1XF4B

Structure of ligand-free fab dna-1 in space group p321 solved from crystals with perfect hemihedral twinning
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
213
Chain Sequence
QVKLLESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCVRGGYRPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Structural Plasticity of Heavy Chain Complementarity-determining Region 3 in Antibody-ssDNA Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fab light chain
total genus 37
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf4B02
4HQQL 3S37H 5JQHC 4U1HA 3TVMC 5FCUH 1O0VA 3RIFK 2G60H 3CLEL 3I3BA 5ESAB 3PQYD 3UTTE 2A74A 3WUWA 2XYCA 4I48B 4MB3A 1MI5D 3VGBA 4AY0A 3PHQA 4PJAF 2X4QA 4QTIH 4JFZH 3UPRB 1HK6A 5GGSB 4XTRC 3RY5A 5HI3D 4ZD3L 3B5GA 5J57B 1NUNB 4NQEB 3OJDB 5IEHB 1T1ZB 3RHWF 5MHSD 3KPNA 5CAYB 3RZWA 1SY6A 3AB0B 5J8OA 3O8XB 1P5UA 3SKMB 4XCFH 3SKUD 5BS0D 5A1AA 4O4YH 4V1DB 1CXFA 1EBPA 4XCCH 5B3JE 5J13B 2LAAA 3THML 1OD9A 4L3ED 1INEL 4OZHB 2M8XA 1DLFL 1UJ3C 2HTKD 1NH6A 5MEOB 4KJWC 5GSVA 1KJ2A 4JAMA 1JF1A 2NY6D 3ZLQC 4YDVA 3DUSA 4YHKL 1FFOA 1LQSR 1NGZB 4RFNB 3HUJA 2D9CA 1F4AA 1D9KC 1VB9A 4G6JH 2IQAB 3OV6A 3VGAB 3VFRB 1IM3B 3L7EA 1IEHA 1HN1A 5C08D 3UTPD 5CJOL 1CDHA 1D9KB 3V52L 3DX8A 1IFHL 4WI9A 4I0KA 4XX1E 2NX5A 2EIDA 4WFFD 4NN7B 2FX9L 5I1LA 5DT1H 5C07B 5HJ3B 1ZK9A 4GRMB 1IQDB 1LVEA 1U58A 4QEGA 3O8XD 1CDCA 2HT3C 4D3CL 3ARDB 2MHAB 3HPLA 1IZKA 4AIZA 4EIZC 5DMGD 4E41B 3MV7B 4J4PC 4UTAH 1BMGA 3LQZA 5F1IB 5A2IH 2WP3O 1MPAL 2PUQT 5C09E 2EH8H 3QDMD 3R06A 5JPMB 1A7RL 1FAIH 3PP4L 2CK2A 4PYHA 4WGWB 1MRFH 3DX6A 4Z77A 1CD8A 3B2VL 1YY9C 3RWCB 2R9HC 1DBAH 3SHSA 3ALXA 3BPOC 1VSCA 4Q97A 1VGEL 5L2KB 1P7HL 1NGWB 2NYYD 4HLZH 2DLHA 3U0PB 4R26H 5KAQG 4K2UH 4WUUE 5I8OH 5F89B 4XPFL 2P49B 4AL8H 4CN6A 3MRCB 3F5WA 4RZCB 5K59E 1MJJB 3O0RH 4HIEB 4PRHD 4BUGA 2VZSA 3QHFH 3RWIA 2XNAA 1K2DB 1UCBL 3ELAT 3QXDB 5DJCB 1BOGA 4I9WD 4QY8B 3OB0K 3PXJA 4X9IA 3U4EB 4NKMA 3OAYH 1RUKH 2VUOA 3RRQA 4MD4B 2QL1A 2FHFA 1MEXH 5F96H 2F74A 3X3FL 1E27B 1MCFA 4HT1H 4Y4FB 3VI4F 3IJHB 4DVBB 1ADQH 4LCIL 4OD1H 3L95A 2VXUH 2Y5TB 3EYVA 5DMIH 3GSQA 3KPPB 3I84A 4XVUC 2PXYB 4MJ5A 2L0DA 4QRUA 1JRHI 1S5IL 3RY4A 5I1GL 2X4SB 1P4BH 3NFNA 2ORBL 4KZDH 3UJJH 1X5JA 1F2QA 3KPRB 1NAML 2IG2H 2XZQH 1K5NA 2BSSB 1F4XH 1UG9A 3FRPA 4UAOC 3QPQD 4H26B 1CXLA 3QEQA 2MSPA 5BW7A 3WLBA 1HILB 1CDBA 3P4NA 2VLMD 4TTGA 5J89A 1ZAGA 1DUZA 2EC9T 1FZMA 2E7HA 4F2MB 4PG9A 4WU7B 2GK2A 3DNKA 1T7YA 3MODH 1QO3B 5JPNB 5HGDB 5E4IA 4KJPD 3CFBB 1AGEA 5JUEL 1D5MB 1U93B 2AJYH 4G6ML 1QLEH 3TBWA 2Z0BA 4QRTB 3WBDA 2G5RA 4LSQH 1W72H 2GUOA 5E2WL 2XQBH 2YPKA 3BQUC 3O2WH 5CBEB 5F3BB 1F13A 1J10A 2IH3A 1WT5A 5C0AB 4V1DA 4H0GA 4HUWA 1C1EL 1BQHG 4BZ2L 2FSEB 4G9FD 4JPKH 4KDWA 3BSZL 3TYGL 2HFTA 1F8TL 2RR3A 3C8HA 4NQCD 1X5GA 2VH5L 4RMUA 4JFOB 4Z5RA 4KK9D 3LQAL 4WUUB 4FQQB 1BZ9A 3LSOA 3UO1L 1IGJB 4NGHH 1CLYH 2F54E 4JDTH 1OVZA 5F7EH 4BFBD 5DMJB 2P5WD 4FFVC 3NIDE 2PCPA 2NMSA 4RRPG 5F3HB 5L88H 3H7BA 1JN6B 1HCFX 2QQQA 4KJYB 3TCXA 1Q38A 1CTOA 1U3JA 4QHMB 2HLAA 1YJDH 2AK4B 2NXZB 4WTWA 2YPLB 1FGNH 5I1CH 3OF6D 2ZP0T 3WNNA 4OD3H 4OLYL 3LDBB 1EFXB 2LQRA 4L4VE 5F1NB 1M4KA 4DTGL 1NCCH 2HVJA 5T1KB 1XGPA 1RQ5A 4C4KO 3ZTJH 4XBGB 4K7PH 4U1KB 5DQ9A 1U8PB 2J8UF 2YD2A 4TUOB 5F9AC 4I3RL 2X05A 2EDWA 4NBZB 2VDRH 4KKAC 2J1KA 1ZGLA 1MJ7L 4O51B 3VRJB 2JIXD 4PGBB 1FNLA 3MLWH 3AS0A 4LPTA 4MXWL 2NPLX 3OKOB 2BVUA 4XRCB 4DGVL 1ZKAA 5EBGA 5D6DC 4AIZB 1JZ4A 4LQ1A 3HMXL 4JFEA 4RCAA 4LAJH 2BXZA 4YAQB 5LXGH 5C7XL 1V7MH 3BO8A 3TO4D 3L9RA 4QGYA 1BX2B 4L3CA 4YDVB 5IKCA 2X7LB 3NCMA 1U36A 3CH8A 4JFEE 5IHLB 4L1HA 2Y06H 4YDJA 3U83A 7FABL 1KN4H 3BIAX 1VFOA 3HZKB 3CVHH 1V7NH 5HI5D 4L3EE 3OR6B 1G6RL 2XTJC 3MZTA 1XF3B 4KTDL 3VXTA 3IDNB 3BXNA 5IBUB 4UUJB 4UIKL 5DEGA 1I85C 5CGMA 5L0QC 1JGDA 4QOKB 3G6JF 1CD0A 3DOSA 4UIMB 1ZLVK 3D39E 3BZ4A 1GGYA 1S5HA 1NGXB 3L5XL 4KAQL 1YMMD 32C2A 2DBLL 4J8RB 4NN6C 1XF4A 3DIFA 4I18C 1WAAF 4Q6IB 5B22A 5FYKE 1PAMA 4L9DA 3ULVD 2VL4A 2WBJB 1SMAA 2V6HA 4RMWA 2NZ9C 2X2YA 3KNBB 2ZUUA 1XF5A 4PRIE 4XAKE 5I0ZA 2EYSB 4OFIA 3QUXB 2YC1B 3PJSA 1GOHA 3AMKA 3LKSA 5F1OB 4WEBH 4HC1A 3L3IB 1J05A 1LO2H 3QEHA 5BS0B 3VWJB 4DKFL 5KVEL 1OP5K 4KU1A 3MLUL 4Y2DD 4ZXBD 3TN0D 4PJ8D 1LK3L 2BOCB 3CUPA 3WJLC 3O0RL 2OQJB 4HPYL 5EFIA 3FOLB 4TTDD 4HSQA 5E1HB 1N5AB 1YY8B 3Q6FB 4LFHD 5FHAL 3CMGA 3WXVH 1WZLA 3FB7B 5BCAA 3SQOH 1KT2A 3PE9A 4R9HA 5D72H 3E2HC 1ZGLB 5K9OB 1M7IB 3GRWL 1CLZL 3QXUA 4R2GC 4TNWK 2WUBH 4D2NA 5CJ5A 4M7ZB 3GMRB 3WLWD 4FFWC 3DO3A 4FQIL 3H42L 3NH7L 4GS7B 3S35H 4KRMB 1G7IB 3KPOA 1NBYA 3HC0B 4WFHE 1OM3L 1BJ8A 1CBVH 2YXFA 4Y16B 1T1WB 2QQLH 5HGAA 3WFBH 4DGYH 1QBML 2MKWA 4HCRA 2BNRD 3C2SA 4OI7A 3HR5B 5E8EB 1VKXB 4GQ9L 4LP4A 2OZ4H 4PJ9B 1VHPA 1FNGB 3BX7C 5T5FL 4ZUVB 1KN2L 4FQCH 4TRPL 2VITA 4YNYB 3CZFB 4Y5YB 2X4NA 2IEPA 4UILL 5J1AA 3GMRA 5IBTL 4YXLL 2V2WA 2VL5A 4Z7QF 2VDPH 3VMPA 3TCLB 1VPOL 4X7CC 1MFEL 4WJ5A 1NEZG 5FM4A 4JG0H 4HF5L 2ESVE 3BP6B 2WWKT 4X98A 4RAVB 3DLQR 4G6MH 4PLJD 1IGFH 5SWZA 4RMRA 2GT9A 2IADA 1TZHA 2YA2A 1FC2D 5D1XD 1IEBA 4P57A 3C87A 3I50L 1FN4B 3PG2A 5B8CA 2YR3A 1RFDL 2EKSA 2AV1B 4XVTH 3TV3H 4OI8A 5T1LB 5JHDD 4WFGD 3ESUF 4X5XA 4OZ4A 3TZVD 5IB4B 3OHXA 4OSUH 3SGKC 1P4LB 4NZUH 2PW1B 2EIZA 5GS2D 1QHOA 5J1AB 4OCNC 3MXWH 4LRNL 3HHRB 1YEDA 1MCWM 5FIEA 1JI2A 1MAMH 2ZUVA 4DKEL 4P9ML 3VFRA 2OTWB 2ICWA 4Z7NE 3EO9H 4KJWD 2F19L 4DKAA 5CSBA 3RI5F 2QHLA 1RZFH 1T7VA 3T04D 3B8SA 3MV9B 3EYFB 2GTWA 1BWWA 1DQTA 1T03H 3TO4A 2GJ6B 1TJIH 3MMEA 5T1LA 4HD9A 3V8OA 2MPAH 4HJ0C 4DN3H 1K3IA 3GMNA 4G3YL 1IAMA 3QFJE 3RX7A 4ZS7L 4MX7A 3BD4A 3MGTA 2XTLA 4XHJD 1LEKB 1R5VB 3F7QA 1AE6L 3T4YB 3NACL 1T21B 4NN7C 4X9FA 3N0PB 5EUOA 3UBXG 1C5CH 3VGGA 3JWDL 4IOFC 5CSZB 3SGDI 5FYLE 1UM4L 1Q9LB 1IJ9A 2VDKH 4CU7A 3U7YL 2CLVA 2Q76B 2BY1A 3GMLA 3RGVC 3STZA 2E9BA 3TPUB 3REWA 4MXWH 1AO7D 5ITFA 1BFTA 1BPVA 3FMGL 1WCBA 1KCUH 5FOBA 4XNYH 3PL6B 3B9AA 4NZTH 3QCTH 3PWVA 2W9DH 2DBJA 2DMBA 5EG6C 4EXPX 4C56A 3OR7A 4WU5A 1W8NA 2E7LA 1KOAA 2E9JA 1IGJA 4P4RA 4HLJA 2V17L 4R4ND 2DWEA 2BVPB 1RZ7L 5HYQA 3HUJE 4MSWA 3IJYB 1YEIH 1WWBX 3BEWA 4J7RA 5EUOF 4NNPL 1CFSB 1I1FB 1MLBA 1I9EA 1LWRA 2MCPH 4JZJC 4KK5D 2K1MA 4MQXD 2HVKB 2YSSA 4Z8FH 4P5MB 4YXKL 1PJ9A 4UU9A 1IC4H 1G6RH 3FB6B 2W65A 3RA7L 5KTEL 5JO5A 1QRND 1SBBA 4KV5F 2UZIH 2UY6A 3IU3B 4PJIE 1UH4A 5INDA 1CE1L 5GS0H 1CICA 2X41A 4CVXA 2NY0C 2DL2A 1WJ3A 5FHBL 1HKLH 1GGBL 2GITA 4P2RA 5E6IB 3GRWA 3FOLA 1BJ1H 5IW3A 5AWNL 1HINH 1MOEA 3DO7A 1UB5A 1NGQH 2W60A 5AZ2H 1DQJA 1A1MB 3WIFB 2E7BA 5D5MB 2BZDA 2ZNWA 5C0AD 3JWOL 5FYJH 1DBJL 1NCAL 4Y2OA 5I8CA 3WV0A 4LSRL 4PGCA 2OL3A 1J5OL 4RMTA 2B8OT 1OCWH 3MLZL 3MNVB 3GBLA 4HDIA 4IMLB 3HE7C 1OD7A 4EUPA 4X4YA 1U3HB 2AP2A 4QXUH 5DHVH 2V5TA 3MRMA 2CDFA 2DLTA 3QWOA 1HHGB 3EJYD 3GMMA 3QIBD 2FCBA 1JPFA 1CG9B 3HE7D 2OCFD 3HS0B 3QIWD 5D7IA 4ORGA 4OCYL 1E28B 1H3PL 1S7WA 1J1PL 2FJGB 2KBGA 5GZOD 1JPTH 2PYED 3DGGB 1NL0L 1FAKT 3OL2A 4XPGH 3CLEH 2WV3A 4LSTH 2R1YB 4XPHL 3TVMB 1PYWA 1KEGH 3TH3T 1T1YB 3BWUC 1TVHB 3VFVA 1CDUA 5BMFL 1SQ2N 1JFQL 3AXLA 1N59A 1C8PA 5I71C 4MVBC 2PTTB 3EHBD 5I8KH 3RZCA 5HHNA 2APTA 3QDHA 5KSUA 4FFZL 1O7VA 2J4WL 3SY0B 4HS3A 5EU5A 4QHKJ 2FDBP 4NRYA 3MZGB 2NXYB 1DSFH 3OR7B 4HKBA 5TFSH 3MJ9H 2IBZY 43C9B 3QO1A 4IS6A 4XPTL 2IALA 3V7AG 4LKCB 2BXYA 1QFHA 1C7SA 4ZPVB 1L6ZA 4QWWD 2APWA 3NFSH 5JNYB 3GK8L 1JI1A 3T4AB 4D0CB 4HHAB 5HI4D 2NY2D 1N8ZA 1FE8L 1KIRA 3VE0B 2AJUH 3ZE0F 5E4EC 4C56B 2JB6A 3SPVB 2VAJA 2V7NA 3AY4A 3N9GL 4W6WB 4JFQB 1QR4A 4QXTA 5IMLA 3E2HB 3S4SG 1KIQA 5DVLA 1FJ1A 1F6FB 3L6FB 4RSVA 3NIFE 4AT6B 4KKLC 5ALCH 4IMKC 5T1KA 4DFIA 5D2LB 2IADB 2RFXA 5C0GB 1UWGL 3NPSC 1CXEA 4D0BA 1N0XL 5ISZE 1XEDA 3EYFA 3QUZC 5KG9B 1TCRA 5F7DA 2W9EL 5C08B 5HVHC 3N85L 4CU6A 1J8HE 4XNUL 2VDOH 3ARYA 4YEEA 4K3GA 1BWMA 4OGYH 4MXVF 4P48A 2HJKA 1VESA 1KELL 5EU6A 5GRUH 3VXOA 1DN2A 2Z9TA 4WTXA 3DGCR 3PNWA 1GGCL 4XGZB 5JA8B 2E27H 3O81A 5JZ7D 3ARDD 2EXWD 2AJ3B 4GXUN 3IDIB 4H1LA 4K8RL 5DQJA 3R8BB 3DX6B 4P2RD 4AQ1B 2FD6L 1UM6H 4LHJB 2AXFA 5D1XC 3W9EA 5HHOA 1BFVL 4JZOB 3SN6N 3SGKA 1S8DA 2GT9B 1KXTB 4R26L 1P84J 1U42A 1W72L 4NKDA 5F3BA 1BOYA 2VLRD 5E2UL 4UT6L 3E6FA 1RD6A 1WK0A 1A6ZA 5K9JH 1H3VA 1EGJA 3HS0A 1T1ZA 1RZKL 1WBYA 1X4XA 4RGNE 2BHUA 1JNHB 3GIVB 3RGHA 5KSAA 1PDKA 4HUXA 3BP4A 1H5BB 3QP3A 2FEDD 3MGTB 2X10A 1A4JB 3MTRA 3T2NL 3DMMC 4PJIF 1S9VB 4H0IA 1G7HB 4L29A 4HPOL 2JJTC 5C07A 1W0WA 5DO2D 1MFCL 5I8CB 2J5LC 1DQMH 2A9ML 4OZIA 4JY4A 4Q58C 1ACYL 1CF8L 3NOIA 2DQDL 3VXUD 4OF7A 1WZMA 1KPUB 3PABA 5KS9B 2CR6A 4WV1B 4FXGA 3MACL 2BNUB 2KQMA 1WBZB 4OQ1A 3HI5H 2FYYB 2X89A 5IHUL 3P73B 2I24N 4F37F 4CRPA 4NKIH 3FFDA 1GIGH 2QADD 2QSQA 3IF1B 4OGXL 4XC3H 3GSWA 4XCNA 2EDDA 1F6AA 5CCKH 3QR2A 1R3LA 2B0SH 3G5VA 3MO1B 4MJIE 1RUPL 3FRUA 1SEBB 4AZ8A 1R24A 4TNVF 1YJDC 3FQTB 4PJBF 4MMZC 3UTOA 3MUJA 4KVNL 1OL0A 3ARBC 4P46B 1IAIH 2IPUK 3FONA 1CXIA 1S7TB 5HHQB 3PWPA 3H9ZA 5EULV 5JQ6H 3CVIH 2BY3A 3MLVL 4AEIL 5C0JB 5DJ0A 4ZO6A 3FO9A 3K1DA 3OKNA 2C3HA 2R9HD 1NCAH 3PUCA 3CC5B 4BKLB 1ZLWK 2DM7A 2E9WA 2GIYA 4J4PD 1LNUA 2ITDA 3QNXA 1AR1D 4N8VG 1MHHA 4APQD 1YEJL 5GRVL 3G5ZB 2HN7B 2VH5H 1NSNL 3M1BA 4R2GD 1KJ3L 3ZKNC 4RQQB 5I6XB 1N5YH 3RTQA 4PJBA 4F7TA 3EDJA 3GKWL 3QUYC 1V5JA 2JLLA 3P0VL 5C0CB 3EOAB 2X4RA 4PBVC 4E5XB 5D71L 4RAUB 2ATKB 1I7ZB 5F1KC 1CIDA 2HFFB 3HNVL 5C0AE 1I9IH 3DV6B 4JN1H 3MV8D 2YD7A 1LO0L 1YEFH 3HE6C 1MCKA 1JFQH 4P5KB 1JYVA 2FJGA 1QBAA 4BQ8A 1A0QL 4G9DA 4KMTH 4PRBB 4ODUB 1YEKH 2ADJA 2VIRB 5IB5B 1CD9B 5JHLH 4MXQC 3D85B 5ESQB 4L1DA 3SOBL 2X1WL 3TM6A 3IXTB 1NMCB 2ZUSA 2D3VA 3QNZB 1QSZA 4XPBL 4LCYA 3IVKA 4PJDA 3CVHA 4BYHA 2EDEA 5EOQH 3WYRA 4J3WA 4M6MH 2W0PA 1GVIA 2GCYA 1OHQA 1MVFA 1EBAA 1LEGA 4KROD 3KS0H 1A22B 5T1MA 2A1WH 5CP3A 2JELH 1YC8A 1IE5A 4YBLC 5I1DB 3K2MC 1BX2A 4WWKA 4HQQH 2PO6D 1INDH 5LG1A 4JRYA 3VXSE 4HMEA 4XCNB 3S97C 4NRXB 4R7DA 3U36A 4IOIA 2QSCH 5D72L 3JBG7 4RFOL 1TXKA 4V1DE 4UQ2B 2AXGA 5TPWH 2WMPA 2BNUA 3VFUA 4BFIB 4H0HB 5KANG 1QQDA 3V5HA 5GXBB 4NQVB 2FNBA 2F8XC 1XT5A 3CFEB 1IARB 3VA6A 1HI6B 3BE1L 4ZOBA 5D1ZB 4HKJA 4F37K 5I17B 3MRDA 3ULVL 1ZT1B 4LSPH 1A14H 2IQ9L 1XCQB 3WFHA 4Y4KB 1G7MB 2Q7NA 3WDIA 4ODVL 1U91A 3NZHL 4XNUH 3RAJL 4QOKD 4PJ5D 5CGYD 4QYOB 1P1ZA 5IW1B 5FUCE 3LQAC 1AO7A 3CLFH 4OV6F 1Y18A 2GSIA 1FLTX 1CFVH 3KDMB 4ZFOL 4AK1A 1NAKL 3GGWA 4P2QB 12E8H 3T65B 2NNAA 2VDMH 5E9DA 4PJFB 4I77H 3VXOB 1VPOH 1P2CA 5ERWB 3UDWA 4FTVA 1BGXH 4EJ1C 3QHZH 4UQ3A 1W2KT 5CJOH 1BFVH 2NXZD 4K3DH 1IGFL 2QJDA 5I15L 4ZDHB 1D5IL 4IIQB 3V4UL 4WFED 1LO4H 2Z91B 1MCNA 4O5LH 4E9LA 5KVEH 3L3DA 3SCMC 4JPKL 3RUGA 2ESVA 4GQPH 1L7TL 3ULUL 1TJHH 4RNRB 4JRYE 1ULVA 4FXGB 4IOFD 1Y6KR 1JPGB 3BPCA 1CGYA 2W0LA 4J6RL 2BOBB 1CQKA 4QHUA 1H8NA 5C0BA 2CLRB 3E1F1 2X4SA 2NY3C 4OI9A 4LSSH 2UYLB 5AUMB 2FIRT 2YPLD 1FIGL 5JIHA 2OL3B 1JZ5A 2FBJL 3H9SA 3S35L 4RAHA 3VRIA 2PETA 3HUJB 5IVXB 2R4RH 1TETH 4JM2C 1Y6NR 3T0BA 2E7MA 2L7UA 1AIFA 3AB0C 5E00B 1NFDE 4JQVA 1TQCB 1S9XA 4MCZB 4YBQD 5DR5L 1IGCL 1OP5H 2BSTA 1RIUH 3EGSA 3IDGA 1N2RB 1I7ZA 4X9GA 2WSKA 1KCLA 2B0SL 2KUTA 1T5XA 2Q8BL 3BI9X 5FV2A 3MRHA 2DMCA 5F9WC 3ZE2E 4C59B 3SDYH 1KULA 4NT6B 3LS4H 4NQEA 4HF5H 4HXAL 1TVBA 1MHEB 1T3FA 2FHBA 1YPZA 5LGJB 4DZ8A 4HT1L 1MH5B 4BZ1L 4QTIL 2NR6D 4YGVB 4PRPA 3MRLA 1T4KB 4H25A 3MOQA 5J6GB 3EHBC 2EXYD 3NABH 5ITBH 4PGCB 5JW3L 2DKUA 4PJXB 2AS5M 4OQTA 3KPSD 4ODBD 1CXHA 4H8WL 4M5ZL 3S6CA 1JTOA 3L3GA 1F5WA 1R5WA 1U92B 2Z92B 3RDTB 1N5YL 1HNFA 3FQUB 1PGRB 1INEH 2VQUA 1XAUA 3SJVE 2OTPA 4UQ3B 4HWEL 1H15A 1UYWH 4ZQKA 1I7TA 3BGAA 1T1YA 5IB2A 3EYSL 4C54A 4RFNC 4OLUH 5E0QA 4I2XE 3ZKMC 5IM7A 2CQVA 4O2EB 5EUOB 3PDOA 4XNXH 4OM0L 5ALBL 4NDMB 2AK4A 1S78D 2PR4L 3DURB 4I4WA 3G9VA 3QUZA 4R0LB 1T5WA 4BSVA 2XQBL 1RZIA 4U05A 1DDHB 5JW4R 3N1MC 1U91B 5TQ0H 5GJSH 1QFUH 1LO2L 4MNQB 5ABDE 3BHBA 3VI3F 3C8KA 3CSYB 1F8TH 5DTFB 1WGOA 1WWAX 2P47B 1JF6A 1KB9K 4JDVB 1VERA 2DYPD 2X4OA 3HG1E 3QWRD 3VGFA 4K7FA 4GBXA 2P44B 5D7LE 2XG4A 1VFMA 2YN5A 3D18A 3ES6B 4M03A 2NY4C 4OLWH 1L9MA 3X11A 3VRJA 1YZZA 3AM8A 2V5RA 3QFJB 3IFNH 4X6CB 2DQCH 3W39A 4HAGA 4OB5L 5J3HD 2QSVA 1L7IH 4YUEL 1QOKA 2F53D 3HE6D 3H0TB 1KIPB 4LBEB 4HGWB 4JKLA 5HGHB 3D0LA 1N2RA 2BNQD 4PLKC 3ZMRA 2HFFA 3IRPX 3QFDB 5BV7C 2VISA 4U49A 1AQDB 4KI1A 3NIGF 4GRLC 3MFFB 1BD2D 3WO3B 4PJ8A 1INQA 1RHFA 3O2VH 3GSNB 2GTWB 2ZKHH 1X5XA 3JWNC 4DOHB 1G6VK 2YPLA 3RKPA 2X9YA 3NH7H 1IGTB 4TN9A 3DUUB 5E9DE 3L5IA 3QDGB 2CIKA 4XCFL 4K2UL 1MLCB 3RA7H 4ZTOL 3PP3K 4ZYKB 3R1GL 1FVCB 2F5AL 5D70L 4TUJB 3EYUH 4U1HB 3VDBA 4YLQT 3V4VL 5EIQA 1ZLVH 5FA3A 2VZUA 4KJQD 5C0BE 1NGYB 3STZB 5SV4A 1Y18B 2KKQA 1OP3H 1RHHB 2AK1L 5EOCJ 5IMOB 1X5KA 5DD5H 5C07D 3QUMH 2F54A 2D7OA 4PJDB 5HPOA 2H3NA 1T21A 1HSAA 1JGEA 2VDML 1MFEH 3UTZA 2D7PA 2WBJA 3MRNA 2ZCHH 3GB7B 1U8MA 4NQED 5EZJB 5K93A 1L9NA 4OBRA 2PTVA 5I1EH 4JANA 1HI6A 4JFDB 4U0RB 1R3JA 1U93A 4KKBC 2FX9H 3ZTNH 3QQ4B 4WO4A 1AY1H 1XH3A 3NIGE 3VRIB 3MJ9A 5I1GH 1J0IA 4PREA 2QEJA 5SWQA 4KRPB 4CKVX 1EFQA 4OGYL 3HRPA 4M62L 4Z7WA 1T20A 1PZ5B 2XA8L 5GRJH 4B41A 3MGOB 3H9HA 4HUNB 1JPTL 3MGAA 4X5WB 3D39A 2FRGP 5CJBA 5DEZA 4Y4HD 1NKOA 1FZKB 1IAOB 3CSBA 4Y16A 3ZDYE 5ADPH 1MRFL 4XBPA 2RCSL 4L4VD 3VI3E 1WZ1H 2VR9A 4LGSB 2BERA 3QDJE 5DVKA 4DAGH 2CUHA 2ED7A 5HHOE 5FCSH 1K4DB 2D7TH 3NPZB 2PN5A 5C2UB 1JCKA 1UEMA 5GS1A 4R4NC 2DJUA 3RVTC 1DR9A 1OAUL 4G3YH 3RVXD 4S1RL 3MLSH 3MLUH 3QXAA 4WJ5B 5K9JL 3F62A 4O02L 5IF0A 2ZSVA 1CR9H 3BDBA 4NO3A 1NCWH 3U1SL 4QHKI 4AT6A 3CUPB 2PXYD 1MLBB 3NTCL 4XNZB 1HIML 1NPUA 3ALWA 3K81A 1YMHB 5HD8D 2N56A 4FG6D 5AAMA 2F58L 2VDLH 3VXPA 1A6UL 1OT2A 4WW2B 5IBTH 1WFOA 2V7NB 4OLVH 4OZGF 5LWYL 4NHCL 2EC9U 1IKNA 4WHTB 4PRIB 1U95A 5AG8A 1FIEA 3QCUL 4Q9RL 2PYEB 1DBKH 4I0PA 3TBVA 2QSTA 3LS4L 2J88L 5EO1A 3WMSA 3QHTC 5EO0A 1KJVB 1UXSB 3DARA 4TTDC 1JWMB 3H6JA 2HJKB 4ONHB 2FX7H 5I75C 2XI9A 4UDTB 4TSBH 3CFKB 3T0EE 1FGNL 5E8DH 2DOCA 4NO3B 4NJAH 3DURA 5D5MA 2EECA 4N90E 5HVWA 1N6UA 3UJJL 1KLGB 2COQA 4GQ9H 4ELME 1BFOA 4F58L 5EH1A 2FX8L 4G8GD 4WWKD 5HGHA 3CJJA 5GRUL 4HIJA 3UBXI 4JRYD 4YC2C 4LFHG 5SWSB 3BZEA 1YQVL 4Y5VC 5C0CA 4X8XA 3VXSD 5IT2H 1OGAA 5J56B 1NCNA 2ENSA 5DXWA 1VA9A 4N5UA 2B5IB 1QHPA 1GGBH 5IR1B 1A6ZB 1KTDA 3UAJC 4JO3L 1MY7A 1JPST 3Q3GA 4BSJA 2JK5B 4PD4K 3VG9C 1S7XB 4CJ1A 2Z93A 4L8SC 3EZJB 3KPSE 3ARGC 4KROC 2E6JA 1B2WL 4KDTC 5D1ZD 2E9IA 1U8JB 2Q1EA 1PQZB 1IBGL 5FECB 4XMKL 2QQNH 1WTGT 1U3ZA 1YEJH 2QR0B 5HHQA 5ICZA 3LQAH 4X6BB 4OFPA 5GSVB 1E6OH 3PGCA 1J1XH 3S96A 4GUPB 1EFXD 4ONFL 5E2JA 1EHLH 1WFTA 1KJ2H 1HHJB 4WIQA 1KCVL 2DQCL 2R0ZH 1KIPA 1IGML 4LBEA 2BVTA 3RX5A 4KAQH 4MDJA 1JWUA 3ARXA 2F8VA 3X13B 2DTML 2I60H 1YC7A 4PGBA 3TPKA 1TZGL 3WNPA 4QRQB 5DJZB 4QRPB 4U7KA 3LZFL 3FB7A 3U9UA 3UTPE 5I18H 1S3KL 3UTSB 1F3DH 3L1OL 5KSBB 2ZKHL 3QFDA 1MFDH 5EBLB 5E1AB 4X7SH 3SGEH 1TCMA 1I7UA 4KKBD 2P5EE 5CJQH 1UVQA 3P3YA 4KVCL 4Z8FL 2P5EB 5CFHA 1GIGL 3V6ZB 5F8QC 4Q9CA 3E6HA 3VG0H 4NKOB 4JFXB 4K7FB 5F7KC 2JCCB 4PPTA 3OG6B 5I19L 1AJ7H 1KG0A 5FA3B 1WC7A 4GAFB 4JPWL 3HI6H 1CVRA 4AH2A 1CICD 3ARGA 1EO5A 4OKVA 4LEXL 1JZ6A 4D0DB 4DGVH 5ITFB 3MRQA 4Y5XC 4ISVA 3HG1A 1T6VN 3MV7E 4RFOH 4ALAL 4HWZB 2V5MA 5HHPB 2HLFD 3PQYB 1BLNA 5AZEL 5JOFA 3ULUC 4IBLT 1CGTA 3MLYH 1ZGLM 1BBDH 2D31A 4IIQA 4M3JA 1YPZE 2GJZB 4WNQB 4HK3J 2X9XA 2DIJA 1IT9L 3TZVB 3BRDA 1SMOA 5IW6A 4JM2B 3RNQB 3QDMA 3V6OC 3TVMA 1MHHB 2M26A 3N85H 5DRXB 3WLBB 2R56H 5GHWL 4OKVB 3C9NB 3SJVD 4UIKH 5A2LH 1OAXH 1G7LA 3FQWA 5CP3H 3I6GA 2H26B 5HD8C 4GAJL 1UQSB 3ARTA 5MEND 4M5YH 1BQLL 1A1NA 4K55A 4NQXA 4U3CA 2ZCLH 2NTFA 1UM6L 4EI5B 3ZE1F 3SOBH 4ZDHA 4NQDA 4Z5RB 2R23A 3LPFA 3F7YA 1KFAH 4JGJA 5CILL 1MCDA 4NC1C 2A6JA 1LO4L 1UZ8A 1RK0A 5H35B 1Z5LB 3LKOA 3WUWG 5T3XH 5ERWA 3EZ8A 4NO0D 2BX5A 1GXEA 4XCYB 4RWHA 3MXWL 3RTQB 3O45B 4PP2A 4EUPG 4WO4C 1EERB 1J1PH 3ROLB 2H9GA 3SBWA 2P42B 4DKEH 2KZ1B 1LD9A 4YHPB 4YK4B 5AD0B 1X5HA 5BMFH 5FO9B 5ISZB 3VDAA 2CXGA 4POZC 1D5BA 4N0UE 3ARGB 4TQEL 2CUIA 1U8JA 2DD8L 3BKYL 4JKMA 4KMLB 4P49A 4S1DC 4KTEL 5KVFH 4G8IB 4WHTA 3GMPA 5IUSA 5I30L 1Q0XH 5D1ZA 1OM3H 4PJ5E 1HKFA 2D03H 4OKDA 4ZXBB 1TETL 1ZLSH 3P4OB 4NJAL 3CAFA 4LCCB 4CMMB 3TFKC 1IEAB 1NAMB 2IBGA 2ZUWA 1JHTB 4P57B 2IH3B 2Y5TA 4GFTB 5C0AA 5C07E 4ZS6C 2Q3ZA 5GZOC 4MJIB 1MREL 5TDPA 3OQ3B 1GGCH 4XMLL 4X6BA 4U6HA 3BZFB 3D69B 1I85A 4OFVA 2HJFA 1WF5A 2DQTH 1AXTH 1HHGA 2LU7A 2A6IA 3UPAA 1MFBL 4LCWE 4IRJB 4J3VA 4QXGH 1OTUC 5D7SH 4OIIL 1AHWC 4U1MA 5DFTA 3C08L 1LO5B 2NY6B 4Q9QL 4UV7H 4UT9H 3UCRA 3RWIB 1EEUA 4EDXB 1N0XH 4OUUB 2J12B 3VCLB 3MRDB 1M71A 5EC1B 3BKJL 2V5YA 2FEEL 2YRLA 3O6KL 3TT3H 1RZKH 4U1GB 5M95B 3G6JA 4ZFGL 5BV7L 4BFIA 1I7UB 4X4ME 2FSEA 5EO9B 3VFOB 4TUKH 4LMQI 4NWUH 3GJFK 1KJ2L 4RGNB 4PJEF 4G5ZH 5FGCE 2A77L 3RVUC 3BFOA 4PJDE 5DA4A 3OJVC 5EUKB 1NLDH 4QRQA 1JPFB 5DJZA 4MNQD 3P30H 1TZGH 2R2EB 4JKWA 4XNMA 3UPRA 2C1OA 3ILQD 3H9SB 2P8PA 2MPAL 4NNYA 3SO3C 1ZHNB 3P9MB 2NXYD 3O6FA 3JWOH 3P40A 4Y4HA 5D1QD 5ID1A 4DN3L 3VGEA 4X6DA 4WVRA 2P48B 2NNAB 3P0YL 5TGBA 3NFPA 3ZYJA 4NWTH 5HY9B 3K46A 3FJTA 3DX9B 3VFSA 1JNJA 5T33H 5FECA 3BIKB 5IMKB 4OQTH 2EDNA 3L3JA 3MGOA 4U7MA 3FZUD 3KPQB 4JCMA 3U7YH 1A4KA 3GNMH 1LP9F 4PJEA 3MJ8B 3ARRA 1MFAL 4C56D 2W59A 4OZHA 3D39D 3OB0H 3ARFC 3HI6L 1JZ2A 2P5WA 3EFFB 4AJ0A 4CVZA 4CDHA 1MIEL 4TVPH 4XNMB 4WFFE 1ZSDA 2O5ZL 3SDYL 4CBPA 1V05A 1KEGL 1L4IA 3MREA 1ZANH 2CLZA 2NX5E 2A9MH 4NN5B 2A6DB 1JTTA 2XWJA 4RQQA 5AZEH 4C57C 2V17H 2V2WB 3MXVH 3HAEA 4G42A 2V7HA 2BNQE 4A6YH 4GRWE 5FYJD 5C70A 1HHJA 3NZ8A 4HJ0D 4LLMA 1YEHL 3EOBA 3GUTA 5F8RC 3H0TA 4P59L 1OF2A 3OGCB 3IDXH 3BD5A 2VXQL 1ETZB 4X4XB 1ORQA 3V5DA 3GI8H 2QADC 5I16A 1JHKH 3SKNB 5EBMA 4Y1AA 2OK0L 2B1AH 4JFXA 4YHZL 3NZHH 3RAJH 3VCLA 4Z7VE 1XCTB 3ZE0E 1HHKB 5IB5A 3CXHK 1A6PA 4B50A 3GJFA 1D5BB 2FWOA 4HKXB 1NCDH 5J12B 5CKGA 3RJQB 1YA5A 1RU9H 2LU4A 4HV8B 4LCYB 3IVKB 3GZKA 4G42B 2C1PB 4L9LB 4ONGH 4XH2B 4P9HL 4AM0A 3ROLA 3N06B 5JOPE 3DTXB 2X4PA 4KK8C 4PIRF 3B3IB 2GJ6E 4OIBA 3IFPA 3GSOB 2Y25A 2NY1D 1BM3L 4QHLB 3TIEB 4NM8L 4LGPB 3FB6A 4S1QL 8CGTA 4P23D 3PXHA 5JOEA 2AGJL 3KLSA 5CWSA 1IRAY 1SY6H 5IF0B 4JVWA 4Z0XA 2FWOB 1KENH 4HKXA 2YK1H 1RIVL 1Q72H 5DJ6B 3M8OL 4O2FA 5TF0A 4L3CB 1J11A 1DCLA 5BRZD 5IEKA 1U8KA 4OCYH 1CI5A 1OW0A 1A6VH 2H41A 2CSPA 4PV8A 4E42A 1PSKL 1JRHL 1KCSH 1I9IL 3ETBF 2XKUA 3LN4B 3MJ8A 5ESAA 3LPGA 4Q0XH 3G6AA 1R6VA 1LGVA 1SYSA 4GKSA 4RA0C 2XA3A 3EFDL 3SO3B 2LU3A 4I4WB 4R0LA 2FBJH 1EHAA 2ERJB 5LGHH 1GJIA 3HI1A 1N0LA 3X3GH 2D7TL 3BZ4B 4JVUA 3PWPB 5L8LB 1ZOXA 4YHIB 3S88H 1G9NL 3FL7A 4GW4B 5GIRA 1FYTE 3ILPA 1W0YT 2N1KA 1Z5LA 1KIUA 2CMRH 2EDRA 2E3VA 5EN2A 1CR9L 3O4LB 5EZOH 1XGUA 4JREC 1OTTD 2DQFA 4ODWA 3SDDD 2H32A 4M7KL 4L8BA 5MI0C 1F42A 4MAYB 3ARVA 3JWDC 3OKLA 3DETC 3T2OA 1WIUA 4HUMB 4J4PA 5LCVH 3IF1A 4M8VA 4KV5E 5A16B 3PGDB 1JNLH 4PTUA 3D0LB 1J0YA 3CSYA 5DTFA 4CMHB 4TVSa 1YUHB 5CBAB 2CUMA 1P2CB 4DUWA 4KHTL 3BIBX 4E0RB 3BEWB 1MFCH 5DFVD 1MJJA 5FDYA 2GSGB 3ZDXF 5I1AA 1V3LA 3MRJA 3GMPB 1RVFH 3QNYB 3WJJC 1HQ4A 3QPXL 4PS4L 1P4IL 5K33A 5E8OB 1AI1H 2YEZA 4ODUA 1GZPA 1LE9B 2EE3A 4ZS6D 4GMSH 4IJ3B 4PY7A 2FBOJ 4I5BB 2B2XL 4RBPH 5I1KL 2DYPB 2HTLC 3PWPD 4BQ6A 1ZT4A 2G5BA 1CYGA 3BN9D 2NY4B 4XVSH 4LLDA 1P7QA 5E6IA 1KNOB 5EO9A 1S78C 3NA4A 4LNRB 2CDEB 1EX0A 2F15A 4UINH 2CLZB 1WBYB 4PJCE 4YXHH 1JBJA 3IFPB 5F9DC 5JOFB 4K8RH 3D18B 3ES6A 2WWMD 5FFLA 2HFEA 1QLFB 5KVMC 5D2LA 1OAYL 4IM8A 4NCC1 1LDPH 2YUWA 2P5WB 3EFFA 1FO0H 3O11A 4JN2A 3WNKA 5FXCH 3U0WH 5L7XL 3TA3D 4HGWA 2F9BT 4HJJH 4H26A 3DV4A 1MCBA 4U6XB 5GSRA 2FLRT 4N0UA 4LCUB 5KZCB 2CDFB 3D3VE 1WZKA 4FHBD 4MA7H 3RDTD 4YFEA 2ITCB 1K8IA 1JYXA 4YO0A 1G6RA 1YNKH 3FO2B 2IBZX 5FGCB 4WCYH 1CGUA 4QRRA 1FHGA 4UTBL 3VD3A 5SWQB 3ZKQD 1OF2B 1G9MH 1EJOH 3OGCA 4IHOA 3B9VA 3QNZA 4HKZA 2XWTB 3WFHB 3S3JA 3GNML 1I8LC 1XIWB 2FJHB 2YPKB 1UENA 3TIDB 3QCVL 3VWKB 2ARJQ 5LWYH 2EXWC 1DQJB 3G04B 3ARWA 4LSSL 4HS3B 4M1GL 1F4WL 3HRZB 1PW3A 5IVZA 4R97B 1JPSH 1ZA6B 2GITB 1I1AB 4EQ3A 4JFZL 4Y4FA 2A6JB 4GH7B 1YEKL 4IOIB 1KPRA 1MCPH 1NUGA 3MOBH 3NABL 2BSED 1P69B 2AEWA 4FTVB 3P4NB 3DHJA 1CL7H 2OXHA 4PLNC 1WVZA 1RAMA 5F89A 2D7QA 2GFBA 4DUXA 4H8WH 3V6ZA 3WFCL 2EO1A 5JPNA 3W5NA 3NA9H 4HS6A 1AKJB 5ILTH 3T3MF 1T0PB 4QF1A 4P5TA 1AD9A 3EYUL 2IGFH 3DYMA 2OP4L 3DROA 2WW8A 1HILA 4F7CA 3ARFB 1ORSB 4PREB 1N4XL 4H88H 1BVLA 3EOTL 1ZA6A 3O9WD 1I1AC 4AIOA 4YBQC 2X4TA 5DEFA 2OR7A 3IDYB 2V2XA 1M7DA 2BOBA 4NRYB 1NBYB 3HC0A 4X6CF 3PQYA 1E4XH 3RL1A 1OAKH 3GHEH 2IFFH 4NOBA 3IAQA 3S36L 3QQ3B 3FQXB 3UYRH 1N7MH 4RX4A 5C0EA 3F6IA 3IGAB 5EORL 2NW2B 2XICA 1F6AB 2FEEI 1QBLL 4M3KB 1FV1B 3NCJL 1FNEA 3TESA 5CUSL 2QR0A 2LFGA 3QWRA 5HHMD 3U7AA 1I75A 3U82B 3WXWH 4WU5B 3QDGD 5AYQA 3RWDB 2EDTA 4HWBA 1MCJA 5D93C 2XA8H 5FUCC 3JWOC 3DVGB 4KK8D 3KLHC 1YN6B 1OTSD 3OXRA 4U6YA 1VCAA 5AD0A 1XR9A 2CIKB 1CFNA 4OT1L 2DWDB 3QIWC 3KYAA 3Q3GB 3O2VL 5DJDB 4NKOA 4N0UB 1X6NA 3IS0X 1MCWW 1WZ1L 2Z91A 1M6OA 4PY8J 1BP3B 3HE6B 4O51A 4YQXH 4E0RA 4K3DL 3A6BL 1UC6A 4IJ3C 4LNVA 2ICWJ 5TQ0L 2EDLA 4PJ8C 3KXFE 4G8EB 3Q2CA 3V4UH 1KYOJ 2O5YL 4OAWB 4UV4H 1CCZA 4JM4H 1JF1B 3RUGF 3CMOH 5DD6A 4PB9H 5HI4C 5D4QA 1RULH 4J2XA 4RBPK 4DWHA 5HVGB 1N3NB 4AG4L 4V2CB 2D4FA 2SEBB 1QA9A 5KBNC 5TE6L 4MD0A 4W6XB 4XPAH 2G2RA 2QKIA 3R8QA 5EPMB 1HXYA 4PJ9A 4OZFB 1SEQL 1JYWA 4KHTH 2R0LH 4KJPC 1OY3B 2J88H 3MRBB 1C08B 5TGBB 4UZGA 1KTDB 4IRZL 5CLWA 3MBED 4U4BA 5CMAA 5TH2B 1XFPA 1G7IA 5DJAA 2YPVL 5I0DA 3W0WD 3V79C 3ULVF 4LSPL 1DVFC 3S37X 3RNQA 5HHXH 4G7VL 4KROB 3DBXA 3WKMH 4FOMA 3REWB 2EIZB 3KPSB 5KSAC 3STBA 1TCRB 5F7DB 2C3WA 2OR8A 3E3QC 2ZOKA 3KJ4B 1XF2A 2EIBA 2PO6C 3VXNA 3HI1B 3K7UA 2VSCA 1JGVH 1HOCB 5CEZL 1I8IB 1FG9C 1AFVL 1DANT 3RTQC 1BQLH 1XGPB 3AS2A 3WN5B 2ICWB 3PV6B 5JXEA 1A1NB 4ZMAT 3ZSSA 4CGTA 4YHMH 5EZIH 4ZAKA 1KG0B 2YPLE 4YFDB 5I73B 1EMTH 2C5DC 1PLGH 3Q6FA 1REIA 5I16B 5D7LD 1VEMA 5GSRB 1FRGL 1V3JA 4WW2A 4NKQB 4DEPC 1IGIL 5CINL 5HI3C 4PRBA 1C16A 1AP2A 3QQ9C 3LMJH 3I3EA 4TYUA 1IBGH 1YUHA 5CBAA 3WIHA 2HMIC 3WUWB 1HHHA 3PDGA 1X5FA 5IIEB 3OZ9H 3RL2B 3MRFB 4MB5A 2CLVB 2Q76A 3GMLB 5BO1L 4LLUA 5EWIH 2I9LB 4QT5A 3VD5A 3FT2B 1S7TA 3DUHA 3GIZH 5CSZA 1QSEA 4HWEH 1DE4B 4XP5L 4XI5C 1EH9A 3I6KA 3KPMB 3FQXA 1NUFA 2G5BB 3VFTA 1JHTA 3HKFA 1GGIH 4N1EA 5CLTA 3WEXA 4XCEA 5DD3H 4NRXA 4P2YA 2ITDB 5CJXC 1JWMA 5C0RL 3MMEB 5FM8A 2QQKH 4ETYA 1A1OB 1JNNH 5D7JC 4UIMA 1M7DB 4Y19B 3VFMA 3AMLA 2UV3A 3LKNA 4LPVA 1CICC 3FT4A 4B5EA 5D2LE 4H1LB 4N0CC 3RPKA 2VL5B 5CIPH 4O02H 5CJQL 4KZDL 5IESH 1RJLB 2X1OA 3C60A 1H3GA 2HKFL 1H8SA 3DVGA 1LNUB 4OCWH 4R90L 3X17A 4WHYH 4Y89A 4D9RD 4HBCL 4LLQA 2IGFL 3T8XA 2Q8BH 2NQCA 4NP4L 3VXSA 5DUBA 3D87B 3VWJA 1N4XH 4POZD 4LEOB 1DBML 2ADIB 4N9GB 4XWOC 3QCUH 3KJ6H 3M17B 1A3RL 4ZO8A 1GZQA 1TVDA 3P4MB 3UTQA 1FFPA 3ARBD 3LEVL 4X7TA 1V7ML 2D9QB 5SWZB 3MBXL 3SKMA 5A3IC 1SBSL 1VACA 2ED9A 4ODSL 4X6DE 3MCKB 3P4LA 1A8JH 4U1NA 3TO2B 5E5MA 3G04A 2J8HA 3I02B 2G75B 3QG6B 1MAKA 4TPRH 3O2DL 1OB1B 4UB0L 1CGSL 1NCUA 3FTGB 1JHKL 3MRMB 1OSPL 1FNGA 2H3NB 2DI7A 1YQVH 4E41D 1H0DB 1PKQA 3QEQE 5TDNA 2IQAA 4K71C 4RMVA 1A6WL 4B7IA 2KQNA 5DQDL 2AK1H 4MB4A 1CE6B 1QBBA 2A6IB 1JYNA 5DK2B 3ZT7A 2GFBB 3P30L 5ICYB 5IMMA 1HWHB 3TO2A 5I73C 5LBSL 2I9TA 3LEYH 3B6SB 1ZHNA 3DV6A 3P9MA 2HJLA 1I1RA 4S1DD 4MQTB 1NBZB 1IFHH 5F1NA 3QDGE 3VXUE 4ZUTA 1QFWM 1DVFD 2EYTB 2V2XB 4I3SH 4RMSA 4HUUA 5HHPA 1J1XL 2P8MB 3G08B 1MJ7H 4HK0A 3Q5YA 1OTSC 1BVZA 2BHYA 3BYYA 5JNYA 3C6SB 3KPLA 4F80A 1YMMA 2CKBA 3C2AL 5E08L 5IHZB 1MIEH 1TMCB 4D0DA 2VZVA 1A64A 4MJID 1MJUH 5F7MC 4CU8A 4XBEL 2BSSA 1QKZH 3MRIA 1BAFL 3BZDA 4LCWD 2VLKB 3BOVA 3Q5OA 4XXCA 4BSVB 1LMKA 4LASH 1KIRB 5DJDA 1DUYB 1MCOH 4PJ7B 4WUUA 4F2MA 3EFDH 4R96A 3MLYL 4P3CH 2KDGA 2FJFB 4JE4B 4PTTB 5CZKA 3OXSA 4J3XA 1U2CA 3QPQC 4YHLH 3WE6A 3MRKB 3V0VB 3I9GH 2WBKA 4WW2F 1H3TA 4WY7H 5CGYC 1OAUH 1VFAB 3V7AE 2R56L 4I0PD 3H2WA 4JFDA 4JEGB 2DIAA 1CGXA 1UGNA 4U1NB 1NAMH 2IG2L 2XZQL 1GGTA 2H32B 2Z8RA 4EQ2A 5KG9A 4GAGH 3ABZA 4I2XB 1GAFH 1AKJD 3FFCA 3QUML 5I1JH 3MRFA 2VO5A 1FYTB 3VFGL 3UZVB 2H8PA 2HVJB 4ONGL 5C0BD 3SJVB 4GXUM 3QEQB 3LRSA 3HMWL 4U1LB 5D1XB 2PCPB 4P46D 1ZLUH 3O3AB 5BOPA 3GEWB 2WZPD 1CE6A 3IT8D 2FIKA 2H6PA 5C6WH 3LKSB 3B83A 3O9WA 5FF6A 5I71B 3OBAA 2HLAB 3T08A 3BISA 5SX4H 4U1GC 3G5YB 4N8VB 3Q1SL 3UTTB 3RWEA 2R69L 4JM2A 4FABL 4YO0B 3LKOB 2XN9B 3VXRB 4YDLB 5C1MB 3DWTA 5E7BA 3OX8B 1H3WM 4NC2B 1HYRC 2YOCA 5DHYA 4O2CB 4O2FB 2B1HL 4XVSL 1LE5A 4HIXH 5E7FA 2UUDK 3EDEA 3KJ4C 2H32H 4JKPH 1SHMA 5D7IB 5D7LB 5FYLD 4ZG1A 2EH7L 1MF2L 5ANMB 1PSKH 4K23H 3W9DB 2R0WL 1WICA 2XZAH 4JO4L 4PV9A 1U8MB 4KGJA 5KN5B 4X7TB 1RZKC 3OWEA 2A77H 3L5WB 4HJGB 4OCXL 5I66B 4X9HA 3BKYH 5CBEA 4HUKB 1A02N 1JV5A 4HAFA 4U6VH 2Y9RT 5JW5B 4AMKL 3OKMA 3GSOA 1MRCL 3FN0L 5J6HB 4X99A 4HHAA 3MV11 2AEQL 3GSXB 1NCTA 1TVBB 5E6ZA 3SDAC 4DGYL 4NSKA 4NUGL 3KHOA 4GMTH 3O8XC 3PHOB 5T3XL 3P0YH 4U6TA 5DRZA 4JY5L 4EN3D 1FPTL 3TZVA 5FYLL 1KTLB 1NDMA 3NVQA 3QUYA 1G9ML 2BY2A 4KKAD 3V6FB 1TENA 1F11B 4PP2B 1PVHA 5MEPB 1EHLL 2DQTL 5HGGS 5L88L 2BMKB 4QXGL 1U8LB 1U8OA 2YKLL 3VXME 5HXMA 5KW9H 3BMWA 3RWGA 4KI5D 4DVRH 1R3KA 3ZYZA 3IRZA 2ZJSH 5IQ9A 4BM7A 3DHMA 2MCG1 4FFYL 1YEGL 1FVDB 4HMCA 1Z9SA 3KYOB 5ID0B 2YBRB 4N5EC 3MXVL 2I07B 5HYEA 3K8LA 5IMMB 2FATL 3MCG1 4NHUB 3EJYC 3QIBC 1NEZA 2I25N 3BDXA 5IFAL 5D96C 4P59H 3CVHL 2B2XH 5DVOA 5F9JA 4KRNA 1NCCL 5F7WC 1E0OB 1R3IL 4F58H 2EE9A 5J6GA 4XVJL 5MENE 3SDXE 1BQUA 1EGJH 4ZPVA 1ZHLB 4NZJA 5KVDH 3RIAF 4XCCL 3MUGB 1MAML 4Z7VA 5ICZB 4WI2A 5EU4A 1BD2B 3HNTL 1I8KB 3RBSA 1KC5H 3TFKD 1A7NL 3BO8B 1BZ9B 3LSOB 15C8H 4RMQA 1RU9L 1U8QA 3RFZC 4H20L 3FQRB 5JORB 3DX7A 1HINL 3C60B 3U0WL 5FO8B 3O4LA 3O6FC 2DM4A 1UWEH 4LSVL 4ZQKB 5BVPL 1JHLH 3GHBL 2VLJE 4H8WC 5C7XH 4L8CB 3GHEL 4RAVA 2OMBA 2AK4D 4RIRA 5FYJL 2P8LA 1K4CA 2OTUA 4MA1C 2VQTA 4LEOA 4Y4KD 5CEXB 2NZIA 3BSZH 5H37G 4MLSA 4XMKH 1C12B 5ACZB 1RUAL 4DKFH 1XIWC 3FO1B 5CUSH 2CRYA 5F1IA 2A6KA 2YD1A 5FUZL 2NY0B 3VH8A 1FC1A 4JFFB 4PJHA 1C7TA 1MFAH 4X98B 1Q9KB 1JWSB 3M8OH 1MRDH 4GSDH 3T1WA 2VN4A 3S37L 3QUMA 5F71A 1VKXA 4JRYB 2CIIB 2OJEA 3GI9H 4PGEB 3TNNA 5E08H 1MCCA 2P24A 3BYTA 1EUUA 2AJ3A 2F54D 1EEQA 4PJAB 3KPRE 2UZYB 2CGRL 4NO2B 4Y8DC 3LZFH 1G9MC 3ZHLA 2DL9A 3OKKB 5D2NA 1HYSC 3EJZD 2X1QA 1QQDB 4EOWL 3SDDC 5I1CL 4NNYB 4X9BA 2J8OA 4JJ5B 5D1ZC 1YEIL 4F8TA 2O26U 2AXGB 1KPVA 3TYFA 3R0NA 5HDOA 1NQBA 4HEME 4AYFA 5BZWB 4GG8A 4JM4L 3FOMB 1FYHB 4L4VB 3WUZA 1T04B 1J86A 1A9EB 3LQZB 5JO5B 2BSRA 4UT7L 4F33B 3QIUC 3MLWL 1D5ZA 4ZO9A 3K8KA 3LHPL 1HOCA 3VXTB 1U58B 4IRSD 1ZS8A 4ZUUA 3DXAB 4K3HA 3SE9H 3RWFA 4LRIA 5CD5C 3DECA 4JQXC 4YXLH 2X4TB 3P11H 5DEFB 1NGQL 4GBXC 3FZUC 3OAUH 5CZVH 2GSIB 2PKDA 1MUJA 3GMQA 5JHDE 4LLVB 1Q9WB 1R3HB 3SDAB 4IMKA 5IBUG 2D4DA 3ESVF 1N7ML 5D5MF 4XBPB 5FDWA 2JJUA 4LSUH 4BKLA 3GUTB 4FQXB 2FO4B 1DFBH 2Z93B 1J5OH 4PGZA 1CD1B 4LVOC 5C6TH 3RVVC 3QEUA 1RUML 4R8WL 4X99B 2OZ4A 2XTJE 3TZVC 4Q9BA 3SKNA 2Y23A 5I1KH 5BJTA 4N0CD 3V6BR 1K4CB 1MCLA 2OTUB 3GSWB 2VDOL 3V0WL 1E4XI 1BQSA 4LLWA 3MA9H 3RZCB 4PJBB 3LIZH 3IU3A 3T4YA 2I9LA 4QT5B 3VWJD 3RU8L 2IAMD 4L8DA 3DMMD 3LKRB 3MBEB 4XT1C 3FQTA 1QTYT 3GMNB 3T09A 1BIHA 1P9MC 2GEEA 2ZUTA 3QRGL 4JO4H 3ARDA 2ICES 1AXTL 3I6KB 1MI5A 2ZUQC 3MLXL 1HQRA 3TA3B 4NO5A 4Y5XB 4BQCA 3BEVB 1DZBA 2DICA 2I5YH 4JG0L 1T7XA 2WINA 1VDGA 3S4SB 1P7QD 4UV7L 3UPCA 4H5SB 2GAZB 4HX1A 1TQBB 2C4FU 3OF6A 1RK1B 1KFAL 4QHMA 4O58H 3G6JB 3RVWD 3G5YA 1E6JH 1JZ8A 1JWSA 4D9QD 5C0IB 2AABL 2P8PB 4XHJC 5ENWA 4LKCA 4I13B 3H3BC 3IETA 5L9DH 1EIBA 3OKEA 1ZA3A 5JXED 3JWDH 2W0FB 2UVFA 3MV7D 1N3NA 4YR6B 5FYLH 5DGRA 4NZRL 5GISH 3K4ZA 3BWAA 3HCVB 3BPCB 2Z8VC 3CFEA 5C0GA 1SYVA 5EU6D 2ZOLA 3MJ7A 4F3FA 1HXYB 5HDQH 3D1MC 4HIJB 2ZNXA 5E2VL 4XXCC 2X44D 3QULA 4GAYB 5L2KD 4KTEH 1CK0H 1KBGH 2WBJC 3JTSA 4U1IB 5KVFL 1HSBA 5AAWA 3ZKXC 2ZWLT 2ZOKB 3TEUA 1ADQL 3LRHA 3MX0A 4E41A 2DLFH 3FB8B 4NOFA 4YHOL 5DQ9B 1B0GB 1AGEB 2D03L 1GHFH 4Q2ZB 3D6GA 4LCWA 4G8EA 4G7VH 3MACH 4NYLA 4BH7A 1P4BL 3T0XA 1TTFA 5IHUH 3W39B 4WFGE 5EZOL 4L4TE 1PEWA 2AXFB 3H3PH 3MPCA 4HUVA 3HZKA 5KTEH 5EC1A 2C3XA 4OCWL 2Z4QB 2F53B 3ULUE 5EOCH 5LCVL 4UINL 1RUPH 5JOPD 4Z7OF 1PKQB 4GKZB 4UILH 3UEZA 2DQJL 1MFBH 3AY4C 4J3UA 1ZHLA 1DVFA 4MQ7B 5GQBA 4OIIH 3QIUB 4IDJH 3BESR 5F6IB 3QG7L 3LVEA 1D5XA 5BRZA 2DQEL 2AW2A 3AU1B 1QA9B 4XP6H 3VXQA 5DUPH 3OAZK 3QPXH 3FOMA 3MBXH 5IM7B 3BRGC 3QDJD 2A2QT 2DI8A 3CFBA 2VTFA 2H2PD 4FNLL 2PTTA 5HGBB 4LAQL 5EORH 3VXMA 5BRZE 4KI5F 3HC3L 4JJ5A 4OZGB 5J7CC 5IMOA 4QXUL 4YEFA 3OKYA 3JSSA 3KYNA 1R5WB 1U92A 2Z92A 3K2UH 4G9FB 4HZLA 3RTQD 5SWZD 3GSVA 3DXAD 1S7UB 3BT2H 5BVJB 4PJCB 2FR4B 3DMMB 3D2UA 4NFBA 5BQ7B 3KDMA 3S34L 3O6FD 1IM9D 4GBXB 4D8PB 1OAZH 3WIFA 4PJXA 1A6WH 3IAPA 2PW2A 2Y36H 1ROWA 1NC4A 2YC1A 3DX8B 1XZ0B 2ZCKL 3LB6C 2CGRH 3FN3A 5DD3L 5FAAA 3GSRB 1EDQA 2KL6A 1A0QH 2DQDH 3BUYB 5DRWA 3D0VA 4FQXD 3E8UL 3ZTJG 1N26A 1XIWD 1T83C 1I8IA 4F7EA 5A2JH 3B5HA 4PRDA 2IPTL 4GOSA 4NN5C 1S9KC 3GSNA 4FXLA 1DSFL 3JV5A 4R7NB 1HSBB 4NWTL 3WS3B 4JFQA 3MJ9L 3EIFA 1VEOA 5KSUB 4K3JH 1B4JL 5T33L 1JGDB 1C5CL 3N1QC 3K4DA 3OMZA 5FO7B 3CFCH 3VA2C 2OI9B 3TYFB 1PY4A 1CFSA 1I1FA 1WSST 1J87A 2R4SH 3TH2T 3EYQC 3GBNL 3MYJA 1W0VA 4EXKA 5KANI 2UY7A 1T4KA 3U30B 3FT2A 4KY1H 5LVEA 3FCTA 1HYSD 2JJSC 2VQ1A 3EYQD 3SQOL 4XPGL 5C0BB 1A3RH 4EI5A 4XBEH 1B90A 4ERSL 4PJAA 4NT6A 1S9YB 3P11L 2QSCL 1HHHB 1J1OL 3PNWB 3FB5A 2YD5A 4U2YA 5DURD 3MV01 3LN5A 2BVOB 2IFFL 3OG4B 4KKLD 2MNUA 1R3HA 3SDAA 5ALCL 2NXZC 3PWPE 3ZZ1A 2PYEE 4U1MB 4RX4D 5FF6B 1A6AA 4ETQB 1I1YA 2VXQH 4KK9C 1FP5A 5BZDB 1CDJA 4WY7L 5D9SB 4UB0H 4YX2H 4XPTH 3OJ2C 1RUMH 1YMHA 4YHZH 2EDBA 1ITCA 4XCEB 3E6FB 1FN4A 5B8CB 1A3QA 4PTUB 1QFOA 3OTTA 3I75B 2R1WB 1ERNA 2Z31A 3WFDL 4F33A 4PR5B 3A6CL 3GK8H 5IVXA 3MBEA 2OS7A 3ZHDA 4H88L 4EUPB 5IJKA 4GRMA 3EOTH 4OLZH 2CKBH 4U1IA 5JZ7C 3QI9A 5EOTA 4C58B 1AH1A 4KKCC 2QV2A 4POYA 1EK3A 1JJUA 2P1YA 1IC1A 1EVTC 1EAJA 4XTRD 1MHCA 1RJYA 3MRGA 3MRRB 5E5RB 4DEPB 2BFVH 3HZYB 2PO6A 1RK1A 5FDWB 1A2YB 4XWGL 4OZIB 3MV9A 4UV4L 3MJGX 5HI5C 3G9AB 3S4SA 4NQSB 1DTUA 1W0WB 2XRAL 3IETB 5D7IE 3O4LE 3LKNB 4ZUSA 5T1KD 3TO4C 3D69A 4XNQA 1F58H 5D7JA 1HNGA 1R5VA 1A6VL 5F1SA 1T0NA 3LKRA 1NL0H 1D5XB 3BP6A 2OR9L 1A7RH 1FAIL 1JMZA 3U7WH 2NY6C 3WNMA 4GW1B 3MV9E 3PL6D 1U6AH 5D7KE 1QSFD 5SV3A 5DK0B 3ULVC 3BEVA 1NFDA 1T2XA 4LVEA 1KCRH 5C9JA 4O2CA 1MWAB 4X6DF 3LH2H 1ZSDB 2DQGH 1WWWX 1T80A 5C0RH 5ANME 3QDJA 3VGAC 5TDNB 3UTQB 2WIMA 5FK9A 1TQCC 5D96B 1UXSA 4H1LG 2IAND 4P2RE 4PJEB 3LKPB 3F12B 4N0FB 2WWKO 3MUZ1 4ODVH 5IQ7L 1DP0A 2X70A 4OZHF 1LILA 5EU6E 3C5SB 3O3AA 4D94A 2VQ1B 5T1MB 1A6TB 2G75A 3QG6A 2Z4QA 3RWJB 4DN4L 3IDJA 1GAFL 2I27N 2VDQH 4OF3A 4Z7VF 2BHZA 1QYGH 5T5NF 3LCYA 4L4JA 4AQOA 1FFNB 1NGZA 1AR1C 4HUUB 3QHZL 1UB6A 1F4WH 4U6HB 3BP7B 3TJHD 5F96L 4J1UA 3X3FH 1FORH 3BMVA 3JV4B 2Y6SC 1EMTL 3GBML 4YJZL 5I15H 1LE5B 4DW2H 1NFIB 3BDYL 2A0LC 3GSNL 2R39A 5EN2B 5C2BH 1ND0B 3MNWA 3ZSTA 4KUZL 3GO1H 2ATKA 4JRXE 1S7QA 2DS4A 5EU3B 4Y4KC 4JZOA 4QWWC 4YBHA 3BPNB 3HC3H 1KSRA 4I48A 2FGWH 3T0DA 4NKIL 1MI5E 2UYLA 5AUMA 1SJEA 3CFJA 2UZXB 3FKUS 5ILTL 4CW1B 5IFJB 1M71B 4KDVA 3TCLA 4G8IA 4EDWL 1NGYA 4FN0A 3QIWA 4K23L 1AO7E 3P0VH 4MCYB 2R2BB 4GKNA 4ZO7A 3KYNB 5IP4A 4P46C 4XC1H 2DM3A 3PV6A 3WLWC 4NO2A 2Y36L 1FO0L 3NZ8B 1OTTC 5J11C 3CU1A 3KXFD 4GRLD 2VXTL 2AEPH 2H2SD 5GJTH 4A6YA 3FCTB 4RAUA 1U8NB 5E94A 2YUZA 4N9OB 3QH3B 2VAAA 3QUZD 1BHGA 4KXZH 4KXZI 3VFMB 4YWGH 1BZ7A 1QR1A 2YA0A 2EE2A 1IKFL 4BZ2H 4OCSH 3K80A 2CPCA 1I4FA 1QFUL 1QRKA 2BNRB 3B9KC 1QBLH 1JGEB 2HMID 3FO1A 1OCWL 1J18A 3MLZH 2EE6A 2VLRE 1EJOL 2VLKD 32C2B 4HWBH 1QACA 3MROA 5J12C 3GJFH 1G7QB 4GLRI 1RZJC 3TC9A 1A7BA 3BIKA 1CFQA 4YGAB 2HFGH 2B4CL 2NX5B 2NTFB 1INDL 1LEGB 1FVEB 1PQZA 5DRNA 4HH9A 1DL7H 4JN1L 4FFYH 1CFTA 4MHHI 1YEFL 4YHNA 4UBDD 3OKKA 5B39B 4PJHB 4Z7UE 4XRCA 1YEDB 4UNUA 1M1SA 2Y72A 1WISA 5TQ2H 2NY7H 1FH5H 1MIMH 4FFZH 3DMMA 4YQXL 4Y19A 3H9HB 3WDHA 1B88A 1MCRA 2OL3H 3Q5TA 4LPWA 2W60B 5JPMA 3V5HB 5DK3A 4HZAA 4MD5A 4XC3L 2IANA 1MCEA 4FQHB 3SE8L 3UJIH 2APBA 2EZ0D 3IGAA 3MC0A 5HHME 3ZYIA 3IDGB 2IF7A 3I75A 3UX9B 3V4VH 4JHWH 1PG7X 2GUOB 3A6CH 5B3NA 2EDOA 2W9LA 3CLFL 1A7NH 1D9KD 4JY6B 3U9PH 3BGFC 2Q7YA 2PTUA 3HLAA 3F8UB 4LRIC 1KNOA 3UTSD 5DJ2A 3VGHA 4LHQB 2ZG3A 5T3XE 4OFDA 1IAII 4ORZC 4JFDD 4I18A 1ES0A 3RJDA 1NC2B 1QSFB 1QVOA 4GKNB 4JG1H 3P4OA 4P23C 5I74C 3MRGB 3MRRA 1ZEAH 1DBJH 3MRLB 3S5LA 4GLRH 4R4BB 35C8H 3JVGA 5FKAB 5E8EA 4LSRH 3BE1H 5ETUB 1D5IH 4PP1C 1AKJA 1UA6L 3FFCD 1K8DB 2H45A 3NCJH 3K74B 1I8LA 4PGJA 3WSQL 3F65A 4HC1L 4I3SL 4KUCF 5C6TL 3NFNB 1DLHA 2XRAH 5J9PA 4XMPH 1KJ3H 2EO9A 5DVMA 3BPLB 2V2TB 2YA1A 4ZODA 5CWSB 3C6SA 4ZFFA 2V7HB 2XY2A 1S7SB 4X6EB 5F7HA 3B4NA 3RUGB 5D71H 5DFWH 1V8HA 2EH7H 2BSTB 5C0CE 2CRMA 3B2UC 2XZAL 3JV4A 4WI7A 3OKLB 4YE4L 4XCYA 4OT1H 4QNPE 5E00A 2N4IA 2X09A 5I1HL 3LDBC 2W65B 1UZ6F 4F15B 2NCMA 5I75B 4L8CA 2ZUQB 3RWGB 4JRXA 3VFWA 2PYFA 4F15C 1RV6X 5GGTL 1EFXA 4L4TB 2IAMA 5JHDB 3TWCH 3ZO0A 4G8GB 4O5LL 4YZFF 4OCRL 5FYJU 4NQXB 2YRPA 2X4OB 5BQ7A 4KI5C 1YQ2A 2A1WL 1TJHL 4XGZA 2E5EA 4UT7H 4M4PA 1I3GL 1RIUL 3DXAE 5B39G 1S9WA 3SDDA 3KS0J 3A67L 2P43B 1YMME 3AS3A 5I1JL 2JF1A 2W91A 1RZ8A 1ZTXH 1FBIH 4WGVB 5KOMC 5JIIA 1G7JA 4NRZB 4S0SD 1AGBA 4GRLB 1FO0A 3WD5L 1ZLUK 5BW7C 3LRSB 2YWZA 4JFOA 3BGMB 4O9HH 4HG4J 3AU1A 3MYZA 1FIGH 5I74B 5TJWK 2JCCF 1NBVL 1T0NB 4MJ6A 2FX7L 1DQDH 5KS9E 3L7FA 3P4MA 3Q1SH 2Q86B 4F3FB 2R4RL 3L6FA 4W68A 1Z0NA 2I9TB 5IFAH 1DQLH 4HS8L 4ZPTA 1AQKH 4POUB 3S36X 1LP9A 5CEYA 4OV5A 1OGTB 3FFCE 4HK3N 1WT5C 2JB6B 3LB6D 4XVJH 5F97E 4S2SB 4K94C 1K8DA 4AEHH 1WFNA 4JZNB 4HZLB 3QISA 4X6FB 4S10A 2VZ1A 1JGVL 5CEZH 4OZFA 3ZYOA 3J7HA 3P77B 3SBWC 4AENB 1CT8A 3VFGH 4NP4H 5FK9B 2C26A 2YUVA 3D9AL 1QVOB 1FYTA 3LN5B 4HH8A 4HK0B 3U4BL 1IL1A 3QYCA 1UZ8B 1AXIB 3BH9A 4HFUL 1A21A 1FFOB 3KJ6L 4ODHL 4Z77B 4Y2DA 1CFQB 1CIUA 3WHE1 2Z31D 3C8DA 4LPCA 4Y19E 2K3TA 1A7OH 3QAZB 3CVIL 5BVPH 1PLGL 1FNAA 2VABA 3I50H 4FQ2L 1IGIH 1EUTA 4MDIA 1TJGL 4JDZA 4U0QB 5HVHB 3QXAB 5HSFA 5EU7C 5KSVA 1HSAB 1KIQB 2DDQL 2JB5L 3DI2B 4EN3A 4NZDA 2QQNL 1CGSH 1MELA 5DQJB 3BGFB 4M8QB 4G8GA 1FNSL 1XF1A 1BD2E 4Z6AT 2GTZB 4JFFD 5SWSE 1VADA 2FO4A 4TUJA 3P0GB 2E7LC 3GI9L 1PG7W 4UDUB 1A4KB 3CDCA 5CEZD 4BH7B 3WHE0 2G60L 1DBKL 5HJ3A 4ELMB 1VGKA 4KQ4H 1YMMB 2CKBB 3OKNB 1GGIL 2ESVD 4AMKH 1IVLA 3AFLA 1ZVSA 1FVEA 3D48R 4HIHB 4DZBB 4H5SA 3W0WB 3WIIH 4XP4L 2JCCE 2FR4A 3ZDXE 3E8UH 1G1CA 2EEBA 1QSFA 4JQIL 3CXDH 2X40A 4M61A 1I1AA 4X7SL 1R0AL 1AE6H 3EKCA 1R3IH 1MSPA 1S7SA 1XGQA 4LHUG 3DUSB 3JTTA 4GT7A 4EN3C 2GQHA 1XGTB 3H3PL 4DJMA 2NY5H 1UT9A 3WE6B 5I17A 3RVVD 5D1QB 4MMXC 1DE4A 3TO4B 1AXSA 5EOCL 4MWFA 3H8NA 3H9SD 5EZLB 5LQBL 5MEPA 4PJ7A 1MHPH 5EU7E 2VWEC 3KYKH 2CRIA 1ZVSB 4WU7A 4X83A 2X89D 3QA3A 5SX5K 3JV6A 4JCLA 2CH8A 3C5ZB 4CL7A 1XGYH 2MQ0A 4J3OC 2E6PA 4MQSB 1IQDA 1RHHA 4JKKA 5DLML 3KPQA 5GRZA 3KWWA 3N1PC 5D7JD 4OLXH 5DI8B 3V52H 4BUHA 2H9GB 3GSUA 1RZGB 4G9DB 3RHWK 4F7PA 4L29B 4ZAKB 1RIHH 3ULVH 4FQJH 4YXKH 3PWVB 3T0VA 1SM3L 2P7TB 1FG2B 4P3DB 3FFCB 1WUNT 1UWXH 1UKQA 2W07A 4M43H 3BJ91 3PGDA 4D3CH 3GKWH 1DQQA 4ZFFB 3QQ4A 4WO4B 1KCVH 6FABL 2XTJD 5FHBH 4Z0XB 1NC2D 4LDLB 4J1UB 5IOPA 5GGVH 5I1DA 4IRJD 1E4KC 3LQMA 4YE4H 1QO3A 3MLXH 2P4AB 4JFFE 2ZSVB 4GKSB 2R1XB 1S3KH 5E99H 4XAWL 3LEYL 1Y0LB 1C16B 3DROB 3ARSA 3BQUB 2PXYC 2PYEA 1I3RA 1QP1A 1HE7A 4G6KH 2CDGA 4ZXBC 5I1EL 1NLBH 2WQRA 4S2SA 4YPJA 1WV7T 3S8WA 5JW4Q 1MNUH 3LRGA 4PRAB 1HZHH 3ZL4L 4LLAA 4X5XB 4N8CH 3ZDYF 4DK3A 2FH6A 5ACMA 1BQHB 3D3VB 4PJHE 1Q9KA 5FUOH 2B1HH 1PBYA 1TPXB 2Y6SD 4OB5H 1ZWIB 3IJHA 3SCMB 5ESVB 5B8CC 5GRJL 4KY1L 4J6RH 4RDQG 4JFYB 1K9TA 1QKZL 2R0WH 1BAFH 3WNLA 1ZVYA 3VMNA 2EYRB 1FNEB 3EYOA 3HZMA 5CS7A 5CZVL 1YEEH 5DK0A 3V7MA 2IH1A 3QUYD 5GGQL 1KF9B 4PRPD 1J0JA 2QLVB 5F9OH 4L8DB 3FT3A 2X4RB 4OIAA 1GZQB 2AI0L 4RGOH 4YHOH 2NR6C 3BQUD 1UM5L 1KJVA 5GRXG 4G8FA 1GHFL 4HIEA 4DOHE 4E41E 4HIIB 5BZWA 1Q94A 5H2BB 4GMTL 5DWUL 3PWLB 3MRJB 4YDIL 4Y1AB 3E6HB 3L3HA 1FPTH 4PUBH 1SJEB 2R29L 3RWEB 5DUML 1IKNC 2HRLA 3RU8H 3G6DL 2PYFB 4R2GB 3QDJB 3MUHL 3N50A 5EBLA 2FECI 5KVGH 3VFTB 1EHXA 4I0CC 3D3VD 2HKHH 1F3DJ 1KUMA 2KZWA 3ULSA 3NFPB 2HFEB 3AREA 2RGSA 4PJGE 2FZ3A 2CK0H 1AGCB 4P4KD 3VXNB 3HB3D 1U0QA 1PG7L 1NEZB 4ODHH 3QIUD 2XKNA 3VXUB 3QJHB 2DLGA 5EC2B 2BDNL 4XP6L 4O58L 4LLMB 4WEUD 1U2HA 3ZTNL 5E8DL 3QUKA 25C8H 5T3ZL 3BN9C 2L4OA 4FABH 3VRLF 4QCIA 4F7EB 2DDQH 2JB5H 2P8LB 3TN0A 3VJ6B 1Z3GL 3MRBA 4PJEE 1YYLL 3NIDF 3QWOB 1KELH 2HRPH 3T0ED 4GO6B 2WWMC 4NGHL 1P7KA 1HHIB 1FNSH 1JL8A 2OI9C 1JF5A 3DPBA 3U7WL 1Y0LA 1DN0B 4LU5H 2FEDC 4RFEA 1IGMH 4G5ZL 4RWYH 5T3XD 5FO9A 3NCYS 1X4ZA 1GL4B 4P23A 4KZEL 4LHUA 3SKOB 1FL5A 1KBGL 3VFPA 5C9JB 3Q0HA 1A1MA 3MRPB 1QLRA 5EU6B 1O7SA 4P2QD 3QUXA 4B53A 2MKLC 2CKNA 5K9QG 2ZSWA 4XP4H 3REVA 1H9VA 5L6YL 3B9EA 1KB5H 5HDBE 4P2RB 4Y16C 3UTSA 2FLBT 3WN5A 4TULL 3BKML 3O6LH 2IANB 1IGCH 4NHUA 3AGVA 3W9EB 1LEIA 4FFVD 3I3DA 4ZUSB 1BLNB 4I3RH 4KK6C 1WTLA 4HWBL 4XHQA 4MA3A 2Y7QB 5CEZE 5GS0C 5I19H 3S7GA 2QHRH 4D0CA 1N5AA 5DZLA 3DRQB 3ARFA 1QYGL 3IFNL 1X5AA 4OM1H 2AJXL 3F6LA 4XNZC 4YUEH 3IDMB 5A40E 1CDGA 3FQUA 2W38A 5D7SL 3CFDA 4Z9KB 2A38A 3SO5A 1IZJA 3LN4A 3OXSB 4N0RA 3MNVA 5ISZA 4QRRE 4Y7MA 1A5FH 4X7EC 2H1PH 3HMXH 5FOJA 4BZ1H 5MP6L 3GBMH 4HGMA 4KKCD 4G80B 3PWLA 5GZND 3O45A 1AC6A 3ALPA 4R4BA 5TQ2L 5EU5B 3MQIA 5ECJE 4EDXA 3IJSB 1WBXA 4U1LA 5D1XA 1CLOH 1P6AB 2JIXA 4UDUA 3WL9B 1MJ8H 1D5ZB 4IS6B 3RX8A 3CX2A 3MCLH 3JTTB 3WNOA 3DRQA 2W1NA 3LAFA 3F7YB 4WW2C 5LAXA 4UMGA 3SQBA 4TUKL 3THMH 4WW1A 5C09A 3BUTA 1GRWA 1INQB 3CD4A 1JZ3A 2FB4H 2ED8A 1NLDL 2WQ8A 5D7IF 2MHAA 3HPLB 4H25B 5MERB 3UC0H 5E2TL 5ALBH 3RNKB 5CD3B 3KPNB 1D6VH 4WI8A 5E99L 3IFOB 3RWJA 4MJ2A 4FFWD 4JG1L 2UWEA 5CP7B 3W11D 1XIWA 1HQ4B 1DUYA 1X6LA 5ETUA 4LAQH 1BVLB 4WEBL 3PHQB 3TBYB 1B4JH 4Z7WB 4YDKL 2VLJA 4JLRA 5GRWA 3CNKA 3F58H 1DDHA 2P45B 3IXTA 4MA8H 4L8SA 5KN5A 2B5IC 3W5MA 2VXVH 1MQKH 1CGWA 3UROR 4L5FL 3L3OA 5EA0L 4WHCA 1S7UA 1NFIA 2ICEB 1OAXL 3U6RB 1L7IL 2B4CH 4WTZG 1A9EA 1U3HD 4D9RE 3RNKA 5CD3A 4NBXB 2EKSB 4PJFF 2NZ9D 5IROA 1FV1A 5EZJA 1NDGB 1NGPH 1SJHB 1ZANL 3P73A 4QTHA 5EIVA 2DYPA 5DJCA 2XQYG 1YDPA 3B2VH 2I5YL 3KHQA 4WV1C 2J5LB 1AR2A 3OAZH 4JJHA 3MSPA 2VUYA 4MGXA 4U0RC 1G9EA 3L3KB 4R0LC 4KQ3L 2IMNA 4L4TD 2CDEA 3W82A 5IB3A 2OYPA 1WWCA 4PJGB 3SGEI 3UBXB 4LCUA 2BNQA 1C08A 5D2NE 1E4KA 4WUKH 5HY9A 2XQYK 4RISL 5GGRY 2QADB 3D25A 4O4YL 5TF1L 4YDIH 4PB0L 1OARL 3IDMA 1OW0C 3UTTA 3GSQB 3KPPA 3WFDH 3QDMB 2R29H 1A4JA 4DN4H 1OSZA 2LAGB 2G2RB 3OKMB 4ERSH 4HXBH 5CZXD 4NHCH 3UP1A 1O5DT 5TPWL 1NGWA 4G6JL 1UB5B 4C83B 1I8MA 3C08H 4OF0A 4LCWB 1F3RB 2CRZA 3VFOA 5IFHH 4LSUL 1J9CT 1NBVH 1UA6H 3EOAA 3QZWA 4HCRL 1TNMA 1DQDL 2AGJH 4PS4H 1HEZA 5FV1L 4W4NA 5F6HJ 25C8L 5T3ZH 1RFDH 2BJMH 4XVTL 1KB5B 1FNFA 5DZOA 3DJ9A 3DYPA 3DBXB 4UQ2A 1I8KA 5F7FA 5DUBB 1ZMYA 2FL5A 4TVPE 4OUUA 5L8KB 1FZMB 4BH8A 2Z8SA 2V2TA 3EAKA 5C86A 1CVSC 1LHZA 4N8PA 1KTKE 4LSDA 4RGND 5DRZB 4DGIL 5MHSE 5CMAB 4J3SA 4MSWB 1VADB 1UKSA 1S7XA 5EO1B 4RZCA 1L0QA 3CK0L 2WIIB 4HKBB 5IV2B 2O61B 5TDOA 1BJ1J 1ZE3C 1G0DA 2AQ2A 5IJVA 4HWUA 4NQCA 3C5ZC 3QUMB 4HFUH 2MJWA 3GKZA 4L3EA 1XGUB 4Q9QH 4LDOB 3CFDB 3ET9F 3H9SE 3E3QE 3VFWB 1K6QL 1SVZA 1G0XA 1L0YA 5ESQA 1J0ZA 3S88L 4PRPE 4YH6A 2EDYA 3RWCA 4M9PA 1DBBL 3S96B 1T1XA 3O2DA 1QSEE 5IHBA 4ZAKC 4M1CD 3NAAH 4M7KH 4MDJB 4NZRH 1E6OL 1T83A 5EC2A 4X6EA 1PX4A 2NX5D 3WS6A 3ULUF 4JFHD 3BP5A 4L3EB 4R4FL 4KHXL 1BEYH 1XCTA 1U6AL 2VXSH 3QXVA 1XCQA 1UJ3B 3MR9A 1EZVY 3VXSB 4LHUB 3JUZA 5CJ8A 1OGTA 1JE6A 1X5ZA 3UBXA 3HLAB 2DQGL 4UOW1 3BHBB 3V5KA 3WHXB 5C0IA 4DW2L 5I30H 4ZFOB 1EAPA 2NY7L 5HYSG 3UDWC 2NY2B 4KUZH 1YEHH 3LEXB 3O3BA 1AGDB 1MUJB 3GMQB 1QUNA 4JFFA 4U33A 3MLRL 4EI5D 1E27A 3RWHA 2J8UB 4G9FE 4KVCH 3KXFB 4OZGE 1H3UA 3WIHH 4AEHL 3RWFB 4JFYA 5E5MB 5D1QA 2UZIL 2DKMA 2VISB 4JFPB 4Y19D 2GHWB 3MUY1 2XOTA 4UUJA 1GCFA 1NCDL 5DMYA 1I4FB 3KYKL 3RDTA 3WFZA 2D0GA 4FZEL 4PJFA 4PTTA 1D3CA 5AWNH 5ICYA 5K9KB 1I9RH 4W6YB 5D2LF 2G9HB 5HDBF 2AJYL 1QLEL 2DQEH 4HJJL 4KUCD 5DLMH 5DUPL 2UWEB 2VR5A 1EZVX 3BQUA 1IKFH 5HVFB 5D8JL 3WJJA 4OGAD 5F7NC 1ZVHA 5ICXA 5I1IL 4MS8C 3AM8C 3EO0A 1RJYB 4M6NL 1OAQH 1OB1A 4I0PB 3KPMA 4RNRA 1NC4D 1J05B 3QEHB 4XMPL 4J8RA 1KJ2B 3WXWL 3ZKSD 2B1AL 2XFXA 1QFWH 4APQC 3BT2L 4WW1B 5C09B 1DJSA 4ODTH 4NJ9L 1OTUD 2R15A 5EBWA 3GB7A 1T2QL 1X44A 1I3VA 4GAJH 3BVNA 1JRHH 1KCSL 3MA7A 1VEPA 3ILPB 5E9DD 5EFIB 3UAJD 1JGLL 5GGVL 4JHAH 1XGQB 4MD5B 3EJJX 2NTSP 4BQ9A 4NQDB 2GK0A 4XXDA 3R0MA 4PRHA 1F02I 1GPOL 4F57H 1UACL 4CNIB 4KRPD 2ENYA 1KLUB 2GW5A 2OL3L 3VXRA 3QIBA 1SYSB 2R0KH 3IDNA 4YAQA 4BA8A 1R0AH 1NLBL 5IBLD 2AJZA 1KXQE 1FFQA 3EDDA 2XXMB 3BD3A 3T0WA 4BJLA 2BVQA 5I8OL 1OP9A 4OFYD 4PJGF 3V8CA 1HHIA 2A73B 4OZFG 2R1XA 1U3HC 4DZ8B 1OARH 1LD9B 3GBNH 4YHPA 2OP4H 4F9PC 5IV2A 2O61A 2XT1B 2DRUA 1LP9B 2YD9A 5CEYB 2DTSA 3FO0H 3C9NA 1T04A 4JY6A 5CJXA 4MXVE 2YZ8A 3CFJB 4YBLB 2EIEA 3NBNA 3O3DA 4MVBD 2XXCB 4L8BB 2X42A 1B0WA 1MCIA 1FBIL 3C5ZA 3B9DA 4NQTA 1URLA 4W70A 3HB3C 4ENEC 1ZGLP 2ZPKL 1AGDA 3O3BB 4TQEH 3ULVE 1P9MA 3BP4B 3QUXD 1V3KA 3VXUA 4Q6IA 3O8XA 2ZUXA 2N7AA 4FQIH 1NJ9B 4LNRA 4HFWB 1B0RA 3GMOA 2X4PB 3B9KD 1RZGA 1UWGH 1VFBB 3NIFF 3BJLA 3BP7A 4LCIH 4OD1L 3BKCL 1KTLA 1NDMB 1T2JA 3CIQA 1I7RA 3L9RB 4QRPD 1QBMH 1VGKB 5DWUH 2CO7B 3G5XB 3RQ3A 4P2OB 4K3EL 4P0DA 4A2LA 4HWNA 2XTJB 2Y1VA 3ARQA 5I6XC 3VGDA 2GY7B 4R96B 1I3UA