1XF4B

Structure of ligand-free fab dna-1 in space group p321 solved from crystals with perfect hemihedral twinning
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
213
Chain Sequence
b'QVKLLESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCVRGGYRPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 37
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4B02
4ZFZB 1TJHL 5TDPA 2Z8VC 4KTEH 4ZTOL 1EO7A 2BERA 4K7FB 1D5BA 3VFNB 4EEEA 1NCWH 5KS9A 5HTSA 3T04D 4MA8L 3WUWA 4GRWE 4OM0L 1MFCH 1IM3B 2NY5C 1H0DB 3MJ9A 2DLEA 4OGYH 3ILQD 3ESVF 1UG9A 3BX7C 2MFNA 2HKFH 4OCYH 4R4FH 1RK0B 5T5NF 3ULSA 5CUSL 3B43A 3FRPG 4X0KA 5D1XA 2O5YL 4U1SA 2HLAA 3L7FB 2F53B 2IEPA 3KDMB 1BEYH 4Z7WA 3CLFH 4GMTH 3WNPA 3P9LB 3RNKB 3KLAB 4IS6A 5HDOA 1WWBX 4JQXA 2BMKA 3D39D 4OF0A 5DJXB 4XNZB 5A2LH 4NO0D 3O4LA 1X6LA 4P2CG 1QLEL 1OAYH 2DI9A 2NX5D 2VITB 1NGQL 4EDXA 1K4DA 4JFEE 1D9KB 1UKSA 3ULVH 4QRPD 4NFBA 5FYLD 4PJDE 3B9VA 3WFHB 4UUJB 3ZKMD 1WITA 3TO2A 1MCCA 2CUHA 3O45B 5CCKH 5JO5B 3OTTA 1MJ8H 4Y19E 4UU9B 3FOLA 1GGIL 1R6VA 3OHXA 3S96A 3BHBA 1RHHA 1J18A 1HWGB 4HSQA 2CRMA 5C08D 2BNRA 3GI9L 4NZUL 3LRSB 1XF1A 3SDXA 5CZXD 3HC4H 1GC1H 5IHZB 4O9HH 5J3HD 4P9ML 1IQWL 1JF5A 5E08H 3TZVC 2EDJA 1J1OH 2AEQL 5IMOA 1CLYL 1XF3B 1KEGH 1EHAA 4HKXB 3UJJH 3FB8A 5FHAH 5IM7B 1CFNB 1SYVB 2VDOL 4P3WA 1JPGA 2YZ1A 3OR6B 1U8MA 2VKXA 2QQKL 5BVJA 4KJYA 2CO6B 2HRPH 2BCKA 1UZ8A 5JQ6H 5ID0A 4JRXB 4PJXB 3VD7A 4N8VA 3DMMC 4L29B 3VXNA 4DFIA 3H3KA 3VD3A 3O6LL 3SJVE 1JWMA 2VLRA 1J0YA 3N50A 4PJ7B 2P5WB 7FABL 3MOAH 1EO8L 4IOSD 2Q76B 4OLWL 4YEEA 4UNTA 1ES0A 1V7NL 4UT9L 4L4VA 4Y8DC 2IGFL 3KYKH 4NYLB 2XKNA 3PG2A 2EEDA 5GISL 1W0VB 3Q0HA 3UTSE 1ZA3A 2IPKB 3QEHB 4IRJD 4JM2A 2DDQL 3QCVH 4NDMB 3BZ4B 3FZUD 1NCAH 1VSCA 4Y1AD 3PWUA 4YJZL 4LSSH 4KWUA 1K8IB 3IDNA 5CJXC 3HNVL 2PETA 1NANH 4YH6A 5HYJE 5I16A 2QQLL 2FJGB 4EDWH 1NAKH 4HWNA 4S1DD 3UC0H 3D0LB 3ARGC 3L3HB 2NW3A 1RHFA 1UB6B 2X1WL 3RIFK 2AEPH 2VO5A 4RGMB 1PVHA 4PJEA 3W81A 3FB7A 3QEUB 1MHCA 1G7JB 1KIQA 4JO3L 1IGIL 3CNKA 5C6WH 4WHYG 3BKJH 5GIRB 2A74B 2HJKB 4ZUWB 3DVGA 5C0BD 2J5LB 5E5MB 5INCA 1U8IB 4QRRD 4JZJB 5DO2C 3MA7A 1J05B 4HJJH 2WUBL 5EC1A 3GZKA 5EOQH 5FHBL 1V8HA 3ULVC 1J5OL 3QEGH 2E7LC 4RNRA 2BY0A 4G8GA 5JNYB 1YNLL 4HT1H 2DQGL 4M6OH 5KTEH 5J8OA 3ULVF 5D7IA 4WO4D 1FNSH 4XPAH 4X4ME 3RL1A 3BDYH 3GSOB 4O4YL 3GMLB 2CKBH 4NPYB 1PZUB 4JO1L 1UXWB 2JB6A 3GKZA 2ESVD 4A6YL 2FO1A 2CR3A 3GSUA 1CXLA 3VFWA 3KAAA 3GHBL 2AJUH 4DN4H 3LV3A 5JXEA 1NC2B 5ID1A 3Q3GA 4DUVA 5C3TA 1NAMA 3QUYC 4KVCH 4PJBA 3VJ6B 4ZYKB 3B2VH 1W2KT 4X7CC 3LEVL 2X2YA 3LKRB 4MVBD 3GUTA 3AXLA 2JCCB 1V3MA 2VXTL 4AK1A 3CSYB 3B2UD 3ULVE 1A6WL 5JTWA 3QHZH 2D7TL 3CC5A 2NNAB 1ETZB 3FRPA 2ZCHL 3LEXA 4X7SH 4F2MA 3DURA 1KPVA 1W8OA 1GOFA 4XCCH 2F54E 4JFFE 5HGDB 1B6UA 3M17B 1SYSB 4UILH 4Z7NF 3HMWH 1K85A 4PTTB 5AG9A 1FRGL 4M3JA 1LO3L 3DOSA 4U1KA 4WHCA 3UP1A 1C12B 5EORL 5CWSB 1FIGL 4NKMA 5I1GH 3S6CA 2HAZA 4M3KB 3VRJB 1F3JB 3OF6D 3I6KB 1B88A 4FQLL 1GZQA 3TA3C 4NNYA 4XCEA 2NXZC 3T3MF 5F7NC 5D7SH 2C1OA 4NC1E 1S7UB 1G6RB 4I1NB 5DURB 2R0LL 3GMOB 1X5FA 4P46B 1P4IL 1LVEA 2E7HA 2R56L 3O9WD 3H7BA 1F11A 4ZUVB 5D8JH 5C09E 3C5ZC 4IHOB 3U30C 1U41A 4WWKA 3V5KB 1FNHA 1IAOA 2HT3D 3DHMA 4MLIA 1UWEH 3VXSA 2H32H 5AWNL 3QFDB 1XZ0B 4Z7NE 3QNXB 1TZHB 3WXWH 5EWIH 2Q8AH 3RAJL 4URTB 4GKNA 4OZFH 1U8NA 4D9QE 5FO7A 5HHME 4R26L 4DKDC 3QXUA 4S0SD 3WFCH 1UCBL 4F7PB 4PJGA 1CL7I 1RZJL 1CG9B 1QRKA 3T3ME 2FRGP 5J7CC 1ITCA 1A5FL 1QPXA 2PO6C 3DRTB 5DUBA 5IB5B 3UTPD 4JRYB 4AZ8A 4Y16B 1CDBA 2MCPL 2Q20A 4D0BB 2V5TA 4OFDA 4OZ4A 2V2TB 4H1LH 4HLZG 3V6ZB 1BWWA 3IFLH 2XT1B 3TJHD 2CKNA 3GHEH 1MHEB 3OKDA 5IW3A 3SO3C 1FSKB 1S7XA 5D9SB 5FB8A 4LGRB 1A6ZB 3BUYA 4JR9H 5EZIH 3QUMB 3BE1L 3Q5OA 3KLSA 4JFED 1RIVH 2DOCA 3TO4C 4HUNB 3VMNA 4LMQI 4J8RB 4QEGA 4Y19D 3WS6C 5D2NC 2IANB 4IIQB 1I7ZA 4KJPC 1D5ZA 1MIML 4YE4H 3R06A 1PG7L 3Q5YA 5BRZD 4KHTL 5K9QI 3H0TB 1YMHA 1I7UB 5AD0B 3S35H 2FX8L 2OM5A 3IDMB 1YEFL 4FZ8L 5TDPB 5KOMC 3MNZA 5L7XH 3VFRA 4UT6H 1D5BB 5B3NA 5KS9B 4G6JL 5L8LB 4HUMB 4NJ9L 3WUWB 2B1HL 3LH2L 1A6VH 4WEUD 3DSNA 2VL4A 4PLJC 4N0YH 3NBNA 2EO1A 4KZDH 1FVCA 1S7VA 4LCUA 4X0KB 5D1XB 4ZD3H 1CDIA 1WAAF 2ERJB 2HLAB 4U1SB 3CZJA 2IPTH 2N4IA 3NCEB 1UWXH 4OT1H 4Z7WB 5E2WL 3KXFE 1UWXK 4LSTL 3U4AA 1BQHG 2WBJA 5CBEA 3SJVD 4KKLC 4IS6B 5DQJA 3H42L 2BMKB 1DVFC 1AKJD 2EDHA 5C0DA 1JNJA 3O4LB 5D2NE 3FTGA 1CXFA 4EDXB 1K4DB 3RDTC 2Z35A 3CFBA 1MREH 1QBAA 2JJWA 4FG6C 4JO4H 1VENA 3AM8C 3UTSD 4UV7L 1AE6H 1RUAL 3TO2B 1YEIL 2YKLL 2H9GA 3O4OC 3FOLB 3OHXB 1A6AA 4HKJA 5B8CA 3BHBB 1LEIA 1RHHB 4KDWA 4X6FA 1KV3A 1A14H 3CGTA 5JW4N 3TV3H 5C7XL 1MCOH 3G04A 2BNRB 4CBPA 1CBVL 4H8WL 1WAAE 2BVTA 1P9MA 4KKBC 5HYJD 1YC8A 3SDXB 3CLEH 1VCAA 4L8BA 3ZT5A 3UMTA 4OD1H 2EH7H 3DMMD 4UOW1 4S1RH 3FB8B 2EECA 4M6NH 5C0AE 3TWCL 3PP4L 2Q3AA 4HPOH 3JWOL 2GJ6A 2HH0H 1JPGB 2OX5A 3GEWB 5ILTL 1U8MB 2HJFA 4GMSL 3O8XC 4QT5A 5BVJB 1UKTA 5BJTA 4KJYB 5SWZA 2BCKB 1UZ8B 2VQTA 1U0QA 2HYMA 3H9HA 3MCLH 4WHDA 5ID0B 4I0KA 4N8VB 4Y4KC 1NGWA 1XGUA 4JHAL 3SDCC 1YYLL 5C0FA 2MKWA 1JWMB 2WWKT 2VLRB 4XXCA 4HWZB 2OR9L 3C2AL 3H6JA 5A1AA 2IBGA 3K46A 2ADIA 4OFIA 1B0WA 4E9LA 2LV4A 3MMEA 4KAQL 1ES0B 3E0GA 4ZOAA 2DQTH 4L4VB 4WI9A 2Q86A 4B53A 4YHLL 2XKNB 3PWLA 2CMRH 1H5BA 3RWIA 5KSAC 1ZA3B 3ARGD 3RGVC 4OZIA 1OGTA 4JM2B 3VGBA 4WU7A 4PB9H 5GJTL 4FQPA 1JHLL 5T33H 1LQSR 3ARRA 4K9EH 3PWUB 3WFEH 3IDNB 1P7QA 3M1BA 1AD9A 5I16B 2Z9TA 1EH9A 5FFLA 1TIUA 2AABL 2NW3B 4ALAH 5K93A 4BZ1H 5DO2D 1R3HA 3REVA 2XI9A 3G6JF 4PJEB 3ULVD 4Q7DA 2RCSH 3H9SA 2K1MA 1MHCB 1SM3L 3IU3A 1KIQB 4LARL 2WIIA 3E2HC 1UYWH 1CDGA 1AIFA 1VFUA 1YN7A 5BMFH 1N7ML 4NIKB 5C2BH 5F7HA 3DVGB 2CKBA 5H37H 3WS3A 2OZ4H 4K94L 4JFFD 5INCB 4ORZC 2Q87A 3VFPA 3MA7B 3GIVA 5EC1B 4G42A 3FAXA 1GYAA 4FQIL 1HZHL 4RNRB 4PTUA 3U9PL 5EIIA 1QSZA 4G8GB 1A1MA 4DGVH 4M8QA 3EYSL 2XWJA 2FGWH 5CSBA 1MFDH 4YDKH 5D7IB 4UTBH 5HD8C 3QI9C 1AQKH 1NCTA 1CFVH 2E7CA 3WN5A 2FNBA 1YMME 3G6JE 2JB6B 4U1IA 4YR6A 2D9CA 3VA6A 1KBGL 5EUOA 4MJ2A 3GSUB 3E1F1 3VFWB 1IGML 1ZT7A 1K5NA 2MMXA 3CK0H 3LV3B 5C09D 4G6KH 4LLAA 5ID1B 3OAUH 3Q3GB 1HH6A 1NAMB 3RBGA 4PJBB 5C0EA 4ZFOA 2YS4A 5DUMH 3TBWB 2OJZH 1NBQA 3GUTB 1HQ4A 3AXLB 4AL8H 4D9QD 1EHXA 5HHMD 3DSFL 1ULVA 2VSDA 3IDIA 4DTGL 4HGWA 4PG2A 3CU7A 3CX5J 1IKFH 4FMFA 3LEXB 4F2MB 2VXVL 3DURB 1KPVB 3LHPL 3HE7C 3HZYB 1AR2A 3AREC 5KG9A 1QKZH 3QUZC 1BQHA 1EUUA 2B0SL 4S2SB 3ULUH 3TA3D 1U3HA 2D7PA 4HCRA 5GHWH 5IF0A 2NXZD 3VXME 4EQ3A 2XZQL 4LPVA 5DJ2A 1L7TH 1OCWL 4NKMB 5TF0A 2HKHL 3ZL4H 1AHWA 4HHAA 3K2UH 3VGAC 1BLNA 3C5ZD 1GZQB 4NNYB 4XCEB 3I84A 3TYGH 1H8NA 2ICWJ 1BJ1J 3HMXL 4C4KO 3BKCL 2C1OB 4HUXA 1E4KC 4NQTA 4EQ2A 4OZFA 5GZNC 3KPSD 2QADC 3QYCA 3MBEC 2P43B 2PXYA 3L3GA 4Z78A 3SOBH 3MXVH 3H7BB 1F11B 4KFZC 4XNYH 4MX7A 3ZE0F 5BV7C 2MOVA 4OLVH 1IAOB 3VXSB 1QBMH 1TPXB 1F4WH 4MB5A 4YHOH 1D6EA 1L0YA 2PO6D 2PUQT 3GMRA 3MLPA 4FP8H 3W9EA 4GKNB 5DYOA 3VFGH 1U8NB 3KHQA 3RPKA 2Y1VA 3BI9X 5FO7B 1L6ZA 4GXUM 4PJGB 2FB4L 1INDH 4U0QB 2MPAH 5DUBB 2VE6A 3OXRA 3QEQE 3OB0K 1V7MH 4CMHC 4CVZA 2BXZA 4O51A 5E1HB 2FYYA 3KXFD 4ZO6A 4OZ4B 5DHVA 1LGVA 3ZE0E 5F6IB 3TO4D 3QQ3A 3H3BC 3FHAA 2O5XH 3OKDB 1OSPH 3QPXL 1S7XB 2X09A 5CIPH 5FB8B 3BUYB 3SGEH 2N7BA 5D1QA 5JMOC 3DYOA 5IUSA 4GG6A 2EICA 3M8OH 4TSCL 1KLUA 2AK1H 1RFDL 2HFTA 3CPLA 3EDFA 4K2UL 1XGYH 2XQYK 3P73A 1I7ZB 1D5ZB 3NCFB 1PLGL 3R06B 5H2BA 5L2JA 3IJSA 2W0KA 1YMHB 4KUCF 1F4YH 3JVGC 3CFCH 3MNZB 3KPTA 1M4KA 5FYKH 3VFRB 3TCXA 1IC4H 1CLOL 5C0AD 2KZ1B 1MI5D 4GAFB 2LU3A 4KKLD 2HWZH 1DVFD 1FVCB 1S7VB 4UIMA 3BXNA 3FQRA 4LCUB 4IJ3B 4MCZA 3ZKQD 3QIUA 4XP1L 3V4PH 4QWWC 4HF5H 1G1CA 4OUUA 3RDTD 3SPVA 1BWMA 3PL6A 1H3VA 2WBJB 4FG6D 4JFQA 5CBEB 1MLBA 5DQJB 3SGDH 3QA3A 5C0DB 2AJSL 4Y5VC 3MV8D 1QR1A 3FTGB 1YN6A 4UMGA 5T3ZH 1QTYT 2Z35B 3CFBB 1JPSH 4LSRH 2CLRA 4NCC1 4OJFH 1KIPA 3S37H 1RVFL 4R90L 4MHHI 4QRUA 1MRCL 5FAAA 3NFSH 1OTUD 5J12B 3G08A 2H9GB 5B8CB 1A6AB 4HKJB 1LEIB 4UV4H 4X6FB 4M48H 1IEBA 3CVIL 3G04B 15C8L 5D70L 3BAEL 2OR8A 1P4BL 4ZQKA 4HMDA 2EDDA 2VDKH 3O8XD 4L8BB 3S34H 1G0DA 5E4EC 3O2DH 2QSCL 5I6XC 1CD9B 3CVHL 1NCCL 3RWEA 3F62A 4Y4KD 4MCYA 4F57L 3GI8L 4U3XA 3EOAB 3SDCD 2GJ6B 4JZNA 1NMAL 3B8YA 3GSXA 2HJFB 1XR9A 3M07A 3OSKA 5LGKA 4QT5B 2B4CC 3IFOA 4W4OC 4HS8H 1AGCA 5BJTB 4FZEH 3LDBB 4Z7UF 5SWZB 3JWDL 5J57B 4ODSH 4NQCA 3LPFA 3EOTL 3LS5H 4L4JA 1TZGH 1NGWB 1MF2L 3BZFB 1EAJA 4OCSL 4HX1A 1XGUB 1F2XK 5CGYC 5C0FB 3MREA 3F5WA 5KSAD 2V2XA 4J3UA 3RGVD 2ZKHL 3S7GA 1T3FA 1T7ZA 2ADIB 4Z7VA 2MNUA 4L9DA 2BVOA 4G5ZL 3B8SA 2F8XC 3QH3A 3MMEB 1JRHH 3BSZH 2NMSA 4XP6H 2Q86B 1YMMD 1W72A 2XIDA 3CH8A 4GAYA 1X5KA 2X5PA 3PWLB 3N1PC 3U7WL 4OIAA 4QYOA 1H5BB 3ARBC 3RWIB 1A6TA 2D03L 3H9ZA 4OZIB 1OGTB 4WU7B 4V1DA 1EVTC 3V8OA 4Z7UE 5JW3L 4XPGH 1NBYB 1RJCA 1P7QB 1WK0A 4PB0H 3LIZH 2OZ4A 3S36L 3M1BB 3IFPB 1AD9B 2W0FA 12E8L 3OX8A 2VXUH 4DVRH 1I3UA 3ALPA 1N6VA 4ONGL 5GS0L 2PR4L 1R3HB 1S5IH 3REVB 3SE9H 3W9DB 4JM4L 5C70A 3H9SB 1SY6L 1MY5A 3IU3B 4K3HA 4Y2OA 3I02A 4PP1C 3ROOA 1B2WH 3HUJA 2WIIB 3UEZA 1T1XA 1AIFB 1YN7B 3LQAH 4JKPL 4X9IA 2CKBB 3WS3B 4ZG1A 3D9AL 5HD8D 1Q1JH 3QI9D 3RRQA 3VFPB 3SN6N 2HTLC 3GIVB 3VXQA 4G42B 3BDXA 5KJRH 2KQMA 4I9WE 4GLRI 2JK5A 3VXMD 4LIQL 3HE6C 4PTUB 1I8LC 1U8QA 5EIIB 2M1KA 4S1SL 3T65A 1A1MB 4M8QB 5FYKE 1FNGA 5A2FA 2CK0L 2XWJB 4NUGL 4QRQA 5HI4C 1QLFA 2R4SH 1MUJA 2CGRL 3ARPA 4ZUTB 2QLVB 4JY5L 3WFDH 1JZ4A 3WN5B 5I9QB 3U9UA 2IG2H 4GW1A 1NSNH 3MRBA 4FQ1L 2XN9A 3FCTA 4JJHA 4U1IB 4YR6B 3WE6A 4NSKA 5F8RC 4XVJH 5DEGA 3KR3H 4HZAA 5EUOB 2CXKA 1EAPA 1ZT7B 1K5NB 4LNVA 1J88A 2EH8L 3X12A 1ZHNA 3G5YA 5JZ7C 1E4XH 1A9EA 3HI6L 5IJVA 3S36X 4F37F 1EJOH 1F42A 5C0EB 2WWMC 4N8CH 4ZFOB 1BQLH 4LEXL 4PRIA 1HNFA 3ARED 2R29L 3O3UN 2BY1A 3MJ9L 3QUZD 1HQ4B 2R0KL 1AI1L 4TUOA 2HFEA 4K8RH 5GQBA 5EO1A 5TQ2H 3IDIB 4HGWB 3MV01 4LASL 2F9BT 2R9HC 3L95A 4TNWK 4P48A 1N64H 1N0XL 3E3QE 4I3SL 5KG9B 2YPKA 5JDSA 5L6YH 4QY8A 2Y7QB 1BQHB 3QEQD 4GQ9L 4M62L 1U3HB 3C2SA 4BQBA 5IF0B 2V5SA 3Q5TA 5F7MC 2VTFA 4ZTPH 4H20L 5J1AA 2APXA 1T1ZA 4BQ8A 5DJ2B 5GZND 2QADD 3HRPA 4XVUC 5L8JB 1AHWB 4HHAB 1QHPA 3Q48A 1BLNB 4HLJA 2RIKA 4I3RL 4G8EA 2VMFA 4DGIL 2VR4A 3SBWA 4QRPA 4HUXB 1RURH 3A6BH 3L3GB 2PXYB 4Z78B 4LSUL 4X4ZA 1QRNE 3IXAA 4MX7B 5HGGS 5C08A 4PBWD 4LSQL 3W82A 4ZAKC 5TE7L 5ACLA 4YHYC 3LQAC 2WW8A 1HHHA 1JPST 5HI3C 1ZANL 1A7PH 1D6EB 1QSEE 3GMRB 2AXJA 1WFOA 1I7RA 3W9EB 3WFBH 4LHJB 3LB6D 5DYOB 1ONQA 1JE6A 3DLQR 5GGQH 4L8SA 5I74C 4JKWA 1C08A 1UM5H 1RU9H 2HFGL 3MGTA 1QO3A 4UDTA 4X6CA 4XVTL 3NACH 4LQFL 2X44D 1SJHA 5CIPA 1FZMB 5CGTA 3O6KL 5IR1A 2YA0A 5IK3A 3LMJH 4YWGL 5AZ2H 1ZHKA 2VE6B 3OXRB 3PQYE 4KTDH 3EFFA 5ELIA 4GFTB 4CVZB 4O51B 4FA8A 5ISZA 2FYYB 1NLBL 5DHVB 4YK4B 4K3EL 3QQ3B 2D4DA 3OKKA 5B38G 3QCUH 1ND0A 1CIUA 3CMOL 5J13C 1PDKA 4KUCD 1FE8H 3HC3L 1H3TA 5D1QB 5F7WC 3CIQA 4GG6B 2WBWB 4QXGH 5D4QA 3JXAA 2DQJH 1TTFA 1KLUB 2X4OA 3CPLB 2D4FA 1AO7A 4JN1L 1RZGA 3THML 4UNUA 3P73B 4Y1AA 5DSCA 1ZGLA 2IQAA 4ENEC 1AQDA 5H2BB 5L2JB 3IJSB 4ZO9A 1FN4A 5TQ0L 3WD5H 4F9PA 1MVFA 5E0QA 1I1RA 4G6FD 1JJUA 4D9LH 1KJ3L 2X1QA 5LBSH 4XC3L 2EKSA 3BKYH 3MX0A 4QWWD 2VDRL 1UM4H 4JPVL 1JZ7A 3OAZH 2A0LC 3OAZK 3H3PH 5IQ7L 5HBBA 4UIMB 3BXNB 3FQRB 4MCZB 3TM6A 3OQ3B 3QIUB 3MSPA 4U49A 1RUKH 4X8XA 2VZ3A 5I71B 1NQBA 1KCVL 4PD4K 3VFUA 4OUUB 3QHFH 1FFOA 4GXVH 3SPVB 2EEBA 4HXBL 1YC7A 3PL6B 1WT5A 4JFQB 1X6NA 4PRBA 1MLBB 1A0QL 1AGBA 2A6KB 3QA3B 1KJMA 1WZ1L 3FT4A 1XGQA 1T7YA 2A1WL 1IBGL 1QR1B 1OP3H 3TC9A 1YN6B 4MDJA 1OP3K 1ZKAA 5F8QC 2HMIC 2CLRB 1KIPB 4QRUB 1CWVA 2KZWA 3MROA 3N06B 4XPBL 3G08B 4JFPA 2V5YA 3WHXA 4DOHE 3FQXA 5DUPH 5DJ6A 2X9WA 1MFAH 2Q7YA 1I8KA 1Q8MA 4X6DF 1JV5A 3HN3A 4ZQKB 3V2AR 4DCQA 4ODHL 2V9TA 4NRXA 4JFHD 2EYSA 3KJ4C 3U36A 2X05A 3RWEB 4MCYB 5LWYL 1A2YB 3BKML 6CGTA 3UJIH 1Z3GH 4JZNB 5IBUG 3UZVB 3GSXB 1HINH 3MOBL 4RMQA 1XR9B 3P0YL 3IFOB 1MCLA 1AGCB 1BZ7A 4NQCB 2Q1EA 4DEPC 4I9WD 5IESL 4HX1B 2DLIA 1HKLL 2YHGA 5I1EH 4YUEH 2J4WL 4K3DL 1NJ9A 4DK6A 3X11A 3MREB 1UJ3B 1WLHA 3F5WB 5F7YC 3ARBD 2V2XB 4X6DE 1T3FB 1OTSC 1X5JA 3UYRH 4Z7VB 3MV9E 4TRPH 2BVOB 1KN2H 2XTJC 5KVFH 4YBLC 3QH3B 4PGBA 3P11L 5ADPL 1W72B 2CDFA 4GAYB 1OP5K 3LKSA 3UTTE 4P3CL 1PSKH 1RZ7L 3ISWA 5EH1A 1BFVL 1DBAH 4AEHL 1A6TB 3BPOC 1XMWA 4QF1A 4V1DB 3RY4A 1T5XA 4LP4A 1FGNH 5I30H 4IMKC 1CFQA 2F19H 2B5IC 4PP1D 1JTPA 2KDGA 1N6QL 1O7VA 1RZKH 2W0FB 5HHQA 4I5BA 1FFPA 2FHBA 1J1PL 3WKNA 3QHTC 4ZXBC 2HTLD 3S3JA 1HIMH 3ES6A 4D8PA 4LCYA 3TT1H 2VDQH 2I07A 3MYJA 3HE6D 3I02B 3BESR 5F96H 3ROOB 3V6BR 3HUJB 2Y5EA 1T1XB 2ZPKH 3F7YA 4HIHA 5HI4D 2XOTA 3VWJC 1BZQK 2X1PA 5EU7C 3BO8A 3ME0A 3VXQB 2JK5B 4KRMB 4ZFGL 1U8QB 4M9PA 4NN5B 3V5DA 1R5VA 4F9LA 3T65B 2J2ZA 3RY6A 3GIZL 1FNGB 1B0GA 2NR6C 1WC7A 4QRQB 5JR1H 1QLFB 1MUJB 4XZUA 5D93B 4HDIA 3MLTA 2G2RA 4MMXC 5CHNA 3GSNA 1BD2E 5E7BA 3LQZA 3U9UB 4GW1B 4LCWD 3MRBB 4CGTA 1H15A 4P4KA 3WE6B 2XN9B 3FCTB 4HBCH 4OGYL 4YIQB 4NSKB 5DEGB 3KVQA 5KANG 3QWRD 3PHOA 2HKFL 4OCYL 4XP4H 4Z7QF 1EAPB 1QRND 4U1NA 2LE9A 4XVSH 2KQNA 4HK0A 3X12B 1ZHNB 3G5YB 5BRZA 2QTEA 1A9EB 1A47A 2QHRH 5IJVB 3ECBA 2R9HD 4GMTL 1YEJL 2D9QB 2GTWA 4W6XB 5ICYA 2X4PA 3IDYC 1YDPA 4KJWC 3TJEH 4Z8FH 3ARDA 4PRIB 3VI4F 4APQA 4D2NA 4BSJA 5EU7E 4KQ3H 4TUOB 4N0RA 2HFEB 5EO1B 1JTTA 4JVPA 1JZ6A 3EJJX 3L3IA 4LQ1A 3L95B 4XVUD 3K4AA 1IRAY 5AG8A 2J8UF 2YPKB 5CCKL 5JDSB 3LKNA 4QY8B 2JJVA 1DFBH 3PQYD 3TVMC 3WIHH 2R15A 1YPZF 1FFQA 3MRKA 2EC9T 4L5FL 5DJAB 5J1AB 1T1ZB 1FZKA 1GC1L 1K4CA 4NCDA 1ZLUH 3SDDD 2JJUA 1J1OL 5ALBH 1ZLUK 5KBNC 1KEGL 1RY7B 3VI4E 4G8EB 5AAMA 5FHAL 5F72S 1RZKC 4ZAKD 4QRPB 3WLBA 4E0RA 5HI3D 3P77A 3TZVA 2NY1B 3JTTA 3LSOA 4XMKH 3IXAB 2J8UE 5C08B 2IBZX 4FN0A 1QSFE 8CGTA 1AP2A 3MCG1 4JCLA 1YPZE 1HHHB 4P5KA 5F9WB 2A77L 1B3JA 1BJMA 1BHGA 1H3PH 2D31A 1I7RB 4PJCE 1ONQB 4JPKL 4L3AA 4I77H 4L8SB 3CAFA 2DWDA 2JELH 1NUNB 4KQ4H 1FJ1A 1C08B 4RWYH 3MGTB 1KELH 1QO3B 4UDTB 4X6CB 1SJHB 3I3EA 5CIPB 3VG0L 4NQDE 5IR1B 4U1LA 3JV4A 4EBQH 5IK3B 3O6FD 3LKOA 1ZHKB 3QCVL 3EFFB 3SCMA 4WI2A 4YHPA 5IROC 4KUZL 2YD3A 4DAGL 1IC5H 3VD9A 4YGAB 1HXMB 1O7SA 3OKKB 1U8LA 3R8QA 1NAKL 1ND0B 5C0JA 5IEHA 3UC0L 4HWBA 3BPLC 3L5JA 4K8RD 3SKOA 2IQ9H 5I8OL 4ENED 3NPSC 5I1KL 4K3JH 3DI3B 3HG1D 5JHDA 3BKJL 4P57A 2X4OB 3MJ7A 3MXWH 2AJZA 2B7DT 5C9JA 1AO7B 1RZGB 4Y1AB 1YECH 4HJJL 5DSCB 1ZGLB 2IQAB 4RFOH 1AQDB 1FC1A 2ZUQB 1FN4B 3D2UD 2A0LD 4J3XA 3QDGE 3BGFB 3NFNA 1TJHH 4ZTOH 2EKSB 4XPAL 5MI0B 5A2JH 5E6ZA 4MA8H 3BDYL 4OM0H 4EI6A 2CKBL 3OKMA 3FN0H 5IFJA 2DQDH 2NY6C 1C5BL 4LMQE 2J88H 4YDIL 1REIA 1ZK9A 2HVJA 5CUSH 3A6CL 4BUHA 4DN4L 5F9DC 1HHJA 1FFOB 2HMID 4KVCL 1JNNH 2E6PA 4PRBB 5KVDH 1AGBB 3T0BA 3QRFM 4P2OC 2OMBA 3MV9D 1KJMB 3FT4B 1XGQB 5HVGB 1QLEH 4MDJB 1OPGH 4GS7B 2NY4B 1F2QA 1NGQH 3QUYA 4MXVF 4O00A 1S9YA 4LOUC 1X3DA 4HV8A 3UTTD 1A9BA 4KZEH 3JTSA 5MP6L 4O2CA 2Y72A 4JFDA 4OZHE 4NN6C 2NY0C 3U0PB 3B9KC 4X7SL 4JVUA 3MROB 3DPBA 1U8OA 4JFPB 2Q8BH 4XCCL 1D5IL 3MACL 5C0NC 4GRLA 2XYCA 4ZFOL 3WHXB 3QUXA 3FQXB 3ROLA 5FGRA 5DJ6B 3QNYA 2CIIA 2Q7YB 1ZGLM 1I8KB 1AGFA 2LU4A 4QHUA 1JV5B 3MUHL 5BXFA 4DCQB 1TDQA 1IQWH 5F9JA 4NRXB 5I1GL 2AEQH 4QXTA 3BN9D 1CLYH 5SX4I 5A40E 3PV6A 2EIBA 2EYSB 3U36B 3WXVL 3T0VA 4KI5E 3LD8C 1GGUA 5D7SL 3QFJE 5I15H 2DM2A 3BGMA 1MHPH 4QHNA 4HCRL 1OTSD 5JW4R 5C0RL 4OGZA 2B39A 2XTJD 1BZ7B 5D8JL 3KS0J 3STBA 5IG7A 1B6DA 1II4E 1M7DA 5GZOC 1NJ9B 4I18A 3O6LH 3HAEG 4UOW0 3X11B 1G7HA 1JK8A 5DA0B 3BIAX 3T77A 2H1PH 1UA6L 5EWIL 4NZRL 2BFVH 4NBZB 1EO8H 1K9TA 1IKNA 1E6OL 3NFPA 4PGBB 3FFCA 1V7NH 5FGSA 3L5HA 9CGTA 2CDFB 3LKSB 1RUPH 3WFCL 4B0MM 3KPSA 3TGXA 1UFUA 4RX4A 4Q97A 5GISH 1F3DH 1CXEA 4QF1B 4ZXBD 1BOGA 2DDQH 1T5XB 3HKFA 4XNMA 2YA2A 2H6PA 3EUUA 2EDXA 1CFQB 2YA1A 3OPZL 4M8VA 2VUYA 3HNVH 5D7JA 4OLYH 2HVKA 4HH9A 4I0PC 5HHQB 1FDLH 4I5BB 3WJJA 1FFPB 2CIKA 4MWFA 4TN9A 2EC8A 2M26A 5HDLA 1L9NA 5E6IC 5HYSG 2YPLA 3U2SB 2DYPD 1JGLH 2B2XL 1KB5H 4D8PB 2XG5A 4LCYB 4QHMA 2I07B 2FEDC 3MYJB 3JBG7 1RIVL 4OV6F 3EDDA 2BHUA 4DWHA 1IGIH 4H0IA 2COQA 2NR6D 3F7YB 4HIHB 1QUNA 3MRIA 1S3KH 1WWAX 3S88H 3BO8B 4D9RE 1A1NA 5FHBH 5FDWA 4YE4L 1J5OH 1ZT4A 1Y0LA 4H26A 4PJ5E 5D1ZC 4LSPH 3V5DB 1R5VB 2R39A 3S35L 1KGCE 1YNLH 1FFNA 1B0GB 3W11C 2WV3A 5I17A 1WC7B 2GQHA 4XZUB 2IWGA 4HDIB 3MLTB 5ABDE 2G2RB 5DMKA 4GAGH 4B41A 4K07A 3GSNB 4JHWH 5CHNB 5F1OB 2P7TA 3QAZC 4LVNC 3T1FA 5MEPA 3LQZB 4JO1H 1H15B 4P4KB 1ACYH 3DGGA 1ZSDA 4N0YL 4KJWD 4ZOEA 2AW2A 1NC4D 3PHOB 4YC2C 3RX5A 3QG7H 4A6YH 3C6LA 4U1NB 4Q9CA 2UWEF 4HK0B 1KTDA 3JV6A 5BRZB 4LVHB 5ETUA 3LY6A 3ECBB 3VDCA 2GTWB 5ICYB 3VXTA 2X4PB 1YDPB 4D3CH 2QR0A 3ARDB 1ED3A 3GSQA 4APQB 2P5EA 3ZDZF 3TVMD 4KRLB 1C5DA 1T89C 3MLVH 2D7TH 5E94A 3L3IB 2XQBH 4MJ4A 4NQDD 2VLME 4JO4L 4U1HB 1KC5L 1ODAA 3OGCA 5L0QB 3E6HA 3OJMB 1IGYA 1NBZA 3LKNB 1ZEAH 1WISA 3BP4A 3N1FC 1NMCB 5DJ0A 1A14L 5FDYA 3WKMH 1MCOL 3MRKB 2UWEE 1LO3H 3IAQA 1K4CB 3LKQA 5HDBF 5E9DE 3RVUC 5JUEL 3MV8A 3A6OA 3VG9C 4CMMA 4OD1L 1UKQA 3MLXH 4CJ0A 2FJFA 2EH7L 1HQRA 3ZDZE 4M6NL 3WLBB 4E0RB 2HH0L 2PW2A 3P77B 3TZVB 3UTSB 2R0LH 4FMKA 1NFDA 3X3FH 3JTTB 3LSOB 4MNGE 4F7EA 1T21A 3MCLL 3D3VA 4KK9C 3BP5A 1F02I 5ADOL 4DJMA 1AP2B 5IVXF 5AWNH 3T0EC 2C9AA 2E27H 3QDGD 4P5KB 5DF0A 5GS2D 1UACH 3NZHL 2D31B 5IBUB 5KVEL 1DBMH 2DWDB 1FJ1B 3SDCA 1VEMA 4R26H 2Y6SC 5E24E 3EDJA 4XPHH 4U1LB 3JV4B 3LN5A 4JKKA 5KSBE 3LKOB 3RU8L 4MA1C 4PB9L 4XCNA 3SCMB 4YHPB 5T33L 4AJ0A 3DECA 4K9EL 3WFEL 4MD0A 3QULA 1U8LB 4NQEA 5C0JB 4N5EC 5IEHB 3GRWH 5IVXE 1W72L 5BOZG 3VXRA 1QQDB 4BZ1L 3SKOB 3BE1H 1FYTA 1WIUA 3GSRA 3LVEA 2RCSL 2R1XA 3MV7E 4Z7OF 5LVEA 3T0EE 4EN3C 3AS0A 5JHDB 1UYWL 4P57B 5E2VH 1E6JL 3MJ7B 1S7SA 2VL5A 5CINL 2AJZB 1EERB 2OZ4L 5C9JB 4G6AC 4NQSA 1OY3B 4F3FA 4M7JL 2FJHA 1MIMH 1PG7H 5HYSA 1RIUH 5GSVA 4JO2H 2FX8H 1GCFA 3OL2A 1XF5A 2NY6D 3NFNB 4FZ8H 2BK8A 4MJ6A 3BQUA 4UTBL 3KYAA 3MGAA 5EU3A 4EI6B 2QEJA 1ZTXH 3LS4H 2BRQA 3QFJD 4W4NA 3HI1A 4RFNC 3OKMB 4HPYH 1L7IH 4C56E 2B1AH 2Y07L 5IFJB 4R8WH 5IFAL 4P2OD 4Z7OE 2NQCA 1JMXA 2E6QA 2HVJB 3K1KC 1G7MA 1HHJB 1OARH 1E28A 3EZ8A 4G6KL 5DMIH 4LOUD 3ZDYF 4OZGF 1LO5A 2J6EH 4GLRH 3B9KD 4ELME 5DUML 3O3EA 1BFOA 4RISH 3UPCA 5C0ND 3UTOA 4AL8L 5I75B 1TTGA 5FKAA 1XF4A 4QKXB 4LF3B 2E9BA 3NIDF 3QUYB 1S9YB 3SO5A 1X9QA 4HV8B 1A9BB 3JTSB 3BWUC 4O2CB 4JFDB 1FGVH 2FSEA 1RUAH 1U8OB 1QKZL 1WIOA 4GRLB 3RUGF 3ULUL 3ROLB 1J1XL 1CICC 5GHWL 4KV5F 4NFDA 5EG6C 5ITFA 3QNYB 2CIIB 4HJGA 1AGFB 4H8WH 4HWUA 1OW0C 4QHUB 1RZJC 2GYSA 5BXFB 4PJ8C 3HE7A 1L7TL 5F9JB 3C6SA 3ZDYE 3ZL4L 3OJDA 4QXTB 1DSFH 4OZGE 3PV6B 1OD7A 3PDOA 3TYGL 1XEDA 1Z9LA 2PYFA 3JWOH 5CEYA 5FM4A 1HHIA 5E5RB 3BGMB 3OBAA 2W9LA 4QHNB 4GMSH 4XXDA 1GZPA 3NIDE 4MMZC 1WF5A 1K6QL 3ZO0A 3C60C 3QG6A 3SOBL 1EK3A 5IBLC 5AEAA 4U6HA 4D9RD 1RULH 3OAYH 5GS1C 2ADFH 4XNYL 3OAYK 2VLJE 1E4KA 1YQVH 4LPUA 4OLVL 4PJ5D 1F90H 5IG7B 1M7DB 3RUGE 1Z5LA 1KGCD 3MBEA 1F4WL 4MYWB 3AU1A 4RMVA 1SHMA 1G7HB 1JK8B 3T77B 1K8DA 25C8H 4H0GA 3C2AH 3GJEA 1WFNA 4FP8L 3C5ZB 3ORJA 3KYNA 4C59B 1X4YA 2DI7A 3ZYIA 3NFPB 3FFCB 4F33A 4JFZL 3W5MA 4I0PD 4MJIE 3KPSB 1SBSH 2WUCH 1BBDH 1DN0A 3HZMA 3EYFA 1KB5A 1INDL 1HHKA 5E6ID 4CVUA 4JKLA 4R4NC 4Y4FC 2MPAL 1TCMA 1BOGB 1SQ2N 1A1OA 1A7BA 4XNMB 1JHLH 2H6PB 5GRZA 1V7ML 1Q0XH 1F58H 1UGNA 3VGHA 2FEDD 3TBTA 5D5MF 5D7JB 2HVKB 4NHUA 4HH9B 2HA1A 3B4NA 2CIKB 3AC0A 4MWFB 1TQBC 2YPLB 3QQNA 4PD4J 3CUPA 2V7HA 4M03A 3DROA 3W0WD 5IHBA 4P5TC 4G80B 4LKCA 1PX4A 4QHMB 2NXYB 2CH8A 4L4TA 4UINL 1T4KA 1P6AB 5D1ZD 2VLMD 1CYGA 1QFOA 1EGJH 5F88A 4YFLF 3SO3B 3W11D 5J56B 3M8OL 1N7MH 3BD3A 2AK1L 3MRIB 3AMKA 1Z9OA 2HP4A 1A1NB 5EU6E 3EO0A 5FOBB 1ZT4B 2XZCH 1XIWC 1Y0LB 4H26B 3WFZA 1X4XA 1QFUL 1F4YL 1FFNB 5I17B 3EYSH 1MCKA 5E9DD 3SY0A 4LCCC 5SX5H 5FYKL 4OQTH 5SX5K 2WLYA 4LFHD 3ZKXB 5DMKB 4BFIA 1IC4L 4H8WC 2P7TB 2NY3B 5MEPB 3T1FB 1EBPA 3DGGB 2DMCA 1ZSDB 2HWZL 1LDPL 4R96A 2OP4L 1ZA6A 3C6LB 1IGMH 2E7MA 4G8IA 2GITA 4OD2A 3V4PL 1KTDB 3AGVA 3JWOC 3JV6B 5C07A 1Q9LA 5ETUB 2CRYA 4PRDA 5EU5A 5DK2A 4J4PC 1CDUA 3VXTB 4D94A 1RI8A 3R0NA 3EIFA 2QR0B 2ZUUA 1CS6A 2N56A 1ED3B 2P5EB 3Q6GL 1P7HL 2FBJL 5DMGC 1VA9A 2FH8A 3IS1X 1LE5A 5E7FA 5C71A 2WQRA 1C5DB 1EUTA 4Y8AA 5DVMA 1MI5B 5T3ZL 1NCBH 3DSFH 4OUOA 5CP3H 3O3DA 5E94B 3CDGA 2AERT 1JPSL 5GGRA 4OJFL 3KNBA 3OGCB 3S37L 1TLKA 2O61A 3RVUD 2JJSC 3LHPH 4NZDA 4P9HL 1UCTA 3E6HB 1IGYB 1NBZB 3NFSL 5DD3H 1MAKA 4YHNA 5TGBA 3BP4B 4JDTL 1F5WA 4M4RA 1TXKA 4M48L 5DJ0B 5BS0E 4MQTB 3T4YA 3WJLC 4D0DA 4XX1G 1AH1A 2R23A 3LKQB 1HYRC 5DVNA 4E41A 3S34L 3QJFA 3O4OB 3MV8B 3PWPA 3TN0C 4CMMB 4MXWH 4X6EA 5CLTA 3L9RA 2FJFB 2Z8WC 4KK9D 1MCIA 4M93C 1HQRB 4MAUH 3HMXH 2A6DA 3BKCH 3MV7D 3T0ED 2PW2B 3QIWC 4OGAD 3OR7A 1NFDB 3CXHK 4RGNC 4PJAF 4RMWA 4F7EB 4BQ9A 3JV5A 3B9DA 3P9MB 2I26N 5GSRA 1T21B 5IOPA 4IDLA 3OG4B 4ODSL 4L3EA 5J0BA 1A22B 3D3VB 4L9LC 5JOPD 3BP5B 3LS5L 1TZGL 4YO0A 1NCNA 2P4AB 1KTKE 2Y6SD 1PKQA 1BIIA 2DAVA 2OBGA 1SBBA 4I2XE 4K94C 1I3RA 1W0WA 1G9EA 5FM5O 4RZCA 5EPMA 1DJSA 4FQXA 3HI5H 2VZSA 1GOGA 1I9IL 4WV1A 1JRHL 2DI8A 3SDCB 3GRWA 4XP6L 2XZAH 2ICES 4LSDA 4PJ9A 2PYEA 1EBAA 5CILL 4C56D 5EBWA 3S37X 5T1KD 1MFEH 2FB4H 3D0VA 1OWWA 4X9HA 4ZMAT 4MGXA 4N5ED 5DFVD 5GRUH 1I1YA 3LN5B 2DQCH 2YRPA 3DHJA 5HHOE 4XCNB 3HAEB 2NY7L 4PJAE 4UAOB 2VXQL 4XPGL 4PB0L 4HFWA 4MD0B 3QULB 5D7KE 2VXUL 4NQEB 3ZE2F 4BK4A 3U0WL 3TH3T 3QPXH 4Z18A 4G6AD 3VXRB 3SE9L 1FYTB 4R2GC 4KDVA 4ESKA 2R1XB 2FDBP 1RSFA 2VKWA 4PRPA 3DRQA 4B7LA 5A43C 5IB2A 1S7SB 2ZCLL 1RFDH 2VL5B 3RNQA 3TNNA 4NQSB 4F3FB 1OM3H 2AQ2A 2FJHB 4GXUN 5HYSB 2YPVH 1UADC 4PYGA 5GSVB 4GOSA 1XF5B 1IC7L 4N68A 5JOFA 3F7QA 3DGCR 2R4SL 4MJ6B 3CDCA 3BQUB 2YWZA 2J6EA 5FUOH 3WFDL 5EU3B 3MFFA 5B3JF 4XNZC 1BPVA 3C09B 1C7SA 2IG2L 3HI1B 1NSNL 1F13A 1NEUA 1D9KC 4ZDHB 1RV6X 1GH7A 3KR3L 2EDEA 5F7UA 4UQ2A 2DS4A 5EBLA 3KLDA 2QV2A 4XP1H 1G7MB 5L2KA 2R4RH 1E28B 3N1MC 1RIHH 3U79A 1LO5B 3KYOA 3GSNL 3O3EB 1ORSA 2XY2A 1BFOB 4HH8A 1CQKA 1LP9A 1KF9B 5FKAB 1XF4B 1CICD 1N3NA 4K8RL 4YBQC 5IEKB 4LCWA 4HZLA 5AUMA 1MPAL 2DMBA 4ZO8A 4MJID 5K33A 5I1HH 3LPGA 2F53E 5B3JE 4PJ8D 2FSEB 4XBGA 1N64L 1P5VA 2A9NH 4DGYL 5EULV 3N85H 5HYEA 5L6YL 4MD4A 3W39A 2NLJA 5ITFB 3CVIH 3DJ9A 4HJGB 15C8H 5DJDA 3P4MA 3MUY1 3BAEH 5D70H 4M1CC 4WTWA 1P4BH 2DIAA 5DWUH 4JQIH 4ZTPL 5A3IC 3HE7B 4JGJA 3C60D 5T1LD 3C6SB 2YMXL 3OJDB 5BO1H 5IBLD 4IEFB 5EA0L 2VABA 1DBJL 2QSCH 2I9TA 3B6SA 4RMTA 1NCCH 4F57H 3PDOB 2PYFB 3GI8H 5MENA 2Z31A 1HHIB 1RURL 2Z4QA 3QR2A 3FO2A 4XXDB 1GZPB 3QXDA 1YEHH 3MNVA 3QG6B 1I75A 4PJ7F 3MLSH 3JWDH 4U6HB 1MQKH 1FNAA 5EU6D 4ISVA 1TTUA 1CDJA 1MF2H 1A3RL 2VZTA 1KIRA 1Z5LB 3MBEB 3AU1B 4U1JA 1K8DB 4Y4FD 3GJEB 5BV7B 1HSAA 2FZ3A 4HK3N 3C8HA 2YUWA 1G6RH 3WFBL 3NCMA 3KYNB 4G5ZH 4JANA 1OAUL 3IGAA 5DJZA 3S3SA 4F33B 1RU9L 4RGMC 4JRXE 4PJXE 3NACL 4EIGB 4I4WA 3KJ6H 3U7WH 3MUGA 1DN0B 3HZMB 4LVOB 3EYFB 1KB5B 4Z0XA 5IJKA 1HHKB 3LMJL 4G9DA 1TITA 1A1OB 4B7IA 4KRNA 4P5TD 4KTDL 4HS6A 2IJ0C 1EGJA 2J5LC 3T2QA 4PJ7E 2P5WE 3PGFH 3TBTB 5JW3H 4JZJC 1MOEA 1YYML 4NHUB 12E8H 3VH8G 4HIXH 1EFXD 5K9JH 3EHBC 3GMPA 5DD5L 5GS0H 2PR4H 3CUPB 2V7HB 4DN3H 4PS4L 3DROB 4H5SA 3ZSTA 1A3LL 1CU4L 4LKCB 1IM9D 4PGDA 1XIWD 4L4TB 1SY6H 4CUCA 1T4KB 3AY4A 3P4OA 1Q38A 5A2IH 5F88B 1KNOA 2DQJL 4HAGA 3D9AH 5C0CA 2AP2A 5F1IA 3RZCA 4XMLH 5BS0D 5CSZA 1EX0A 3EO0B 4HWBL 1FG9C 4ELKA 4TPRL 4LIQH 5E8PA 1AC6A 4S1SH 3QUMH 3SY0B 3V6OC 3BKYL 3BW9A 1B9ZA 4BFIB 2VDLH 3OMZA 4ZS7L 3MRQA 2CRIA 2DQUL 4KDTC 4FQ1H 5CGMA 1X7QA 3HG1A 1AY1L 4R96B 4CU8A 1LO0H 1ZA6B 4HMCA 1EJ6A 4G8IB 1QYGL 2JCCF 3MRPA 2GITB 2EH8H 4OD2B 3CFDA 5C07B 1Q9LB 1U8JA 3QHFL 3HI6H 3D2UA 1HSBA 4PRDB 4KKCD 2CLZA 5EU5B 4WFHE 5DK2B 4RRPG 3INUH 3ILQC 1NMBH 3JWDC 2YOCA 2R29H 3MJ9H 1JHTA 2R0KH 5DJXA 1S5HA 1LE5B 1EZVX 5GRXG 1AI1H 1OAKH 3O3DB 3CDGB 4LASH 5HHPA 1BVZA 4HXAH 3RTQC 5GGRB 4W81A 3KNBB 3TBYA 2O61B 1PQZA 3NCBB 1JI2A 5D7LA 3V6OE 4AEFA 5TE6H 3TN0D 1EO5A 5TGBB 4YHNB 5I8EA 4GQ9H 5TE4L 4M62H 1VGEL 2OL3H 4RWHA 4YXKL 2ARJQ 3T4YB 1MFAL 2EYRA 2JCCE 4D0DB 2WMPA 2R23B 4OI7A 4H20H 3QIWD 4WW1A 4MNQA 1IGJA 4NKIH 1F3DJ 4OTXL 5GRJL 1EHLL 4E41B 3QJFB 4RGND 2Z8SA 4YHKH 4NZTH 3PWPB 5KAQF 4WTZA 2EE2A 4I3RH 4X6EB 2P8PB 3L9RB 5FECA 4HKXA 1CTNA 4FTVD 2A6DB 2GK2A 2VERN 2APWA 1Z3GL 1QNZH 43CAA 2IH3B 1HINL 3OR7B 5GS0C 1X4ZA 5I6XB 4ZOBA 1Z2KA 3P0VL 4WEBL 5GSRB 5IOPB 4J3TA 1GXEA 4L3EB 5EIVA 4Y16C 4YO0B 4LSQH 5FYJH 2GY5A 1PKQB 1BIIB 5I8KH 5M94B 4GT7A 5I1EL 2P49B 2VDNH 5HHVH 5FF6A 1ZANH 1OLZA 4PV9A 1I3RB 4ZO7A 4BZYA 5GGUA 3SGEI 2IALA 1W0WB 4RZCB 5EPMB 4FQXB 4TRPL 4AH2A 1KN2L 2ZUWA 5KVFL 1FSKC 4WV1B 2RGSA 5ICXA 2HFGH 4WRLA 1WZLA 4GH7B 1XGPA 4XVTH 4PJ9B 2PYEB 1D5XA 4LQFH 3ZT7A 5GS3A 5EBWB 3O6KH 3D0VB 5EOTA 3WO3B 1OAXL 1DBAL 1I1YB 1HN1A 4EUPG 2C3VA 5JXAL 4PR5A 4R2GD 3RWDA 5L9DH 4IIQC 4XB8A 4HFWB 4E42A 3ARBB 3FMGL 4RAVA 1ERNA 4OIIL 4IRJC 1UWGL 2DJSA 2A83A 4IMKA 3UO1H 4JRYE 2F53D 3NA9H 3SDAC 4PRPB 3DRQB 5IB2B 2ZPKL 5GIRA 3RNQB 3TNNB 4ZXBA 3O6MH 5KS9F 1IE5A 3THMH 2FD6H 1TNMA 4LIQE 1FL3A 2ERJC 4KRPB 3SGDI 1EPFA 1Q94A 5DFWH 5I1IL 1D9KD 3VWJA 5JOFB 1KJ3H 5JR1L 4GAJL 3UBXA 4G9FD 4XC3H 4JQXC 3G9VA 3MFFB 2IADA 1NGPH 4Z7WF 2IANE 5TFSL 3WBDA 4MQXC 4HBCL 2XACC 3A67H 1MCJA 5IQ7H 1JUFA 4UQ2B 4XP4L 5EBLB 5T5FH 1MLCA 2GY7B 4XVSL 2J12B 5L2KB 4YBQD 3FT3A 1MVUA 5L8KB 3V4UH 5KS9E 3U4BH 4LBEA 5ALCH 4HXBH 2BJML 2UZIH 3KYOB 4CU7A 3CFEA 3TJEL 4PRAA 2P48B 4J12A 4Z8FL 1ORSB 2DM3A 4DQOH 1LP9B 1WZ1H 4HEPG 2A1WH 1IBGH 4KQ3L 1N3NB 1BBJA 3EZJB 4LCWB 3IFNH 4HZLB 5AUMB 4M1CD 3IB4A 4JRXD 3SDXF 5A3ID 5F97E 2YUVA 4Z7WE 4XBGB 4TULH 5IHLB 4XPBH 1NAMH 4MD4B 3W39B 3WIHL 4RRPA 2P5WD 2NLJB 3FQTA 4Q2ZA 3O4LE 3EYOA 5DJDB 1UXSA 3P4MB 4TTDC 2DRUA 1FL5A 2YD9A 2FATL 4N0CC 1UEMA 3DUSA 2IFFL 4PG9A 3EYUH 3TEUA 3WDJA 2Y5TA 2VB5A 3ILPA 1CR9H 3ARWA 5IVNA 2RAMA 2RHEA 1F97A 2VABB 3D18A 3B6SB 3MA9L 1JIBA 4MQ7A 3ESUF 4PJFF 2AI0L 5MENB 1H3XA 2Z31B 4YX2L 3MZTA 2Z4QB 2XPGA 3N0PB 3FO2B 3MOBH 3P0YH 2BNRE 2F8OA 3QXDB 5J11B 2IMNA 5I19H 3BH8A 3MNVB 5AZEH 2IAMA 4MD5A 3SDXE 1CD1A 1YEGH 5KZCB 4XMKL 2ENYA 4ISVB 4J3SA 4ODXA 3P3YA 1JNHA 1U6AL 5IESH 4NKOA 3KGRA 5JIPA 5FA3A 3V5KA 2VC2L 5JPNA 1U8HA 2J4WH 4U1JB 3TCLA 5DA4A 1QBLH 1H3PL 1HSAB 2FZ3B 4JANB 1BGXL 4OLUL 3EGSA 2JELL 3IGAB 3P11H 4KQ4L 5DJZB 1JGUH 1KELL 4DUXA 4I4WB 2ATPA 3BD5A 1SJVA 3EHBD 3MUGB 4Z0XB 3V0AC 5DJ8A 4EBQL 4G9DB 4OSUH 5J89A 1UEYA 2VLRE 3LRHA 4PY7A 4HS6B 4PJIA 4WFHD 5K59F 3WNNA 4LAQH 4L4VE 1U36A 4G3YH 4WEMB 4QTIH 1I8MA 4X6BA 5IROA 3VFSA 4NHCH 4H5SB 4PGDB 3EJZC 3MRCA 1G1YA 2OTPA 1NC2D 3P4OB 4NN7B 4K3JL 2GSGA 1KNOB 3S3PA 2ZOKA 2ZCKL 1CCZA 2ZG3A 5D7IF 3TJHC 3DXAD 5C0CB 4NWUH 5E6YA 3IYLW 3T2PA 5F1IB 2A6JA 3RZCB 1YECL 1R0AL 1FLTX 1QP1A 5CSZB 1JZ8A 5FKPA 4ELKB 4QGYA 4ZFGH 3MRFA 4PJEE 5E8PB 3QDMA 2KKQA 3LEYH 2OQJA 4OCRH 5K59E 5GRVL 1N6UA 3BW9B 1KT2A 4OFYD 2MJWA 3MRQB 4PJDF 4POUB 1F4HA 5DGRA 1X7QB 3HG1B 1KJ2H 3BJ91 4HW6A 3FN0L 5TJWK 1MCPH 1U2HA 2DQDL 1Q0YL 3T09A 1ZHLA 4G8GE 2J88L 3RL2A 1SEQH 4XTRD 3MRPB 4R97B 4OV5A 3CFDB 1T7XA 2AXFA 5D7IE 3BP7A 3P30H 1U8JB 1U93A 3D2UB 1HSBB 2FBOJ 4WI6A 2CLZB 3RTQD 1HXYB 1YEJH 1JNNL 4WHYH 5KVDL 2OL3A 2DD8H 2R69L 5DURD 3KPLA 1JHTB 4QOKA 1S5HB 4P46D 3PXJA 1OPGL 3MJ8A 4KZEL 5HHPB 2D7NA 4HD9A 3MRLA 3TBYB 2GJZA 4P2OA 1PQZB 5ESVA 4PJBE 5D7LB 1X5YA 5I0ZA 3K4DA 2Q8BL 5FM5M 5BVPH 1QHOA 5I8EB 2VN7A 2AEIT 2ZUVA 4EJ1C 2EYRB 4HULB 1F45A 4L5FH 4WW1B 4MNQB 1IGJB 2YD8A 4WWKC 3HTLX 4AIZA 3VU2A 5GS0D 4O02L 4CJ1A 1LDSA 3GK8L 2XY1A 2O93L 2BNQA 1JPFA 3I75A 3Q2CA 5FECB 2RFXA 4JRYD 4Y16D 4IRSC 4ZNEA 5I15L 43CAB 1MHPL 3KJ4B 1IVLA 4ZODA 4YNYA 2CRZA 1JZ5A 1GPOH 4X5XB 3ZTNL 2UYLA 4PJGF 1S7QA 5FF6B 5HI5C 3UJTH 5I0DA 2A77H 4PV9B 5E4IA 5GGUB 2H1PL 4WUUA 2IALB 3HZVA 4HWZA 5F6IC 5JA9A 5T1DL 4JCMA 4AH2B 2BFVL 3DV6A 4JPKH 2Q6WA 4NWTL 1Z9SA 2IAND 5ICXB 3BUTA 1HWHB 1XGPB 1D5XB 2DJUA 5CJ8A 1RUPL 2O5ZH 3OKYA 3VG0H 3IU4H 1O5DT 5EOTB 3VXSE 1F00I 3AUVA 4P2RA 2XTJB 4YBLB 1NKRA 2C3VB 1OGAA 3SKJH 4PR5B 3RWDB 4F7TA 4ONFL 4KUZH 4DAGH 2DMKA 4AG4L 3SDAD 4E42B 4OLYL 4U3HA 4RAVB 1FDLL 2YN3A 3BPOB 3V52H 4U7KA 4PJGE 2MQ0A 3WIFA 2BVPA 2UY6A 4P23C 2A83B 1JGLL 5HYFA 5DEFA 5I8OH 1KB5L 3ARZA 1JZ2A 5I1KH 3ZHLA 3DTXA 4ZXBB 2V2WA 1S3KL 3T2NH 4XNXH 3S88L 1OTTC 5FYKU 3VH8B 3O4LD 1KPRA 3VFOA 1FL3B 4MQXD 1Q94B 5E70A 4LSPL 4J1UA 3VWJB 3CFIC 2WBJC 1QSVA 5LJYH 3UBXB 1BVKA 1Z9MA 4Y7MA 5DHYA 4GAGL 2IADB 4JHWL 2UZYB 2G9HA 3ZTJG 1GC1C 4Y88A 4HLZH 1ACYL 2DQHL 1D7FA 5FM8A 4PJHA 5DRWA 3BVNA 1JUFB 1PY9A 1C5BH 2BOCA 3QG7L 1KIUA 4YDIH 1MLCB 2VDMH 4MHHG 1NBVL 3A6CH 1M6OA 5J12C 3FT3B 1MVUB 3HHRB 4Z6AT 1PEZA 1QZ1A 4NM8L 4LBEB 5KANI 4NC1C 4FQHA 1VFAA 3CXHJ 3CFEB 4PRAB 4D3CL 2PKDA 3TBWA 4XWGH 4L8DA 5DK3A 1P9MC 1N5YH 4M7ZB 2AK4A 2OMNA 1FPTH 1BBJB 4DKEL 3UYOD 3SQBA 4TTDD 3MLVL 3IDYB 4N0CD 5MP6H 2XQBL 1F4XL 4K23H 5IMKA 3VFTA 1VFOA 3NGBB 1ZVSA 3HZYA 2VLRD 3ALWA 1C1EH 1D5IH 1MWAA 3MACH 1ZEAL 4S2SA 4NM4H 5ENWA 3LDBC 3FQTB 4Q2ZB 3EYOB 1UXSB 1FL5B 3WKML 4L4VD 3DUSB 4PG9B 2K9UA 5CD5C 2Y5TB 3ILPB 2BHYA 2C3WA 2F15A 4LLQA 4PRHA 1LHZA 5GGVL 3WXVH 3D18B 4XXCC 2V9RA 1YY8A 2FO4A 3MLXL 4MQ7B 4Y5XA 1L4IA 4GUPA 5HDQL 2XPGB 2EXWC 5F89A 4KK8C 3WO4B 4HCRH 3BH8B 3QIBA 2IAMB 4MD5B 3X3FL 2MQCA 1CD1B 1PY4A 5C0RH 5F9AC 4ODXB 1JNHB 4OBSA 4NKOB 3C08L 3RIFF 5FA3B 2P24A 5JPNB 1U8HB 3IAPA 4LRNL 3ETBF 2E27L 2GJ6E 2R2HA 1Y18A 3TCLB 4OZIF 1UACL 3ZT6A 1UA6H 4LVEA 3TIDA 4NZRH 5LQBH 1FAIL 1DBML 3EGSB 1E6OH 5SWZE 3GMNA 2FX9H 4LPYA 3P0GB 2NZ9C 2ATPB 4XPHL 4Q9QH 4M5YL 1MJ7L 5DJ8B 4G8GD 2OCFD 1MH5A 5CBAA 1M71B 4PY7B 4L1HA 3EJZD 3S4SG 4DW2L 4PLNC 3OPZH 2IFGA 4PJIB 3P2TA 5TDOA 4X7DC 2ZG1A 3QRGH 3GRWL 4X9GA 5T3XL 1I8MB 2DJ4A 4X6BB 1GVIA 3VFSB 4OZIE 2B2XH 2WAHA 1ZLSH 4HJ0C 2X4RB 3MRCB 5J4MA 4ONHB 1DEEA 1MQ8A 3SGKA 4UIKL 2GSGB 2BDNH 3BPLB 5I9QC 2ZOKB 1X5GA 5E2VL 5IIEA 1NCDH 4KGLA 5DHVH 3T0XA 5IT2L 3ALXA 1KJ2A 2A6JB 4L8CA 1Q9KA 1HOCA 2IPUG 4PGEA 2W9EH 5FKPB 3NPSB 1HKFA 1RIUL 3MRFB 4EN3A 3QDMB 1J11A 2X70A 1IMHC 2OQJB 4JO2L 3H9SE 4RGOL 5EUOF 1WICA 2C4FT 5DRZA 1PKOA 3PP3H 2DBLL 3PP3K 2OK0L 5CJBA 1KT2B 5C3LD 1Q9WA 3QDJA 1HILA 3EJYC 4H0HB 1XGTA 4DZBB 1ZTXL 3DVIA 3LS4L 5IB1A 3VRIA 5GGTA 4HPYL 1L7IL 1WZKA 2B1AL 3O0RH 1A7OL 3CXDL 4PG2C 3V4VL 4R8WL 1ZHLB 3RL2B 4LKXA 2B8OT 4OV5B 3GFUA 5JIKA 5K9OA 2AXFB 3BP7B 1OARL 4NNXA 4RDQG 5DMIL 1U93B 1U3HC 2D3VA 2J6EL 2PNDA 1J0IA 2OL3B 3AFLA 4JDZA 3KPLB 4RISL 5B22A 4QOKB 3AB0C 3QDHA 8FABA 1AHWC 1SMAA 2ZSWA 5EUOE 4B5EA 3MJ8B 2Y25A 2AJXL 1CXHA 4K7PY 1MIEH 3CFKB 4WWKD 2FECL 3MRLB 1FGVL 1KC5H 2GJZB 4P2OB 3VXSD 5I66A 5ESVB 3NZ8A 4U0RB 4YHMH 3T2OA 1DEDA 2P46B 1PG7X 2VDPH 4IRSD 3I6LE 5INDA 2NY0B 3WHE0 1V3JA 3B9KB 5TH2A 4AIZB 3BJLA 4ODWA 1DSFL 2BNQB 5JUEH 1OTUC 3F7PC 1JPFB 4OD3L 5CEXA 3I75B 1DLFH 3MOQA 4WENB 3RQ3A 5IW6A 2ZG2A 2RFXB 5DMJB 2W60A 3RGHA 1OW0A 4NBXB 3EOAA 3KLHC 4PJ8A 1INEH 5HI5D 1RZ8A 3HFMH 2W38A 1WBZA 1ITBB 3TESA 3IKCA 4YNYB 3LD8B 1RULL 4TQEL 1CFTB 2ADFL 1MJUL 1T83C 3SDYL 1ADQA 5D2LA 1YQVL 5ADOH 3BZFA 5FCSH 2UYLB 1F90L 2NTFA 3KPRA 1S7QB 5CJOL 3ZE1E 1KCUH 2O26U 1ZAGA 4GG8A 4QHKJ 4YK4C 4WUUB 5IW1A 3HZVB 25C8L 1INQA 3NZHH 1KCSL 4F7MA 5KVEH 3DV6B 4MAYA 4N90E 2Y06L 2Q6WB 2EDFA 1YEKL 1VERA 3CZFA 4NO5A 1SBSL 2WUCL 4G6MH 2LTQC 3JZ7A 1BBDL 4KK6C 1I1FA 4P2RB 5F7DA 3RU8H 4P23D 1OGAB 2CLVA 1IQDA 4OLZH 3D87B 4F7TB 1Q0XL 4GG6F 1F58L 4PJ5B 3U4EB 2GEEA 3F65A 2VZ1A 1NBYA 3IFPA 2H2PD 1W72H 5C0GA 43C9A 3WIFB 2BVPB 1OTTD 3K81A 5K9KA 3W9DA 5DEFB 1A4JA 1F8TL 3S4SA 4JJ5A 1EGJL 1E6JH 3DTXB 3WV0A 2ORBH 1MRFL 2WBJD 1MJJA 1OB1A 5CINH 5F7EL 2V2WB 5FGBC 1ZHBA 2F54D 4P5TA 3K8KA 2EKJA 4M7JH 3HPJA 1KPRB 3VFOB 3QIUC 5GGVY 2XZCL 5GGRY 5I71C 2EC9U 2YD4A 1N4XH 4J1UB 4GG6E 3FN9A 1BVKB 3MCKA 2X4SA 3W0WB 4ZUTA 4OQTL 1NLDH 5DHYB 3GB7A 3L5XH 1W0YT 2EDQA 2G9HB 4YFDB 4N1CA 4AEEA 4Y5YA 3X14A 5C0IA 2Y07H 4M4PA 4PJHB 2W9DH 4O2EA 2XA8H 5DRWB 5IFAH 3BVNB 4O2FB 4YHZL 2BOCB 1CGYA 2VLKA 2PCPA 4LVNB 1M6OB 1LEKA 1CQYA 3DYMA 2DKUA 1IARB 5IKCA 3HR6A 4FQHB 1VFAB 1IGFL 4YC2B 2GJ6D 5KW9L 3VDBA 4L8DB 3G5XA 2CDGA 3HRZA 4LHUG 2AK4B 5D72L 3K4ZA 3HS0A 1K3ZA 1NCBL 1DE4A 3ARUA 4J4PA 4NO2A 3NCJH 2R0WL 1WIPA 1T66C 3VFTB 5IMKB 5CD5D 5ANMA 4TVPH 1IGCL 4NZJA 1ZVSB 3H7LA 5DD3L 5BW7A 1MWAB 2Y7QA 5ENWB 1J1XH 1XH3A 1BVLA 2VAAA 2YK1L 2EXWD 2VIRA 3UDWC 4KK8D 4Y2DA 2EZ0C 4R4BA 5EFIA 4FOMA 4PRHB 4LLQB 4P5MA 4MXWL 2JIXA 4K9EC 3QO0A 4WW2A 4LLUA 1YY8B 2FO4B 3FO0H 3WJLA 4KU1A 3AAZA 4Y5XB 3CFJA 4MAUL 1UVQA 4GUPB 2I5YL 3NABH 3OGOE 5F89B 2P45B 1P7QD 1YUHA 3TN0A 1K6QH 3QIBB 2E8ZA 3VG9B 4Z7VF 4ONOA 3MRMA 2EDYA 4FXKA 4XMPL 1ZE3C 4ODBD 3RFZC 4JREB 5DFTA 2P24B 2NZ9D 3H9SD 1I1AA 2R2HB 1Y18B 5HYQA 4HC1A 3IT8D 3TIDB 4L9LA 4OF3A 3S5LG 3VXUA 3HI5L 4FTVA 2APVA 4Y4HA 4TUJA 3GMNB 1OAQL 1EMTH 3QWOA 2XZAL 4NQCE 4JFZH 5F1KC 5SWSA 2VYRE 1DBKH 1A7QH 2DLGA 1FZMA 3SE4A 5FO8A 1PAMA 3ZKNC 1MFEL 4ZSOA 4ODTH 4P4RA 5GRUL 2FIKA 5JDJA 4JKMA 4OFPA 1MH5B 5CBAB 2DQCL 1FZOA 3I50H 3DIFA 3LB6C 3SEPA 4Z7VE 4R3SA 3SQOH 2E7BA 4HJ0D 4JRWA 3HUJF 3LQMA 5TDOB 1T03L 4EI5A 2Y9RT 3ZLQC 1R5IA 1JYVA 1JMZA 1PX3A 3PJSA 3QO1A 3EO9H 4XBEH 1LO4H 2CXGA 2G5RA 4PY8I 1FLRL 4V1DE 5JLZA 5D93C 2QSVA 4UINH 2A2QT 1DEEB 3CSBA 4KMTH 1P6FA 4WI8A 3C87A 4TSBL 4QCIA 5IIEB 1ZMYA 5FUCE 1JYWA 4UZGA 2DIJA 1KJ2B 4L8CB 1Q9KB 1OM3L 1HOCB 1WBXA 1BF2A 2FLBT 3EJYD 4PGEB 5ESAA 4EN3B 2UZXB 2YPVL 2X70B 1QFUH 3FKUS 1MCQA 5DRZB 1HYSC 3HUJE 5LCVH 3ULUC 4IDJL 2ITDA 5FUOL 5FV1L 4HGMA 1Q9WB 3QDJB 1HILB 3KPOA 2VISA 1XGTB 1U3HD 3VRIB 1MELA 5IB1B 3ULUF 1LDPH 4GBXA 1KENH 1GIGH 2OP4H 3U82B 1EEQA 4LKXB 2E5EA 4BK5A 3OKOA 5K9OB 1N5AA 2X9XA 2R4RL 4NNXB 5JIHA 1MY7A 1RIHL 3BRDA 5IFHH 1UM6H 2A6KA 2XN9E 1LEGA 4G9FA 3Q6GH 4JDZB 1JL8A 2FBJH 4I0CC 3CX2A 4C4KT 8FABB 2ZSWB 3HB3C 2FEEL 1CVSC 1GHFL 3RY5A 4N0UA 2DLTA 1G7PB 1G9ML 5DD6A 3MRNA 5I1HL 4TVPE 3OXSA 3SBWC 1CK0H 2IF7A 1U3YA 5I66B 4M7KL 3NZ8B 1FORH 3DUUA 4XCFH 2A9NL 4P9HH 3C8DA 3F8UB 3UROR 3ULUE 3N85L 1CT8A 1NL0H 2NY1C 4PRIE 5IHUH 3MLYH 4NKQB 4JDTH 2HTKC 3FRUA 5INDB 3KLHD 5E95B 1TVHA 4LHUA 5DWUL 4JQIL 3VWKA 5TH2B 1AGEA 2GAZA 3KWWA 2BC4A 3FB6A 4ERSH 5BO1L 4ODWB 2FR4A 5F9WC 2X10A 1CICB 1F6LL 5CEXB 5EO9A 4OGXL 5HSFA 5IW6B 5CLWA 2NPLX 4P59H 2ZUXA 2W60B 1A2YA 1GGCH 3I3BA 4U2YA 5D6DA 5EB9A 2YXFA 3IDXH 4PJ8B 4L8SC 3GBNL 3EW3B 3F7VA 5I1JH 1RZ8B 1WBZB 1YEHL 4LRIA 1A02N 4EKXA 3IKCB 1KCRH 2WZPD 3MLSL 2G60L 1MQKL 1TQCB 5ESQA 2GUOA 5D2LB 3WLWC 2X40A 4X6CF 3NN8A 4ZFFA 2NTFB 2YBRA 3EAKA 3KPRB 3PNWA 2FWOA 5T1LB 1UJ3A 4KK6D 4GG8B 4QRPE 3SGJA 5IW1B 4Q9RH 1INQB 4G43A 4J3VA 4F7MB 4WUKH 4F58L 2V5RA 1G6RL 4MAYB 3UAJC 1GAFL 1I9IH 4GSDL 4OCXH 3CZFB 3I2CL 4NO5B 5CILH 5C08E 4N9OB 2ED8A 3KJ6L 3ZHDA 1I1FB 1G9NH 5F7DB 2X89A 1Y6KR 3V8CA 1VEOA 2I27N 2CLVB 1IQDB 2NY7H 5FXCH 4BYHA 3PGFL 3TBSA 2VXQH 4WVRA 3S5LA 4RA3A 5D5MB 3ARFC 4HK3J 2ZUQC 4HIXL 4X6CE 5K9JL 5IGXL 1CGUA 2OSLA 3WUWG 3ARVA 4F9PC 4PBXA 3U0WH 1J12A 4QXUH 5C0GB 43C9B 2I60L 3VMPA 5F3HA 5K9KB 4DN3L 2Q3ZA 1A4JB 3QIUD 1KJVA 2WLZA 2VWEC 5MI0C 3UX9B 1VGKA 2GW5A 1T2QL 5IWLC 5ISZE 3HR5A 3S4SB 4JJ5B 2ZCLH 3PL6D 1MJJB 1OB1B 3PGDA 1ZHBB 1J0ZA 4P5TB 3HPJB 3MO1A 4XMLL 4G7YL 1IAMA 3RA7H 2NYYD 3RWFA 3FOMA 4P9HC 3QUML 1IC7H 1R24A 1WT5C 3E3QC 3MCKB 4F7CA 2X4SB 3CDFA 3GB7B 4YXHL 4P2QA 3LCYA 2VDLL 2FECI 5EBMA 1AO7E 5C8JA 4Y1AE 4K71B 3VA2C 1CD0A 4GS7C 2NY4C 4Y5YB 5A2KH 3X14B 5C0IB 2AVGA 4YIQA 4O2EB 3DXAA 1LO0L 2PCPB 2VLKB 4WCYH 3RX7A 4RFEA 3WEXA 4RQQA 5IMMA 1LEKB 3ZDXE 4KDTA 1S7TA 1GL4B 1WCQA 2VWEE 4AEIL 1FG2A 4KTYA 1J8HA 2ZWLT 5IKCB 1T66D 2F74A 3GSNH 3INUL 4TVSa 1NMBL 3ZMRA 3CVHA 3G5XB 2CDGB 3HRZB 4OFYA 5T3ZE 2G5BA 3S98A 4M5ZH 4E5XA 1OAKL 4Q6IA 4LLWA 3HS0B 1DE4B 3D6GA 4NO2B 1MPAH 4IBLT 4KROC 4NQCD 4V2CB 4PGZA 4HXAL 5CSGA 2EZ0D 2F58H 5ANMB 4NUJA 4KY1H 4N8VG 4DGYH 5TE6L 4ZPVA 2FGZA 3MJGX 2OL3L 1XH3B 1BFSA 1FHGA 1BVLB 4V2BA 4U6XA 3RTQA 2VAAB 2VIRB 4U1MA 5DJAA 4NRYA 4HUWA 4Y2DB 4NKIL 4R4BB 5EFIB 3D39A 2YMXH 4NO0A 4YHKL 4P5MB 4NZTL 5EA0H 1MCWW 4CN4A 1DBJH 2JIXB 3QO0B 4WW2B 2DF3A 4LLUB 5DT1H 2NX5A 3AAZB 3CFJB 1UVQB 3SE3A 2Z93A 4A2LA 1QNZL 2B20A 1W8NA 1CDHA 4ZUUA 1YUHB 2GI7A 1FNEA 3TN0B 3BPNC 3BPCA 3SDDC 2NY2B 3MRMB 1BAFL 4FABL 4FXKB 2P8MB 2WQ8A 5CKAA 1A3RH 2X41A 1JHKH 2ILLA 5FYJL 2ZUTA 4M7LL 5I8KL 2VDNL 5HHVL 3ZKND 4TYUA 1I1AB 3O2VH 4P0DA 4RGNB 7CGTA 3BWAA 5HYQB 4O5LH 4U6YA 2XA3A 4QNPF 1MCRA 4L9LB 3VXUB 1OQXA 4FTVB 4Y4HB 2BOBA 4ETYA 1OAUH 4TUJB 4FQ2H 3LN4A 3DO7A 3QWOB 5SWSB 5FO8B 1KEMH 4ZSOB 1DBBH 4P4RB 4NCC2 2FIKB 1EFQA 4BA8A 3QSKB 4YEFA 1I3VA 1FZOB 3DIFB 4HMEA 1T20A 1OAZH 1OLLA 4R3SB 5L9DL 1YNKH 5DVKA 3GSVA 4YDJA 1YYMH 4EI5B 1HXMA 2KH2B 3W2DL 5GJSL 2XN9D 1R5IB 5DD5H 3RY6C 3O6FC 3PJSB 3QO1B 4PS4H 4C55A 4Z76A 1A3LH 1CU4H 4DUWA 3UO1L 5JLZB 4QNPE 2AXGA 4Q6YA 2GT9A 3NA9L 1K2DA 4QCIB 3EYVA 4I13B 1HYSD 1XFPA 4IRJA 1WUNT 3O6ML 3ULUD 2EXYC 4K8RC 4PRID 4R2GB 5D96C 4KXZH 2FD6L 1WBXB 3Q6FA 1T0MB 1BOYA 5ESAB 4HWBH 2UVEA 3SDAA 2CSPA 4TPRH 4XPTH 4NOBA 3O11A 4LVHC 5MEOA 2YUZA 5T5NG 2DTMH 3CCHA 1N0LA 2K3TA 3DWTA 4U7SA 1VPOH 4EZMA 2JKXA 3ARDC 4TNWF 2ITDB 4APQC 3UTPE 4ZS7H 3KPOB 2NCMA 1NGPL 2DQUH 2VISB 4KK5C 3RJQB 4X83A 5T1MA 3MLZH 1AY1H 4XH2A 3GJFA 4GBXB 5J6GA 3A67L 5C0BA 3OKOB 4QRRA 1QYGH 2Z0BA 5T5FL 1N5AB 1EIBA 3HB3D 2MTPA 2ZJSL 5L0QC 2QHLA 3V4UL 2AKRA 3U4BL 1U3ZA 5ALCL 1V5JA 1NMCC 1RUQL 2UZIL 5EZOL 1LEGB 4G9FB 4WO4A 1ROWA 1CGWA 4DQOL 2NY1D 3BEVA 2HTKD 5DVLA 3IFNL 4NNPH 1KFAL 3L3OA 4N0UB 5DD6B 5E2UL 5BRZE 3MRNB 3OXSB 3ARQA 3U0PA 1U92B 2ESVA 4JFXA 4TULL 3DUUB 2KPNA 5I76A 4KMLB 1XR8A 5IV2A 2DLFL 2HT2C 5CJ5A 1CT8B 1NAML 5E1AA 5TE4H 1VGEH 3BZDA 2J8OA 1JGVH 4YXKH 3FRUB 4GKZB 4HKZB 3AVEA 1TVHB 2EDWA 1I85A 1S7RA 4LHUB 3OB8A 2MCG1 3VWKB 1U9KA 1I9JL 1AGEB 2GAZB 4OTXH 5GRJH 3KWWB 1EHLH 2BC4B 3FB6B 3EYUL 1CR9L 2FR4B 4M1GL 1A8JH 4NKDA 2C7UA 2BRRH 3N9GH 4FXGA 5EO9B 1P2CA 2JE8A 3WLWD 4R0LC 4M02A 3H8NA 1QFWI 1MWAL 3F7VB 4PJFA 5ISZD 3BZEA 3G6AA 1JPTL 5I19L 2JB5L 5AZEL 5HHXL 1GGTA 1YEGL 3V95A 4XCYA 3BN9C 3P0VH 4WEBH 2ICWA 5TF1H 3UAJD 5I1CH 4MA3A 5ESQB 2UY7A 2GUOB 3NN8B 3SCMC 4ZFFB 4RBPH 2YBRB 3WIIH 1IT9L 3PNWB 4NT6A 2FWOB 4RBPK 4S11A 5FYKD 1NDMA 3RWCA 2H3NA 4MZ2A 1QLRA 3OF6A 4G43B 1QBLL 1OOAA 3DV4A 3GM8A 3PABA 4WGVB 1DZBA 4KGJA 1AO7D 1DQLH 4O58H 1JGUL 1KUMA 4AIXA 3ARFD 1OAXH 3IDJA 4LU5H 1XCTA 3O9WA 4FFVC 4KHXL 4OSUL 5DI8A 3QP3A 5JXAH 2YD7A 4OFKA 3ZYJA 1ORQA 35C8L 3TBSB 3FQUA 4LAQL 1UH3A 3S5LB 3FMGH 2X4NA 1G7QA 4G3YL 2OSLB 4CDHA 4OIIH 4QTIL 4JHBA 5F3HB 1UWGH 5T3ZD 1A7RL 4M1DL 3U2SA 4NHCL 3V9FA 1DQDH 1KJVB 3T3PF 1IFHH 2W65B 1VGKB 5ACMA 3HR5B 4S1QH 4C57C 1RZIA 2D0FA 2VRAA 4PFEA 1FAKT 3PGDB 4NWUL 2J1KA 1CF8L 3UBXI 5B38A 2YSSA 3MO1B 3KPMA 4Q0XL 1R3IH 2V17L 2X9YA 5F7KC 4F15B 4TOYH 2VR9A 2W0PA 2NY4D 2VH5H 3LZFH 2OI9B 3LEYL 5I1IH 3RWFB 3FOMB 5DJYA 1M1SA 1R24B 2F5BH 4OCRL 4GAJH 4F7CB 4YLQT 5JHDE 3RBSA 2FEEI 4MB4A 4P2QB 4JFEA 4MLSA 4FFZH 5EBMB 1MCBA 5I75C 5C8JB 1MRDL 5TFSH 3OKEA 2BP3A 4PJDA 1KJ2L 4QXWA 4CNIA 3DXAB 1MCPL 3T3PE 4Y19A 2ATKA 1WBYA 4RFEB 1CGTA 1SEQL 2BSSA 32C2A 3WEXB 4RQQB 2EE6A 1ZXQA 5IMMB 2AV1A 1S7TB 3P30L 4EXPX 4KROD 4GRLC 4BQ6A 1FG2B 3QUXC 2BJMH 1J8HB 4LPXA 2BY2A 1FC2D 2F74B 1NKOA 2BNUA 2DD8L 1QSED 3CVHB 3MLRL 1TVBA 5GGTL 2HT4D 2G5BB 4E5XB 4Q6IB 4LLWB 2DQFA 2OJEA 4IRZL 5LGHH 3DO3A 1WCBA 5DVOA 4U1HA 4YPJA 4NUJB 5E00A 1YJDL 4ZPVB 3WL9A 1I9EA 5BVPL 1T6VN 5GXBB 2AJYL 4U6XB 2ZOLA 3Q1SH 3RTQB 2FATH 1Q72L 3SJVA 1URLA 1FBIL 2ICEA 4NRYB 4U1MB 4HUWB 2V9QA 4PJCF 2IFFH 1AKJA 3D39B 1BJ8A 4JFDE 4XAWL 4I18C 4OLXH 1ZT1A 4NO0B 1G84A 3MA9H 4UTAH 2NX5B 3JWNC 4A2MA 4NO3A 3U83A 4R7DA 2AI0H 2Z93B 3BYTA 1IKNC 4YX2H 5I73C 5LGJA 4ZUUB 3UTSA 4BZ2H 1FNEB 3BPCB 3GKWH 1MFNA 4PIRF 1N26A 1RZFH 5DK0B 4IRSA 4Q74A 3T0WA 1U6AH 1AXSA 1GPOL 5HYJA 2VC2H 3WMSA 3J7HA 3UJTL 3BWAB 5D7JC 1T22A 3GGWA 4U6YB 2VQ1A 4PYHA 3WJJC 4MA7L 4UOJA 1BGXH 2BOBB 2GTZA 3DMMA 4OLUH 2EIDA 3LN4B 2MWCA 3DO7B 2O5ZL 2WINB 4QHKI 2NXYC 1HEZA 3IU4L 3TYFA 1ADQL 1NUDA 2FIRT 1I8IA 2H2SC 3WDIA 2VSCA 3WNLA 2WWKO 2X4TA 3SKJL 1T20B 1P1ZA 2I25N 4LGPB 3GSVB 4YDJB 1BX2A 5B4MC 5C6TH 3FFCE 1DQMH 3MC0A 3QQ4A 4P4KD 3EO1A 3V52L 1T04A 3KPSE 2EXYD 4LNRB 4X4MA 1QQDA 1G0YR 2A6IA 3BIBX 4FHBD 4Z76B 5C1MB 2DKMA 5CJXA 4FRWA 1HCFX 2XKUA 1SEBA 2YD1A 2AXGB 3ZKXC 3R8BB 2GT9B 5DLML 1K2DB 2NY3C 3HAEH 3EYVB 3ARGA 4HUUA 2ZCKH 4IRJB 4TUKH 5E99H 3VXOA 4P23A 1LK2A 3ARDD 2EDOA 4HUKB 2NW2A 4APQD 3T2NL 4XNXL 2X1XR 3SKMA 3Q6FB 1A4KA 1R0AH 2CJUH 2YPLE 3WNKA 3C6LC 2GIYA 4KK5D 3SDAB 1O0VA 4JPWH 1OT2A 3O11B 5MEOB 1IL1A 1OL0A 3CCHB 4K3GA 3QJHA 2KBGA 5HGHA 5GRVK 3ULSB 4OZHF 4AT6A 2E7LA 3HNSH 1Z0NA 1CGXA 4POYA 1V05A 5T1MB 4XH2B 3GJFB 4ACPA 5J6GB 3K2MC 4NRZA 3NTCH 5C0BB 1Q0YH 2F54A 3MYZA 1OSZA 4JFFA 4QRRB 4EOWH 2XWBA 3ARYA 1MAML 1CXKA 2VDML 1LK3H 4KI5C 5IBTH 3H2WA 2AKRB 2X42A 2XFXA 4I48A 3DVNA 5FGCB 4L3CA 5F21B 1DUZA 2ARWA 3GO1H 1D5MA 4KI5F 2R69H 2IBBA 4J6RH 4XWGL 3TZVD 4WO4B 2HT2D 1N5YL 2VR5A 4PLKC 1IZJA 4Z5RA 1HE7A 1OD9A 1AXTH 4YXLH 3BEVB 3SKNA 4OZFG 1FPTL 3B3IA 3S96B 1VESA 1CD8A 4LF3A 1GRWA 3L3OB 4WY7L 4K23L 2ESVB 4JFXB 5I76B 6FABH 1XR8B 3VD4A 5IV2B 2C5DC 2X1OA 1IGTA 1C1EL 5E1AB 5IMOB 5C09A 2R0ZH 2P5EE 3C5SA 4HWEH 1B0RA 1J7VR 4NM4L 2E3VA 1X5XA 4RMRA 3KPNA 1S7RB 1MI5E 5DTFA 1IAIH 4H1LG 1NFDF 4O02H 3GK8H 2NTSP 1P84K 4NKDB 2C7UB 3OWEA 4FXGB 2V7NA 1P2CB