1XF4A

Structure of ligand-free fab dna-1 in space group p321 solved from crystals with perfect hemihedral twinning
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
molecule keywords Fab light chain
molecule tags Immune system
source organism Mus musculus
total genus 50
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4A01
4ODWA 5DJ6B 1YY9C 2AGJL 2VDRL 1DQJA 3ROOA 3BGAA 3CSBA 3X11B 3LN4B 3G9VA 2JJSA 4JJHA 1CE1H 2VC2H 3B8SA 3IETB 3UTOA 4UOW0 1FPTL 1X5YA 4GJTB 2JJTC 3BVNB 4ZG1A 4OFYD 2X7LA 2WWMD 5IVOA 4BQCA 2ARJB 3IKCB 4CKVX 1CLOH 1WFNA 1BFSA 5I6XB 2DS4A 4TUKL 1DVFA 4RMQA 4V1DE 2DQCL 4RFOH 4G6KL 3MA9H 1T1ZA 1A7OL 3JV5A 1I9RH 2ARWA 4MXWH 4QXUL 1G7LA 3OXSA 3DPBA 2X42A 2FBJL 4YDLB 5DJXB 1TQCB 3VDAA 1BQHA 2C4XA 3FOMB 4PG9B 4ORGA 3SY0B 3UTQA 3X3GL 3QHFL 4PJHB 4NM8L 4K7PL 1FNAA 4KAQH 1CGSH 1J05B 4J3OC 1FSKB 1K8DB 3JWDC 3IFOB 4I9WD 3I3DA 5I1HL 5DRZA 1VDGA 3AMLA 1HHKB 2P5WD 2F53A 4CNIB 2HMID 2B4CH 3RWDA 2HWZH 4NCC2 2QQKL 1ZA3B 2EZ0D 4WJ5B 4KDTC 2WMPA 4KQ4H 5EDXA 1NC2D 3T2OA 4KZDL 1NBZB 4TSCH 3P2TA 1QLFB 5HVWA 1KV3A 3BI9X 1NAMH 2V9QA 5D1ZD 4XAKE 4D8PB 3BP5A 3MJ8A 5IVXB 1A6VL 2F8VA 1S7UA 3DTXB 3QDGA 1NANH 1X5IA 5EO9A 3RWIB 1II4E 4HX1A 1UKQA 5I73C 3QNZA 3MV11 4LOUD 3TC9A 1OGAE 2FLBT 3VFMA 1T5WB 2X89D 5I66B 5J0BA 5HDQH 4EIZC 1LK3L 2P5WB 2WBJA 3EDEA 3L1OH 2O93L 5EPMA 5C07B 4AQOA 1GOFA 3GHEL 4U1KB 2AK1H 2NW2A 5GGUB 4KGLA 1NC2B 3CK0L 1TVHA 5KSAC 2MJWA 5EC1A 2HAZA 4OD2B 3BZ4A 3S6CA 4NP4L 2VN7A 1YEKL 2EIZB 3BD5A 5D1ZB 3U0PB 5C0BA 4DJMA 3CH1A 1CTOA 1OAZH 1YPZA 4P4RA 3GSOB 5JA8B 4GRLB 4AEIL 2O5YL 2YHGA 3GSQA 3P11L 4CW1B 1OB1A 1Q9OB 4PJFB 1VCAA 3VFOB 3VI3E 4CDGC 3HMXH 4JY5L 3F58H 4G43A 3BW9B 3GUTB 2DAVA 2Q3ZA 4XPAL 1V7MH 3VXSA 4UT7H 1TDQA 4KKCD 3WFDH 3LDBB 6FABL 4XGZB 4XI5D 1SJEB 3SE9L 5I1AA 3VI4F 2FSEB 4FQJL 3RI5F 1LE5B 5I16B 5FDWA 1FVDA 3HG1B 5H2BB 3UTSA 3RVXC 3KS0J 5GISL 3C09C 1A1MA 4FP8H 1IAMA 2MQCA 4K7FB 4XPGH 5E94A 3RGHA 4ZS7H 3BGFC 1YEIH 2IBBA 3UAJC 3DSFL 4JY4B 4LASL 5F8QC 2BDNL 4HPYL 3T0BA 1BBJA 4U1MA 5FA3B 2QQLH 3VXUA 4L4VA 4XC1H 3AGVA 4HIJB 3KYNA 4NQDA 2XG5A 3IB4A 5MEQA 1CLYH 3RWHB 4JZJC 2AJYH 4HKZB 2AXFA 1U92A 4HQQL 1D5MB 3NA9H 1AD9A 1BAFH 4XWGL 3VRLF 1XGQB 1TFHA 3MFFA 2J6EL 2XICA 5D72L 1Z5LB 4K9EC 3QIUD 4DCQA 4Z78A 1FL6B 4Z95L 2PNDA 5GGRY 3NTCL 4L8SC 5IFHL 5EA0H 3DXAB 5E1AA 3BZFA 1U3HC 1PZ5B 2FEDD 5A16A 1KIRB 4U1NA 4RIRA 3E6FA 4CN1A 3QQ3B 3O3UN 4BH8A 1MHPL 3RY6A 1QP1A 4JFYB 1KJ3L 4CU6A 4KK9D 5DD1H 4JJ5A 3NH7H 2PTTA 4F7MB 3D85A 3UPAA 1P84J 3N50A 1QBLL 4LARH 4Y4FB 2QSVA 3TYGL 5ADPH 2ZSWA 4D0CB 1KG0A 3C5ZC 4KJQD 4LLWB 5CZXC 3QIUB 2OR9L 4M5ZH 2G5BA 2EIBA 4HXAH 4RBPK 5DXWA 4G8GD 3VWKD 4JRYB 2PO6C 1NBYA 25C8L 4FQCL 2IH1A 5KVGL 5FM5M 5MHSE 1QQDB 2EH8H 3BE1H 5EZOH 4KZEH 1CGUA 4L4TD 3BPCB 4XC3H 4Z7UA 5I30L 1BLNB 3LIZL 2F74B 2DTSA 2QSTA 2H8PA 4Z7OE 1JZ7A 1JBJA 1YEGL 3KYMB 3BGMB 3BPOC 4HJ0D 4LKXA 1FBIH 5F9JB 3AS1A 4N1CA 1BHGA 4OM1H 3O6KL 4FG6D 1E4KC 1KULA 3FTGA 2EYTA 2P7TA 4HPOH 3OJVC 1JV5B 4UIKH 2V9RA 1FO0H 3S3JA 4E42A 4JFXA 5FGBA 4FQIH 3WFCH 4UDTB 1QKZH 2Z9TA 4QXWA 1P2CB 4NQCA 4G8GB 3VWKB 3HNSL 3NVQA 4QY8A 2BERA 4Y4HA 1LEGB 3F7VB 4OCXL 4WFHE 5C09A 3PE9A 4L4TB 4ZUVB 1NUFA 5JHDA 2YUZA 4DAGH 2Y36L 2HH0H 4I0PC 3DECA 2W65B 1PAMA 3SO5A 3QUYD 3O2DH 1G1YA 3NZHH 5IBLC 3C60C 2XY1A 4QCIB 4MNQB 3VE0B 3FMGH 4RGMC 5I1GH 1WT5C 5L0QB 1IC7L 3FONB 2XYCA 1Z2KA 2R2EB 3DLQR 1MCPH 2XWJB 3DROB 4AEHL 1TVBA 5E4EB 4F3FA 1DQDL 4NFCA 3VMNA 2DBLH 2ATPA 3BAEH 1I3GH 3I2CH 2NLJB 4WU7A 1HE7A 3RFZC 3IU4L 2WANA 2R0KH 5IV2A 4EIGB 1XGUB 4R96B 2X4NB 1UFUA 3LEVL 4M62L 2ADGB 4HS6A 1FIGH 5SWSE 4NHCL 3U9UB 4MQXD 4FN0A 3IDYC 3ECBB 2F15A 5T1LA 5J6HA 5IBTH 3WKMH 2J4WH 2YRZA 5IB4A 1AE6H 3QUYB 1A7NL 3M8OL 3B9DA 3I85A 1WBYB 4WW2B 4O9HL 2JJTA 2K7QA 2FO4A 4Z7OF 1OM3L 1NUDA 4KV5F 3TZVD 1CFVH 3EKCA 4EI5C 1MAML 1MVFA 1NCWL 4RZCA 1OOAA 3RUGE 1C12A 1KLUB 3HZYB 4RWYH 4X99A 5ESQA 1CBVH 2VXTL 3L95A 5AEAA 1MREH 2D4FA 3EJZC 3FB8A 1N3NA 1CS6A 4LEOB 2DJSA 5BMFL 5DFTA 1P4IH 3D3VB 4K71B 5HHVL 1DL7L 3N85L 3LKPA 1DBBL 1N6UA 3D1MC 4XPBH 4JFFD 3OKOB 4NQEB 4X6CF 1ZV5A 3V6FA 2Z4QB 1KCLA 1HINH 2YPLD 5I1LB 3NN8A 3UYPA 4QF1B 1ZTXH 2F19L 1DEEA 4H8WC 2VISA 5L8JB 4JLRB 4QRRB 1Z9MA 1RQ5A 3OJDA 4KDTA 1AR1C 1ZHKB 3HE7A 5E2JA 4P59L 1HSBB 5FUOH 1IBGH 3IJYA 1QACA 4BFGA 2XACC 5IESL 1IGML 4OLZL 4D3CL 1FDLH 4M9PA 4G7VH 2BX5A 3VGBA 5HVHB 4NZRH 5DRNA 3B3IB 1T1XA 2BXZA 5CGMA 3TN0B 1CDIA 1QEWB 2GUOA 4JFFB 3V2AR 5KAQF 4Q9RH 5HI3C 4WUKL 4R3SA 4GXVH 4M7ZB 1E4XI 2XN9A 2XPGB 2YPLB 4HKBA 3JV4A 1PSKH 5EU5A 2NY5L 1H5BB 1JUFB 4F7PA 2VLJA 5FCUH 4M1GL 2ZPKL 4TSAL 4KI1A 1A7BA 3B9KC 3GI9L 4KTEH 2JIXD 5HDBF 4R4BA 1ORQB 1MJJA 1QYGH 2BNQE 2DM2A 5D6CB 1B0RB 4TTDD 3RUGF 1MFDL 3G9AB 2D7TH 3MRRB 2MKLC 2VLRE 1IRAY 3KPRE 1RZ7L 4BKLA 3VXRD 4XXDB 5EFIA 2BNRE 1G0DA 4UTAH 4LNVA 3TVMC 3N1FC 3VD9A 5F7DB 5LBSL 5DFWH 3TPUB 4P9HL 4DK3A 5KTEL 1IGJA 1FAKT 4Z7QF 5J7CC 2YSSA 3G6JE 5M95B 3QIBC 4LCYA 2DQGH 4LNRA 4X6BA 2X1WL 4NQTA 4GSDL 1JWMA 2OSLB 2BMKB 3MRJA 5SX4H 3D87B 3WLBA 2PW2A 1ZKAA 3MV9D 3TNMA 1HH9B 1IC4H 3U6RA 2I26N 1EEZB 4OZGA 4X4YB 2OR7A 4AMKH 5BZDB 1XZ0B 1YYMH 4JM2D 3EO0B 2H2SC 3CPLA 3BQUC 2I9LA 3O9WD 1TJIL 3SE8L 1JZ4A 4KI5C 1N5AB 2HN7B 1HCFX 1I3VA 1MQ8A 3HAEG 3VXRB 2EDLA 5DUBB 3LH2H 4QO1A 1Z9OA 3TJHD 4ZSOA 3U7WH 3SKNA 5JA9A 3GMQA 5I1KH 3IS1X 2IALB 3S3PA 4K7PY 1OAXL 4NQVA 4YBLB 4ZUSA 2IANE 4N90E 1YEEL 4Z76A 1GZQA 3QO1A 5GSVA 3MV9B 1U8JA 5DO2C 4YFLF 2J5LC 1R5VA 1W72B 3KXFB 4LIQE 4X9FA 1IQWH 1KTKE 4NKIH 4QYOB 2WIIB 4JM2B 1BEYH 1U3HA 3BESR 5ERWB 4HGWA 3MRGB 1AP2B 2WNGA 3O9WB 5BRZB 5KVMC 2R4SH 4HC1L 1PEWA 2A73B 2YA2A 1N0LA 2RFXB 3ZL4H 1BF2A 2YKLL 3IJSA 2VLKD 2GQHA 4MA3B 1UJTA 3DVIA 1U8LA 2D7PA 1ODAA 3MLPA 3MRKB 1AI1L 4IOIA 1G7PA 1QZ1A 2DL9A 2CRMA 4OZFB 4PJIA 4XTRC 1GRWA 4KJYB 3WN5C 1QD0A 4WWKC 2V5TA 1LEIB 2DQEL 1Q1JH 2CKBA 3C5ZA 2VXSL 3G6JF 4LGSB 5HGHA 4LHQB 1CXLA 3G6AB 5BVPL 1CFSB 3T4AB 1SY6A 3T4YB 3GSVA 5I71B 3FN0L 1N64H 5DUMH 4JN1L 2NZ9D 4HZLB 4KC3B 1W72L 4P48A 1EEYA 3ULVE 5BV7C 2BFVL 2GSGB 3PHSA 4Y1AE 1YMMA 2RQ8A 1WC7B 4JQIL 5GZOC 2VLKB 1LGVA 3QFJA 3O3EB 1LEKB 1S7VA 1D5BB 3FFCD 1LNUA 2FX9H 3CFEB 2PKDA 1D6VH 2QR0A 1PKQB 5DHVB 2J8UA 3LQMA 3UYOD 2YC1B 5D2LA 5IM7B 1RIUH 3IFNH 3O6LL 1OTSC 4PUBL 3T1FB 1AQKL 1S7WB 4WVRA 3VFGL 5CS7A 4PJ7A 4EBQH 3SQBA 1G7QA 4JFOB 4P2QE 5D8JH 1PD6A 3OAUL 4PJ8D 5HHOB 1P4LB 5TDPB 4TSBL 2PN5A 2BVEA 1KFAH 3EZ8A 4JO3L 3SOBH 4RGOL 4NZUL 4U7MA 4NC2B 3SBWA 3TO2A 2H1PH 4OM0H 3C60A 8FABB 3O41A 2VQ1B 5D2NE 1QA9B 4XCYB 1WT5A 1ZS8B 1FG9C 4S1SL 3S37L 3VFWA 2AJXH 1ULVA 5I18H 4WCYH 3BZEA 3FB6A 4L8DB 1FE8L 4HH9A 3DX6A 3MLVH 3FAWA 1DBML 4QRPA 4TNWK 4EOWL 4WHYH 3RL1B 5JUEH 4XPTL 5EC2A 4HIXL 4WO4C 1U8IB 4LCIL 4XHJC 1AO7E 3GRWL 4ZPVB 2V5YA 4N8VB 2EE6A 4GMSH 5SV4A 1MH5B 4RFNB 1PG7W 4UQ2B 4PRBA 3PV6B 1PYWB 3FCTB 1EFXD 3DYMA 4WV1C 4J3XA 3ULVF 5JPMB 5DJ2A 4JB9L 4X6CB 1AGBA 2NR6D 4FQ1H 3MUJA 5FIEA 1ZGLP 4FZ8H 5JOEA 1M05A 3PJSA 2H9GB 4DTGH 3BP4B 1RZKC 3C6LC 5E5RB 4EI5A 2NXYB 1QBMH 2FL5B 5IVXE 1FC1A 4RNRB 5A2FA 1CL7I 3PWPA 5L2JA 2B2XH 4MJID 2EC9U 5LGKA 4OZHA 4I9WE 2I60H 2C1PA 3T0WA 3DI3B 4XNUH 3MV8E 2D31B 1G7MA 1V05A 4A6YB 3Q6FB 4JGMA 4YDIH 3DVGB 5CJXC 1QFWH 4FXGB 1JNNH 1KELL 1BWWA 4LQFL 1FYHB 1JGEA 2UWEB 1EFXB 2QSCH 4YHML 4GW5A 1UWEL 3NAAL 3D25B 1LO3H 4Q97A 2AJUH 4F33B 2CK0L 4YJZL 4HIEB 1MI5D 4WUUD 3T1WA 1VGEL 1OAKH 1RURL 1NBVL 3WIFB 3L5WB 2BOBA 3T65B 3MYJB 4Z0BL 1TNMA 3HE6D 2YMXL 3MCKB 4MJIB 1CXEA 4WGWB 1CTNA 1GOGA 3EFFB 2B1HL 5GGVL 3RKDC 1HSAA 1ZOXA 2N1KA 5C9KA 4PJEE 3DJ9A 3DMMB 2DQDL 4P4KC 1J0KA 1OAYH 3B5TA 1L0XA 5EUKA 5IHBA 2XWBA 1JPGB 4XXCC 2R9HD 4A6YL 3Q5TA 3L7EB 1C08A 1YQ2A 2D7OA 4I3RL 3QUKB 2J8HA 5HTSA 3ZT6A 1F8TL 3BXNB 4LEXH 3RVVC 4LLYB 1RJCA 1MI5B 1XF2B 4QXGH 2W9DL 2ZUWA 1WSST 5C92A 1D6EA 4M48L 1C1EL 5GJSL 1SBSH 1M7IA 3B9KA 3LKOB 3HE6B 3WIHA 1U58A 1FGNL 5FFLA 2BY2A 1FFRA 5ITFB 2DM3A 2Q7NA 2F5BL 1BIIA 3CSPA 5DEGB 4POUB 1UZ6E 1LO0H 4PJDA 5FO9A 4LRNL 1BPVA 3WFBH 4G6JH 1NDMA 4PBVC 5MI0B 1PX4A 3PHQB 5KG9A 5DC4B 3EOTH 3RGVD 3TVMA 2Q7YA 3ALWA 4UNTA 4M7JH 3VFNB 5KSVB 3UTZB 2A0LD 3QPQD 4OCMC 3U2SB 4U6VL 3QIBA 5HHMD 4O4YH 2CDFA 4J3TA 3KAAA 5FK9B 4ZQKB 3LV3A 5TDOB 4DKAA 3IVKB 2Y5TB 3OV6A 4CUCA 1OT2A 1AGFA 2YBRB 1I9IH 3L3DA 3LB6C 2ICCA 2H26A 2B7DT 2IPUG 1L7TH 3BQUA 2BY3A 4KXZI 3GJFB 3W39A 1A21A 4OGYL 2H2PC 1A3RH 1NCDH 5DS8A 4ZAKB 3SDXA 2ERJB 3LHPH 4IRSD 3RNQA 3WXVL 1E6JL 4X83A 4PS4H 3RGVB 2VLLB 3QDJA 1YNTB 3EW3B 2ZUQB 1IEBB 3SDCA 4QRSB 2KDGA 4K8RH 1OHQA 4UT6H 5FV1L 1ZLWK 4NSKB 4PLKD 4BH7B 5E2VL 3ZTJG 4LLDA 2BHUA 1OWRM 3DX9A 4R8WH 3CLFL 1EDQA 2Q87A 5IJKC 5EIVA 2EH7L 4PTTA 3WFEL 3HC3L 3B5GA 5FYLD 1KYOK 2WV3A 1W0WA 4KK5C 4DVBA 4NRYB 2DBJA 1A7QL 3GFUA 1PQZB 4LSPL 4YDJB 3VFPA 3AC0A 5GSRA 4MJ5A 1H3VA 4G7YH 4NC1C 3KLHD 1EAJA 2BCKB 2YN5A 5C0JA 4IRSB 1UZ6F 1UM6L 2WBWB 1DQLH 2BVOB 5FKPA 1KPVA 12E8L 2R4RH 1YEDA 2ZG2A 2V7NB 1Q9WA 4N0UA 4EDXB 2Z92A 3VGAC 1AH1A 5HPMB 3NIDE 4HFUH 4NO0D 4WWKA 3HCVB 1J1XL 4EZMA 3F7PC 4L4TE 4FA8A 2VQUA 3TO4D 1FG2A 3QFDA 4PJBF 1YN7A 4JDVA 1HHGB 2XTJD 4YZFF 1P4BL 3U1SH 3BUYA 1QFHA 4TRPL 4WI7A 2VMFA 3ZO0A 3PQYA 1YEFL 3NPSB 5DVKA 3MUY1 4HJGA 4JZNB 3X14A 3GJEA 3CX5K 4YXHH 5HYJA 4EN3B 2XQBH 4Y4KC 2D7QA 4M4RA 1KT2A 2A1WL 3ME0A 4MJ6A 5DSCB 32C2A 5FDYA 3EYSH 1SM3L 4OF6A 1RZ8A 2ZKHH 5GS2D 1KEML 2QBWA 5JIHA 1W0YT 3P40A 2Z35A 3TBYB 3MUZ1 4FQQB 4NO0B 1QO3A 4W70A 5C0RL 4KDVA 2OYPA 3ULUF 5EIQA 5F9DC 3IDJA 3O0RL 5GGQH 3N9GL 4LL9A 4PV9A 1XGRB 5E08H 1RUAL 3TO4B 2ZJSH 4J12A 5LWYL 2HT3D 1JGDB 4ALAL 1Q0YL 3HC0A 4K2UL 4PRPB 4GAFB 1RUKL 2X70B 1KTLB 3KPSB 5D7KE 3PABB 2E9BA 5JIKA 3FB7B 4DN4H 1S9YA 2XG4A 1NGXA 4GS7B 4YHZL 2RAMA 3QA3B 3GO1L 4S1QL 3HHRB 3QZWG 1DQML 1MLCB 2BC4B 4PYGA 1LD9B 4ZDHA 4WGVB 5A1AA 4OCYL 4TPRH 1XT5A 4LGRB 4P0DA 3QXAA 5IG7A 5DC0A 5D7SH 3RI5K 4YHLH 4DUXA 1BJ8A 2K3TA 2HT2C 4R0LB 5C0CB 5F96L 4KFZC 3DUSA 5FCSH 1B0GB 3GSNH 4G9FA 2CUIA 1ACYL 4YK4C 3INUH 3GMMA 2OQJA 1LK2A 3B6SA 1FL5A 1A9BB 2FJGB 2IH3B 2NY1C 1H15A 4IM8A 3VDBA 2LFGA 1YJDH 4YO0B 1N6VA 3JWOC 4PLOB 5DUPL 3KPNB 4HCRL 5F1OB 5T3ZD 3P0YH 4WO4A 2DQTL 4PJGE 1CE6A 1G7HA 3F12A 1G7JB 3MOQA 1OAQL 3KPOA 5DJDA 3VGGA 2YD8A 3AXLA 2ATKA 4I5BA 4WV1A 1NFDA 3P9LA 1J12A 1OSPL 2X4QA 3GKWH 4KRMB 5ACMA 4TQEL 3OKKB 1NGWB 5D9SA 4Y8AA 3VGDA 3DX7A 5K59F 5I1EH 3DETD 3EFDH 4OUUB 3C6LA 4FFZL 5C9JA 3WNMA 1YUHB 1T3FA 4G8EA 2R23B 1NAKH 3CDGA 3PL6A 3MUGB 4Y5XC 5EZLB 3S3SA 3L5IA 9CGTA 1ONQA 1DUYB 2VR5A 5FHAH 3TBVB 1QNZL 3U0WH 5BVJA 1ZT1A 4DGIH 4NM4L 3A6BH 5CEZD 4PJXB 3PWNA 3DBXB 1U6AH 5JZ7C 2OX5A 5CJXA 3MBXL 3ZDZF 3MLRH 2FIKA 4P2RA 2Q6WA 3S4SB 3S5LB 2DQJH 5DD0H 1DUZA 4KMQA 3UJJL 1DVFD 4DW2L 4M8QB 2FJFB 3BWAB 3D39E 4GG6F 1ROWA 1INEL 3QHTC 4I2XA 4R2GC 5CBAA 5JLZB 2DF3A 2FJHA 3FT4A 3HPLB 4X98A 3VD5A 4QRTA 3U7AA 4OLVL 2XA8L 3WCYA 4MD5A 3CMOL 2XNAA 4HUXB 3SPVA 4AL8H 1XCTA 1A3QA 3UJIH 1JWUA 3DGGB 1PVHA 2NW3A 1DQJB 2BOCB 3ROOB 1YNKH 3PWVB 2GCYA 1WAAE 3VFRA 4NBZB 2OL3A 4UUJA 2VNCA 4CMMA 1GCFA 1KPUB 2OI9C 2LU3A 4KVNH 4B5EA 5I8EB 1LDPH 2F53D 4U0QB 4S1DC 4P4KA 2X7LB 4F57L 5LQBH 3RY4A 4B53A 3MR9A 3MGOA 4FABH 4XP9L 1PG7H 5CINH 1FL3B 4OFVA 3CFCH 3DIFB 5T3ZL 4XXCA 3FT3A 4OJFH 4JG1L 2QLVB 1T1ZB 3RWEA 5B39A 3EUUA 5F97E 5H8DA 3TLRA 1ZXQA 1WK0A 1Q0XH 2O5XH 3E6HB 4M7KH 3SJVA 4KJPD 4PJ5A 1KC5L 3RWCB 2JCCE 2FGWH 1BQHB 2FECL 4EQ3A 3UTQB 4ORGB 2IPTL 1GGBH 2AQ1A 4KK6C 1RZGB 3QDGD 2H3NB 4XP6H 3EGSA 4XVSH 3O11A 3BP6B 5EORL 4ZFZA 5EZIH 3CFIC 5JW3H 3KLDA 4PG2C 4HLZH 1KIQA 1YN6B 3TBTB 3T0EE 5C0IB 2WBJD 1EO8L 4OZ4A 2HLAB 1MRDH 1NL0H 1A0QL 1QFUL 1EJ6A 3S35H 3ZHKA 5GGRA 1JYNA 1GGCH 1JGVH 1HYRC 1MCHA 1JGUH 2I25N 4PGEA 1ZHLB 5D71H 1HILB 3KJ6L 3P30H 2ZP0T 3EIFA 5F1IA 3V4PH 1CQKA 3H3PH 1XGYL 3FQXB 2IG2L 5C0BD 5GS0C 1Q8MA 4GRWH 2IFFH 3D48R 4K3EL 4WI2A 4UDUB 4QOKE 1T20A 4JFDB 5IMLA 5KANI 1OAUH 2Q20A 2DI8A 3HTLX 1UEMA 5I6XC 2JKXA 4URTB 1MCOL 2BVYA 3BPLB 2L4OA 1NLBH 3TJEH 4P2OB 4JM4H 3VXSD 4JQVC 3DARA 4YDLC 4ODHH 4ZNEA 5ETUA 1RJYB 3PXJA 5E8OB 5EPMB 1RUQH 5CIPH 1K2DB 3BDBA 4MQTB 3MLUH 1FSKC 1QR1A 3D0LA 3WXWL 3UTSD 3QUXA 5HDOA 1QUNA 2V6HA 3I3EA 3VH8G 2QADB 1UWGH 3IXTB 3CH1B 5CAYB 1YPZB 4L29B 2AABH 1H8NA 3O3DA 2R2HA 5GRWA 1NEZA 3U9PL 5IVNA 3QDMA 5IJKA 3GSQB 5T5FH 3VXUD 2CQVA 4KDWA 4L4VD 3TA3B 3MRQA 4X6EA 2JCCF 1OB1B 4LCWB 4NQDD 4RAHA 4PJBB 3OF6D 3OXRA 2AEQL 1GPOH 4G43B 1IQDA 4PGJA 3FO1A 3P77A 4Y19A 4LSVL 4RSVA 1A2YB 1TMCB 4JVPA 3AROA 2DKMA 5I1AB 3W9DA 1AXTL 5EU7C 1NANI 5FDWB 5GGVY 4DKDC 3UTSB 1A1MB 3N1QC 4AY0A 3U30B 1ZANL 5E94B 2KBGA 2RGSA 4ONHB 5BJTA 1ZGLM 2G9HA 2E9JA 1X5GA 1BD2A 3FN9A 1C7SA 4JAMA 4RX4A 4O02H 1BBJB 5A43C 3VXUB 1T83C 4HJJH 4L4VB 4MXVE 4YHOL 1BECA 1KYOJ 4HEME 1H3WM 4FS0A 5MEQB 3B2VL 3CIQA 4H1LA 3C8HA 2WUBH 2BXYA 2JELH 2AXFB 4LIQH 4E41A 2C3HA 1U92B 3FFCE 5FYJU 3D85D 4OD1H 3MXVH 4M6OL 3Q5YA 1NDGA 5D1ZC 2ZG1A 1RVFL 3DYPA 4GRLC 1UADC 1FYTB 4Y4KA 2XQYG 5DI8B 5CCKH 2P5EB 1JF5A 3BZFB 4HDIA 2AGJH 1MLBA 2CPCA 2E7HA 3LDBC 5A16B 4BYHA 4U1NB 2AJVH 4OSUL 2ZUXA 4QNPF 4BH8B 1BZ7A 4QWWC 2LU4A 5E9DA 1I8LC 4JRXB 3T0DA 5CEYA 4HWNA 3ULUL 2PTTB 4Z8FL 3KLAB 4PB9L 3D85B 3QULA 4BELD 1YA5A 4S10A 5J1AB 2QKIA 4BSJA 1QRNE 2DI7A 4Q58C 4S2SB 4TUKH 2DQCH 4G6KH 1T22A 1KG0B 2MHAA 1T0NA 1A7OH 4OAWB 4QXUH 4NQCD 2FBJH 3H3KA 3IKKA 1E27B 1NBYB 4Y4HD 2IH1B 2MFNA 3QHFH 5ALBL 4NM8H 4K7PH 2C3GA 5C09D 1R5IA 2NY7L 5JHDD 2ITDB 3BO8A 1FNSH 3OKEB 4UTBL 4X4XA 5I1HH 2BVPA 1F90L 1MJ8L 5K33A 1BM3H 2H8PB 4G42A 3FT2A 1IC1A 3IYLW 5B22A 3ALPA 4FFVD 4X7FC 3V0AC 1LO4L 4UV4L 3EOAA 2QQKH 4MXVF 4ELME 3BP7A 1Q9LB 2EYTB 2YEZA 1A4JB 3FAXA 1C7TA 5GRUH 4E42B 4JFXB 4KZDH 3GIVB 4DKEL 2EEDA 4JFHD 4GG6B 1ZSDB 4NQCB 1XGPB 4PPTA 4QY8B 1IAOA 3VMOA 5EBWA 1A6VH 3THML 3WLWC 1EHNA 3SDYL 5IK3A 2V17L 4OLUH 5C09B 4P3DA 2D0HA 4Y4FC 4BFIA 1E6OL 2DQUH 5EUOF 5JHDB 5D7IF 3C2SA 3HFML 2W9LA 5T1LD 1A64A 3QIUC 2R29L 3HUJA 3NIFF 3EOBA 1J1OL 3WL9B 4MD4A 1LK3H 1Y6NR 2R1XA 4IMKC 4X5LA 3LQAC 4LMQI 2J8UF 4WUUE 2FEDC 3WEXB 1N8ZA 4PRNA 4I0KA 2IQ9L 4QTHB 1TVBB 1KENL 3CK0H 2X9XA 1AQDB 1BJMA 3MV7B 1FFNA 3F62A 5FGSA 4XBPA 4HIIA 4WU7B 4F8QA 2A6IB 1JPSL 4G6FD 4NP4H 5IF0B 2OZ4A 1JJUA 1H0DA 4LP5A 4OBSA 2RR3A 1XIWC 5J11C 4AEIH 1DLFL 5EIIA 1Z0NA 1CD1A 3P11H 5IFJB 3V5HB 1TPXC 2IAMB 4LKCA 1QSFA 4GAYA 4JY5H 4X7SH 5FYJL 1XFPA 4CVXA 3HI5L 3TF7C 5DHYA 2FO4B 1ZAGA 3SE9H 3TGXA 4H5SA 1I3RA 4FQJH 3VD4A 4RZCB 3I6LD 4POZC 1RFDL 4OCSL 1C12B 2O26U 2CSPA 3HE7D 4MDJA 5GISH 4ELMF 4X99B 4YR6B 1KNOB 3IDMA 4MAUL 4L9LB 3A0OA 3L95B 4G6FB 3DSFH 1C5BH 4LASH 2NNAB 2GJZA 1WCQA 4ZS6D 4HPYH 3FB8B 1KB5B 1N3NB 4MVBC 1HNFA 3VXMB 5L6YL 5L0QC 1T4KA 1ETZA 3GSUB 5E7FA 1TETL 2VR4A 5E4EC 1HXMB 4NJ9L 1D9KA 5JMRA 2HFEA 5J6GA 4PGDA 4PG2A 2ICES 4I13B 2XN9D 3GGWA 4XWGH 2AV1B 5HHME 1KXTB 3ZHLA 2J6EH 1FIEA 5DJ6A 1NMBH 3RKPA 2VLJD 3GNML 2VISB 5ADOL 3X11A 3MRDA 1S7QA 1RY7B 3OJDB 2IBZY 5C7XL 2A74A 4Z95H 5L9DL 3HE7B 3MLXL 3NTCH 5F1SA 5IFHH 2CJUL 1BMGA 3FQWA 3LRSA 5DDHB 5LKNA 3IJYB 4IS6A 4WW2C 1ZLUK 3BVNA 5D7LB 3QPXH 3QXUA 3UMTA 3QEQE 1V3KA 4X4ZA 3QEUA 4GMTH 2JLLA 1T7VA 1EXUA 2ARJA 1MHPH 2SEBB 5DQJB 4LF3B 1EMTL 2BK8A 1T1XB 3H9SE 2LTQC 4PB0L 4JPVH 4GH7B 1I1RA 2AJ3B 2MQ0A 4HUKB 3GBML 3R8QA 1Y6MR 2XN9B 3JWDL 3HRZB 1QBLH 5DJXA 4HKBB 3UC0L 2CD0A 4XBEL 4PG9A 3SY0A 3PGFL 1I75A 2VLJB 2GJ6B 43CAB 4MQXC 1CZ8L 4XRCA 4U3HA 3PGCB 3UTPD 1R24A 3IFOA 4DUVA 2NY5C 4JPKL 25C8H 3LQZA 1MPAL 1TLKA 4FQCH 5FYLE 3UAJD 4AT6A 4MA1C 5DJAA 5EB9A 1HHKA 1HWGB 1RPQA 4CNIA 4XPHL 1WICA 4E0RA 1RMFL 3NCMA 2NZIA 1ZA3A 3LIZH 1JPFA 4WNQA 1BWMA 1JPST 3CD4A 4JZOB 1NBZA 2NY2B 3UYRH 1SYVB 2W38A 3EYUL 1QLFA 2C1OA 5KVDL 2HJKB 2YSSB 4NHUB 1CXFA 4LCYB 5IHZA 4FFYL 4HF5L 4D8PA 2A77H 1JWMB 5C6WH 3MRJB 5I0ZA 4P9HC 5HVHC 3DTXA 4O5LL 4UAOB 3WLBB 1U42A 2PW2B 4Z7WA 3MLZL 3OL2A 4EUPA 1E4XL 3RWIA 3TN0C 5AWNH 1WEJL 3HNSH 3CDCA 2VDOH 2C3WA 1DANU 1JIBA 1DBKH 2XTJE 4LU5L 1KF9B 5I8CA 1T5WA 2Z8VC 4DWHA 4PJDF 5JORA 2WAHA 3ZDYF 1TCRA 3CPLB 2I9LB 3K8LA 1XF1A 1H5BC 5C07A 1NH6A 4H0GA 1I7ZA 4N5UA 2Y36H 3MRIA 1MRFL 4X6DE 4U1KA 1T83A 1G9ML 5D5MF 5KSUB 2EEAA 3NCYS 4JREC 1NC2A 4OTXL 1J5OL 4JDZA 1H3GA 2DI9A 1R3HB 3RJDA 4ZSOB 3BH8B 3D5OF 3ESUF 1RUPH 1A02N 5T1MB 3GMQB 1RUML 1RHHA 1T80A 3HRPA 3Q0HA 4OD2A 4WDIA 1IC7H 1K85A 5D1ZA 4FTVE 4NQVB 4NBXB 3GSOA 3ARFA 3KHOA 4GRLA 1V7NH 3B43A 1U8JB 3C5ZD 5DQ9A 1R5VB 1UWXK 1Q9OA 4PJFA 5E5UB 3STZA 4P5MB 4R26H 4AYFA 1T7YA 4M62H 1CIDA 3FN3A 5GZNC 4HGWB 4NHCH 4XGZA 1J88A 5L88H 2DIBA 1YMMD 2R1WA 3U4BL 5DD3L 2FSEA 4NKMB 1MHHA 3IJSB 5IKCA 5I16A 1WWAX 3QFJD 3M8OH 1A7NH 4OQTA 1I8LA 3HG1A 4IRZL 4PLJC 5F7FA 3MJ7A 5H2BA 1R5WA 5H94A 2R69L 1EUTA 4K7FA 3VRJA 1KN4L 1KB9K 1RZFL 1G7PB 1VEMA 3EO9L 1OM3H 3BKJL 4JFEA 4D94A 4PJIB 4TTDC 4P3CH 1NCWH 1BF8A 2CLZA 2ENYA 1UM4L 3MJ9H 4S0SD 5FA3A 3WFHB 4JN2B 2UUDK 2CKBB 3C5ZB 3MXWH 5FO7A 4N0FB 1CVRA 3VRIA 1X5LA 2ESVA 4WY7L 3VJ6B 4BQ6A 3GSVB 1U3JA 4HKZA 3FRPA 4AEFA 5ABDE 1JYWA 5J1TC 4M43L 5BMFH 4KUZL 4H20H 5EOCH 1DL7H 3N85H 4YBLC 1XGQA 1DBBH 1B9ZA 3V7AG 4QHUA 1YMMB 5EUOB 1NC4B 5D7IB 1Z5LA 2C26A 4ZUWA 1FL6A 5DZLA 1GOHA 3BPOB 4P5KA 4RCAA 1S7VB 4KKLC 3S97C 3DXAA 5IBLD 3C60D 1LNUB 4OLXH 1A6ZB 2Z8RA 3SCMD 2J88L 4KHXL 5MENE 2QR0B 2F19H 1PZ5A 2Y7QB 5CZKA 3X3FH 2J8UB 4GO6B 3O9WC 1KIRA 4GAJH 1CGTA 4Q9CA 1F4AA 3GIZH 1OP5K 4P59H 4U05A 2O5ZH 5J4MA 3C8KA 3HLAB 4QRPD 1BGXH 4PJ7B 2RCSH 2OBGA 1IGMH 4OLZH 5IESH 4D3CH 1CF8L 4F7MA 4NNXB 2CKBL 5IROC 4M00A 5CEZE 4BZ2L 2I5YH 4D0BA 1SY6L 4Y4FA 2F5AH 5D93B 4D0CA 4S11A 3UJTL 1WZKA 5J1SC 4LLWA 3QIUA 4HSQA 2KQMA 2MWCA 5CILL 4YXLL 3ZE1F 3TO2B 1KN2L 1Z6JT 3I75A 4XBGB 1XR8B 1OL0A 1KEGH 4JRYA 5I71C 2M8XA 4IMKA 3SCMB 1CDJA 1H8OA 1C16A 3QWOB 1FVEA 1QQDA 4EI5D 3VFWB 2ZPKH 2EXWD 4Z7VE 1ZLVK 2MCPL 5EO1B 1BLNA 3OPZL 3LKNA 3GI9H 1OLZA 3BZEB 2F74A 4M6NL 3PWPD 3QQ4A 2HVJA 4HH9B 3KYMA 3BGMA 5ICXA 3DGCR 4U31A 1MFDH 1ZVYA 2DMKA 2DKUA 3JVGC 4WWID 5EC2B 4IEFB 1XIWA 1RZ7H 2P44B 1FNEA 5C2BL 5F3HA 2QL1A 1H9VA 2F53E 3AM8C 2CR6A 3VGEA 5E2TH 1JV5A 1SEQL 1T21A 2IPKB 4IRJC 1PDKA 3NMEA 5L2KA 1V5JA 2DLEA 5LBSH 4UDTA 4CU8A 1JNLL 5DJ2B 1AGBB 4EDWL 3R1GH 1BVKA 1WTLA 4JPWH 5ICZB 4P99A 2CRZA 2YZ8A 2XFXA 1LEGA 3F7VA 4M5YL 4EI5B 4IMLB 2EICA 4MJ2A 2DLFL 2WM0A 4ZUVA 3WUZA 2DICA 4ZFFA 3S7GA 3QDGE 5L2JB 1DBJL 2W65A 4OZHB 2X40A 2C1PB 1GZPB 4QLRA 5CJQL 4F7TB 1Y6KR 2B1AL 4MNQA 3VE0A 5BZWB 3AMKA 1OARH 3KHQA 3GK8L 1Q72H 2R2EA 5D6DC 3JUYA 1G6RH 5CSBA 3VW3H 3DROA 3RIAF 2EE9A 1SJXA 1RV6X 1JGEB 3WUWB 5IMMA 4FQPA 1R3JB 2DLIA 4GW5B 3KWWA 2NLJA 3ZYZA 1NUGA 4NKDA 2VKXA 4WHYG 4KRPB 2JB6B 3D69A 4MQ7A 5GHWH 4U49A 1S7XA 4YDKL 1F2QA 2VWEE 2ADGA 1JGLH 5C0BE 4ZD3L 1DLHB 3BISA 3U9UA 4RFNC 3ECBA 3B9KD 5F9OL 4MDIB 2LE9A 2WUCH 2B5IC 4XVUC 4Z7VF 1WBYA 4YQXL 4YC2B 4C83A 3T2QA 1HSAB 4PREA 2DYPB 2Y23A 3VXSE 4NRZA 4HC1H 5HYSA 2AEIT 2ZOKA 2NXYC 1RZJL 2FNBA 5C08A 2BSRB 1CXIA 5EUKB 4XB7A 2XWBB 1A22B 3TVMD 3HZYA 3RTQB 2OP4L 1AI1H 1FZOB 1I7UB 4XNMA 3QIBD 3H7BB 3VXQA 2H32B 5ENWB 1DN0A 3D3VA 2FWOB 2IBGA 2AK4A 2FX7H 2VXSH 5BVPH 3B9KB 5MEPA 4KKAC 3C6SB 3OKOA 4NIKB 1NGYA 4NQEA 1MIEH 4JN1H 3O4LE 4NQDE 4H8WL 4I4WA 5DVNA 2NR6C 4F9PC 2LQRA 3O3AB 3G5VB 1BIIB 2BFVH 2H2SD 4PJDB 3BQUD 1AC6A 3AUVA 2BY1A 4KVCL 2IADA 5F6HJ 4QF1A 3WO3B 4KI5D 3D2UB 4JQIH 1F11B 4QRRA 5MEOB 1FH5L 1EIBA 5KG9B 1DANT 5IMOA 2IQAB 2AKRA 4R7NB 4JKLA 1ZA6A 4XAWL 5D5MB 5D1XB 3TVMB 2Q7YB 1HSBA 3QDJD 4U1JB 5JQ6L 1WGOA 3JZ7A 3SDCD 3BYYA 3NIGE 4ETQA 3RU8H 2YPVL 2M1KA 2YD7A 4XNXL 3BEVA 3DMMC 1B0WA 3A6OA 4IIQA 3MLWH 4PUBH 3DVFA 5DO2D 2A6DA 4ZXBC 1EZVX 1AQKH 3TN0A 1AGFB 3L3DB 4YUEL 3QG7L 3OAUH 3WIHL 4TSBH 3PWUA 3K1DA 3W39B 4JO3H 1MRCL 1JUFA 4RGOH 4TUJB 3L3IA 5DS8B 2DQIL 1E4WL 4LHUA 3OB8A 4FXLA 3P9MA 3TV3L 3RNQB 2E8ZA 1IT9L 5TE6L 3C5JB 3QDJB 2L0DA 3HE6C 1AC0A 4BA8A 4ZMAT 3SDCB 5D6CA 1B0RA 1IGFL 2OXGA 1T04B 3S37H 3QNXA 4XTRD 3MLYH 3NGBC 4WWKD 4IJ3B 3QCTL 4ODXA 4LLDB 5F71A 1CWVA 2WK2A 1FE8H 2CLVB 5D4QA 2EDRA 4Z7UE 5DHVH 1DBMH 4AIXA 5F7DA 1YECL 5LCVL 4G6ML 3OKDA 4DVBB 2GTZA 4LCIH 2D4DA 4RISL 5F7UA 5HYFA 4WI5A 3PQYD 5GSRB 4MJ5B 1OF2A 4FRWA 4X6FA 3E3QC 1OGAA 4AG4L 4HXBH 1K3IA 5C0JB 1HH9A 5HYJD 5GZOD 4JB9H 1EEZA 4MNGE 5I15L 3I02A 5FKPB 1KPVB 2X41A 5BZDA 2VJXA 1Q9WB 2IMNA 5FUCC 1IGYB 4EVNB 5FYKD 2Z92B 3MA7A 5EOQL 4MHHG 1P6FA 5E7BA 1A6WL 3VFSB 4KGJA 1N5AA 2AJSL 2P43B 3ARGC 5JDSA 1OTSD 3NIGF 3IRPX 3PNWB 4ZAKC 5T5NG 1JPTL 5ITBL 3EJJX 3RGVC 4JDVB 2ZUQC 5FGCE 5F3BA 4ZFOA 3PGDB 1OLLA 2DMCA 1MIMH 2A0LC 1HOCB 2UZIL 4QRUA 1YC8A 3ZKNC 3NCYP 1QBBA 3PQYB 1KELH 1FAIL 3GJEB 4WTZA 3CXDL 3UP1A 3PP4L 4RRPG 4YHMH 1UWEH 4DFHA 1W72A 3KXFA 3NAAH 3FQUA 1KT2B 4MLIA 3CVHB 32C2B 4QYOA 1A3LL 2WIIA 1MEXL 3EYFA 1MHCB 1HIML 3KPMA 1RURH 5EWIL 2EDTA 5ERWA 1NBVH 4RMSA 1QO3B 1AP2A 1IGTA 4FFWC 3O9WA 4G9FD 5AYUL 5BRZA 3L7FA 5SV3A 1LO2H 1BFVL 2HJFA 2A73A 4Z0BH 4PV9B 3C87A 4LDEB 2YMXH 4IRSC 2ZZUT 4MA3A 5FHBL 3W11C 3T8XA 1IAIM 3QRGH 3MRKA 3B4NA 4WO4D 4OZFA 2DQDH 2VXQL 3S88L 1S9YB 1NGXB 2E7MA 4KMTL 1A6AB 1I1YB 1LEIA 3FO2A 4PGCB 4A6YH 2CGRL 5CKGA 5KZCD 4GBXA 4I3RH 3G6AA 1CFSA 5J9PB 3QXAB 5IG7B 1F8TH 5A40E 5HHXL 1KCSL 4OLWH 5F1KC 5IT2L 5C1MB 2V2XB 2CLRB 3C6LD 3QHZL 4ODSH 2HFGH 3H9HA 5ID1B 3DUSB 1VENA 4L9DA 4NO3A 3QUZB 3DRQB 4M48H 3RWFB 1C1EH 2GSGA 3CVHL 3NPSC 4G9FB 5GJSH 1RK0B 5HD8D 3GMMB 3PL6D 3VMPA 1LK2B 1FGNH 4GAGL 1WC7A 4EN3C 1D5XA 1H15B 3O3EA 2F5BH 1LEKA 3CXHK 2OK0L 1D5BA 3KG5A 1L0YA 3CFEA 3JVGA 1AGCA 4LRNH 4GLRH 1CE6B 1G7HB 3F12B 4L8CA 1PKQA 5IBUG 3AM8A 5DJDB 4IRJA 2YC1A 3NACL 1HHJB 2FR4A 3QQ9D 4P2RD 5IM7A 2ATKB 1KJMB 4AM0B 5I1DB 2FH6A 1NFDB 1P6AB 3GRWA 3P9LB 3TO4C 4F58L 1X6NA 2X4QB 5ALCH 5E6IB 1K8IA 4P9ML 4HWEH 3U36A 1BOGB 3DX7B 1VKXB 3C6LB 4JFOA 4GS7C 2BRRL 5C9JB 5C86A 5HHOA 1P4LA 4G8EB 3CDGB 2EDEA 3PL6B 1F42A 4K3JL 2VL5A 2AS5M 1FZJA 4UQ3A 1ONQB 2G60L 3ULVC 4BSVB 3MBEC 4R0LC 4HUMB 4HFWA 2XN9E 4XCYA 1QLRB 3PWNB 4PIRF 4P4KD 2FX8L 1FGVL 2UV3A 5D6DA 1T2QL 4C56B 1LP9F 1KGCD 3WXVH 2VLJE 2E27H 4P2RB 2OTWB 2E5EA 1DUZB 3K3QA 1O0VA 4HULB 1GGTA 4M1DL 4M3KB 5GRZA 2HT3C 2G5RA 3FT4B 2FJHB 3RL1A 1KLGB 4DQOL 3MSPA 3SJVD 1HEZA 3RVVD 2D03H 4MD5B 2XNAB 4PJ5D 1U8IA 4PJ9A 5E2VH 1YQVL 1R6VA 3ZYIA 3SPVB 4EXPX 3W82A 5C6TL 4UBDD 3L5XL 3CLFH 5I0DA 4Y2DB 2YXMA 3WFEH 1MH5A 2XTLA 2OTPA 3HC3H 3VFRB 4OZIE 4L3EB 1F45A 1PYWA 3FZUD 1RZKL 1XCQA 2HP4A 3FCTA 3W0WB 2OL3B 4UUJB 4CMMB 3ZDXE 1A7QH 4X6CA 1L9MA 5C6PB 1I9JL 3LKRB 1G7IA 3VFVB 4Y5YB 3BP4A 4P4KB 1YEHL 2OJZL 3B9AA 1JL8A 1PZUB 2YN3A 3MR9B 1PLGH 4XMKL 4M8VA 4GW1A 3CU7A 4J3UA 5DT1L 1QFWM 4RNRA 3GJFH 5I8KL 4LCUB 5KOVC 3UBXG 1BVZA 1AIFA 4OZGE 4LSQH 5B39B 3ARYA 3QO0B 3MGTB 1GVIA 1XH3B 4JGJA 3UBXI 1UKTA 1A5FL 3SJVB 3U48A 1MHEA 3O2WH 1J1XH 2Q8BL 4OD3L 2PTVA 4LSRL 3BRGC 3DVGA 5TFSH 1TJGL 2BRQA 2X1PA 5IB2A 4FXGA 1MJ7H 3CFDA 2YPKB 3ARRA 3EGSB 4PD4J 4DN3H 4MX7B 4RAVA 4ZFZB 1P4BH 3TCXA 3T04D 5SWSA 4NWUL 3D25A 5JIPA 5AZEL 4F33A 3MRNA 4N1HB 1KIQB 2ADFL 4OI7A 1YEFH 4HIEA 4J3VA 1GH7A 5EOTA 2XKSA 3ZSSA 2OL3L 4OZ4B 2C7UA 4UB0H 3T65A 2A1WH 3MYJA 4O2EB 3MCKA 4R90L 1SM3H 3QUXD 4LAQL 3KPPA 1KEMH 2A83B 3EFFA 3RUGA 5C0RH 4CVWA 4G80B 4IHOB 3DMMA 1X5FA 3S34L 1DR9A 3DSNA 3N9GH 3O6ML 1NLDL 3IGAA 4DOHB 1RUAH 4WI4A 4ZXBA 1UZ8A 1ZEAL 3QDMD 2WP3O 1T20B 2XOTA 5IMLB 2BHZA 4ALAH 5F8RC 4NN5B 2PYEE 3GI8H 4K2UH 3MPCA 3L7EA 4KK5D 2I9TB 1ZT7B 3H6JA 5AUMB 1MAJA 1NEUA 4G8FB 4K3GA 5CEXA 4YHZH 4PYHA 4OZIF 3ET9F 4Y19D 5FYLH 2N7BA 1XF2A 4OB5H 5HPOA 1DQMH 4G9DB 1S7SA 3ZDXF 1P9MC 1FZMA 4XVJH 4EXKA 3BSZH 3MLTA 1FNHA 4ZUTA 3GBNH 3HE6A 3E2HB 5F7EH 3D0LB 5ITFA 3QUXB 5J3HC 3TT1L 4LVHB 2HKHL 2WLYA 4HLZG 2Q76B 2HTKD 1BVLA 2VDNH 5DEGA 3KYAA 3EYOA 3M45A 2A9NH 5IR1A 5C0NC 5DFVC 4RX4D 2Y6SD 2MQ3A 3O3DB 3DHJA 2R2HB 1DSFL 1NEZB 3PHQA 3QDMB 1RJLA 1RJZA 4KHTH 3MRQB 4JFZH 1JP5A 4X6EB 4CADB 1UCTA 4LVNB 2B0SH 5DUPH 4HCRH 5L8LB 3QFJE 3OXRB 3UTZA 2R8SL 2DQTH 3DX8A 4E41D 4XCCH 3IXAA 3U2SA 1L6XA 3BJLA 4Y19B 1ZLUH 5FK9A 1NMAH 3HNVL 5KOMC 1NAMB 3IVKA 3NABL 4YFLI 3W9DB 1OSPH 5D2LE 3MA9L 3TBSA 4Y4KD 3W5MA 4TQEH 1I9RL 4N8CH 3CU1A 3I6KB 1RIVH 3H42H 2F54B 4FFZH 4OBRA 4PJ7E 4P2OC 4W4OC 3VGAB 5BJTB 1DE4B 4KAQL 1CVSC 3HI1A 3NFPB 4ODTH 5IQ9B 5GS2H 3ARGA 5I1CL 4ZAKA 2BNUA 4HUUA 2W60B 2VDQH 5C0GA 4QHMA 4Y8DC 2VLLA 5FA4A 2ED7A 3SKMB 5E9DD 1GAFL 4U3XA 4H1LB 1IEBA 4QRSA 2EDXA 4HK3J 4E41B 1HHHA 3MLSH 5DMKB 4J2XA 2QADC 4EQ2A 3MBXH 1NDGB 1SJHA 4BH7A 1N5YH 2UVFA 1KPRB 3MRHA 5SX5K 3UJJH 4KQ4L 4HUWB 4DW2H 1KCVL 2MPAL 5IW1A 1JHLL 3G6JA 3T0AA 1INEH 2OMNA 3TA3C 5E70A 2PETA 3JTTB 3REVB 4OLVH 2XA8H 1NAML 5GGSB 4NRYA 2HT2D 4M61A 4QRPE 5JIIA 4HIHB 1YNLH 2V5SA 6CGTA 1QPXA 3L3KA 1R3IL 5IQ7L 2VTFA 5F7MC 2B20A 2GK0B 2BCKA 4JDTL 4C4KO 2GW5A 4X80H 4POYA 2NY1D 3LSOB 4JHAH 1R3LB 3UROR 3SKOA 4YGVB 2X4SB 1S7TB 5CEYB 3SGKC 5HDQL 3U30C 2V7NA 5ANMB 1T7XA 5B8CB 3QULB 2CIIB 3IDNA 4U1LA 4ZNCD 3DO7A 3B2UD 3P73A 4XP9H 2QKIB 1HYSC 4MZ2A 2AK1L 3C2AL 5T3ZH 3ULUC 1T0NB 4LLMB 3V79C 5KVEH 4JFQA 3PWPE 4TTGA 1HHGA 1UG9A 5E8PA 3RDTB 1KC5H 4NRXB 4Y5VA 1K6QL 5E8DH 1OAZL 2IPTH 2EKSB 4RWHA 5FUZL 2YD2A 4FQLH 4JZNA 1R5IB 3F5WA 3NOIA 1VESA 3BO8B 4X4XB 5EORH 3UTTB 2BVPB 1Y0LB 4EN3A 1DP0A 5L7XL 3FT2B 3MJGX 2EDKA 1VFOA 3F58L 5DSCA 5CFHA 1T66C 1V7ML 4UT7L 1EO8H 4U6HB 1A0QH 1QFUH 4PRHE 5JZ7D 3QH3B 4P2CG 4AK1A 1CYGA 1LP9B 5CEZH 1T5XB 1CGWA 4OQ1A 4XPGL 4G3YL 4PRPA 2GITA 1XGYH 1KTLA 2X70A 3KPSA 5F6HI 3PABA 4OLYL 3IDGA 3CUPA 2IG2H 5EBWB 2EDFA 4TVPD 2VIRB 4FZEL 4K3EH 5IK3B 4YNYB 2QQLL 3I3BA 2B8OT 4LFHD 2PCPB 4J8RB 4HMEA 5TE4L 1CLYL 4X7TA 1QSFD 1MCOH 4QXTA 2F8XC 3CXHJ 3EOBB 1Q94A 4Y1AA 3MBEA 1BAFL 4R0LA 3WHXB 5IHLB 2R1XB 3L3HA 5C0CA 1N59B 4S1DD 4P57A 5KW9H 5F7HA 2FH8A 1K4DA 1F2XK 3HC4H 4WFED 3VCLB 2CO7B 4U6YB 4NN7C 1N8ZB 4PRNB 5JXEC 1NUNB 4LVOB 3WXWH 1IGCH 1FFNB 4NJAL 3JWNC 4JRWA 4XBPB 4YO0A 3KPNA 2R0WL 3QIWC 1H0DB 1GJIA 3P0GB 3QNYB 4H0IA 4KK6D 3U9PH 1CD1B 4L3CA 2EECA 4JCMA 1WZ1L 2QV2A 1F5WA 1H8SA 4LKCB 1D9KD 2P42B 5B21A 1QSFB 5DD1L 5CBEA 3P4MA 1NGWA 2F58L 4CVXB 4LSVH 4OUUA 5DHYB 1MF2L 4LARL 1I3RB 3OAZK 4X5XB 1AXTH 2R23A 2CUMA 3L3OB 4MMZC 5EZLA 3GEWB 4MDJB 4O2CB 5K9OA 3IDMB 3SGJC 3U83A 1DUYA 2CUHA 1UCBL 3QJHB 5DTFA 4FFVC 4O00A 3UO1L 5I2IA 2GJZB 1G0YR 4I77H 3DBXA 5GS0D 2XZQL 3LAFA 4UT9H 2OMBA 1DFBL 1ETZB 3S35X 1ZWIA 2VZ1A 4KI5E 4Z0XB 5E6YA 3S5LA 1IKFL 3LS4H 3DVNA 1XEDA 3SDXE 3B2VH 4TVPL 3H7LA 1D9KB 1AO7A 4EJ1C 3PP3K 4OFPA 3HZMB 4M6OH 1M6OB 1GSMA 2NX5E 4HPOL 1RVFH 2PUQT 4UIKL 3CVIL 4BQ9A 5LGJB 3DGGA 2BOCA 4FQIL 5F70A 3BKCL 3PWVA 1KSRA 1HXYB 1QKZL 1S7QB 3MRDB 4D9LH 2A74B 5L8KB 3UEZA 1FLTX 4LDOB 2GKIA 2IAMC 1MFCL 2VDKL 3P9WB 3FQWB 3LRSB 1KPUA 1TZIA 4IS6B 4TN9A 5I8EA 1I4FA 1N4XH 5DJ8B 4OSUH 1C8PA 3QEUB 4DAGL 4NQUA 4OFIA 1EXUB 5IW3A 1FL3A 2J12B 3DIFA 3MV8A 3U7YL 4HAGA 4UINH 3SO3C 3REWA 3STBA 4Z8FH 4L9LC 4PB9H 1A7PH 2X4PA 3E6HA 2EDJA 1UXSA 1I8IA 4N0UE 1A8JH 3RWCA 3QI9C 1P9MA 5K9QG 5DMYA 1RZGA 4PJCE 2APBA 1I3GL 2H3NA 4XRCB 4AENB 3I2CL 1R24B 3CNKA 4NN6B 2ZNXA 3BP6A 5IEHB 1FFOA 3LQZB 2I07B 1B4JH 4MCZA 3EHBC 1IILE 1YN6A 2VITB 3TBTA 4AT6B 5DJAB 3WD5L 5C0IA 5EU6B 2HLAA 1T89C 2NY7H 4E0RB 5C07D 4UTBH 4LLQA 4X7EC 1F90H 1MJ8H 4KH2A 4Y2OA 5DEFB 1JPFB 2NY4D 4WNQB 4LPUA 3WKML 5DJYA 1ZHLA 3HE7C 5GS0L 5HYJE 1LO4H 3RIAK 2VDLL 1HILA 1T1YA 4PRIA 4MAYC 4UV4H 4C59B 2C1OB 2VH5L 3WDJA 3U46A 1CFVL 5IHZB 3FQXA 4B0MM 4ZS6C 3V4UL 5FYKE 3ILPB 1G9NC 1F4WL 2Q1EA 3ARFD 4GRLD 4DKEH 1M7DA 3MO1B 4UDUA 4Z7WB 4RWYL 4JFDA 1ZHBB 4EUPB 1UQSA 4YHYC 4HKJA 4P2YA 4UNUA 5I74B 5F9WB 1F58L 1WJ3A 5C0AE 4P2OA 4W4OA 5I8CB 2BY0A 4OGXH 5JORB 2ZUSA 1U36A 1TCRB 1RJYA 5E8OA 4XPFL 2VR9A 1I7ZB 1FHGA 3MRIB 1K2DA 4PBXA 1S9KC 2NY4B 4QWWD 1UH2A 4IOFC 1FN4A 1U3ZA 1J1OH 3HG1D 4JDZB 4KWUA 4LPTA 1L4IA 4LLAA 1A6PA 1RHHB 4JFED 2PYFB 4WDIB 1G9MC 3IXTA 1J8HB 2EIDA 4L29A 5E00A 3ARFB 1KENH 4G9FE 3CAFA 2YUWA 5DQ9B 4YX2H 3TA3A 2ESVD 1JPSH 4LCWA 1IBGL 1EJOL 4PJBA 2NY2C 3STZB 4HAFA 3STLB 4PJCF 4BQ8A 5DMIH 3NPZB 1MNUL 1DLFH 4NNYA 5DJCA 4NZRL 1A2YA 1SQ2N 2NYYD 2X4UA 2WINA 1RSFA 2R1WB 4QRQB 4UAOC 2BSTB 1BJ1H 3TPKA 5AG8A 1MHHB 5IKCB 3MRLB 3MJ7B 3GSWB 1OP3H 2X4OA 3SGKA 1R5WB 5H94B 3DXAD 3VRJB 4ONHA 4JFEB 4C58B 1DBAL 4EKXA 5FCUL 1F4XH 4K7PX 2CLZB 4R4ND 3W9EA 2NCMA 3MMEA 2Y06L 3MRCB 4OCSH 1KXVC 2PXYC 2VRAA 4MAUH 5FO7B 1HKLL 3VRIB 4A2MA 1QYGL 2ESVB 5EO0B 5KS9E 4M7LL 3OF6A 1IEAA 1I1CA 4U1HB 1EO5A 3KPLA 2D7TL 5L6YH 3WLWD 4NUJA 4RA0C 1TETH 3WE6B 4Y4FD 4QHUB 3KYOA 4UTAL 4NJ9H 1FFQA 2D0FA 1FYTA 1LHZA 3UZQA 4RGNE 4ZUWB 1FV1A 3QRFM 4TULL 1UACH 5DI8A 4P5KB 5D1QC 4JRYD 5IHUL 1MFBL 2P5EA 4I2XE 1JZ3A 4RAUA 5CJOL 2IJ0C 3GNMH 4OQTL 2Y9RT 3V8CA 5ADOH 3TM6A 3QCVL 4GT7A 5L9DH 5MP6L 2C3VA 3MLXH 5J12B 2CJUH 1MSPA 5CD3A 4KK8C 5E8NA 4YEFA 1VFMA 3TEUA 3C8KB 1YYML 4JRXA 4OI9A 3LZFL 5T5NF 3ZYJA 5LG1A 4PRAB 3KLAA 1XIWD 3PIQA 3Q1SL 4HW6A 5J1AA 4MZ3A 3QQNA 3VI3F 1EGJA 4D0BB 5F7NC 1EMTH 4S2SA 1NQBA 2V9TA 3N0PB 5DC9B 5LGHH 5L2KD 1KGCE 1OTUC 5DGQA 2XI9A 3DO3A 1D3CA 4PB0H 3LH2L 3BMWA 5EN2B 4OAWA 3GBMH 5GJTL 5I1KL 1J87A 3K2MC 3I75B 3JWDH 3QSKB 4XNZB 1E27A 4XBEH 1K5NB 2YS4A 1C16B 3DUHA 1FVEB 4WHCA 4PJ5E 1HI6A 2P8MB 2WIMA 3MODL 4POZD 5JXEA 2ITDA 4K07A 3LKNB 3OKEA 1CFBA 4JPKH 4PP1D 3QQ4B 1MPAH 2HVJB 4NKIL 5ICXB 3DUUB 2FD6L 3ARZA 4TOYL 5FB8B 1BEYL 2FCBA 4AJ0A 3QIWA 5DJZA 5GGTA 4XPHH 4MNQD 4J6RH 1XIWB 1RMFH 2QTEA 4MVBD 4K3DH 1FNEB 5F3HB 5EZJA 5J11B 1Q9LA 5BXFA 1A4JA 1T21B 3I9GL 4LLUB 5L2KB 5CSZA 1TPXB 3GIVA 4PFEA 1QRKA 1GGIL 3EYUH 4GG6A 4J23A 5F7WC 1ZSDA 1XGPA 1BVKB 5MERA 1QSEA 4FFYH 4HK0B 2XFXB 5E2WL 4O5LH 3LRHA 1N6QL 4D9QD 2YUVA 3CFKA 1WEJH 4ZFFB 3LQAL 5D93C 1N0XL 2X1OA 4X5WB 5TQ0L 2HFTA 1IM9A 3SGJA 4LSTL 3NZ8B 1N64L 3SBWC 4LU5H 3WL9A 3ZTNH 4GKOA 3SCMC 5DYOA 1MRFH 5C08D 5I75B 5GRVL 4MS8D 3WEXA 5C0EB 1J5OH 4QTHA 4WI6A 4M7LT 1KXQE 1AQDA 3MV7A 5IMMB 4W4NA 3KWWB 2CRIA 3BD4A 3FQNB 3MOAH 4NKDB 2A6IA 4ORZC 5IF0A 1KCUH 1EAPB 3D69B 4ZPTA 4MQ7B 1S7XB 5GGSY 4APQB 1B6DA 2XQYK 3D3VD 1OPGL 4OGZA 1I7RB 2AK4D 4PLNC 1TZHA 2ADIB 3T3PE 3HZVB 3LKSA 3TCLA 5IFJA 3V5HA 5J8OA 2IAMA 1INDH 2FDBP 1H3XA 4NQED 5BS0E 3OKMB 3M17B 4N5EC 4C83B 4PREB 3V5KA 1XF4B 4NRZB 5HYSB 1MY7A 1IKNC 3U4BH 3NCCB 2ZOKB 4NC1E 4DZBB 5C08B 4QRRD 2EXWC 2GYSA 5IGXH 4XCFL 2LTQB 5GIRB 2X5PA 1JWSB 2H1PL 2R69H 1KNOA 4PJAE 4YR6A 1JNJA 1RZFH 1CK0H 3EO9H 4L9LA 3BKJH 1RZJC 2NNAA 4XNMB 1HZHH 1FORL 3VXQB 5ID0B 3QI9A 1KB5A 1DN0B 5E8EA 1IAKB 3VXMA 3OX8B 3D39A 1RK1B 1BD2E 3GSUA 2AK4B 1JK8A 3OAYK 5H37H 5ILTL 3LMJL 3MLVL 3TN0D 4WY7H 1HXMA 5MEPB 1G6RA 1NGYB 4J3WA 1QBAA 5IVZB 4B41A 4I4WB 3U82B 4KUZH 4K9EH 5TE7L 4KRPC 4MA1B 1WAAA 4E41E 1U93B 2AV1A 4GMSL 1T89A 2C9AA 3PF2A 2IADB 4M6ML 4B7LA 4LHUD 5IMOB 2AKRB 4K94C 1ZA6B 4FQ1L 4I18C 4FZ8L 4MAYA 5DDHA 5FECB 2J88H 4KHXH 4P49A 1QR4A 3CCHA 3WHE1 4N0RA 4YC2C 1P5VA 4ETQB 5D7LA 1S9WA 2DDQH 1QBML 2W0LA 4JHBA 3BEVB 1PJ9A 4IIQB 4CJ0A 2SEBA 5DQJA 2A6DB 4LF3A 2Q8AL 5A2KH 2B2XL 3MROB 5JOPE 4RQQA 2I60L 2JCCA 3DRTA 3RTQC 3T2NL 1MCNA 2AJZB 1H3TA 5SWZE 5E9DE 2AJ3A 2CKBH 4HT1L 5EBMA 4U2YA 3HRZA 1EERB 4HV8A 4GRWE 3RIFF 5GZND 4BZ2H 4UMGA 4DK6A 1SY6H 2KL6A 3IAPA 3PWUB 1LDSA 4J1UA 2AXGA 4NOFA 2GJ6A 3UJTH 4PV8A 3L3IB 2X4RB 1OGAD 4LHUB 4JREB 5CILH 3P9MB 4YXLH 43CAA 3PGCA 4PLJD 3T0EA 3OKNA 43C9B 2VZ3A 1LO3L 4WTZG 5T1DH 2Q86B 3C5SA 5D70H 3QNXB 2VN4A 4PJAF 3N1PC 4X9GA 1CT8B 4ODXB 1O7VA 2P45B 3HKFA 4U1GC 1F4YL 4JZOA 5D1XC 3T0VA 3IAGC 1SYVA 3OKDB 4H26A 5CP7A 1VHPA 1JZ6A 2GTZB 2HJKA 4BM7A 1VPOH 4OKVB 4QOKA 4NHUA 1J0ZA 1WBXB 3K81A 1SEQH 3R4DA 5HYQB 1OF2B 1MCKA 4X6FB 1XF3B 3MNWB 1OGAB 4W81A 1NCNA 1JNLH 3KXFD 1NFKA 1R0AL 4EDWH 2RJMA 2PF6A 3I02B 4KKLD 1YDPA 2BSED 2YZ1A 4LEXL 3WBDA 1AGDB 4X7DC 2YOCA 4M5YH 4CN4A 4NGHH 3MA7B 4HHAA 5BRZD 2G75A 1UT9A 2PXYA 5JDSB 5KSUA 1JNHA 1DBJH 3S98A 3PWLB 5E2UH 1T6VN 1R3HA 5EBLA 1OTTD 5F3BB 2DLHA 2EIEA 3BH8A 3HAEA 3HUJE 4O2FA 4ZFOB 3WKNA 1LO0L 3SDCC 2V7HB 5T1MA 2FYYA 3GK8H 4NCC1 4QRUB 2XXMB 3QCUH 1DQQA 4IJ3C 4XMLL 3SQOL 1L6ZA 3SE3C 2E9IA 5EBGA 1OGTB 2EO9A 4L1HA 4GRWF 4GBXD 2RHEA 4NQSA 3FQUB 5D1QA 5FGRA 3TBWA 4P5MA 4NZJA 2YD9A 3MQIA 2KH2B 3EYFB 4YDKH 3V52L 3KPMB 1D5IH 3BKML 1ZHNA 1IGTB 3L7FB 2NY0D 1KBGH 1G0XA 5DA0B 2HJFB 5F9OH 4NKMA 1FCGA 4LSSH 3H2WA 3K8KA 5K9KB 2HRPH 4JVWA 4YQXH 3T8XB 3WFZA 3TT3L 1NCDL 1RZJH 1OVZA 4IRJD 4C57C 3FO2B 4ZFOL 1EX0A 4JN2A 4PS4L 3WFHA 5E56A 4N0FA 3TIDB 4GBXB 3QB7C 2D7MA 1IAIH 2NTFA 5BQ7B 3VJ6A 1O5DT 2Z31C 1F6AA 3KS0H 5CGYD 5JXAL 5KSBE 4YAQA 2R0ZL 3NFSH 3H9HB 4NO3B 4R8WL 5HHOD 1NPUA 1GYAA 1KJ2A 2NY0B 2KUTA 3ETBF 1NC4A 5EUOA 5D7IA 5AZ2H 2ZUTA 4LPVA 2ICWI 4N8VG 4H8WH 5MHSD 1D5XB 3EJYC 4P23C 2K1MA 4YFEA 3HZKB 3QXDA 1A6ZA 2YWYA 1AGCB 4G7YL 1CR9H 4KVCH 3LD8B 3C8DA 4L8CB 4Z5RA 1IC5L 2Y7QA 3BD3A 4HBCH 5E1HB 3V0VA 2HYMA 4IRJB 4HUVB 2FR4B 4XAWH 1U8OA 4ODVH 3O2VL 3W2DH 1DQLL 4XCEB 2FATL 4ONFL 4QHKI 4CVZA 1K8IB 3HLAA 4XWOC 2ARJQ 3OJ2C 1QRNA 3U36B 2YPVH 4NO5B 4HFUL 4NNXA 4PJ9D 4XNXH 5DRWA 3FRUB 1ORSA 5KVFH 1JF6A 1IZJA 3O8XA 3QEGL 1GGYA 1OP9A 2VL5B 2WP3T 2HKFH 4Z77A 3HNTH 1MCLA 4JANB 1FZJB 3QG7H 5B4MC 5CP3A 1FLRL 3ULSA 4UQ3B 3U1SL 4XVUD 2IMMA 4WFHD 4XBGA 3WNLA 2NY6D 1XR8A 3SCMA 3WIHH 5B38G 4HFWB 3QWOA 1S5HA 3V6OC 1D5ZA 3WIIH 2DQIH 2NXYD 2R0LL 3QUZC 4FNLH 1E4WH 2LABA 3MRPA 4YXHL 1KIPA 4YE4H 4PJHE 5EO1A 5TE6H 1IT9H 3MRBB 1IM3B 1FZKA 1VGKB 4ELMA 5JOFB 2P49B 4U6XA 3GMNA 2VERN 1KCRL 1IARB 4YXKH 1HEZB 3TH2T 1PKOA 4PJ9B 5E24E 5GGQL 3KR3H 4GLRI 4YDVB 2IPKA 2DM7A 2ZCKH 2ZJSL 4KKAD 4ZODA 1F02I 1XCQB 1YECH 5LCVH 4X9HA 5E6IC 5DD6B 2B5IB 5SWSD 2NY6B 3LN9A 4RISH 4Q0XL 5IB1B 4DN4L 1G7IB 2FRGP 5ICZA 2X9WA 2E6JA 4S1RL 4H88L 1IKNA 3VA2C 1UH4A 1X44A 5CJ8A 1VADB 4GRMB 4IMLA 3IFPB 1J10A 1JRHH 4TPRL 5HD8C 4GW1B 2Z93B 3PL6C 1Z0MA 3ZE0E 2ENSA 2LAAA 2YA0A 3VXPA 4G6AC 5EU7E 3RBSA 2Y72A 1AIFB 2Q3AA 4KROC 5AD0B 1S9VA 3R0NA 3HS0A 1GZPA 4F7TA 3UBXB 5EOQH 1MHEB 5BZWA 4TNVF 1A6WH 3DMMD 2P5WE 1J7VR 2AJSH 4GKSB 3SKJH 4Q6YA 5IB2B 4ZXBD 5ITBH 5C07E 3CFDB 3QQ9C 1YJDL 1QFOA 3WUWA 5LXGL 3LKQB 1R3JA 3EBAA 4RAVB 5SWSB 2UZIH 1G1CA 3DNKA 2L7JA 5FEBA 2JB6A 3MRNB 2LV4A 1ITBB 4KQ3H 1BJ1J 3BWUC 4ISVB 5EOTB 1FAIH 2JJVA 1EBAA 5INCB 2C7UB 1CD8A 3CXDH 3RQ3A 1DLHA 3OB0K 4Y2DC 2VUOA 2OR8A 1J18A 1RD6A 4I18A 5KN5A 4MDIA 4PJFE 1MEXH 3GZKA 3KPPB 3EFDL 5I1EL 4JQXC 4PY7B 1HIMH 1EPFA 4PJHF 2DYPA 3RUGB 5HY9B 1HNGA 4N0YL 4Y5YC 3IDXH 5D7JD 1BFVH 1SEBB 4Y16B 4BZYA 3IGAB 2BSRA 4ZXBB 1UZ8B 4C4KT 5LJYH 3MRFA 5FHAL 1O7SA 2APWA 3RTQA 3ES6B 3U0WL 4DGIL 2BSSB 3HG1E 1FZOA 1PY9A 4C54A 3K4ZA 4HZAA 3A6BL 3S88H 1BZ9A 1I7UA 1YY8B 3N1GC 5CEXB 3H7BA 4KMTH 3S37X 2H32A 5ENWA 3QT2A 4P46D 3E8UL 2MTPA 1QSZA 1S7SB 3VFUB 1FZMB 4LPYA 1WWWX 2FWOA 2DQJL 4UBDC 5KJRL 1IE5A 5BV7H 3MLTB 2BJML 4ZUTB 3MC0A 3C6SA 3FZUC 1MELA 4YHPB 1JTPA 1X6LA 5IT2H 3B9EA 2DLTA 2GSIB 3BOVA 3V95A 3OG4B 5IVXF 1EA9C 2YD5A 3O3AA 3G5VA 4JO1H 3SGDH 1BVLB 5J56B 3ZT5A 1EV2E 3UJIL 3IFLL 1VFAB 3EYOB 3NGBB 5GRVK 1JMZA 5IR1B 5D7JB 3M07A 1IZKA 5JMOC 1NGZA 3CDYA 3D2UA 1W8OA 3ARGD 2BNQD 1F11A 1HDMB 5FYKH 5MEOA 4UV7L 4ZAKD 1Z9SA 3W81A 2IQAA 1RJLB 1RJZB 4R7NA 4UZGA 5D5MA 1ADQA 5D1XA 2OK0H 4U1JA 3K1KC 3MFGB 3QEQA 3L3JA 1DN2A 1FFPA 3DX8B 5EULV 3IXAB 3QG6A 3DXAE 3DV4A 1F3DH 3T3ME 3PV7A 3ZKND 3H9SA 4P46B 4F7EB 4FABL 2WLZA 1PG7L 2VB5A 4HWUA 5D96B 5DLMH 3TBSB 1GIGH 4NN5C 3RPIA 4BZ1L 4P9MH 4M7KL 1Q0XL 2DB8A 4WTXA 3SDAA 1MWAA 5TJWK 2FGWL 2YK1H 2BRRH 3MCLH 4KTDL 1VSCA 4FFWD 3BYTA 3HI1B 2VAAB 5T1KB 3RX5A 4TUJA 3ARGB 2BNQB 4XVSL 4NDMB 2BNUB 1T2XA 4HUUB 5C0GB 4QHMB 4PJEF 2G60H 2X44D 3C5JA 5CIPB 5FA4B 3W11D 3E2HC 2VLRB 3KPRB 5ISZA 3QUXC 2D9QB 1FRGL 4NNPL 3RP1A 4LVHC 4CBPA 1HHHB 3EDDA 1MRDL 1NL0L 2FX8H 2ORBH 4JRYE 4V2BA 1T04A 2BNRB 3WNNA 1SJHB 5JW4M 5CD5C 1JGVL 3SE3A 3MRHB 3BDXA 1JFQH 5IW1B 2CLVA 3Q6GH 2B4CC 2R15A 5D71L 3G6JB 3V8OA 3B9VA 4OKDA 4LVNC 2YWZA 3H3PL 2VZTA 5A2JH 5EH1A 4FMKA 1UA6L 4M61B 1AY1L 4HWBH 4CVUA 4B7IA 2IFFL 1OT1A 3L3KB 4YBQC 4HLJA 2Y1VA 1NMCB 3OKLB 1ZK9A 4DKFH 1RZKH 3S36H 3G5XA 4EN3D 2X6MA 5AYQA 1MJUL 1NLBL 3TJEL 4JM4L 3SKOB 4G8GE 2VAJA 4ESKA 2HTKC 1IGYA 2OJZH 3VFTA 4EVNA 2VQTA 4HWZA 3IDNB 4ERSH 4U1LB 1RUQL 1JVKA 3EO1A 3DO7B 3P73B 2G2RA 4XMKH 1TCMA 2M2DA 2XZAL 5DWUL 3VFSA 3MLUL 3RJQB 2Y6SC 2COQA 4M93C 4ONGL 4X8JB 2KZWA 3PNWA 4MD0A 3T3MF 5B3JE 2EYRA 4QT5B 4OF0A 4A2LA 1CXKA 3FQTB 1CDUA 4JFQB 3WSQL 2Z31A 3R06B 4PRPD 5E8PB 5FM8A 3PGDA 3P4OA 3KPSD 1UWGL 2UYLB 1HOCA 4Y5VB 3MREA 5BO1H 2DJ4A 2YRPA 4LSRH 4M1CD 3VD7A 3S9DB 4MNQE 1TJGH 4FQXA 4NBYB 4AH2B 3F5WB 2PR4H 1RIHL 2P4AB 3AS3A 4NWUH 4P23A 3ULVD 4OV5A 3CVHA 4JR9H 4WTWA 4Y1AD 3MBED 5C0CD 2OL3H 1MHCA 5DMGD 4I8DA 4DVRL 4UNVA 3TYFB 1T03L 3HPJB 4K3HA 2E7LC 3I6GA 1BFOA 4NZTL 4X4MA 4D9QE 5AAWA 2ZSVA 4R90H 2N56A 2OCFD 2IGFH 3GB7B 5CHNA 2MMXA 5F88B 4LQ1A 5DD5L 1WVZA 2GITB 3IDGB 3ARWA 3CUPB 1I1AA 1FQ9C 4ZO9A 3S34H 5B8CC 4O02L 1NLDH 1PX3A 1A6AA 1I1YA 1ZEAH 1I3UA 2MSPA 4XP5L 1EBPA 4PGCA 5C08E 1W0VA 1HHIB 3QZWA 4X7TB 2WUBL 2YD3A 4JHWH 4QXTB 5J9PA 3S4SG 1Q94B 4Y1AB 3F7QA 3MBEB 1CLCA 3RDTC 2HTLC 3L3HB 2V2XA 4X0KA 1U8PB 2CLRA 4D9RD 3V6OA 1EHXA 1RZIB 2R2BA 4P57B 5ID1A 2FECI 4NWTL 3QUZA 3DRQA 1K4DB 3VXOA 3RWFA 2NXZD 1RK0A 3D3VE 3WJJC 4TUOA 5DRXA 1W8NA 2E9WA 3LEYL 5MENA 1OSZA 3VG0H 2O61A 3NIDF 5CCKL 4NQEE 2VZOA 3QAZB 3BKYH 5B3JF 4DEPB 2H41A 2AJVL 3MNVB 4I1NB 1DSFH 3B2UC 1HHJA 2EC9T 4L3CB 2Z91A 1KJMA 3MACH 4QRRE 4AM0A 4ZOEA 3RAJL 3UCRA 5I1DA 4P2QB 1AO7D 5E6IA 2R8SH 3LRGA 5CBEB 1SJVA 4P5TA 3P4MB 3LS5H 4K55A 1BOGA 1VKXA 3HNVH 4OCRH 2AI0L 4XHQA 4M6AA 3NABH 5F1NB 3ULVL 2NXZB 1CICD 1K4CA 1BQHG 3GMLB 5D2NB 1IJ9A 3CZFA 1BP3B 1NCCL 2ITCB 2P8PA 1AHWB 4JFFE 5K9OB 3F65A 5DTFB 5HGAA 4BSVA 5HSFA 4RBPH 5HGGS 4Z7VA 2FEEI 5HGBA 5I2IB 2FBOJ 2VOTA 1X5JA 3U4EA 1QLRA 2YPLE 2OJEB 3CDFA 5I1CH 3K4DA 1FNLA 4C56A 1FNSL 5IB5A 1ZWIB 2WZPD 4LCCC 1BM3L 3S8WA 2OTWA 2ADJB 3DVNB 1GAFH 4QTIL 4WW2F 4LVOC 3MV8D 3MYZA 3VI4E 3SGEI 1AO7B 2XZCH 2A6JB 3IAQA 2R56L 1KLGA 1S5IH 5E4IA 4Q7DA 5C2UB 1GHFL 2VLMD 5GRUL 1KCVH 2MPAH 1X4ZA 2P8LB 1JHLH 3QUMA 4Y2DA 3M1BB 2D9CA 1CICB 4HG4K 1TJHH 1GGUA 4L3EA 3FFDB 4AEEA 5F72S 2EDOA 1JTTA 3W0WA 4U0RB 2PW1B 4YPJA 1MFEH 5J3HD 4JQXA 4N68A 1TZIB 2AEPL 3RHWF 3LKRA 3OZ9L 1R3IH 1T6WA 3VFVA 4Y5YA 5IQ7H 4OLUL 1I4FB 5C0ND 5DFVD 4JDTH 2DQUL 3GMOA 2OTUB 3VRLE 1IMHC 4KPHL 3MV8B 4PJGF 4LSDA 4LCUA 3REWB 3QO0A 1NGPL 2GY5A 4PRID 3CX2A 3MGTA 1XH3A 3ISWA 2X4PB 3IJHB 5GQBA 1UXSB 1MQKL 2V2WB 4MA7L 1I8IB 3C2AH 4H1LH 1J0JA 1FVCA 2ICEA 1I85C 2EDWA 5SWQA 2YPKA 4JFDD 2IBZX 3VXRE 4MX7A 1D9KC 4F9LC 1FFOB 1MOEA 1K6QH 1ND0A 4MCZB 3MRMB 4P2OD 5FUZH 3MOBL 4CAGA 1RHFA 1GC1L 1L9NA 1YMHA 5I1IL 3H3BC 4XZUA 2GK2A 5CZVL 1ZLSL 1NCTA 4WEBH 3K46A 4ENEC 3AAZA 4LLQB 5L7XH 4F15C 2X1XR 1UYWL 4O2EA 4X7SL 3MV9E 1BQLH 1LO5B 4YIQA 4PJEB 5DJYB 4XNYH 3KXFE 4JKWA 1T1YB 4PRIB 3CMGA 4UILL 2A83A 4OCLC 3U46B 4Q6IC 3PWJA 2QADD 4G80A 4IHOA 15C8H 2KKQA 3RVUD 3AS0A 3IF1A 3HB3C 4W6XB 5BRZE 1M7DB 1TTUA 2EYSA 4IDJL 3TA3D 4G3YH 1UQSB 4LCWD 4HKJB 1C5BL 2I9TA 4OLYH 2VDPH 1ZT7A 5AUMA 4EI6B 4GOSA 3KVQA 3VWJA 3U79A 4G8FA 4FZEH 1WAAF 2DL2A 3RPKA 2XWTA 3X13B 3FB5A 4G9DA 4L5FL 3O4LA 4ZTOH 5AAMA 5TE4H 3VD3A 1JHKL 3OAYH 3IDIA 1FN4B 4WHTB 4J4PC 4NN6C 2BVQB 4KKNA 4YHKL 5HVGB 1BOYA 2APVA 3BH9A 4J7RA 2Q76A 3NA4A 1NMBL 7FABH 3AY4C 3JWOH 5F89A 2EDYA 4OGAD 1HYSD 5E00B 1SMOA 3EOYG 4NT6B 5TPWH 3ULUD 3T08A 3VH8A 4NJAH 4FMFA 4JE4B 4CADA 4Z9KB 4GW4A 2VLKE 2R0WH 1E4JA 4XH2A 3QPXL 1OCWH 5FXCH 4NNYB 1QLEL 4GMTL 5JW4Q 5DJCB 2IFGA 1PKQE 4JHZA 1NAMA 2X4UB 2CO6B 4ELKB 1AXSB 2WINB 1G6VK 1WZ1H 1ERNA 1WITA 1FYTD 4JPVL 3ARDC 3BIBX 4DGYH 3KJ4B 2DIJA 2F58H 2EXYC 3SN6N 1T66D 4GQ9L 2X4OB 1WBZA 1B6UA 4MXQC 5I74C 3I6KA 1GL4B 1IFHL 4MLSA 5F9WC 2P5ED 3EYQC 2F54A 1MF2H 1DE4A 1S3KL 3NFPA 3W9EB 1YYLH 1HQ4A 3MMEB 5IQ9A 4NKQB 5HHOE 2W60A 2YXFA 3JV6B 2NY4C 1SYSA 4JM2F 1UCBH 3SKMA 3SEPA 4NUGL 1BIHA 2VXUL 3UO1H 4JRXD 1IEAB 3KPLB 3QXVA 2XZQH 5JW5A 5DMKA 1J0YA 1DFBH 4NUJB 4XMPL 3AU1A 2OZ4H 4WEMB 3ABZA 3RIFK 4KV5E 1IKFH 1KPRA 3ARFC 3KYOB 4HEPG 4HUWA 4JY6B 4TVPH 2CR3A 3UYRL 1FV1B 3JTTA 3REVA 5GGSA 4HIHA 3CVIH 1AJ7L 2A77L 4PP2A 5C3LD 1MAKA 4RAUB 1CI5A 3HMXA 1ZMYA 2GIYA 2VDRH 4MNGA 3BKCH 3KDMB 2E7LA 2GK0A 5AWNL 5JXED 2C3VB 1MFCH 2DQHL 2VDKH 3LSOA 5CD3B 5GXBB 2VDOL 1R3LA 5E8NB 3ARBA 1DBKL 1FPTH 4YGVA 2X4SA 1S7TA 4X6CE 3QIWD 2P48B 5ANMA 1VA9A 5GS1A 4O58L 5B8CA 4R9HA 3TFKC 2CIIA 3RWGB 1BX2B 3PIQB 3CFJA 5IFAL 1U2CA 5D7KD 3U7YH 2QEJA 4LLMA 2J2ZA 2KZ1B 1RUPL 4NYLB 3RDTA 1QSED 4NRXA 3X3GH 1AD0A 2CMRL 1UB6A 2EKSA 2DOCA 1AGEB 1HI6B 1V7NL 3WJJA 3FOLA 5FYJD 4LLVA 2NYYC 4NN7B 5FKAB 3UTTA 4NKOA 5DHXB 1Y0LA 3RZCC 2QHRL 1U8KA 2P1YA 1IM9D 3PHOB 4R26L 2UWEE 3TH3T 3QIWB 4YHIB 3WD5H 4I3SL 5DJZB 2VZUA 3FO0L 4U6HA 2WSKA 5L88L 1QG3A 3QH3A 5EZJB 5IEKA 5CLWA 4E5XA 5GRYA 5BXFB 5IW6B 4R4NC 1LP9A 5GS0H 1T5XA 4YLQT 5CSZB 2VDLH 5J12C 5IJVA 3MV7D 3RRQA 3G5YB 1EHLL 2VH5H 5TH2B 4JPIB 1EGJL 4CU7A 5HDBE 4I0CC 3V7MA 4MJIE 5MERB 1QSEB 4P3CL 3V4UH 3NCEB 5BW7C 2VDML 5I8OL 1F4WH 2VIRA 4N0CC 3MJ9L 5HYEA 2ZG3A 4YNYA 3MXWL 5KBNC 2UVEA 3CFKB 4GKZA 4R97B 3EDJA 5I17A 2PCPA 4J8RA 4LVEA 2IAMD 1G84A 1IM9B 1F58H 1H3PL 4XNZC 4H20L 5EOCL 3WHXA 1EEQA 1N59A 2M26A 2H45A 4Z7QE 4XP4L 4XPFH 1WLHA 3L6FA 5DYOB 1MI5E