3OHXB 5FYKH 3TESA 5HYJE 5D70L 2W07A 1CE6A 1JV5B 5FAAA 3K1DA 3NFPA 1KIUA 3VFWB 5IK3A 3N1QC 2GSIB 3HZKB 1H8NA 1YY8A 4JRXA 3MNVA 2ESVE 4PRIE 1EHNA 2ORBL 3MV7B 1NCDH 5FCUH 4CGTA 3V4VL 3PV6A 4Z0BL 8FABB 5HHXH 3TH3T 1IAMA 1YECL 5C0JA 5M7QA 2AQ2A 1JL8A 2Q20A 4K94H 1BZ9A 3WD5L 2IQ9L 3ES6B 2DQHL 2PCPB 1KIPA 4U1KB 4OTXL 4HUVB 3BRFA 1LE9A 4JRWA 1CK0L 1U36A 4MXVF 3QUMB 5IHUH 1D6EA 3HMXL 3ZYJA 4Z78B 3Q5TA 3HZYA 5FXCH 1ZHNB 1MSPA 4NCC1 1KACB 2DOCA 1I8LA 4HWZA 4WEMB 4TVSa 5HDOA 1OLLA 5JPMA 4HPOH 3OAYK 5H35B 3QQ9C 4JPKL 3KYKH 4ZQKB 3MRJA 4V1DE 1HILB 3K4ZA 5DK0B 3MBEC 3QEHA 3QUZD 4NZJA 5LXGH 4OCWH 1H3GA 3V52H 2GK0A 3FQXB 4Y1AE 3AB0B 4OCXL 4PJIF 4KVNH 5E2WH 4Q9CA 3VI3F 3DYMA 1MWAA 3W81A 1S7VA 2VLKD 5DFVC 2DL9A 3L5HA 5D7LE 4GXVL 2W59A 5BS0E 1KCSL 2VABA 5BW7A 4XX1G 3O3DB 2UWEB 4Q6IC 4PV8A 2QHRL 4JHAH 4DUXA 1KC5H 2ZOKA 2J4WH 2XZQL 3S96A 3X12A 3KG5A 3ZYOA 3T8XB 2OK0H 4H1LH 3O3BB 4Y4HB 5D1QB 4IRSC 1MFEH 5H94A 4YDIH 3P4MB 1CGYA 4ZPVA 4L8CB 2VSCA 1HXMB 1FH5L 1Q8MA 1RZIB 3C08H 4LGRB 1WWAX 1PFCA 3DHJA 4YGAB 4XXCC 3G9VA 2IFFH 3AROA 3VXUB 4ZTOL 4RDQG 5C9JB 3ARYA 3RP1A 4WFHD 3RAJH 3DI2B 3O2WL 4XXDB 4ZS7H 3UP1A 1Z9SA 3UTQB 2DWDA 2X9YA 5JOPE 3MJ8B 4TN9A 3VXSD 2HMID 2XG4A 1JE6A 1AP2A 4NN7B 2C4XA 4I0PA 3SDDA 1NAMA 1CICC 4GW1B 2P5EB 5B38A 5IKCA 1KENH 5D93C 1G9MC 2CDEB 2MFNA 4GLRI 5SV3A 3WXVL 3NFSL 3BIKB 5CINH 3GRWA 5EOCJ 2CR3A 1QNZH 1J7VR 2OBGA 2WWKT 3QHFL 3M07A 4TTGA 5DFWH 5ANMB 4M61B 4IBLT 3V0WL 4N1CA 1TQCB 5C0BE 2YMXL 1GGBL 1KCLA 2MWCA 3HE6D 3S4SB 4LMQE 2AXFB 3EDEA 2NX5B 1BGXL 4R8WH 4XP5H 5KTEH 4HKBB 4JDZA 1FVDB 1MJJB 4GBXB 5E5MB 5AD0B 2OL3A 4OZHE 1RZ8B 1Z9MA 4LRNH 4X6FB 5KSBA 4TVPE 1JYXA 3CH1B 3FOMB 2FIRT 5D4QA 1Z9LA 3PP3H 3FQWB 3KYOB 2E8ZA 12E8H 4X99A 1C8PA 3E8UH 1BPVA 5GZND 1QBAA 1KCUH 2LVCA 3UYRL 4G5ZL 2VLLA 4PJXF 4APQB 1GGCH 2VDPH 4O51B 1HKFA 1XT5A 3MRCA 1PAMA 2IBGA 1ZAGA 4CU7A 1HQRA 3QQ3A 3TZVB 3VD7A 4LSSH 1AD0B 2X2YA 3D25B 1FGVH 3PDDA 1BD2E 1QR1A 3F58L 3AM8C 3DUHA 3U0PA 2JCCA 2B4CL 3NPZB 1ZANL 3PP4L 4I3RH 1CXIA 1V3MA 3BQUD 4XAKD 4E0RA 1FIEA 1S7TA 5IW6A 5I1CL 4M6NH 3F5WB 1MCBA 1WC7A 2FJFA 4CBPA 2FL5B 4E5XB 3UBXA 2XQBH 4OD2A 5EZIL 2W1NA 4Y7MA 4UZGA 4CAGA 4LP4A 3FB8B 3GJFH 1Q9LB 5J8OA 4XCFL 4X7TB 5C07A 4NUJA 4OIIH 4MJ5A 4HXBL 5E70A 4AM0B 1BOYA 4TVPL 4WEBH 1X7QA 1UACL 3T1FA 1R3HB 5TQ2H 3LV3A 1AHWA 1XMWA 4NWTL 1J0IA 2C1PA 3L3HA 1NGWA 2OZ4A 3T0AA 3X3FH 3P4OA 3OKEA 1SBSL 4WUUE 5LJYH 4FFVC 4MNGE 2OLDA 3H9SD 1CYGA 3PWLB 4U1IA 4Z8FH 1SY6A 4IRJB 4NO5B 4ZNEE 4R0LA 3BP4B 3BT2H 3GM8A 3HI6H 3WV0A 3CGTA 2YWYA 3TNMA 4IOIA 5HJ3B 4YQXH 4P2YA 4XAWL 4XNQB 5D71H 3T0VA 1F11A 2XZZA 3MV9B 2CQVA 4FA8A 2I9TB 3W2DL 3QI9B 2DQGH 3MOBL 4TPRH 1P2CA 1LNUB 3FN9A 5IJKA 4MQ7A 3G5YB 5E6IC 2NY1C 4YEFA 1H3XA 3WLBB 3CX2A 1BIIA 4PLKD 3FN3A 5GGSA 4L9DA 5C0IA 4NHCL 2WIIA 2Q7NA 3O3AB 5CZXD 1CFQB 2FYYB 1PYWA 3QO0A 5CJQH 5D1XA 4WFGE 5ADPH 1BQUA 4I4WA 1Q0YL 4WRLA 2I24N 4ZUWA 3UROR 3KLAA 3NN8A 4RGMB 3L1OH 3GMOB 1G7HA 1Q0XH 3SDXB 4JZNA 4LNVA 3EYFB 4PG2C 2P46B 4JQIL 4CW1B 1NFKA 1FSKC 1BJ1H 5CEZH 2J8HA 4LAQL 1CD1B 4RFNC 5AAMA 4FQXB 5HYJD 5EU4A 1QPPA 2HLAA 4J1UB 3KPQB 3PWPB 4MAYB 3VWJB 1N5AA 2LQRA 4PR5B 1MHPL 5IWLA 3VXRB 1JGUH 4NQXB 1IEBA 5F1OB 4Y2OA 4Z7UF 3HKFA 1S9YB 2AEQL 4JDVB 1J86A 5IV2B 2FWOA 3OPZL 4PRID 3RX8A 3NIDF 4UV7H 1TVHB 5I0ZA 1M71A 4JG1L 4UQ3B 1IM3B 4GRLA 1KB5B 1OSZA 4ONHA 2C1OA 5BCAA 5T1MB 4I2XA 1QBLL 4P4KC 4MDIA 3KDMB 1EEZB 4Z76B 5EBLB 1NC2A 3BYTA 3QUMH 1A7OL 5SWSA 1U3HB 4HIIB 1BHGA 4ODVH 1SBBA 1KTDA 5T5NG 2L7UA 2ZUQC 2D9CA 5FA4B 1QLFB 2CLVA 4OI9A 5A1AA 5INCA 2EKJA 4QYOB 3CMOH 3BZ4A 1YN7B 3BESR 4HK3N 5ID1A 5C6PB 3PWVB 5D2NE 3HS0A