1XF4B

Structure of ligand-free fab dna-1 in space group p321 solved from crystals with perfect hemihedral twinning
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
213
Chain Sequence
QVKLLESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCVRGGYRPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fab light chain
total genus 37
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4B02
1JL8A 5HYJD 1O7SA 3TT1L 5I1GL 4OD2B 4Q58C 4J1UA 3JTSB 5C0FA 4PJEA 5BVJA 5C0IA 1S7XA 1MJJA 3TVMC 2CDEB 4P46A 4LNVA 4Y4FA 4Z7OF 4ZD3L 2KH2B 3WO3B 2F5AH 2L4OA 4FQPA 2R0KL 1OQOA 1ZHBB 4P57B 2VQ1B 4ODSH 4UDTB 1AFVH 1AGCA 3IFOB 1C5BH 4MNQE 2CKBB 4DGYH 5E2JA 4G42B 5D8JH 5C0AA 4DGYL 3CJJA 5AZ2L 3SDYH 3ZKND 3DPBA 2X4QB 4P23B 3I6KB 1HNGA 4PRIE 3L9RB 1MFDH 4WFFD 3RWDA 3X3GL 5DRZB 3WDHA 4HK3N 4FNLL 5GGSY 3CX5K 2XFXB 1MFEH 5IOPB 2R1YB 2ZZUT 4XCNB 1CL7H 1EIBA 1RJLB 4XBEL 1VADA 4OZFH 4N0RA 3FRPG 3MREA 4TVPH 2DN7A 1T1YB 4GRWE 2NXZD 4Q0XL 4LARH 5IP4A 2MJWA 4MX7A 3FT2B 2A73A 4TNWF 3N06B 3QUXA 5ALCH 1P4IH 3VD9A 3GIZH 3PWUA 3QRGH 4JQXA 1CS6A 1NLDL 4MDIB 3ULSB 3ZHKA 2CMRL 1E4XL 4QT5A 1JRHI 3D2UD 4JDZA 4PP1C 4FA8A 4OF5A 1V3JA 1A7NL 4WU7A 2OZ4H 1Q9KA 4BUGA 4ZUWB 1IAIM 4NO5B 2IH1A 4PJXB 4D9RE 3VRIB 1IAIL 2EXWC 2O5XL 1DLFH 3BPCA 5FFLA 5I8EB 4ETYA 4G8IA 1H8NA 1WWBX 2OMBA 3HMXA 2LE9A 3KPPA 4JPVH 5E9DB 5DSCB 1J8HA 3IJSB 4LCIH 3FMGH 1BFOA 2X4RA 4N0CC 3OX8A 4S11A 2J6EH 5E2TH 3V4PL 1UEMA 1KENH 4ZOCA 5TH2B 2A73B 4Y19A 2WBJD 3HG1A 3EKCA 1YEJL 4Z7UA 4XI5C 4ZDHA 1GHFH 3TH3T 1KLUA 1G7LB 2IJ0C 4C56A 3Q5OA 3H42H 1J18A 4BM7A 3IDNB 1YEDB 1GSMA 3MNZB 4JO3H 5D7KE 2QQKL 2EDWA 2PW2B 4P2RD 3UTOA 2YMXH 1UWGH 1FV1A 3MXWH 4RSVA 1HINH 2MPAL 2BP3A 4Y4KC 4X9GA 1MFAH 1QFHA 4PRHB 1U8HB 4RWHA 3VGBA 2WLYA 2XPGA 5IV2A 1U91B 4PR5A 4WFGE 3SDDC 1VFAB 3P4OB 4PP1D 3L3IA 4RGMB 4AYFA 3OKLB 4YHIB 3GSWB 1TDQA 1T2QL 4JDTL 1HYSD 1K6QL 3CLFH 2CMRH 3BIKB 5IVOA 3MRCA 3MA7B 4IDJH 4WDIB 4A6YB 1P4IL 3RVXD 2CDEA 1VGEH 2W9DL 4N8PA 2PTUA 1BLNA 4DGIH 3VFUB 3BPNC 4HLZG 4OD2A 4G6JL 1VB9A 4EVNA 4JAMB 4S10A 2HWZL 3SDCB 4XHQA 5FGCE 4LPVA 1F11B 3D18B 3HRZB 3MNVA 4H26B 5GRUL 4L4TE 3AMKA 3AREB 3GRWH 2BC4B 4NQVA 4RMTA 4YHYB 1YQVL 4DN3H 3GSNH 3SQOL 3U9PL 3AROA 2XACC 5DSCA 4X9HA 3D9AL 5DRWA 3HPJB 1QRND 1BECA 3OGOE 5IB2A 5D70L 3MGOA 1C08B 5J4MA 1G1YA 5F3BB 5DJDA 3H9SE 43CAB 5CKGA 3OTTA 3UEZA 2J2ZA 3NAAL 2NY4B 1NCBH 2DD8L 1ZA3A 2VLMD 4X9IA 3W9DB 3ZTNL 5DHYA 1I9RL 3K4ZA 4XC1H 1LO5A 4QHLB 3OJDA 1HHGA 2QR0B 4LP4A 4YQXH 3TO4D 1BFSA 5EB9A 4DOHE 1VADB 3BO8A 4JFXA 5GS1C 4UTBL 4G8EB 5EUOE 3OR6A 1F4WH 1A6ZA 2DQEH 1ZHNB 4BH8A 3X3FL 2F58L 1WAAE 3MRMA 4JANB 3RA7H 4Q2ZB 4WO4B 3IS0X 4FTVB 5I8EA 1UA6H 3ZKSD 1DVFC 3V7AE 4FZEL 5DMGD 3T0EA 4XP9L 1G7MA 1MY7A 1LO2L 5LQBL 1LEGB 3QUMH 2XV6B 1T22B 1BJ8A 3UZEA 3D3VA 4P2OC 4AEHH 5HDBF 2IFFL 1N0LA 1B90A 4K9EC 2VZ1A 1OHQA 2AK4E 5B3JE 5KVDL 1NC4B 4TPRL 4RA3A 4KUZL 4P59H 3BKJH 1Q72L 2NXZB 3QNXA 4ZFOB 3LQZA 1DBAL 4ZS6D 1BBDL 4LLVA 5I1LA 3QFJA 5MHSD 2CR6A 3T0VA 5FV1L 1OTTC 2YPLA 3KPMA 4OLYH 3BX7C 1OW0A 3HC3L 4M02A 4M6AA 2AVGA 1Z3GH 5DEZA 3O3UN 4P23D 2OI9B 3FFCA 5FYKE 1ZLUH 1U3HD 1HH6A 4LF3A 5D1ZB 4PV8B 5I8CB 2WSKA 3WIFB 1QLRA 4JN1L 4POUB 1T7VA 4KZDL 4MXQC 4KTEH 1WISA 3WNPA 5B21A 4NRZA 3JVGC 4U6VL 4P9ML 4ZFOL 1ITCA 1AXIB 1P4LA 3ALXA 4P2YA 3RDTA 3W11C 4XGZB 1C16B 4XX1E 1OAZH 3E8UH 4MMZC 2YD5A 4LVOB 1EV2E 1W72A 1I7RA 1NGWB 5F7KC 4X8JB 2R56L 4E42B 1BWMA 4JHBA 5DS8A 2HT2C 1U92A 3VG0H 3QEUB 4YHLH 4OUUB 5GQBA 4DW2L 4QRUA 2Y23A 1HN1A 3BAEL 2XZQH 4R2GC 3RWGA 4GSDH 32C2B 1ZT7B 1EFXA 5J3HC 2HN7A 3ABZA 4PREA 3GBNH 1OOAA 4X6EA 3V0VB 3ARSA 2DYPA 4JRWA 2QQNH 3C60B 5AUMB 4NM8H 1AQDA 2GK0A 3ZZ1A 2X7LB 4NRYA 1KPVB 1LP9E 3QAZC 5DO2C 4XPAL 2FHFA 3P4MB 4MJ6A 4JKLA 4WI8A 5EC1A 3C6SA 2D4FA 4Y1AB 1HZHH 1SYVA 5TE6H 1I8LC 2VO5A 2JKXA 3DRQA 5DMKA 5SWZB 3VXSE 1NCCL 4M48L 1D5ZB 4LLAA 4X6DE 5DK0B 1D7FA 3C5ZC 5ICYB 1ITBB 1GGYA 4H1LG 4ZPTB 4YE4L 4WI6A 1Y6MR 5T5NF 3HI1A 1CFQB 4ELKB 1G6RB 1KGCD 3SDYL 2ED8A 3RWGB 2VDPL 2J6EA 4TULL 1WFTA 5EU6E 1D5XA 3TV3L 1CFVL 2NXYC 1KELL 1XGQB 5IWLA 2NX5B 3S3SA 2C7UB 2BNQA 5F89B 5T3XL 2HFGH 4KVNH 4NQUA 3FFDA 4IDLA 3RA7L 3WKNA 1KJ2H 1CDYA 3RGVD 2YN5A 3VD3A 4HC1A 3V6OE 4CL7A 4GUPB 3LZFH 1UWXK 4GMTH 5F9JA 2D0GA 1YEFL 2A6IA 1MI5A 1CD1A 3EO1B 1NAMB 3K46A 3O6LL 1DJSA 3B2UC 5D9SA 4APQC 4HPOH 4TUJA 3MUHL 4TSAH 4X5LA 4XWGH 4P2QE 5EOQH 2EE6A 1FVCA 1TQBC 1LEIB 5GPRA 2YR3A 1F6LL 3L3HA 2VDLH 1J88A 2Z0BA 2Z31D 3WXWH 5I8OH 1V05A 2ZUWA 3D0VB 5IT2H 4H25B 1KEMH 3QXAB 2FO4A 2HP4A 3GFUA 4M6ML 4PJGA 4ZPVA 3OKDB 4JLRB 4PJIB 5CCKH 2FIRT 1DUYB 2BC4A 5CHNB 1JGEB 1IC4H 4LRNH 3DVFA 3U0TB 2NW2A 3LN5A 4HWZB 2CO6B 4XB7A 1UGNA 3ELAT 1JPFB 4ZODA 1NFDF 4YK4C 4M5ZH 2F74A 3RKDC 1YJDL 1AR1D 4DCQA 3Q6FA 4NQEE 4NQDD 2GKIA 1RZ7L 1XGRA 3JV0A 5JW5A 4FXKA 4M8VA 4HKZA 4KI1A 4PTTA 3SO5A 2AJVH 4N8VB 4WV1B 4NZUL 1Q0XL 3EFFB 4LGRB 1PFCA 2Y4SA 4AZ8A 3QO0A 4YR6A 1WIPA 3CH1B 1X5XA 3RL1A 3IDYC 1T6VN 3PHSA 4APQD 2ZSWB 4LOUD 3RTQC 1GVIA 4P99A 3TIEB 4Y89A 2XQBH 3HZYB 1T83A 5HHQB 3IDXH 1U8IA 3BE1H 2DQIL 4EIGB 1VGKB 1WJ3A 1A6TA 5GRYA 1I1FA 3S96A 5KSBB 3VXRE 3DURA 4XPTH 1FC2D 4I18C 5I1IL 3VFPB 5T5FH 2P8LB 3QUYB 1S78D 1N7MH 1FORH 2VTFA 1ZLVK 1FO0A 3T4AB 3W9DA 4D9QD 1K4CB 4NJ9H 3WS6C 3DETD 1KEGH 1FNFA 4G8IB 2XI9A 3N85H 2AGJH 2B2XL 4L1HA 3PWPE 1MLBB 2DLTA 4O4YL 5ILTL 2ESVA 3C6LB 4LLYB 4AY0A 4GAJH 5IB4A 4I18A 4XMLL 1AQKH 1YNLH 2W0KA 4UT7L 4GW5A 4KROB 4WO4A 4G9FE 3IDYB 3MV9B 3VRLE 5T1DL 3CDGB 4L1DA 3B3IA 4F33B 6FABH 4OZHA 5IW6B 2NY0C 1FL6B 3DROA 1IGJB 3ES6A 1XF2A 4DK6A 4OCLC 4MX7B 5I1JH 3SKNB 1GXEA 5IHLB 4K94C 4Q74A 2AV7B 5C6TH 2B8OT 1D5MB 3X12A 4JZJC 1G6VK 4GXUN 4LLDB 3X11B 4W68A 3ARDC 3SJVA 2NTFB 4PJ5A 4ORZC 1MHCB 5AZ2H 4HAFA 4KK8D 3GKZA 3UBXA 3R4DA 1M7XA 3LD8C 1EK3A 5I0ZA 3LIZH 5TQ2H 1S7RB 4XNUH 5MI0B 4BSWB 2I9LB 1F3JA 5FO9A 1V8HA 4PRPE 5SWSD 4M7JL 5D7JD 3VU2A 5JIHA 2PYEE 4UNVA 3U2SA 4BA8A 1FG2B 1WVZA 5HGAA 4JFFD 5DUMH 2IG2H 2DBJA 2R2EA 5C09B 1BFTA 2X4NA 5TDOA 1MFEL 5E94B 4P2OA 4R4FL 2ICEA 1RJYA 4PJIA 1B2WH 3G6JF 4O2CB 4I2XE 4F7CB 5HHOE 3B9KA 3QI9B 3TZVC 4JJHA 5TF1L 1AR2A 2W9EH 1RUQL 4MJIB 5JNYA 1VDGA 4G8FB 4BKLB 1DQTA 1MCBA 4TNWK 3L3GA 4CVXA 3C2AL 1CGSL 5CEXB 5FHAL 4L8DA 2BNRE 2Q8BH 3OXRA 4H0HB 1OAUL 5L8JB 4JFPA 1QKZL 1FLRL 1NJ9B 5HPMB 1RU9H 4PLKC 4PJ7B 3U0PB 2YK1H 3VGFA 1EAPB 4GUPA 2VN7A 5E8OB 1RIVH 3BEWA 4NKDA 5GRVK 1MVUA 4FFVD 4QHKI 1E27A 3K0WA 3QUYA 1IAOB 3QSKB 2NY1D 4XP5L 1A6ZB 1KN4L 2M2DA 3DMMD 3DURB 4ZO6A 3W9EA 2X70A 5GZNC 3WIIL 3VJ6B 2QSTA 4JRXE 5T1KA 1WBYB 3MYJA 3QFDA 2XY1A 3O2WH 3LOWA 3WNOA 1XGTA 5C9JB 1KXTB 2FLRT 4N5UA 4E5XA 3CUPB 3ZE0E 2VZVA 4UILL 1TQBB 1FFOB 4ZPTA 1RK0A 4ONGH 3QPQC 2FCBA 4PJ7A 1GRWA 3OB0H 2IGFL 5ENWB 4WUUB 4P9HL 5SWZD 3TN0D 4DUWA 2Q6WB 4EXPX 2VDKL 3KLHC 4AIXA 3D9AH 3TIDB 4YBLC 4RGNC 5CJXA 1T89C 2CLVB 2W65B 4CVUA 5ANME 4O9HH 3T3MF 4PJAF 3L3JA 3Q3GB 4HUMB 5CINL 2BRQA 3C8HA 1YQVH 5GS0D 2YOCA 5DVKA 4Z18A 5IQ9B 3WN5C 5L2KA 2FR4A 1CLZL 3PV6B 4JFYB 2YHGA 5HYEA 2VLJD 4RQQB 2DRUA 3F58L 4IM8A 3TM6A 1SY6L 1K8DA 3GSUA 5E1AB 2FRGP 3BEVA 4P3DA 2WNGA 1JPST 1MAML 3HNSH 3MO1A 1A8JH 2P7TB 2OP4L 1NFKA 2XKUA 3JWDC 5BV7H 4NBXB 2EYRB 4PY7A 5C0AD 4AEEA 5I73C 3GUTA 4OCYH 3QAZB 3VXSA 3BHBA 5A16B 3QPQD 2MPAH 1IEAA 2BJML 2OR7A 4OKDA 1IGIL 4PRBA 1BGXH 1KF9B 1RULL 4C83A 1CDHA 5IFHH 2EDFA 2QBWA 4WTXA 1G9EA 4HIHB 2HKHL 2EIZB 1D5MA 4YPGA 4BSVA 1KLUB 5F96L 1ES0A 4HIJB 1G7JB 2DBLH 1F42A 4ELKA 4OUOA 2F53E 2OTWA 2PR4L 5FKAB 1XF3A 3X14B 2R0ZL 3MV7E 2HLAB 4Y1AE 5HHNA 2DQFA 4TRPL 2R56H 3RWJA 4JVUA 5FCUL 1VKXA 2XXMB 2QQLL 4RMVA 5DR5L 5B8CA 1NBQA 2IF7A 4MA3A 2MKLC 1WQVT 1ORSA 1BVZA 4EN3D 3G08B 2OQJA 1Q72H 2W9LA 3SDAA 5AWNL 4YNYB 3QCVH 5F3HB 2HH0H 2GJ6B 3HNTH 2ADIA 3TO2B 4AEHL 1G0XA 2MOVA 1LEKB 3VFGL 4LIQH 4GKSA 2D7PA 3FFCE 4WCYL 4EOWH 1ZLWH 1N6QL 4C56D 3V79C 1GL4B 3I02A 2NXZC 3MRRB 3QIBA 4K94L 4IMLA 4FFWC 1NC4D 2C4FT 1LNUA 1AGBB 2QJDA 3MODH 4I4WA 3V7AG 3OKOB 4OGYH 3PP3K 4U0QB 4YAQA 1AIFA 1FNGA 4PB9L 1HE7A 1X4YA 4P9HH 4JB9H 2NZ9D 2OX5A 2ARJA 4HCRA 2QADD 1ZTXH 5C2BH 5KZCB 3FOMA 4PTUA 3KPOB 4LCWE 5IF0B 1A3LL 1VCAA 4HKZB 3RZWA 4W4OC 3L3GB 4YHLL 1F4XH 4K3EL 1N5YL 1KEML 1JFQL 1N5YH 4EQ2A 5EO1A 4C58B 3MV7B 1MRDH 3IXTA 1CWVA 4C55A 2JLLA 1AD0B 4Z95L 4ORGB 2IFFH 3S4SG 4OZGE 4U1IB 1AHWB 4P5TC 2P48B 1TCRA 5HHVH 1CBVL 1S7WA 3ZYOA 4JRXA 2FR4B 5EZJB 4HX1B 2VZOA 1NCTA 1MFBH 4FQLL 5C0RL 1QFUH 2LTQB 3AS0A 4NFCA 3FT4B 1N6QH 4JRYB 4LRIC 5HHXL 3KJ4C 3RDTB 2V9QA 4OFKA 5ADPH 2BVOB 1MCSA 2FJGB 1S7RA 4KKBC 1CXEA 3OKMB 4FTVE 3OGCB 4PRHA 2J1KA 4Z7VE 3FCTA 1QBLH 3ZKNC 3O11B 3H7LA 1KB5B 4D8PA 1RUKH 4WW2F 3B6SA 2QADC 4LGSB 2YRPA 3RY6A 3C5JB 3OJ2C 3S35H 2VDMH 4PFEA 5FKPB 1K8DB 4IMLB 4X4XB 2HFTA 5F9AC 2AXGA 1FVEA 3OB8A 5F7NC 2OSLA 3CC5B 4U1NA 1MCKA 4KK9C 3DROB 4PV9B 4XPFH 3OX8B 4XP9H 4HUWA 4NM8L 1XCQA 2DL9A 3UX9B 5TDNA 2X4TB 1I1AA 4YC2C 3VMPA 2D3VA 3V2AR 4LQFH 2ENSA 1EJ6A 1JV5B 1FZMA 2AAVA 1ZGLA 4G43A 1QNZL 4AL8H 5TQ0L 3WS3B 2KUTA 3MYZA 5H35B 1A4JA 2X7LA 5GJTH 4P4KD 4IIQB 1ZHKB 3MGTA 3QBTB 4GH7B 4MJIA 4WCYH 4M1CC 2W60A 3V6ZB 1T03H 1I1CA 3M1BB 1FORL 4XCFH 4XPGH 3RKPA 5IG7B 2GJJA 4WWKC 5A1AA 1JYWA 4HGWA 3AS1A 2ZCKH 1INQB 3KPQB 5FGCB 3IT8D 4LVHB 4O51B 4X6CB 5J1AA 1R5IA 4QHLA 1SY6A 2B20A 1XR8A 3D69B 1RFDH 2R2EB 3TA3B 1DE4A 2XTLA 1ZK9A 2XQBL 4POZD 3MRNA 4H88L 2ZOLB 5E2WH 5JXAL 3MJ6A 4D9LH 3CVHH 3L9RA 1ED3B 3P4NA 1HSBB 1GAFL 2N56A 4AQOA 4M7LH 2ID5A 1VFAA 3P4OA 4NJAL 4G5ZL 1UJ3B 3LH2H 2WAHA 4LBEA 1P4BH 3ILQD 3LMJH 4LKCA 5D2NB 4LNRA 4GRWB 3LKSA 4FQQA 1ZA6B 5J12C 1PZ5A 1M6OA 4WV1C 5C08A 5HI3D 4M5YH 3ROLB 1S3KH 1RUPH 4XP6L 2EKJA 2Y5EA 3HE7A 5LGHH 1KPUA 5LXGL 4QOKD 2AQ2A 4X7DC 4NQVB 4PG9A 1OAKL 1B4RA 2JB6B 4LSUH 3PF2A 3RVWD 3OXSA 3CFKA 3UJIH 3QRFM 1XF4A 3PV6A 2Y7QB 3BESR 3IVKA 4ZFOA 2ZUSA 4YHMH 1N5AA 4JFHD 1DN2A 3RPKA 3WFZA 5I74B 1WF5A 2E7LC 1FP5A 2FX8H 3QNZB 4DGVL 5B38G 2DQJH 4NZJA 2JCCF 2Z93A 2OTUB 1R3HB 3E1F1 1A02N 3NACL 3I84A 5E8EA 3VH8A 1KV3A 1W0VB 1GC1C 2F19L 3HAEG 4K7PH 1OGAA 3MBXH 1RIVL 3F12A 4QHNB 4YEFA 1CL7I 4PGCB 1NBZB 5JO5B 4LCIL 4NHCH 5C8JB 2E27H 1UQSB 1FQ9C 1RZKL 1UADC 2VWEE 3FKUS 2Z91B 3TVMB 4PJCB 3SY0B 2C9AA 3SGKA 1C5BL 3LY6A 1QSEA 3OSKA 1BQHB 1QHPA 4NWUH 4E5XB 4G8EA 2BOBB 4ZO7A 3MBED 3RX7A 1XGUB 2MHAA 2XZZA 5BQ7A 1MFAL 4X6CA 4RX4A 4Z7UB 2WMPA 5C0JA 5FKPA 4OKVB 4PJHA 2P24A 2WV3A 3NFPB 1UWGL 5DFVC 2R1YA 1KJVA 4PJ5E 2YBRB 3ARGC 2XYCA 1CGWA 3S36H 1D3CA 5LXGH 3TO2A 4M4PA 5DJCA 4AK1A 5T5NG 4JRYE 2MTPA 3QG6B 1JTTA 4MA8L 5T1KD 5FGSA 3OKMA 3F7PC 4KRPC 1QO3A 3ARGB 4MNQB 2HFFA 3QDHA 2MCG1 5B8CB 4G6FB 5EORL 3QIWC 4M43L 4DGVH 4XPAH 3WJJC 1KTRL 1YC7A 1IC7L 4G6JH 3MJ8B 3QI9C 4K71B 3TZVB 1MFCH 3HZMA 5EOTA 4GG6A 4N9GB 3X14A 4R0LB 3WFBL 2LV4A 2BFVH 5DQDH 1PEZA 3FQXA 3F65A 4PV9A 3MPCA 3PDOA 2H32A 5AWNH 2J6EL 3V4PH 5F1NA 3PQYD 1IM9A 3FQWB 1A7NH 4G6KL 4QHMA 3PJSB 4HKJB 3RGVB 1T7XA 5I1CL 3KAAA 4GBXD 4NQSB 4Y8AA 2WK2A 1NCNA 5L88L 1O5DT 1JGLH 3VXRA 5SV4A 1D6VL 4R4BA 1UC6A 2ED7A 3CXDH 4G5ZH 4YFDB 4LVOC 1NPUA 2H8PA 1OAYH 2A1WH 5C0ND 3I3DA 4RCAA 5DVNA 4AIZA 1KB5L 5HYQA 3B9VA 3MRLA 4NUGH 4U7SA 5D96B 4UV4L 1ACZA 4NUGL 3SDXA 2XT1B 3HPLA 2FYYB 3T65B 3FFCB 5IFAL 3OAUH 2BSRB 5JHDD 4JO2H 5CMAA 2ORBH 4OI8A 3X12B 2J4WH 4P2RA 1PJ9A 3GSUB 3Q5TA 1CICA 4TVPD 5E99H 5J6HA 3T0DA 1Q0YH 3FFCD 2X89D 2A0LC 4OZHB 1CVRA 3KYKL 1WAAF 3PWJA 4RZCA 4YX2H 5CIPH 5DHXB 3U48A 2XNAB 4JZNA 2Y1VA 3IKCA 1FVCB 5M94B 5DK0A 3KJ6H 1H0DB 3FQTB 1CG9A 1SYVB 3Q5YA 3KYOB 4NPYB 4AMKL 5FYLE 3T0EB 1MEXH 1B3JA 3LCYA 4QYOA 5DEGA 3ILPB 2CDFB 1QFOA 3BQUA 3QHFH 1OP5K 4PJDF 1A6VH 5E5MB 1PX4A 2CQVA 3V0VA 3MMEA 1UG9A 1S5IL 4XB8A 2D9CA 4NQDB 4BUHA 2YBRA 3K8KA 5A2LH 3P9WB 5E6ID 4U6XB 3OJVC 4KMTL 1NEUA 5CFHA 4OLUL 1UZ8A 5BO1L 1QHOA 2Z4QA 2J8UB 2R1XA 1PZUB 4UBDD 4ZG1A 5C0CE 3O4OC 3RTQB 5F6IB 4GMSH 1PAMA 3LEYL 4OFYD 1AGEB 3JTTB 4Z0BL 2XWTA 1LEKA 4C4KO 1AKJA 4AEFA 1AC0A 5CIPA 4UILH 4CU7A 1NL0H 4P23A 2IQAB 3VRLF 3U0PA 5KANI 2DJUA 5TE7H 3KPTA 4CN6A 1LO2H 1H3GA 3K2UL 2PXYD 4PGCA 4XWOC 3SCMB 2NY3C 2YMXL 4AIZB 5A43C 2XN9A 4OCXH 3VXSB 5F93C 5DUML 5FUZH 1E28B 3BKCL 3F7YA 5BMFL 5DD3L 4JR9H 4FQXC 2FL5B 4MSWA 4CW1A 5E8EB 4N1HB 4X7EC 4K23H 3QZWB 2DKSA 3VXTA 2M1KA 4YZFE 5HHVL 4GQ9L 4HK0B 4FQHB 5I19L 3TJEH 4Z7NF 4P2OB 3T0AA 2AQ1A 3RNQA 4LDOB 2HFEB 3HG1D 2WUCL 3HC3H 1R3KB 3O8XB 3T0ED 5FB8B 3GI8H 3BP5B 3KDMA 4XCFL 3WLBB 1KPUB 2J8HA 4QEGA 2C5DC 2J3SA 1DSFL 1F6AA 4JY5L 5C86A 1DL7L 5EBGA 3I50H 4GG8A 1G6RH 4I5BA 2VDQL 1L6ZA 1J87A 2EH8H 3P30L 1U3JA 1A1OB 5CEYB 3V0WL 3FRPA 2X4OA 4ETQA 4KZDH 2HT4D 1QPPA 3EFDH 2HYMA 1AE6H 1SBSH 4X80H 1EXUB 5DJXB 1KNOB 1JF6A 4DKFH 5KSAB 3QXDB 4U6HA 4L8CA 3GHBL 3QULA 1UXWA 4CVWA 5GGQH 3PIQB 4R26L 2ZG1A 2CH8A 1FHGA 5C0JB 1SJXA 4KJPD 4L4VA 1WZKA 4Y2OA 1IGFL 4U05A 2G60L 3ARDA 1LO5B 3OAYH 1NCWL 2OJEB 1FL6A 3BGAA 3EO0B 3TBTB 4UNTA 2Q7YA 4P49A 3VG0L 5E5MA 5I18L 4CAGA 3PWNA 3T0EC 1CK0L 3ZL4L 2R9HC 3BXNA 4PRDB 3SBWA 1L7IL 4R7DA 3VRIA 4I2XB 2EDDA 3U46B 1TZGL 1G7MB 4P0DA 2NY4D 4JG0H 5GSRB 2GCYA 3K8MA 3VWJC 3RWJB 1HZHL 1U8MB 4Y2DB 4M93B 5E2UH 3GMRB 1NDGA 2FB4H 5DJCB 3V95A 1XF1A 2IPTH 3VFNB 3FN0H 2P8MB 3LKPB 3BGFC 3TN0B 3U4EA 2NY0D 1I85A 4L4VD 2DMCA 1L4IA 5ITFA 3FQUA 3MODL 2WWMD 2H3NB 3O9WC 2OSLB 4KTEL 3CMOH 1S8DB 1G7JA 5DHVA 4XNZC 1KCUL 5KN5B 1JPSL 4QRSB 4DKFL 4JFFE 3HR5A 4MQ7B 4CVZB 4IJ3C 2OZ4A 3PHQB 1AE6L 4X80L 5EUOA 3AU1B 5GGQL 4U6HB 1QVOB 4LMQI 2Z91A 3QDJD 4U1SA 1HOCA 4LMQE 2Q8AL 3O3EA 3O0RH 4H0GA 2ADGB 2F53D 3NA9H 3EYUH 2XZCH 4X0KA 1A1OA 3ULVF 2EIDA 4R97B 4X4YA 2H2SC 3B9KD 3IFOA 1U3HB 1U8JB 2HLFD 2VZUA 3W2DL 1JUFA 1HYRC 4FQCL 4IRJD 4CVXB 4RFNB 3N1PC 2NY4C 2VR5A 5IMLA 1DR9A 2NR6C 4TSAL 5K59E 1U8QB 1RJYB 1NAMH 1N2RB 4MXWL 1OB1B 5TE4L 4FQLH 4XBEH 3BZFB 2K7PA 5F1NB 1CGUA 4J4PC 3TH2T 2PXYA 2ZCLH 3QXAA 2Q7NA 3K4AA 1CBVH 1E6JL 1CT8B 1N8ZA 2C3VA 1TVBA 3N9GH 1YY8B 3ECBA 4GG6B 5SX5H 1G0DA 3TYFA 3ZMRA 3H2WA 3NIGF 4E41A 5KVGH 1IFHH 3ARXA 4LBEB 4GO6B 3SGEI 5BOZG 2EDNA 4Y88A 1GC1L 5GGRB 5DK3A 3JWDL 5J06A 1DBAH 4Q6IB 2O5XH 3VFWA 3IFNH 2UZYB 5DMGC 4WTZA 5GJTL 1QLFA 3IU3B 3AU1A 1GOGA 4KI5F 4L4JA 4P2OD 3MLVH 4P3CH 4QXUL 1QBBA 2HG5B 4JCMA 3AS3A 4Y4KB 1E4KC 3RVXC 4P23C 3KPQA 3FN3A 3TBVA 3DUSB 3JWOC 2Z92A 2E7BA 1RURH 2XTJD 1YEEL 1CLOL 3VFMA 2AEQH 4YDIL 1VEOA 1JGUH 4MAUL 4OCRL 4MXQD 4WFGD 3V6FB 1KB9J 1KLGA 4L9DA 5JXEA 2D7QA 2G5BB 4R96A 1DLFL 3MFFA 3WO4C 5JO5A 1S7VB 43CAA 4F2MA 2BHUA 3JSSA 4JO1H 1YEGL 3P73B 4CN4A 4R7DB 4RWYH 1T03L 2YRZA 4ZUVB 3RAJL 5MI0C 4CDGC 2EDHA 1NMCB 4PJIE 2EDRA 2DKUA 1QBML 3QNZA 4H5SB 1KPRA 1PSKL 2VKWA 4JFEA 4JM2D 1PY9A 3DHJA 2XA8H 3OZ9L 2YD1A 3BGMA 4BSJA 1T1YA 1H15B 3QDGD 3MLXL 1EGJL 1F11A 1QRNE 2DM2A 1PKOA 4ODTL 4MJ2A 2HJKB 3EDKA 1AGFA 4BQ9A 3T08A 3V6BR 5I15H 4Y19D 5F7WC 2NY0B 3L95B 1FRGH 2YXFA 3C5SB 4NCDA 5TQ2L 1ND0B 4U1GC 1I1RA 5D7IF 1JZ8A 4XP5H 3HE7C 4ETQB 1IAMA 3CFBB 3E6HA 4FQ2H 5IVZB 4P4RA 4PGZA 5ISZA 2ADGA 5F8RC 4JFZH 3U30B 3DYOA 4X4MA 1ZHBA 2NY5C 2ZG2A 5GHWL 4G9FB 4F3FA 2GT9B 1G1CA 3KPRA 3G5ZA 1P7QA 3R0MA 1KEGL 2C1OA 2H9GB 2NXYD 4MD0B 1RZGB 3MC0A 4A6YL 1KT2A 2R4SL 4HKJA 4Z7NE 4PJFA 5I1LB 5D5MB 3FQRB 4RGOH 4U1HA 2KZ1B 1MHHA 1K3ZA 1U8OB 2NW3A 4U33A 4PJGB 4ZPVB 3VXQB 5ESQA 1NC2A 3I3BA 4URTB 1XGPB 3ZE1E 3JUYA 3GIZL 1L9MA 1WT5C 3PL6B 3Q6GL 4J12A 4HS8H 1IKNC 5KS9F 2NY5L 2V5RA 2YZ8A 5JOFB 4MAYC 3P77A 4I3RH 3O2DL 5C0BA 1PKQE 3PXJA 2N7AA 2FECL 2HA1A 4L3AA 1BX2A 1CD8A 3WS3A 1HWHB 1FGVL 1X4ZA 3D39B 4HWUA 4Y5YC 5D5MF 4EUPA 4P4KA 2NLJA 1D6VH 1FZKA 2XQYK 3ZTNH 3MRDA 3KPLB 4PJGF 1OSZB 1QP1A 4YDVA 4MHHG 2Q76B 1SJHA 4CADB 5D8JL 4U0RB 1K3IA 3VFSB 2GFBA 3MACH 2FJHA 5GSVB 2R0KH 3ARBA 4IRZL 1B88A 3HUJF 1D9KD 3CDCA 2DMKA 3IDXL 5IUSA 4W4NA 1RD6A 2NX5A 5J6HB 2ITDB 1LNUB 3RWEB 2AJYH 3TNMA 1I1YB 5J6GA 1AFVL 4WWID 4MDJB 2HG5A 1JZ2A 1P6AB 4KK9D 2QQKH 4LSVH 5C0DB 5CAYB 5HYIA 2WINA 1UA6L 4LARL 4HWBH 1F4YH 1UM5L 3EOAA 5LGJB 2R2BA 4P2CG 5EG6C 1K85A 5ACZB 3GI9L 2FYYA 2EXYD 3MJGX 1VPOH 1C16A 1KFAL 5EBWB 4KAQL 3RKDD 1JHLH 1SM3L 4ZXBB 1J1OH 2E7LA 1OAYL 2A1WL 3O9WA 3N1MC 4YQXL 5D71L 1KXVC 1DCLA 1YJDH 5HDQH 3DV4B 1CGYA 3ARED 4L3ED 3PABA 3N1GC 3E6FA 4E41B 3AGVA 4JDTH 4Y16B 4PJBF 3PWJB 1BFVL 4ZFGH 4XPTL 5I1IH 1MVFA 5TGBA 5KVMC 2BVPA 1RVFH 1DLHA 1OT1A 3T77B 3BPOC 1ZWIB 4GKOA 5I2IA 3OXSB 3FQRA 4U1HB 5F9DC 4OJFH 4H8WH 1G7PA 4B41A 2ZUUA 3O4LA 3V4UH 3MROA 4MXVE 1P6FA 5DGQA 4WHYG 1G9NC 4HWEH 2F5AL 4NNPH 1WCBA 5SX4I 1MF2H 3JV4A 2PTTB 2DTSA 3F58H 3QQ4A 3N1FC 1TQCB 1A6WH 5ADOH 2HAZA 2VZTA 4XP4H 4KZEH 2A77H 2I26N 4N5EC 3P0GB 4TUJB 3CVHL 3DX6B 1SMAA 2PW1B 3QO1B 4KZEL 2CJUH 3VXPB 4NQXB 4DOHB 2FEDD 2KQNA 4IOSD 2FATL 1UM5H 4BK4A 2V5MA 4K7PY 3UTZB 1I3GL 1W0WA 5KG9A 3QDGA 4AENA 3QH3B 3BPLC 1CDGA 1X5HA 3MUZ1 2X1PA 3QUKA 2MFNA 2XWTB 3WFDH 3JV5A 1M4KA 5I1DB 1NKOA 3AREC 2IAMA 1YEDA 3MV9D 4N0FB 4NYLB 5DK2B 4M00A 1VFOA 1A22B 3T4YB 1B0WA 2X1QA 1BP3B 5MEPA 5E7FA 3S6CA 5ESAB 3CSGA 4UQ3B 5FOBB 5IW6A 1U6AL 1LO0H 2LVCA 4QRTA 1BFOB 3QQ3A 1A21A 35C8L 5K59F 1FAKT 5JIIA 3MOAH 4NKDB 3BYTA 4JM4H 5CZXC 1ERNA 4PGEA 2GSGB 5FA3B 4OLVH 3ARDD 1YYLL 1JYXA 2EYSA 2FDBP 1A6VL 5IBLC 4XH2B 5HVWA 5KS9E 5HHNB 2ZG3A 1MWAL 1MF2L 3L6FA 1IGYA 3VH8G 2VN4A 4KV5F 1A1NB 2VDRL 4YPJA 1Y18A 4LLQA 5EZOL 1OPGL 4P46C 5BW7C 4HS6B 2IWGA 1U95B 3QUMA 1FCCA 5GRWA 4HWNA 2AXGB 1SYSB 2APTA 3HA0A 1ES0B 1HSAA 2EC9T 5EIVA 2Y9RT 2PO6A 3BWAB 3PP4H 3MUY1 5MEQB 5IMMA 3VGEA 1W72L 1G7QB 3ARGD 4MNQD 1LQSR 4PJAE 1QBLL 1WGOA 1J1PH 1RZIB 4AEIL 2ZNWA 2AI0L 1QOKA 5ADPL 1JUFB 1YPZE 4FQQB 4OAWA 5EOQL 1V7NL 1OL0A 3DGGA 4ONHA 3OAUL 4MQSB 2QL1A 2QQQA 2O5YL 3DO7B 1PKQA 4UOW1 5KOVC 1KN4H 5IHUL 1CXKA 4F15B 3K1KC 3WHXA 4IOIA 1L0XA 1QLRB 2ZOKB 2CIKA 2WIIB 4KUCF 3QIBD 35C8H 3QFJE 4HF5L 3ALWA 3NCCB 4XBGA 3MSPA 5EWIH 3RVTC 2JJSA 5DUPL 5FYLD 3QHTC 1KIRA 2J88H 5T3XE 1IC5L 2BVYA 1S7SA 2GTWA 5CILL 2IQ9L 4JM2F 5GIRB 4LSSH 4YHZH 2AV7A 5EIIB 4Y19B 2B4CL 3QNXB 4LAQL 4ORGA 4XVUD 2Z31A 4PJ9D 1KYOK 1E4XI 4IRSD 5C0EA 1RIUH 3TJHC 5E56A 1BQLH 1BJ1J 2VIRA 4IIQA 1YN6A 3B9DA 3DV4A 3BPCB 4IOIB 4Z7WB 1DQLH 1QA9A 3TGXA 3H9ZA 2MCPH 4UAOB 3TBWA 4NCC1 4QOKE 1HDMB 3OAYK 4QRRD 5F88B 4CBPA 4F37F 1QR1B 5KSAD 1M7IA 2AABH 5HYSG 1T4KB 4YAQB 4ERSH 1Z3GL 5JHLH 2IAND 4UUJB 2YXMA 1RZ7H 2BSED 4BFGA 5C9JA 1RFDL 3CC5A 2X9XA 4PRIB 3HE6D 4G9DA 3QFDB 1BMGA 2G75B 1EHXA 3T04D 2EZ0D 1EERB 2BY0A 4ELMB 3S88L 1NL0L 2XTJC 2K7QA 4N0FA 4OI9A 5F7HA 1SBBA 2DQGL 1AKJD 3QWQB 4ZS7L 2WM0A 1ZANL 3QHZL 3QUZD 1DANU 3PGCA 4WW1B 1ACYL 2FJHB 5GSVA 1XH3A 3BRFA 4YXHH 3GBMH 5LWYH 1IGYB 1PW3A 5I17A 1MLCA 4Z77B 2EIBA 5IM7B 4GRLA 3ALPA 4RWYL 3QFJD 3QQ9D 3VXPA 3QUML 4J8RA 2B5IC 2BVOA 2QSCH 3H9YA 3OB0K 4NHUB 3EFFA 2P5EA 3RVVC 4JM2A 5DA4A 3QG7L 1CG9B 4KKAD 3U7WH 4I0PD 3U9UB 4QRPA 1AQDB 5BRZB 3BH8B 5F7DB 1OT2A 1SQ2N 4LQFL 5GS2D 2V17H 4JDZB 4F9LA 4M3JA 2ICCA 3FT4A 1MPAL 5E2VH 4KKLC 4YLQT 2ZUVA 1FCGA 2C3VB 3BZ4A 3QDMD 5C0GB 5ESQB 1YN7A 3FO2A 1OARL 5I1EH 1RZ8A 2BDNL 3IRPX 4JKKA 3U6RA 1WWCA 1DBBL 2AGJL 5CD5D 1AP2B 1NCAL 5CP7B 3WHE0 1FAIL 4O2EA 3SDCA 4GJTB 3TBSB 2BNRD 1DVFD 2DDQL 3ULUC 3NCYP 2OCFD 4U31A 5DLML 2DDQH 2NY2B 5J1TC 3VXTB 1JP5A 1YY9C 2VH5L 3ARVA 1LEIA 1F4AA 3ESUF 1CF8L 3MRPB 3H9HA 3R1GL 3OAZK 4OZGF 4TVSa 2NY3D 1C7TA 3VXUA 1NGXA 2LAGB 5BCAA 4ONHB 4D0BB 1N6UA 4ZAKB 1BEYL 1BWWA 4D9LL 1CGTA 1KC5L 2K3TA 4ZS6C 4NJAH 2GK2A 2YPLD 1T7ZA 2DQTL 3C5ZA 4OD1H 8CGTA 1W0YT 3UMTA 3WO4B 2JJUA 4UT6H 1YEFH 4PG2A 1DBKH 4PRPB 4GSDL 4YXLL 4GRWH 2IPKB 1SEBA 3O6FC 2DQJL 3KNBA 4FQIH 4NQDA 3WYRA 5H94A 5DA0B 5MEOB 2A0LD 3G6JA 2R2CA 3U7WL 3VFGH 5FYLL 2XY2A 2Q8BL 1ROWA 3BW9B 3GJEB 4Y16A 5GRJL 4Y5XC 4RMSA 4JKWA 5C08E 1HKLL 4CADA 4R0LC 1IMHC 5IVNA 2FL5A 5HDBE 3V52L 5DJ2A 3ULVC 3FOLA 3BN9D 5MENA 2IEPA 1FL3B 2BNQD 4F2MB 3S37H 3QJHA 2DM4A 2NY7L 5L0QB 1DBBH 4GRMA 3GSNB 5GJSL 3ZO0A 1ZEAH 4OLEA 4LAJH 2R23B 3ZYJA 3O2VL 2BXYA 4P5TD 3VXME 1XF3B 4KQ3H 2Y5TA 4RRPA 3PGCB 3QB7C 4UDUA 2HN7B 3CFDA 4ODTH 5EUKA 1OCWH 5C0DA 4KWUA 2IPKA 3NFPA 3QUZB 1ZLWK 1TZHB 5AG9A 1EO8L 2BERA 4HIJA 4KHTL 4N0YL 2X89A 4NYLA 1FYTB 4TSBL 4PRIA 2FJFB 1U92B 4JQXC 1QQDB 15C8H 3EYOB 5IBUB 3RJDA 2Z8VC 2YK1L 2J5LB 3KLDA 4L4TD 4DKEH 1EEUA 5KSAA 1IKFH 4FQCH 3QISA 1QR1A 1FZKB 3TBWB 2PYFA 3F12B 1CXHA 3HAEA 5IB3B 4PP2B 1L7IH 1U8LB 1X5ZA 1ORQA 4I5BB 1UVQA 4JFZL 3W0WD 4R7NA 2NNAA 1ZS8A 5FHAH 3U82B 3HC4L 4Y4FB 4QKXB 4NO2A 2HRLA 3JWOH 4G8GA 3BP7B 1S7XB 4EKXA 4EUPG 1J05B 4MJID 1X5YA 4U6YB 4BJLA 4PRID 2IG2L 1CZ8L 1MWAH 1B2WL 1IM3B 3MRJB 5D5MA 1AQKL 1Q1JH 1QSFA 4FG6D 1DQDH 5GRVL 5IROC 3U0WH 4GAJL 4HFUH 1A6UL 1PYWA 4QRQB 5A2FA 4HULB 3ARWA 4LDLB 5IESH 12E8H 2YZ1A 3WNNA 4ZFZB 3B2UD 5KOMC 1DBMH 3CXDL 5C09D 1MSPA 3JWDH 4AMKH 2D7OA 1QKZH 5CEZE 3G5YB 3UC0H 3QDAA 4ZUSA 4XBPB 4XP1H 4HJ0C 4PJBB 2H32H 3DMMB 3SKOB 4OI7A 4HIXL 1A14L 1II4E 1LILA 2ADFH 5D7LB 4DKEL 2J5LC 5E6YA 5T3ZH 4U1KA 3FAWA 4S1QH 4GKNA 5LGJA 3RWHA 4IS6B 1G7QA 1NDMB 4MQ7A 3HMWH 2C7UA 4KFZC 5IGXH 2SEBB 3HC0B 5E9DD 5INCA 3QEGL 1T7WA 1KIPB 1KXQE 5EIQA 4M43H 3STBA 4ZAKD 5CKAA 1CL7L 2NPLX 2VKXA 1CR9L 3QA3B 3IJSA 4JQIL 5BRZD 2A9MH 2AXFB 2OLDA 5AG8A 4O00A 5E8OA 1KTDB 1YDPB 2A6JB 1XEDA 4YDVB 5BMFH 5DEGB 4PLJD 1S9YB 3U36B 4MWFA 1CFBA 4Z7WE 3C6SB 3P73A 5C7XH 4XMLH 2HFFB 1RAMA 4NO5A 3AC0A 4HGKC 3CFJB 5B3NA 4CDHA 1ODAA 1S7UA 2CIIA 3VDCA 3WXVL 1OAKH 4LVEA 2GUOA 1QEWA 3PHOB 3R06B 3RIAF 1T0NB 4UU9A 3UTQA 3EYQC 3OR6B 1UACL 4BQCA 2F9BT 5K9OA 4KTYA 2R0ZH 5BV7B 4WW2B 1QPXA 5DRNB 3UP1A 4KQ4H 2ZJSH 1GH7A 5MEND 2BOCA 3BGFB 4GRWF 4UT9H 1PG7H 4S2SB 1G7IA 5HD8C 1GHFL 4I3SL 4YUEH 1C5DB 2EDXA 5K9JL 4ZAKC 5IQ7L 5DJXA 1M7IB 1MCPH 3EJYC 1JVKA 1KB5A 4LKCB 2CUHA 5D2NA 3MV8E 4KVNL 1MJ8L 3G6AB 4XCCH 4JREB 3ULUF 1R5WB 1KJMA 2UV3A 4PY7B 1JZ4A 1WBZA 4NN7C 1L6XA 4YDLC 2QEJA 4C4KT 1I9IL 1W8NA 2I24N 2X9WA 2NY1B 5KBNC 3W5NA 3BEVB 4P3DB 5HDOA 1I7ZB 2YPLB 3KPMB 2AK4A 4FZ8H 3O4LB 4K8RH 2LTQC 1R3KA 4TNVF 3SCMC 5GGSB 2AEIT 3VFOA 4M1CD 4OIBA 1DEEA 4FQJL 2E7CA 2J4WL 2BVPB 3PQYA 4FQHA 5HHXH 4PJCF 2FWOB 1MIMH 1DBML 3Q2CA 4WRLA 2AQ3A 4IRSC 5ETUB 3B43A 3ROLA 3G9AB 2FZ3B 3M07A 3O6ML 1JI2A 3QIWD 1JRHL 2G5RA 4NKMB 3V0WH 4UOW0 5IMKA 4H1LH 3QI9D 3KXFE 1KIUA 1DVFB 2MMXA 5D7KD 4BFBD 1PG7L 3D25B 1YYLH 1MI5B 3TYGH 1LP9A 3HE6A 3G6DH 5C07E 1Q9KB 1NMAH 1KCVL 3BUYB 2V2WB 4HJJH 4RMUA 1ZVYA 1P1ZA 2DWEA 5HGHB 1RJZA 3MRMB 3T8XB 1H5BC 1C5DA 2BJMH 4UB0L 3R0NA 5FDWA 3L1OH 1Z6JT 1JZ5A 1BVLA 2JELL 4F37K 1DE4B 5FHBL 2Q87A 1KCRL 4PBWD 5DFTA 3TCLA 1FVEB 2VNCA 4N8VG 2LABA 3TCXA 2D7TL 5T1KB 3CZFB 4HGWB 1EBAA 1CICD 3P0YH 2ERJB 2EE9A 3HI1B 5EUKB 3DX9B 3IU3A 3HAEH 1RPQA 4K8RD 4JFFB 1TETL 3IGAA 1P69B 4PUBL 1WLHA 4F7TB 4D3CL 5B39A 1EJOH 1FH5H 5DD1H 5IB4B 3QO1A 1YEIL 2GTZA 3QUXD 4HS8L 4DZ8B 5GS2H 3O4LE 3A6CH 3F7VA 3VCLA 1S9YA 3U36A 3OXRB 4Q97A 4I0PC 4CKVX 1BQLL 1A7OH 2DB8A 3QYCA 1P9MA 3SHSA 5IB1B 2A2QT 1N64H 3DVGB 5ELIA 1X6NA 2OS7A 2YKLL 3BAEH 3BW9A 5J57B 1XGPA 2B4CH 1CFTB 4LAQH 3GJFA 3CVIH 3PL6D 5JHDB 4F7CA 5DI8A 2VXSH 1P7KB 4OF6A 2NMSA 1W72H 5EOCJ 3Q1SL 4IRZH 3SO3B 5FECB 4WEMB 3RFZC 4F7PA 3OKKA 3U4BL 1YPZF 1RJLA 2CKBL 4JPKH 2OK0L 3RL2B 3E8UL 4Z6AT 5BVPH 4H25A 3ZSSA 2WLZA 1INDL 4WY7H 3IDGA 1ZVHA 3TH4T 1F3RB 1IFHL 4ZNCD 1I7RB 5C07B 3THML 2D03L 3MUGB 2ORBL 3TN0C 4RGMC 4EDXA 4BZ2H 5IHUH 1KCUH 2AKRA 2ZOKA 2QV2A 4B5EA 3MRQA 1PX3A 1NGQH 4IRSB 4LKXB 3VD4A 5FO9B 4ERSL 2AJXL 2X9YA 2I27N 3C60D 1XIWB 4FXKB 4BQBA 4EDXB 3ZKMD 1FV1B 43C9A 1PQZB 3LKOA 3LIZL 2P46B 1J9CT 1HXMA 3MLUL 3UTSA 3STLA 3O3AA 5IMMB 4I4WB 4H0IA 3CSBA 1XGQA 3W2DH 5ALBH 2HMID 4G6FD 4OZIE 1I8IB 3IXTB 4YE4H 3NFSL 1HHJA 4HEPG 1T7YA 5HGBA 4YHKL 4KDTC 3CZJA 4K7PL 1A2YA 2A9NH 3CCHA 3G04A 4HUXB 4KI5C 5DQ9A 4UBDC 4YBHA 1QNZH 4NIKB 2APXA 1TJIL 1V3KA 2CDFA 4PTUB 1DQQB 4NNYB 3WBDA 3REWB 1YEKL 5JW3L 1A5FL 1ORSB 1P53A 4XNYL 1JPSH 5FCSH 4KVCH 2BCKB 3FRUA 3QWRD 2LU4A 3SOBH 3LQAC 1EH9A 3ZHLA 3THMH 3CCHB 2HT3C 1P84K 5K9QG 1J0JA 2V17L 4ESKA 1CE1L 2F54E 5FKAA 1PY4A 3FFDB 4FABL 4P2QD 4RFOL 5SWSE 5D5ME 4NZRH 1GGCL 3DUHA 2GITA 5F1IB 4L5FH 3N0PB 1D9KB 5KVGL 4WI4A 1CCZA 3H7BB 1U8KA 3VXUE 5DS8B 1I1AD 3S37L 4B7IA 1HI6A 4XNMA 5DRZA 4U1KB 1PQZA 1T89A 3ZSTA 4EN3C 2D7NA 1EDQA 3IDIA 4G9FA 2EXYC 5B8CC 4X6FB 3SDXB 5JQ6H 5EORH 2KL6A 5F88A 3LS5H 3L5JA 5TE4H 2OXGA 4XVJL 4JHZA 4G7VL 4JFDB 1R3JA 1I7TB 1DQJA 3MGOB 3GKWL 2UUDK 4XAWH 4U4BA 3G5YA 2VIRB 2QSCL 1B0GA 4M6NL 5I1AB 2HT4C 2F74B 3DTXA 4HC1L 1NC2B 3E2HB 1LDPL 4X5WB 1MAKA 4WUUD 3MROB 1TMCB 2AEPH 5JDJA 5I16B 4LEXH 3CFCH 5GRXG 4NBYB 2FGWL 1TCRB 1SEQH 4EI6B 1JGEA 1JGLL 2XA8L 3K2MC 4PJFB 3W0WA 3QXTA 3MV7D 1GGTA 4KXZI 1KPRB 4HIEA 2R9HD 1WZ1L 3S36X 3VFUA 4WI2A 1FNEA 1A7PH 5TFSH 4E42A 3MLSL 1KULA 4XBGB 43C9B 3CLEH 3C8DA 3DXAB 5IJKC 1MCWW 1E6JH 1FVDA 3C09B 5FV2A 3RWIB 1QRKA 1BPVA 5DLMH 1FRGL 2NY6D 4CNIB 2OBGA 3GMNB 3F7VB 3VCLB 1A6PA 2P5EB 5JUEL 4L3EA 3BJ91 5GXBB 5D7JC 4WEBH 2FH6A 5IJVB 1S7TB 1OM3L 1WICA 5HXMA 4OCWL 2PW2A 1FFOA 1HI6B 2VQUA 1BEYH 2EXWD 4DK3A 5GRZA 4EI5A 5BS0E 3NTCL 1IQWH 1AXTH 3FT3A 3MCKA 3P40A 4PJ7F 1TZGH 5D7IA 1AJ7H 2DQCH 5AZEH 3L7EB 5DC9B 1Y6NR 1G7LA 5CP7A 2DTMH 4C56B 4YBQD 1D9KA 4EXKA 2DQTH 4PYGA 1RMFH 3EBAA 2AV1B 2XOTA 3SKJL 1G6RA 1A14H 1BVLB 4NT6B 1VHPA 3TN0A 1IGCL 4NNXB 3KPRE 2X4UB 3EDEA 3EYVB 3WEXB 2D31A 3ZKXB 2QKIA 5KSBE 4K55A 3BD4A 3TVMA 1Y0LA 5F70A 2ENYA 1XAUA 1YYML 3M8OH 5C6TL 4GFTB 3CD4A 4NBZB 1U2CA 5I1GH 2ESVB 3QDJB 5D96C 4K3JL 2YEZB 4PLKD 1OAQH 4UTAH 4PG2C 3VH8B 5IBTL 5E00B 1I9EA 3IKCB 4NFBA 4X9FA 2QKIB 4PS4L 4ISVA 4KMTH 5CZVH 4MNHB 3NZHH 1J0IA 4G7YL 1FAIH 2NZIA 2OTPA 2H2SD 5F97E 5SWSB 4OTXH 3NZHL 1FFRA 2FWOA 4JQIH 4QXUH 5FUCE 2VSCA 1YEJH 2V2TA 1R0AH 2HLFC 2ESVE 3GK8L 3J7HA 4Y5VA 3ZYIA 2R69L 4HJGB 3C09C 4NC0B 5HBBA 1FO0H 5JA8B 3ZLQC 1IEBB 2VXVH 3OV6A 2BOBA 5D1XA 2HTKC 2JELH 1X6LA 1E27B 1NCUA 2BSRA 3T8XA 1C8PA 4FTVD 5DWUL 1W0WB 2V2WA 2YD8A 1EXUA 2B1AH 2DQHH 5JQHC 3DWTA 2VDQH 2ZUXA 4IJ3B 5EFIB 4X4YB 5BXFB 3GGWA 2W0PA 3SBWC 4JPIB 1I9IH 5EO9B 5FUCC 1JMXA 5I76B 3LPWA 2NY2D 4KTDH 3WFDL 3BIBX 1Q9OB 1GGBL 1MCJA 5HI3C 1CFNB 4GG6F 3O2WL 4D3CH 1S9XB 1CXLA 4X98B 3UJJL 1T20A 4QRRE 1MCPL 4F58H 5CS7A 4QRRA 4G9FD 2ZP0T 1J11A 1BZ9A 1LO0L 2KKQA 4RAUA 1WC7A 2P4AB 5E94A 3O8XC 4HZAA 4LSRL 4ZYKA 3HRZA 3VWJB 4XAKE 2ATKB 5D6DA 5TGBB 4CMHC 4ODVH 3QT2A 5ILTH 4KU1A 3CU7A 4NSKA 4UV7L 5MERB 4ZNEE 3QIUD 5FM4A 1EO5A 4MNHA 5FF6A 4LSQL 1NFIA 2NX5E 4X4ZA 5BO1H 5F7DA 4LPUA 1I9JL 4H8WL 4ZUVA 4DN4L 5I76A 1W2KT 5EZIL 4MGXA 4F7EA 4NRXB 1A7RL 3BYYA 3NIDE 4XPBH 1NCBL 2LAAA 3UC0L 2H6PB 1CFSA 1UB6A 3L1OL 4X6FA 4WHCA 1K4CA 3GI8L 3AS2A 4IHOA 1AKJB 5E6IA 4HBQA 2B1HH 2CK0L 4YWGL 4O58H 4PRPD 3WFHB 4CVZA 1H5BA 2CRYA 5E1HB 4J3VA 3DUSA 3T09A 1ZGLP 4Z7QF 1HEZA 5L2KE 4TVPL 4KMLB 5DJ6A 2CDGB 2G9HA 2AI0H 1KB5H 4JFQA 5K93A 5LKNA 1MCLA 3PIQA 2I9TA 2F5BH 4TUOB 2PO6D 1LDSA 5JIKA 5ANMA 2P44B 4HIIA 1QLFB 4MA8H 3C08L 4ISVB 4J4PD 1C12A 3M17A 4O5LL 2W9DH 1BBJB 2Q20A 4WUKL 3G5VA 3P9MA 4UQ2A 5H35A 2ZKHH 3DX6A 4NWTL 3BKYH 4LVNB 1HHHA 1NFDA 5BOPA 2F54B 1QSVA 2XNAA 2QSQA 2DF3A 1O0VA 4IBLT 4FS0A 5HGBB 3KYNA 4N90D 3PWUB 4WI5A 2GHWB 5D1QC 4AG4H 5ALCL 3LDBB 1MH5A 4OLXH 3ZT7A 2DIBA 3P4LA 5DEFB 4MB5A 4QO1A 3W0WB 3BJLA 4LSPL 2DICA 1T66D 4OZFG 4RAUB 4ZTPL 3TA3C 1GPOL 1T21B 5GIRA 3T1FB 4LSPH 4LSVL 1H8OA 3TJEL 1WIUA 1VFMA 5B39G 3I75B 3MJ7B 2V5YA 2PNDA 4LIQL 5C09A 2VYRE 4TNVK 3D0VA 4X5WA 5DO2D 4YWGH 4FNLH 3QUKB 3OBAA 3BP4A 4WJ5A 2RCSL 4K3DL 5CJQH 5KTEL 5C2UB 2BK8A 3DLQR 3X13A 3WHXB 4RGOL 2FNBA 3P0VH 3SKOA 4BSWA 2KBGA 4W4OA 5IV2B 2MNUA 3HB3D 5TE7L 4OGXL 3TV3H 2RBLA 3CVHB 3SEPA 3EOYG 3FO9A 1XZ0A 3S3PA 1P2CA 4BELD 2APVA 4XNMB 1N26A 4ZFZA 4DKAA 2GSIB 4Y5VC 2IADA 4Z7VB 5KSUA 3WFEL 2J8OA 3RU8H 3FB7A 3I75A 2GJ6D 1AGBA 1BJMA 4LSRH 3GDBA 4XRCA 3S9DB 3BGMB 4PJ9B 1HSAB 1VPOL 4HZLB 3RGVC 1U41A 5TH2A 3CAFA 3N1QC 4Y2DC 3GSNL 3SQOH 3CSPA 3RWCA 3GEWB 5F3HA 5E2VL 4ZMAT 5LJYH 1ORQB 4XP4L 1U6AH 4KJQD 4NO3A 4OZFB 1Q38A 3H3PH 1LE5A 3H0TA 1T22A 5EUOF 3RVUD 1FGNH 1L7TL 2EDTA 1WK0A 1BVKA 3JXAA 4PRDA 4OFDA 3CSYB 3LEXA 5LAXA 1T5WA 3BRGC 1A2YB 3ARUA 3D3VE 4OJFL 2P5WA 4MAYA 4OT1H 4MCZB 3EYUL 3DNKA 2I07A 3WMSA 1EEZB 1K9TA 3S96B 5KSBA 3NCMA 1KOAA 3OL2A 1QTYT 1WBYA 3MRGB 1AI1H 3MYJB 4R3SB 4EBQH 2QR0A 3I02B 5E8PA 5SX5K 3NCEB 3SE9L 2XZAL 5IR1A 3QUYD 5GS0L 1TTFA 3FB8B 2A6KA 5F1KC 5F9WB 4YBLB 5GS0H 4K9EL 2GFBB 4WNQA 4ZTOL 1ONQB 1QFWM 4MD4B 1JPGA 5L2JA 1BVKB 3U4AA 3DRQB 1EHAA 2CUMA 3KYOA 1X44A 4NPYA 5I6XC 4LOUC 1A6AB 4WFHD 2VAAA 3FQTA 3D39E 3CPLA 3C87A 4DW2H 1VEPA 1FVDB 3RWIA 5AUMA 4B7LA 3MR9A 3RX8A 4AT6A 2XA3A 2ZCHH 1X9QA 4GQPH 4OZIA 5CJ5A 3DRTB 1UH3A 5FYLH 1FLTX 1PDKA 5MEOA 1PYWB 1NUFA 3IFLL 3WCYA 1DQMH 1AY1H 1A9EB 1UKSA 3IDJB 1IRAY 2JB5H 2VXUH 5CHNA 2V7HA 5DEFA 3TC9A 1CDCA 3FO2B 4B53A 5TQ0H 1QFPA 5HGAB 1WZMA 4XAWL 5FGBA 1NGWA 1J1XL 4UT9L 5BJTB 2KDGA 1NCDH 1T2JA 2AW2A 4MLSA 3MLYH 4HKBB 4V1DB 3VA6A 4YHIA 4ZAKA 3DX7B 2JJWA 2H2PD 1S78C 3O2VH 4OM0L 4Y4HB 5CJXC 4XPGL 4NZUH 1JWMA 5CZXD 2UYLB 5JXAH 2HVKB 3ULVL 1YMMD 4KMQA 1UM4L 1GC1H 3B5GA 4ODWB 5F9JB 4NQEA 1VEMA 5CSZA 1NUGA 3MO1B 4J3UA 5HYSB 3QXVA 3T2QA 3MLSH 3INUL 1ZHNA 3MACL 5HSFA 3MRBA 3RL2A 5JOEA 3MV8B 3UTTE 1EZVY 1RUAH 3IJYB 4GKZB 1VENA 1MNUH 4JDVA 4LVHC 2V2TB 1LDPH 1Y18B 3K81A 4P9MH 3U83A 2IH3A 3L3JB 1OM3H 4OFYA 5H2BB 4XNYH 4HDIA 2CIIB 3HFML 4YXLH 2P5EE 4Y5XA 4TN9A 4XNXH 2DYPD 4OZHE 1NFDB 1JZ3A 1OSPH 3RZCA 2YD7A 1J0HA 1KYOJ 1LK3H 4J8RB 2ZCLL 4NN6B 3P4MA 4XVJH 4F7EB 3R8BB 3KPSE 1H3VA 2NY7H 3MLZL 3NACH 4QF1B 1GOFA 5H2BA 4LP5A 25C8L 2VXTL 3TYFB 2X4UA 4GAYB 1FNAA 2AXFA 5ANMB 3DX9A 3QIWB 3DSFL 2Q7YB 3ISWA 4NSKB 5D1ZD 5E03A 3ULUL 1MIEH 3LPGA 1Q9WA 1MIEL 4YHNA 2Y06H 4HUVA 3TJHD 2FGWH 2JK5B 1A0QH 2Y6SC 1BZ7A 1RI8A 3RRQA 5ACLA 1I7ZA 5KSUB 1UJ3C 3H3KA 4JG1L 1JHTA 1YNTA 1X4XA 1RJZB 4OLUH 2XQYG 5C08B 3RUGF 2IQ9H 3B5HA 1WBZB 4XVUC 3GKWH 4BYHA 1VA9A 1NBZA 3RJQB 4P3CL 4RGNB 4Y4HA 3RY4A 3H8NA 2OR9H 1OCWL 4PJBA 2O61B 2FX8L 3HCVB 1JGUL 1FH5L 4KDTA 3MLRH 3ARQA 4LF3B 4JRYA 5D1ZA 1CFVH 2Z93B 3WIHH 3LS4L 5L7XL 1IQDB 1AY1L 2ZSVA 5D2LB 1VFBA 4RBPH 3QDMA 3BH9B 3F7RA 1KN2L 5JORA 1A7PL 3FQNB 3D1MC 1QYGL 4K7FB 4MQXC 3UAJC 2H3NA 4LSQH 4QXGL 4LSTH 5DZNA 1F90L 4GBXC 5EBMA 2X4RB 4KHXH 1BOGB 4H5SA 3DSFH 3QIUC 1S9XA 2E5EA 4FP8H 3N50A 4NWUL 3L3KB 1CF8H 3S7GA 1JBJA 5F21B 4L3CA 1QEWB 3PHOA 1E4XH 4YHOH 4RGNE 2WUCH 5BRZA 3U9UA 4LCCB 4KHTH 2E27L 3QUZC 3MLPA 4XC3L 1R3JB 4JRYD 3PWLB 2A6IB 1HSBA 5B4MD 2GI7A 1OLZA 5KVFH 1MLCB 2FX9H 4YGVB 5IBTH 2JJTC 3MJ9A 4NDMA 3RVVD 3ZDYE 5E8NB 1D6EB 2Q86B 2BSSB 4FFZL 2I9TB 1Z0MA 2AXJA 3MNWA 3SE3A 4DVRH 4HT1H 2XWJA 1H8SA 1BD2D 3RVTD 2ZWLT 4ZNEA 5KSVB 2PCPA 1J0KA 3PP3H 5D7IB 3BKML 5HVHC 1J0YA 3B3IB 4MYWB 2IMMA 1MCWM 4JGMA 4M8QA 3WJJA 1DFBH 4PJCA 4U3XA 1IGFH 2J8UF 3BQUB 5HTSA 5GS3A 3TO4A 1RHHB 2UYLA 5GSRA 4WWKB 3C6LA 2O93L 1MCIA 2EDEA 4UINL 4KY1L 4OTXL 5CEXA 4HXBL 3HPJA 1A5FH 5T33H 4QOKA 1MWAA 3MBEB 5IW1B 3HZKA 5I19H 3UBXI 4PREB 1HHJB 3VFRA 3VFPA 5DMJB 4J1UB 2Z31B 3LEVH 4JG0L 3U1SL 5C0FB 3LN9A 1SEBB 2JJSC 1N5AB 5CZKA 1ZAGA 1GYAA 3GHEH 1T04A 1QFWI 1T1XA 5DK2A 2VDNH 4W81A 3MNVB 2FB4L 3RZCD 2YPKA 3BKYL 1OQXA 1I1AC 4UOJA 4HK0A 1AD0A 3C5ZB 4L5FL 3BT2H 1FYHB 1KTLB 2O26U 4A6YA 2HTLC 1B0GB 3HPLB 1K5NA 5K33A 1PD6A 1RIUL 4CW1B 4NUJA 4ODHH 4Q9CA 3QIUB 5E99L 2EKSB 3WUZA 1JWMB 1U3ZA 2CJUL 4GMSL 4V1DE 4PD4J 1F97A 1UZ6F 1CYGA 3E6HB 4FQXA 4GXVL 2F58H 3V5HA 3C60C 3MLRL 4M1GL 4NN6C 5EBWA 2VLJA 1QVOA 1K5NB 5DURB 5FYJE 3LVEA 1JTOA 3RBGA 4KKAC 3TP4A 1FPTH 1BOYA 3AXLA 2YPKB 1JTPA 1ZT4B 2J8UA 2JK5A 4GAGL 3QFJB 4PRAB 4GT7A 1YEHH 3KYKH 4ELME 1A9EA 4WO4C 4IOFD 2W1NA 1A7QH 3NA4A 1MIML 2HWZH 1RVFL 4U6YA 2FLBT 4FP8L 1NC4A 3OKNB 4MNGA 2R0WL 4IIQC 3MMEB 3HZKB 3RP1A 4OV5A 3LEXB 5LAXB 1D5ZA 3B2VL 1G7HB 1U8LA 3KXFB 3GSNA 5DD0L 1U58B 4YX2L 3NAAH 3NBNA 3L3OA 2Q6WA 5JXED 3OR7A 1B6DA 1LEGA 2CXKA 5IW3A 3QDME 1DL7H 4NRYB 2D2OA 1CVSC 4R96B 1B4JH 4L29B 5DT1L 2OMNA 4HDIB 2UZIL 1G9NH 3ARYA 3WSQL 1MELA 5F9OL 4TOYH 5ACZA 4QT5B 1RK0B 4KUCD 1IEHA 3S3JA 1OPGH 2BSTA 3QEQE 2VE6A 3JTTA 1AGEA 1MPAH 5C92A 4UAOC 3SE9H 1CN4A 4YBQC 4M7JH 3C2AH 1MRFH 4GW1A 3OJDB 3L7EA 4MVBC 2SEBA 3HC0A 4RFEB 1I8MA 4AEIH 5CBAA 2ZUYA 2ADJB 4MB3A 2ZJSL 3B6SB 1NUDA 1SVCP 1CQYA 1L9NA 5I71B 2ILLA 1ZA3B 4XAKD 1K6QH 3CLFL 4LVNC 4AH2B 3NCJH 3T0BA 1YUHB 1RY7B 3ET9F 1D5IL 3BRDA 3VA2C 5IHBA 4FQXB 4X6CF 3D39A 3AM8C 3KJ4B 5BZWA 2CLRA 2JJTA 4L8DB 2YUWA 3SO3C 3A6CL 5EWIL 3RNKA 8FABB 3C60A 3GMMB 1NKRA 1VACA 3ARBC 1WBXA 4DQOH 1HWGB 3WN5B 3S97C 3NCFB 2H1PH 1EJOL 3U1SH 1YY8A 1F2QA 1XCTB 4LCYA 3NH7H 4OF8A 4ZOAA 5DJ0B 4N0CD 4NO0D 5CZVL 3MXVL 4NC1C 5T1LA 3FMGL 1H15A 3ARFB 2MWCA 1PLGL 4PJ9A 4MZ3A 1CLZH 4U1IA 1NAKH 5EU4A 4FMFA 4UNUA 5E5UB 2EECA 5ITBH 4XMKL 4OZ4B 1YN7B 1FG2A 5I9QB 2AJVL 4WVRA 1W72B 5E4IA 1T3FB 4HMDA 2EDLA 1Q9LA 2P5WE 2XTJE 1IM9D 3PXHA 3QP3A 4HLJA 1SVZA 2OP4H 3FOMB 1H3XA 2XG5A 3DI2B 4P4RB 5DRXB 1KCSH 2JJVA 3CVIL 5IEKA 1S7VA 5SWQA 1RUKL 1DN0B 2IQAA 4ZTOH 4LLMA 4OB5L 2X4PB 4PPTA 3MOBH 2X10A 3HLAB 1X5KA 1C12B 1LMKA 1L0YA 1JN6A 3LD8B 3A6BL 3RTQD 2A6KB 3MJ9H 3NABL 3KPSD 3BDBA 4YEEA 3UJTH 2CLZA 5HD8D 3BO8B 3AUVA 4JFXB 3O41A 1R5IB 3TFKC 5FO8A 4TTDC 4M7LL 4PBXA 3B9EA 1ZLUK 3FO1A 1OGAE 4HEME 1J0ZA 3QUZA 2DQEL 3PDOB 1UCBL 5KZCD 3DI3B 1YECL 5IQ9A 5L2KB 1JYVA 3T0WA 4OIIH 3S5LG 2N4IA 2R8SL 2OXHA 5J7CC 1KJ3L 4W70A 2YA2A 3JBG7 4QF1A 4KROC 3RIAK 5J13C 1EMTH 9CGTA 2GTZB 3EJZD 4D0CB 4DZ8A 4I2XA 2B0SH 4YDKH 3DV6B 4QWWD 3CXHK 4EN3A 3EYFB 1L7TH 2J12B 4NNXA 5FYKL 1OGTB 2EO9A 5C3TA 1SJEA 1Z5LB 3AMLA 4OCNC 1XGTB 1AC6A 1OVZA 1VGKA 2UVEA 4HZLA 2X4SB 5KVFL 5C09E 3TESA 3A67L 3MRFB 1CZ8H 4OGYL 5IVXB 2EYTA 4ODXB 2HTKD 4KK6D 1VESA 1CDIA 1YNLL 1FSKB 3BDYH 1CDBA 4LU5L 1JN6B 5JQ6L 1M1SA 4RMRA 3FHAA 5IJVA 4OCWH 1QR4A 3OF6D 5D7LA 4AIOA 2ITCA 3VRJA 3KS0J 1HDMA 5IHZA 3EJJX 3HN3A 3OGCA 2ARWA 3S37X 3QWOA 5HPMA 2A74A 3MQIA 1U9KA 4JPWH 3MRQB 4IRSA 4POYA 2VDLL 2Y06L 5I8OL 1X5AA 3WL9B 4EZMA 4M5YL 2A83A 1FNSL 3EJZC 3O6FA 1T0MB 4RAVA 1CT8A 1IC4L 1N8ZB 4OF3A 5CILH 1RUPL 4XP6H 3PQYB 2EYTB 4ODXA 2V9RA 5DD6B 2W92A 4NGHH 1JGDB 3VWJA 3RUGA 3MLZH 1DEEB 1URLA 1T1ZB 3KLAA 12E8L 5D7IE 1FL5B 1GIGL 5F71A 1DUYA 5C0BD 4X99B 1U95A 5CGYD 1P7KA 3UDWC 2OR9L 4BZ1L 2DIJA 3MBEC 2VLKD 3BZ4B 4IMKA 3Q0HA 4HGMA 3JUZA 4D0DB 1J5OH 3CGTA 1DZBA 4M5ZL 2ZCKL 3CPLB 4KK6C 3V5DA 3HE7D 2DOCA 4I18B 2IPTL 4D0CA 2PTVA 4WUUA 2VISA 4ODSL 3BQUC 1KJ2L 2ED9A 4ZUWA 3DGGB 1Q94A 4U2YA 2D4DA 2YD2A 3O3EB 3P4NB 5A2IH 3M17B 1NBYB 3GO1H 4KGJA 1ONQA 4R9HA 2VH5H 3K7UA 5HYJA 4J2XA 4BFIA 3T4AA 3LDBC 5JLZB 4HG4J 3RQ3A 1G7IB 3SGKC 2DAVA 2WWMC 2AV1A 1ZVSA 4XVSL 5GGUA 2G75A 3H3BC 4YHYC 4KDVA 2VLKA 5HHQA 1XGUA 3SDXF 3WIHL 1HCVA 3PL6C 3FN9A 2VR4A 3OHXB 3FQUB 3FT3B 3MCKB 1IQWL 2P8MA 5HDLA 3V6ZA 2MKWA 4JZJB 4O4YH 5E9DA 1T4KA 4XVTL 3VFWB 4WEBL 4Y4KD 4LLMB 1U93B 2C4FU 2X5PA 1Q94B 3ZKMC 4XH2A 3S4SA 5CINH 2X41A 1MLBA 2PUQT 1QBMH 3SDDB 3BISA 1CD0A 1FFPB 2RR3A 1BIHA 3GSQA 3QWRA 3QCTH 3DXAA 3SDAC 5ABDE 2HMIC 4NZTH 1ZT7A 1XCQB 5D2NE 2AJZA 4PJ8A 2GAZB 4NZTL 4KH2A 4Y4FC 5LGKA 1NFDE 3IVKB 1ZT1A 3IJYA 5HPOA 4QRRB 2VDOL 5I16A 3EYSH 1UB5B 3SPVA 5DJ0A 4I13B 3UBXG 4M6OL 3L3HB 2C1OB 4HHAA 3CFEA 2GT9A 1S5HB 3RL1B 4F9PC 3V5KB 5BZDA 3QO0B 4EI5D 5IEKB 2DQUH 1OWRM 5L9DH 4K8RC 3PWPA 3CDYA 5EU5A 4DAGH 1KENL 5IHZB 2F15A 2B1HL 2CK0H 3NFSH 1IAII 3HZVB 1NGYB 2BZDA 3LB6C 4LHJB 4PYHA 3VXNB 4H20H 4OLWL 1EUUA 1YYMH 3M8OL 3X11A 2VMFA 1A7QL 5T5FL 3ARFD 1CGVA 1GGIH 4NZDA 3T1FA 5FECA 1QACA 3QIBB 5ICXB 3EOBB 2W9EL 4FQIL 1YY9D 3LSOB 5JDSB 4V2BA 1SJEB 3PNWA 1ZHLB 3BP7A 1LO4L 4KKNA 4UDUB 1AR1C 4ODVL 5DQDL 2XXCB 5SWZE 2QSVA 3U0WL 4LSSL 4YHZL 1NDGB 4QOKB 3GK8H 3GMMA 5I0DA 3CSYA 3WNKA 4QRPB 4J6RH 4QTHA 2DQDH 2C4XA 3U9PH 3BD5A 4LCWB 2ARJB 3EO1A 3UJJH 2DWDA 1YEIH 1VKXB 3DVNA 4AH2A 4MD4A 2Z9TA 1KLGB 4G6ML 1IGTA 2DD8H 3KVQA 3OWEA 4L8SC 4B50A 5IVXE 1I75A 4WFHE 3OKOA 5IR1B 1F6FB 3LSOA 4U1NB 2CDGA 2G9HB 5DUBB 5FGRA 3GNML 4HIXH 3INUH 1MQKH 2EH8L 3L5WA 1J1PL 3O41B 4YGAB 5GS1B 5HHOA 1ZVSB 5GGUB 3RI5K 4MA7L 3W82A 4M7KH 1SY6H 4TSCH 5KW9H 4LK4A 4UUJA 3G6DL 2BSTB 5F7YC 1C1EH 2P5WB 4ZFGL 1KSRA 4HH8A 3KPNA 5HYSA 2AEPL 4HQQH 3HLAA 2NXYB 4I1NB 1WV7T 4L9LC 1FIEA 3EIFA 4JCLA 5CP3H 4XCYB 4XXDB 4NQXA 5HDQL 2OQJB 3QCUL 4OZHF 2WBWB 4LLWB 4QTIH 4GOSA 1MI5E 2CKBA 4WFED 3FOLB 5T1LD 1W0VA 1ND0A 5FUZL 3V6OA 4HKXA 5E2TL 4D9RD 1BF8A 3H9SD 1TJHL 2MQ3A 1BHGA 3WLBA 4PJFE 3C9NA 4ONGL 4RDQF 2EIEA 3LRHA 3MOAL 3I3EA 3MRJA 1BFVH 1IAKB 4U7MA 5SV3A 4BSVB 4XRCB 5L88H 4Y1AD 4H1LB 2GTWB 3TNNB 5EZOH 5KAQG 5C0GA 1FFNB 3O6FB 4RAVB 1EAJA 2JIXB 3BDXA 4GBXA 5EU6D 3VXNA 1SHMA 3D3VB 3HI5H 1MAMH 4JFDE 1TJGL 4XXCA 1NCCH 2H2PC 3DX8B 1JRHH 4M48H 3WFBH 2Y25A 5IVZA 2PYFB 2Z35B 4LU5H 1WWWX 3MFFB 4I3SH 4X7CC 3REVA 4LHUG 5I8CA 4ZTPH 4ZSOA 5IBUG 1G9NL 5MENE 4WHTB 5EPMB 2ADJA 5F96H 1AI1L 3S5LA 3FB8A 3NZ8A 5F6HJ 4Q9QL 1KELH 3X3GH 4L3EE 2R1XB 2PO6B 3I85A 3B8SA 3WFEH 3FZUD 4O51A 5J1AB 1OF2B 1E4WH 1PG7W 4LCUB 5DD3H 1RZ8B 3U6RB 3RWFA 3GBML 3TCLB 4DJMA 1TTGA 2GAZA 4I9WE 4XHJC 4PJHF 3EW3B 1A3RH 3KPSA 3RGHA 2HVJA 2Z8RA 1IGTB 4KKCC 4KKBD 5DTFB 4ZFFB 3MJ8A 4EN3B 3H9SB 5MHSE 5HYJE 2F8VA 5M7QA 3FRUB 2VXQL 3QDJA 4EUPB 2EYSB 5C0RH 4MJ5A 5IEHB 1KPVA 4WUUE 5EOCH 4OF0A 4AM0A 4NO3B 4OZFA 4FFYL 1MEXL 2CPCA 2NY6C 1YECH 3PL6A 1WCQA 1D5BB 3SDDD 2ZUQB 4F9LC 4JFHE 6CGTA 1V7MH 3UTTA 3MTRA 4WWKD 4L4TB 2A9NL 3GSVA 3C8KB 5GZND 3K80A 3NPSB 5FYJD 1ZLSH 4YXKL 3TPUB 4NKIL 4DTGH 1JF1B 1JMZA 2ZUQC 5INCB 5KW9L 3MLUH 5ID0A 1IQDA 4HV8A 5DXWA 1VGEL 5GGTA 4BFIB 3MOQA 3O8XD 1HIMH 1NBYA 3SGJC 3HE6B 3T1WA 4U7KA 4LGPB 4PJ7E 4QHNA 1Q0YL 3DO7A 1NC2D 5BS0D 3GMNA 2WWKT 4ONOA 2VZ3A 4PJBE 4RGND 3ZDZF 1K4DB 1S5HA 2FZ3A 2Y36L 4HHAB 1QLEH 2Y07H 1JYNA 3Q6FB 1FFNA 1LK2B 1C7SA 1MJJB 2YWYA 1TXKA 3NN8A 1OAXH 2ICWB 3RGVA 3SCMD 1BBDH 4YFLI 4EUPH 5CD5C 1INEH 5DRNA 1ZT1B 5KS9B 1AHWA 3OKDA 4JLRA 3UAJD 5ITFB 2YD4A 2YD3A 4JQVC 1KGCE 1PEWA 3RAJH 2UWEE 3LKRA 3TO4C 4GRLC 4TUKL 3HZMB 1MWAB 4JFEE 5AAWA 5E00A 4LPYA 1ZLSL 2DLFH 1U3HA 1NBVL 2EO1A 1U91A 3G6AA 3UROR 3RZCB 2X1XR 1K2DB 3PWVB 3H3PL 4NKIH 2OR8A 2H41A 5D4QA 1HOCB 4RX4D 2FD6L 1G9MH 3UBXB 4JFFA 1NQBA 1KG0B 5E24E 4HH9B 3RVWC 3EOAB 4N0YH 1KJVB 2AABL 4JDVB 4HPOL 5KN5A 5KSVA 1UEYA 4HCRH 4UI2A 3TPUA 1X5JA 3CZFA 3MRGA 3D87B 4L4VB 2EEBA 3OKEB 4XC1L 3SGDH 4PGJA 5JUEH 5C0AE 2VL5B 4MJIE 1FG9C 4PGBA 3RWHB 1A1NA 1S9VB 3IFPA 2W38A 5KJRL 3GO1L 4IHOB 3MV9A 3ZHDA 5HGHA 3HB3C 1A3LH 1KJ2A 5T3XH 3CFIC 4Q6IA 2R23A 5FGBC 1OSZA 5A2JH 2FIKA 3ILPA 3PG2A 4KRPD 4LASH 1HH9A 1WZ1H 2OL3A 2YWZA 3OG4B 3U46A 4CMMA 3O3DA 4NKMA 1HHKA 4TTGA 2RFXA 3CIQA 4JREC 5DR5H 1ZKAA 4MZ2A 5JW5B 3B8YA 4G8FA 5KTEH 4CMHB 1DUZA 2JF1A 5F7UA 3CMGA 3EO0A 1FN4A 3TBTA 3TWCH 3PNWB 32C2A 4HX1A 4CGTA 1HK6A 3Q6GH 2PF6A 4FHBD 5IJKA 5DC0A 5EZJA 4EBQL 2I60H 1XF4B 3D5OF 3IDJA 4PG9B 3QEUA 2HFGL 2YPLE 5T1DH 3KWWB 1MFBL 3JZ7A 4O2FA 4ZXBC 4S0TD 5BV7C 5EO1B 1JK8A 3SKUD 3WN5A 2AERT 1F4HA 3NIGE 3MRCB 3GSXB 1AXSA 4RIRB 1OGAD 2BNUB 4D8PB 3LQAL 3ZDXE 1A0QL 1CGXA 2YC1B 2V5TA 1UKTA 2FGZA 4TSCL 2FBJL 1PKQB 1HQRB 5AEAA 4X0KB 2H8PB 3DX7A 2EYRA 4N68A 4JGJA 3GSXA 4GG8B 2VXVL 3CFEB 1ZTXL 5C2BL 3UDWA 3BP4B 4WJ5B 1N6VA 4OCRH 3BE1L 3NGBC 4JE4B 4OQ1A 2KZWA 2IBZY 5F1OB 4QTIL 4OIIL 1J12A 3O8XA 2XWBA 1FYTA 4QHMB 4KJWD 3U0TA 4KAQH 4OD1L 3FAXA 4XPFL 3VMOA 1YQ2A 5FM8A 3PGDA 3ORJA 4Y5YB 5IG7A 3T2PA 4WHYH 4JN2B 1OD7A 2I07B 3N85L 4LRIA 2HKFL 5F7MC 1ZSDB 3FONA 2F8OA 4DZBB 1J8HB 1RJCA 4NOBA 4UU9B 4YHOL 3SE3C 3GSQB 2GYSA 5I75B 2VDOH 3VXMB 4Z7QE 1QD0A 4PJCE 1A4JB 3JVGA 4EDWH 3VWKA 3S4SB 1QO3B 3ARGA 4LLUB 4MNQA 1H3WM 5JR1H 1B6UA 2A6JA 2VSDA 4LDEB 1KN2H 2V2XA 3VI4F 2LQRA 4CJ0A 4MD5B 5CWSB 1FO0B 3IFPB 2WBJA 3W39A 4L8BA 4BH8B 4NT6A 5KVEL 1JF5A 3NMEA 2BRRH 1I8MB 1YNKH 3O6LH 15C8L 5IROA 3VXOA 2F5BL 5F1IA 3U79A 3MLYL 2WWKO 4JO3L 4OD3H 5GZOD 3QEHA 4NQCD 1CFQA 1RZGA 1BF2A 5E2WL 2DQUL 3ULUD 4LHUB 3TT3H 4KJWC 1VSCA 1P5VA 3QEGH 5D7JB 1Z0NA 2WZPD 5LBSH 4XNUL 2YUVA 4HUKB 1SJHB 2X4PA 1EAPA 3WLWD 4PRNA 5C6PB 2X09A 5HHOD 1XF5B 4S1QL 1IKNA 3MRLB 1QBAA 4KROD 4X6BA 3FTGB 1MCEA 4UDTA 1DQQA 2ICWI 3SGEH 5I1HL 3MRPA 3MV01 5CEZD 2W07A 1S3KL 5KSBF 5B3JF 3ZE2E 4GS7B 5DRWB 4Z0XB 2ICWJ 4S1RH 1ZMYA 3EYQD 3OKNA 4MNGB 2B7DT 3MV11 3TNNA 3BP5A 4U1LA 3DHMA 3J8F7 1LGVA 4NHCL 4B0MM 2ICEB 3DARA 5KS9A 1A7OL 3UTSD 4F7PB 1AP2A 2A38A 1F5WA 2YA1A 3E2HC 1ZWIA 2YPVH 1QG3A 5D2LA 1NUNB 2FX9L 3AY4C 2YPVL 3AM8A 5JIPA 2X05A 1IE5A 4JR9L 4QCIA 4WU5A 3DJ9A 4OZIB 1RZJL 4WDIA 2EC8A 3D0LA 1YNKL 3MLVL 1WAAA 4PLNC 1IGML 1FIGH 2CIKB 2WW8A 4C54A 1A7RH 4MA7H 1E28A 1INDH 2R1WB 4WY7L 5CBEA 4Z5RB 3QCVL 3V8CA 3ULUH 4N0UB 1U8HA 5L0QC 4LEOB 3V5KA 3VWKC 1N0XH 2G5BA 3OPZL 3GNMH 4NUJB 1FNGB 3PQYE 3GIVA 1RIHL 2VDNL 4HIIB 2VLLA 2ZKHL 1YJDC 2HJKA 1AJ7L 2DQCL 5AZEL 5CBAB 4S1DD 1QQDA 4WI7A 4FQ1H 4OKVA 2BOCB 2LU3A 1RUML 2PYED 4PY8J 3GZKA 1MFCL 1FZJA 3SKNA 3SQBA 1YEHL 2BVUA 3GJFK 5E5RB 25C8H 2VXTH 4P46D 2HJFA 3NPSC 4GQ9H 5DVOA 5DC4B 1FPTL 4F8QA 3UTQB 3KYNB 5D1XC 3BI9X 3DVGA 2GJ6A 5CSBA 2IC2A 3R06A 5TPWL 5DJYA 3RI5F 5IFAH 1IT9L 4JVPA 3OZ9H 3EGSB 2EC9U 5C70A 4KQ4L 4CMMB 5EBLB 5LG1A 3SDCD 3IRZA 4WWKA 3BP6B 4X7TB 1HXYA 1XMWA 4YHKH 1FZMB 4JG1H 3BPLB 2DLGA 4Z77A 3G04B 4HUXA 5DQ9B 1OP3K 5LCVL 4JEGB 4XPBL 5CGTA 4BZYA 2LFGA 1TVBB 5BV7L 3IJHA