1XF5A

Complex hcv core-fab 19d9d6-protein l mutant (h74c, y64w)in space group p21212
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
220
structure length
220
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Capsid protein C
total genus 50
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf5A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xf5A01
4DVRL 3VFWB 5L2JA 4C56D 3VG9B 2R15A 3ALWA 1IGYA 5IW3A 1AR1C 5CJOL 2EXYC 1PKQE 4KUZL 1I7UB 4N90D 5CP7B 2MKLC 3IS0X 1A6WL 5T5NG 2JCCB 2FX8L 4J6RL 2JJSC 2ZUQB 1VESA 4OGYL 5IG7A 1Q8MA 3ULVE 2AV1B 2G2RB 2QBWA 5HHOB 4XB8A 5E2VL 4XHJC 5C8JB 4J7RA 2ENSA 4QOKD 2FWOA 2DICA 1SEBA 4K8RL 3B83A 3BESR 5D71H 1K85A 3DO3A 2G75A 1I1FB 2YC1A 3KG5A 4NN5B 4RQQA 5GRUH 2Q6WA 4XXCA 4QKXB 4PRAB 2XG5A 2JELH 1LO4L 2NY4D 3EGSA 3FQUB 1MIML 4X6EB 1JI2A 5ITFB 2VIRB 1N6QH 2FSEA 2JF1A 1BOGA 1X44A 2BDNL 4DFIA 5AD0B 5H35A 4G3YL 4HBQA 1BM3H 3ARBA 1YC8A 5IOPB 4OLZL 3VWJD 2BHZA 4MNHB 4OCYL 1JF1A 3KXFE 2ED9A 1FFOA 2DD8H 3CLEH 4HKZA 3WHE0 3QIBC 3WS6A 4NFCA 4P2OC 1TQCB 3ARDC 1PQZB 1V7NL 2BNRE 5H94A 3BKML 3ZKXB 4YBQD 3K3QA 1QO3A 3D0LB 4X7SL 3NABH 3TZVC 2WSKA 4N9OB 3SDAC 4TULH 5CWSA 5ADPL 3G6AA 1MFAL 2F53E 4L8SC 1RIVH 1BJ1J 4PJAF 1JPFA 1T4KA 3OPZL 4JZJB 4OCMC 3RAJH 3LEYH 2GIYA 1TDQA 3GMPA 4CADB 2ZUQC 1S5HB 4Z0XA 4FNLH 1PKQB 2WBWB 1ZGLA 3P11L 5KSAD 1J1PH 2VE6A 4GKOA 4DEPB 3MO1A 3BQUB 5I75C 1KLUA 2BVPB 2LU7A 3LSOA 4GG6E 1OD7A 3HRZB 4PJEB 4I0PA 1QPPA 1YEEL 2PCPB 5C3TA 2PR4L 3GO1L 3BHBB 1JN6A 1MJ8L 5F1OB 2E7LA 2ESVA 4JFEB 3KPPA 2Z35B 3EDDA 5A2IH 1A1MA 5FM4A 3WLBB 3NPSB 4OZIA 2XTJB 5J3HC 2OTWA 5CKGA 2AK1H 4LCWA 4X7SH 4MNQE 2X4PA 3IFLH 2J6EH 1R3IL 5F3BB 5IEHA 2Q1EA 4OZFH 2WANA 1CLCA 3RDTD 4OZFA 4G7YL 1EO7A 5F96L 3L1OH 5FK9B 3ZT7A 5F3HA 1I3UA 3INUL 1ACZA 4LF3B 1KIUA 5ETUA 3NIDE 5D96B 2VLRA 5FAAA 1YEDB 4OAWA 5IBTH 3UPAA 4MJ5B 1VGKA 3EYQC 5DMYA 1FVDB 3TVMD 2PUQT 3HC4H 4OZGE 5B39G 1N5YL 1MNUH 3GMLA 2EE2A 4YBHA 3GHBH 5F7UA 4UIMA 3V6ZA 1FDLL 3ALXA 1LE5A 1NBYB 5FKAB 2NY0C 3TNMB 3U9UA 3FB6A 3C5ZA 4JFDE 1H3TA 3C60D 4RDQG 4GRWH 4JHWL 2NLJB 4PJIE 3UYPA 4DGVH 4UOW0 1T3FA 2HFFA 1U8MB 1QRNB 4ZAKC 4AEIL 1QKZL 3O45A 2O5XL 4J3XA 1A6ZB 3QNYA 3D85A 4J3TA 2F53D 2IBBA 5CGTA 5D2NA 3CX2A 4PJCA 1T22B 5IP4A 2OR9H 4V1DE 4C54A 3INUH 3FO9B 5I6XB 4KROD 4MSWA 2WWKO 1A3LH 3G5VB 1UEMA 5FCSH 3TZVB 4X4XB 1P1ZB 4UI2A 2DBLH 5I8CA 5M95B 3K8MA 1G6RH 2ICEA 4KJYA 4PJ9A 4P46B 3P0GB 4U6TA 4GKNA 1K4CA 5C3LD 2ADJB 2DLFL 4U7KA 2G9HB 2RGSA 5GS2H 4O5LH 1NBQA 2ATPB 4JVWA 5I71B 4C83B 1UXWB 1OAUL 3HZVB 5DHXB 3T8XA 5IJKC 5DHVA 3VH8G 2EEDA 1T7WA 3MRIB 5IB2B 4K7FA 4QXUL 2WLYA 3BEVB 3MROB 2NXYD 1UZ6E 1E4XL 4Z7OF 2R29L 3HNTH 4JHZA 1T1WA 3MRBB 1YY9D 5CEYA 1A7OL 4F58L 1IBGH 5TF0A 2JJTC 2CRYA 1EXUB 2AXFB 4DQOH 1VADA 4WV1B 1KGCE 4JQVA 4YHNB 5KSVB 3CH8A 4DN4L 1FZJA 1XR9A 4FQLL 3EYVB 1DLFH 1CDHA 4WW2A 3IT8D 3H3PL 2X4OA 4OFYD 4Y19A 4WI4A 5HGGS 4L1HA 4Y2DA 1RUAL 4QF1B 1MLCB 4ESKA 3RU8H 3BZEA 4XMKL 3OKEA 3HE7C 2FJFA 3SDCD 2ZG2A 2DMBA 3ZDXE 5EFIB 3FFCD 4FZEH 3WNNA 1HHIB 1FVEA 4PJDB 1EMTL 1AGFB 3UBXG 2FBJH 5FYJH 3VGAC 4BUGA 4F7EB 4R0LB 1JI1A 2EE6A 5AG8A 5HVHB 3IXTB 3QFJB 1Z5LA 3PDDA 4EI5A 1T20B 2GITB 3SJVE 3HI1B 4OCSL 4K7PL 5TQ2L 4QRRB 4CGTA 4NNPL 1NBVH 1IILE 4WNQA 5H2BA 4UT7L 3OGOE 1L7TL 2IAMD 3KLHC 1D6EA 2Q8AL 1F00I 4PV9B 3ZE0E 5SWQB 3SGEH 1YMMD 4UT7H 5KSUA 1HILA 1I8KA 4G6KL 1AR2A 5SWZA 4EUPG 1U91B 5FDWA 1RJZB 1HXMA 4NT6B 2AK4B 4XP4L 1EZVX 5D5MB 5IMMB 4KPHH 3V7MA 3RTQA 3SY0B 3NACL 3ULUF 4JHAL 3UTSA 1R3HA 2P4AB 4F57L 1EMTH 1KELH 3GUTB 4I4WB 2KUTA 1KXVC 3RDTA 2AJXH 3BOVA 3SDDA 1HZHL 4HPOH 5D1QA 4LLYA 2X1WL 3PV6A 4FFZH 4WO4A 1OQOA 4OD2A 4Q2ZB 1IGIL 1RZKL 1CTOA 3E6HB 4RFEA 5FV2A 3NTCL 3I2CH 1QLEH 4YHLL 3JWDL 3OL2A 1YNTB 3FZUC 1QQDA 2XN9D 3L3JB 5JO5A 4UV4L 5C2BL 5E08H 2SEBB 5TFSL 5JXEA 2GK0A 3D69A 1I8LA 3GJEA 4PJGF 5CGMA 2VZSA 3S36L 2R56H 12E8L 4G5ZL 2EICA 3EJZC 3QFJE 1CG9B 3O3EA 5KOMC 1T3FB 3IRPX 5DI8A 4X80L 2OL3A 3MCLL 2QSTA 2YA1A 3HR5A 1MFDL 3QFJD 3BGMB 1HXYB 1X5FA 1BPVA 2UY6A 4QEGA 1JMXA 3MCLH 1TJGL 4OLUL 4AMKH 2FX7H 2EZ0D 3F65A 1G7LB 3QEHA 3MA7A 4XCEA 4K3DL 1YN6B 1DBAL 2NY1B 3FCTA 1XGUB 2EECA 5ICZA 3P9MA 2V6HA 1EBAA 1VKXA 4S0SD 4G9FA 3HR6A 2R2EB 3H9SD 2BHYA 3JWDH 3HFML 5K9OA 2H1PH 4L8CB 4M6ML 5E24E 4LOUD 4XP6H 1LE9B 3EOYG 4X6CE 3B8YA 4Y5YB 1XH3A 2VKWA 1H3UA 4R4BB 1OAYH 3DX8B 4NGHL 2IADA 4XZUA 1E4KC 4H26A 1LNUB 5I8OL 1N8ZA 3KAAA 2ZKHH 4X7DC 1QBLL 4HC1L 4WI2A 1JHTA 3QBTB 3GM8A 3FB8B 3IXAB 2G2RA 5HHOA 1E28B 2FEDD 1FP5A 5HYJD 3KLAB 2IPUK 4LEOA 3CFKA 1NLBH 5EU7E 4AIXA 4I1NB 3TO2B 5GJTL 3C8KB 1UA6L 3N9GH 5KAQF 4M7JL 3RWIA 5F7KC 2ZUUA 5E6IC 4OD3H 1DQDL 2QL1A 3NA9H 1U92B 3QDAA 5J1TC 3DROB 1UM5H 4MQTB 4JKPL 4PJFA 1DBMH 5DO2D 1NGQH 4QHMB 3P30L 4XMLL 5GIRA 3BEWB 3QXTA 1X5JA 4MQXC 3LKNB 3SQOH 5IJKA 4X6DE 2HT3C 2BVQB 3KJ4B 5I1LA 5EU6A 4LHQB 3MCKB 4I0CC 1QRNE 1AXSB 4CL7A 3F62A 4QRQB 5DJAA 3SJVB 3W39A 5F7FA 3CVIL 4LCIL 2VXTL 3S88H 4NHCL 3TN0D 5JW5A 5CSBA 1CLZL 2HG5A 2IBGA 4QTIH 1NC2A 2V5TA 5GZNC 5DJYB 3BWAA 1I9RL 3IU4H 3FTGA 5D2NC 4L4JA 4RGMC 4RFNC 5CJXC 4DN4H 2DM7A 1ZWIB 2F5BH 3B5GA 3TA3D 1B0GA 4N0YL 3T04D 2W0FB 5IIEB 5HVWA 1J11A 3ARGD 4I18B 2XIDA 3T0XA 1P2CA 1S9XB 3FQWA 1XFPA 4OQTL 4FP8L 3CPLB 4FQQB 4F7MA 2ZOKA 4H5SA 1OGTA 2H32A 3H2WA 2M8XA 4M3JA 5GZOC 5FYJL 5FGRA 5HI4D 4HIXH 4MA3B 3WXWL 4JFEA 2ZPKH 1XCQB 1X5GA 5DC9B 1C5CL 4FQPA 4XAWL 1KTLA 1GVIA 1G7MB 2VAAB 3HI6H 3FFCE 1WBYA 3SDDD 3V52L 1KTDA 2I27N 4NCC2 3C6LD 4HK0B 4N0FA 4OGXH 4K7PX 3GMLB 5EWIH 3RGVB 2NMSA 5JOEA 3QUXC 1A6TA 3RWJA 3UPRB 5TDPB 4I3RL 1N2RB 5SWSD 5T3ZH 2VO5A 3IKKA 4QXWA 4OLZH 1IGCL 5E2UL 5MERA 4H88L 4JRYE 4YC2C 1AD9B 4PV8A 5C0CB 3K4DA 3HCVA 3V5HA 4OCRH 4C4KT 2IANB 1SBSH 4QLRA 4MAUH 3S96B 3ULUE 1MY7A 3ZDZF 5FB8A 4NOBA 1ZHKB 2HVKA 3FAWA 4GW1B 4Y1AA 4KZEH 4QTHB 1Y6NR 2PO6C 3MRNB 1QHPA 1RZ8B 4CMHC 5IQ7L 1UWGH 1X5LA 3MRCB 4HUUB 5AWNL 3QUZD 4AH2A 2JB5L 3Q48A 3VFSB 5CIPB 4YWGL 3UBXB 3VG0H 3PWJB 1WT5C 3UTTE 3TO4C 3MLTB 2GT9B 4RIRB 5EZJB 2BNRB 4UOW1 4HGKC 1RU9H 3KXFB 4G8FA 4XI5D 1BD2A 2CMRL 1MNUL 4LSRL 1ERNA 3I2CL 3LZFL 2ORBL 4PG2C 1KJMB 1FFRA 4ELMF 2Z91B 1D6VH 1U8IA 4B53A 1K4CB 3OZ9L 3RWCB 3RDTC 3K1DA 2EDYA 3TBTB 4RQQB 1BD2E 4CJ0A 3LH2H 1EEQA 4LNRA 3T4YB 2C7UB 5C07D 5FA3B 1AJ7H 2D0GA 3TZVA 3MMEB 4PJFF 4M5YL 3FN0L 2YD4A 2QQKH 1D9KC 4NZRL 3B9KC 4WCYL 5LVEA 5GS3A 3I02A 3GKWH 2ERJB 1XIWB 3SE4C 4M02A 1FLRL 3VXSE 2YUWA 4LKCB 3UAJC 4L9LB 5IESH 3BIBX 4NNYA 4U1SA 1U8JB 4JQXA 2FL5A 4JREC 4O5LL 3DARA 1AHWC 1DE4A 4OF3A 3VMOA 4NQED 1P5VA 2FCBA 3LN5A 2NY1D 1R5WA 4FXKA 4MD5B 1S7VA 2K9UA 4HLZG 4P3WA 4XNMB 1RUQH 3H0TB 4UTAH 3P11H 4Z7QE 2CQVA 3QIBD 1BD2D 3VXQB 4JPKH 3SE9L 3OAYK 1T04B 3RVVC 5I66B 5FYLE 3E6FA 3V0VB 2ADIB 1TENA 1N5AB 2CR6A 2Z31B 1HH9B 3OJMB 1BQHA 1AXIB 1MCRA 4HWEH 3B6SB 1TZIA 1D5ZB 4MCZA 1VPOL 4FQ1L 4PUBH 5CJQL 1CFSB 3MNWA 1AO7A 1NGZA 5CD3B 1F97A 4WDIA 1FHGA 2F74B 3QIWC 4K23L 5D7JB 4XPFH 1M7XA 1EJOL 1NLDH 3MLWL 2DJ4A 1FNEA 3TT1H 1AE6H 4IRSA 4NP4H 3TNNB 4H20H 5SWQA 2JJTA 1EAPA 2AEQH 5E2WH 3VGBA 5I1JL 1ZSDB 5BV7C 2RCSL 5TE4H 1HKFA 1NMBL 1MAMH 1A3RH 2MQCA 4YUEL 3OKKA 4CDGC 4P57A 2NY7L 1ES0B 1KFAL 4N0UB 1SYVB 4Y2OA 2VITB 4YHKH 5E2JA 4QRSA 2BNUA 1P7QB 1YMME 3UTSD 3MLSL 4U0RB 3WFCL 5JDSB 4FQJH 4OTXL 2DLFH 3REWA 1GYAA 3PV7A 4NQCA 5KG9B 3LRHA 4O9HL 5FDWB 3ZMRA 3O2WL 1LP9F 2DQHL 2EDDA 5K9KB 1WITA 4XPAH 5F7WC 3O2WH 1HHKA 2H8PB 2VSCA 1R3HB 4KJQD 1QSVA 3MV8E 5GJSL 5IUSA 1PSKL 2VZOA 1JZ8A 1EO8H 3UTQB 2GJ6A 3DXAA 1FNLA 1HIML 2DQTL 2GW5A 5INDA 4X5WB 4ZUUA 4HAGA 2VR4A 1NBZB 4UINH 4K7PY 4QHLB 2NY7H 4ZDHA 2D9QB 2CGRL 3EOBA 1EXUA 2IMMA 1IE5A 5IV2B 4RFNB 1YEDA 4OAWB 4PRDB 5J57B 2VN4A 3VD7A 4JREB 2X5PA 5FOBA 1IAKA 4RFOH 5DC0A 4A2LA 1N64H 4NM8L 4YHYC 4WI3A 3IKCB 1CDGA 2HJLA 4RRPA 1H0DB 4UT9L 4UB0L 3BPCA 5IEKB 4IHOA 4ONOA 1FE8L 4JGJA 4P4KC 5IM7B 3BP5A 2D0HA 1IAII 3MJ9A 5K9OB 5DUBA 4GKZB 1IGML 2EDRA 1NKRA 3KGRA 3EBAA 5ISZA 3P4NB 2ICWJ 3L3OA 1KV3A 5GS0H 1QSZA 4MQSB 3MR9B 2F54E 3U7WH 1UB6A 4KC3B 3O2DA 2IC2A 2XFXB 4TTDC 2R23A 3AC0A 5DD3H 2YMXH 3P40A 4OM1H 3QEGH 2B39A 5D2NB 3UROR 2FX7L 4ZO7A 2FD6H 4RGND 5C0EB 1NDMA 4L4TE 2GAZA 2IALA 5I18H 3D9AL 6FABH 3QO1A 4MA7L 4YZFE 3VGHA 5IR1B 2DQEH 3Q6GL 4WI5A 1I8MB 2W65B 4TUJA 1HOCB 5D6CA 3MYJB 2VH5L 4PJ9B 2A83B 4QGYA 3TPUA 1BF8A 3BPOB 3B2VL 3A0OA 5DJ6B 4P3CL 4H26B 2CPCA 2HTLD 3BD3A 1YEHH 5DMIH 3IDGA 3G9AB 4Z7UE 5F6IC 2DKUA 1NAKL 3MRLB 3IDNA 3WKMH 3V9FA 2EDBA 2CXGA 1JPST 4U3CA 4F7PB 1UYWH 1ITBB 1A7QH 2CDFB 5HGHB 1VFBB 4NO5B 2QR0B 1QNZL 4GRLB 4X6DA 3TO2A 3H9YA 3S36H 1P4LB 3BN9C 4P2QE 5ICXA 4I3RH 3PGFL 4HDIA 3VFTA 4ZO8A 3BO8A 5FHBL 5K93A 1CFQB 1QSFD 3QUXB 3VMPA 5BJTA 5F9AC 2ITDB 3MLXH 2H45A 1ZLVK 1Y18B 5L6YH 1OF2A 2AJVL 2QSVA 1XGYL 5TH2B 5D7JA 2BFVL 3FONA 3WNMA 15C8H 4I5BB 1T2QL 1JWUB 4G6KH 1WFOA 1FN4B 3I6LE 5SWZE 2I9TA 2BSTA 2VDPH 5DJDA 1IFHH 1JV5A 1KXTB 4KK8C 5DI8B 3H9ZA 5FECA 4IOFC 5D2LB 3QUMB 3O9WD 1DQJB 5D93C 4XC3H 2C4XA 4FQHA 2Y6SC 1A1OA 4RZCB 2GCYA 1ND0B 2DF3A 5TPWH 3T2NH 3VRIB 1JYXA 1INDH 1SYVA 5JXAH 3GHEH 3IXTA 5HI5C 4NQEA 3FTGB 4GQ9H 3LSOB 1I1YA 2YXFA 5KS9F 4OBRA 5J1SC 4XCYB 2VAAA 4G9FB 3OHXB 5LQBH 3KPNB 4WNQB 5IMKB 2YPVL 2OTUA 4OGXL 5GRWA 3BW9A 1IM9A 2VQ1A 1FL3A 4ORGB 1T66D 3T77A 3R06B 2J8UE 1OWWA 4K2UL 2AK4A 3WO4B 3OX8A 1XCQA 5KSBE 4PJBA 5F1IA 1NGPL 3JWOL 1BBJA 4K9EH 5INDB 2IANA 4FFYH 4YFDB 1JP5A 1FYTE 1ZHKA 2AXJA 2HVKB 2X1OA 1H5BB 4Y1AB 3NVQA 5DJ8A 2AS5M 4GSDH 5FGCB 1LD9A 1FNGA 2VTFA 1FRGL 1GOGA 2OMNA 3AVEA 5HHNB 1YN6A 2HT4D 3NBNA 1AIFA 3B2VH 1JK8A 4LSPL 1DEDA 2Y1VA 4YNYB 8FABB 2ZWLT 4NKQB 4KV5E 1JGLH 4JFHE 5ALBL 3KYAA 2CJUL 5BZWB 2DKMA 3QDHA 4PJ8C 4KGLA 2H9GB 3VXMB 5EG6C 4LVEA 1BAFL 4PRPA 5T3XH 1E4JA 1IAIL 1PDKA 4X7FC 3VFPA 5BS0E 1NGXA 3DX6A 4LEXL 3GSNL 5M7QA 3K2MC 1VFAA 2DAVA 5GZOD 4IJ3B 5D7IA 5L6YL 1S9VA 4ZXBC 3TYGL 4OT1L 2YPLE 2NQCA 4OI7A 3RUGB 4KI5C 4KKLC 3S37H 1RD6A 4PD4K 1WV7T 4R26L 2JJSA 4MJIE 4HULB 2DLTA 3VDBA 4FABL 2KL6A 3STZB 3D5OF 1Q9KB 2EE3A 2W0KA 5ICZB 1A64A 1P1ZA 3BPNC 4XPHL 2G75B 3CD4A 4ZQKB 2BCKA 5D6CB 1TTFA 4HXAH 4JFDA 5C08B 4J3OC 3OKMB 1IC4H 5C6TH 3LHPL 5AYUH 1LVEA 3WUWB 2VL5A 1VACB 4F7TA 3EYOB 1KB9K 3CFJA 2A0LC 5LAXA 1S7VB 2QQKL 4PJAB 1L0XA 2VDNL 4Z0BL 5LBSH 1N8ZB 5KVMC 4ZFOB 1MFNA 3X14A 2I60L 4Y5XA 5GRJL 4PJ7A 3EYQD 4MNHA 2VMFA 1FG2B 5TFSH 4I77L 3VFTB 4Y19E 2FL5B 4QCIB 5HHMB 3LQZA 1E6OL 2NY6B 2CIIA 4E9LA 1QFWM 5ERWA 5D7SH 1MQ8A 4JPIB 4PJEF 4JFQB 4ISVA 3NFPB 3T2QA 4BSVA 1J8HB 2J6EL 5GGUA 1YNKH 2IH3B 5JMOC 3AU1B 1WIPA 1C12B 2MCPL 4ODSL 5E9DB 2WIIA 1Z3GH 1BGXH 2J8UA 2DQFA 2M26A 3BJLA 3RWDB 1UZ8A 3UTSE 5E8DH 3V0WL 4JHAH 5J3HD 2MHAA 5I74C 3IDXL 4YWGH 2J7LA 5GGRA 1KFAH 3GO1H 1DL7L 2JIXB 5F93C 5MI0B 3VCLA 5JPMA 3OAUL 3WFBL 4I2XE 3Q6FA 2XN9B 3CMOH 4NBZB 5HYSG 4IIQB 3QDGD 4X83A 4PLKD 3JVGA 1NANH 3GRWH 5E56A 1NJ9A 4YK4B 1CYGA 4CJ1A 3AS2A 4UQ2B 3RI5K 4QRRA 1FFNA 1SJHB 2CDEB 3TT1L 3C6LB 5C2BH 1Y6KR 5HYFA 4D0BA 4UDTA 3VFWA 5L2JB 3FO2A 1S9WA 2R9HC 1ZGLP 1KJ2L 3NABL 4GBXB 2ARJA 1MWAL 1V5JA 2NY1C 1CU4H 1G7IA 2NXZB 4O2FB 4OZFB 4P23B 1QVOA 4BA8A 1CVRA 5DQDL 5L2KD 1IT9H 4CVXA 4M8QA 1DZBA 4G42B 2K1MA 25C8H 1TNMA 5JORA 5ADPH 3NFNB 1NCTA 3UO1H 3TH3T 3CAFA 2MMXA 5HYJE 4HUUA 5T5FL 5CINL 3VRJB 4MAYD 4NRXB 5E8NB 5AUMA 4Z76A 4GBXD 2VYRE 1MWAA 4RAUA 1M7DA 1LO4H 4G9FD 3OXSB 3U0PB 4QYOA 4UU9B 4U6YB 1M05B 5IW6A 1PG7W 1KYOJ 3LMJH 3EOTL 1IBGL 4EIZC 3PGCB 1KCVH 3KXFA 2APXA 1YEGL 4EQ2A 2GI7A 2W0PA 5LBSL 3OG4B 1ROWA 4JPVH 2VUYA 4LVOB 3TO4D 2C4FT 5DUBB 2A6KA 2E3VA 4JFZL 4LHUA 1D5MA 2ADFH 2YPKB 5LGHH 5IB1B 1MFBL 1YEIL 3LN4B 2XPGB 3VA6A 4ODVL 1V05A 1W0WA 5ID1A 2P44B 3HI5L 4J4PD 3SKUD 3V4VL 1LDPL 2FB4H 5I8KL 3D39D 5KVFL 5GGRY 1UM4H 5B38A 1JUFB 3RL1A 1RZ8A 1PX3A 5T1KB 1P5UA 5IB3A 4P2RE 1AQKH 1KSRA 3IJSA 3V6OE 4F3FB 3NCFB 4NSKA 2GSGA 1MRCL 4U1HA 3ZTNH 2VZVA 3BUTA 3F7VB 1SEQL 3ZKND 1YN7A 3O6FA 1DCLA 1QSFB 1UKTA 4YGAB 2MCG1 4UNUA 4S0TD 3ULVF 4L9LA 1I7RA 4CVUA 1DVFD 1RMFL 2Q6WB 5I30L 4PRAA 1YPZE 5DFVC 4M1GH 3FT3A 4P5MB 4BH8A 1Q94B 3MRQB 5CZVH 1C16A 1R24B 4DKDC 5JR1L 1WJ3A 1YMMA 4WUUE 3PGDA 4EEEA 4MQXD 3MRRA 4QRPA 4XP1H 3D3VE 1EHXA 3HNVH 4HQQL 3T09A 3MMEA 4BFBD 4RGOL 3EO1A 2VC2H 2X4NA 5LWYH 1MCIA 2M1KA 5I76A 2EH8L 5A2FA 5IFJB 5HHVL 3O41B 1IGCH 5E2UH 1KENL 2YEZA 4HPYL 2P7TA 4Y4KB 1HQRA 4HCRH 2H3NB 1GC1L 1Q0XL 4U6VH 5E8PB 4LBEB 1H15B 4XH2B 3MV11 4LQFH 3X11A 5MEOA 3MV9A 3QNXB 3QDME 1MRFH 1AFVH 1EAPB 4YHMH 1I3RA 3TN0A 1DANT 4XWOD 4EQ3A 1NGYA 2L4OA 3TA3C 1T1XB 2FATL 4WU5B 4DK6A 2W91A 4KKCD 2ZNWA 5I19L 4FFWD 3HPLB 2VDNH 4Z0BH 5D1XC 1QR4A 1NUNB 3MBEA 1QSEE 1BP3B 5TE7L 5DYOA 3U0WH 3VWKC 3D25A 1P4IH 1INEH 2VLKB 3KPPB 4JG1H 5BRZB 4G5ZH 4MJID 1C5DB 1KCVL 1QLFB 2GJZB 2UV3A 3AS0A 1BVKA 4IEFB 1G1YA 4HWUA 2YD6A 1PLGL 1J0HA 3TP4A 3DVNA 5D9SB 4MS8D 3RWEA 2XA8L 2XTJC 4NQDD 2WBJA 1IGFH 1XGTA 2NY2C 1EDQA 1PKQA 4XVUD 4FABH 4YJZL 2CLVA 4JFPA 1UB6B 1LDSA 2QKIA 2L7UA 3LEYL 2FX9L 4JY6B 4QOKA 4EVNB 3TM6A 9CGTA 4M6OL 4F9PA 2W9EL 1GPOL 2CUMA 2WUCL 3RY6A 3MNVB 2P8MA 4TPRL 5FA4B 1LHZA 3RJDA 3ZDYF 2X1XR 3S35X 1U8PA 2QJDA 3RL2A 2KQNA 3SBWA 2FEEL 4KAQL 3UJTL 3L3IA 1KN2H 3L5JA 4NQDB 1A9EB 5CILL 2DWDB 5ID0A 4C56E 4D3CH 4HGMA 4JGUA 4QRTA 3O3EB 5A16A 1MCSA 2LAAA 5ALBH 4EBQL 1GHFH 5K59E 5DGRA 3FQXA 2VSDA 4OJFL 3L3DB 4BSWA 3BMVA 3LKPA 1WWBX 4NO5A 2H6PA 3E2HC 3RIAF 1W72H 1GGBH 1ZA3A 2QV2A 2XQYG 4GAYB 4LPCA 3WYRA 1R3JB 1F90L 5I1JH 1I1AA 2VXQH 4Z6AT 3GB7A 3QCTH 5E2WL 1Q9OA 5EBMA 4RMUA 4FZEL 5FO7A 1GAFH 4ETQA 2Q86A 1F3DH 2V17H 1FL5B 1YA5A 3UBXA 5BZDA 3PHSA 1S9YA 1BVLA 2XZCL 4KTYA 4P5TB 2OZ4A 2MWCA 1P69B 3FONB 4Q0XH 4U3HA 2IQ9L 3BGFB 1BIHA 1VDGA 1YDPB 5HVFB 1CFBA 4TYUA 3MOBH 4KXZI 5CEXA 4PRHE 4MMZC 5BVPH 1KEMH 4TNVF 3W2DL 3RPKA 1WTLA 2NY4B 3F7QA 2JK5B 4OZHF 2CKBH 5KBNC 3QAZC 4JPKL 1A9BA 2MPAL 1S8DB 1HHGB 1U58A 2GTWB 3P4NA 4X6CA 3EZJB 3GI8H 1BWWA 4XP1L 3MRRB 4NZTL 2C1PB 3MRKA 4O58H 2R1YB 5EU4A 2BNQA 2OL3L 3SN6N 2HKFL 1WZLA 1XCTA 1RIUH 2I9LA 5GRXG 2MTPA 1J5OL 3O41A 5TE6H 1RULH 4KFZC 1FZMB 4XB7A 4KDVA 1RJYB 4KI1A 1PQZA 3SE3C 2J1KA 3L5IA 4JM4L 2G9HA 3MGTB 2XZZA 1L6XA 15C8L 2RIKA 3DJ9A 4OIBA 2PXYC 5DLML 5ESQA 4DN3H 4X5LA 3NCBB 1OSPL 2E5EA 3KYOA 5HD8C 3MV8D 3E8UL 1AO7D 4HAFA 5DQJB 5E00A 4F9LC 3W2DH 5CJ5A 2YZ8A 1CICA 1KJVA 3D3VB 4PRIA 3BYTA 3M17A 4XC1L 5IMLB 1FBIL 4WV1A 5ISZD 3GEWB 1D6VL 2JIXA 5GGQH 1REIA 4Z7WF 1MIEL 2DN7A 4HUVA 3FFCA 2VL4A 4ODVH 4TSBH 4DTGL 4AEIH 4QRUA 2FHCA 2K7QA 2R4RL 2BC4B 3NPZB 1MHCA 5T3XL 3BZFA 2LE9A 2Z4QA 3QEQA 5TE6L 3KPMB 5CAYB 2W07A 4YDIH 3TBYA 1AR1D 4LQ1A 3QO0B 3QUZB 3RNKA 2Q3AA 1J9CT 3U6RA 5BXFA 1YY9C 1N6UA 1I7UA 3VG9C 5DRXB 1GZPA 3MRDA 5IHBA 1ZSDA 4W68A 1DQJA 3LEVL 1Z9OA 1MCFA 4Y2DD 2B4CC 1MCJA 4X7EC 1IFHL 3BN9D 4NQCE 3ARFC 4KRMB 5C0IA 1DDHA 3RZCB 3JV5A 2EDQA 4XVJH 2XTJE 4CW1A 2AABL 4MXWH 5CMAB 4WU7B 2AXGB 2ZUYA 4BKLB 3KS0J 1P7QA 4LCUB 3I3DA 4FQ1H 1I8KB 1FE8H 1KJ2A 2WWKT 3X17A 2AAVA 1UQSA 3BH8A 3VXMA 1NL0H 2AJUL 4R4FH 3KHOA 1H3WM 1ZEAL 4ZXBB 2VLJB 3QPQC 1NC4A 3C60A 4FP8H 1MI5A 2DL2A 3FT4A 2DLIA 3WE6B 3G5ZA 5KSVA 5E8NA 3K7UA 4X5WA 1AHWB 3FQNB 3EIFA 4MXQC 4N90E 3CDGB 4LLQA 3GK8H 1CE6A 2VLMD 3DV4A 4Z7VF 3BQUD 4DKAA 4PJ5B 4YE4L 1RIVL 4D9LH 2CK0L 5DD6B 5IHUL 2YD8A 5EU3B 5F6HI 3HN3A 5EH1A 1UKQA 3B5HA 2BVUA 4Y4FC 3ZHKA 3IKCA 3D3VD 5BZWA 3IAGC 4K3GA 4AEEA 5IVXB 1T2XA 1OAKL 2XQBH 5K9QG 2MHAB 3QRFM 5T1LA 5KAQG 4KQ4H 3MO1B 3QUYC 5IB4B 4ZFGL 1LNUA 3O2DH 3QIUA 1S78C 5L9DL 3ARBB 1QA9B 2IF7A 2WIMA 4G8EB 4BH8B 2XN9E 1DLHA 3AB0C 3NFSL 4W4OC 3CFJB 4I9WE 3WNLA 4MSWB 1MFCL 4F58H 5D7SL 3FZUD 4APQD 5TDNB 5GISH 2LTQC 3NAAH 2BNQB 5BW7A 1A2YA 3F6IA 5I76B 2AV7B 3O8XA 4O4YH 3Q3GB 4AG4H 5CD5D 4OUUB 5I1AA 1SEBB 2ADJA 4ODXB 1HWGB 5JHLH 4J3WA 4LSSH 4OF0A 3EJYD 3BP6B 4PBVC 3G9VA 4ZD3L 1JNJA 1BREA 3T0EE 5J9PB 3BZEB 3CLFH 4Y8AA 3MV9B 1XIWD 4R4BA 4O51A 1QBML 5GGQL 3WFZA 5I8OH 5C08D 1PFCA 1H9VA 5HHOD 2VIRA 2BVEA 3WLWC 3OSKA 3RBGA 1QFOA 3HS0B 4DFHA 3VXME 1XF4B 1TIUA 5FGBC 4PRHD 3SKOB 4PG9B 1BFOB 1EIBA 2Y36L 2QADB 2X89D 4EOWL 1JGVH 4K3HA 5FYKD 3C8HA 1U93A 4ODTL 4L5FL 4LEXH 3VXRD 5DUMH 3AFLA 2FZ3B 1SJEB 3X3FL 4I18C 4DCQB 1DQLH 3D0LA 4HLJA 4L1DA 3VXOB 2CUIA 1YJDL 2DIBA 2EIZB 5DR5H 2CRMA 4CMMB 5I1LB 1GZQA 1DBBH 1ZHBB 5GZND 2IAMC 4Z7WA 5D1ZC 4LAQH 4H5SB 4MHHG 5FYJU 4EN3C 1FJ1A 2I26N 4LPXA 3EYFA 4PP2B 2BSSB 1A6AA 4FQXA 4CVWA 4N0CD 5JDJA 5EBGA 4TRPL 2F5AH 3RI5F 3BKCL 3W81A 1EFXA 1MHHB 1XF3A 1F3DJ 3PWNB 2YD7A 3RZCA 3CFCH 4NHUB 5E03A 2A9ML 2B5IB 2OSLB 1R3LA 2Z9TA 6CGTA 3U0WL 4E5XB 5GJSH 3KJ6L 4MA1C 3HPJB 1RUKH 5F7EL 2VQTA 3OKNB 4GAFB 2V5YA 5DA0B 5DRNA 3G6JF 4YQXL 4Y4HC 2DDQH 4E0RA 1ZHNA 1FCGA 4XWGH 2F58H 4FQIL 4C56A 2FH8A 1LO0H 3KHQA 2B1HH 4F7MB 5IEHB 4QHNA 4G6AD 2RAMA 5I9QC 2DDQL 2NNAB 5CHNB 3RVTC 2OQJB 5I1IL 3KPTA 1IEBB 1A6VH 1P53A 3G5YA 3HI5H 2JCCE 4MA3A 2DJUA 3KLSA 5SWSE 2WQRA 3EW3B 1ED3A 2EDLA 4YIQA 1DBML 2DRUA 2P8PA 1ADQH 2D3VA 4ZUTA 1NMBH 2EDOA 3STLA 5FUZH 1QD0A 5ANMB 3LPFA 2X70A 5C86A 5KSBB 4OD3L 3L3KB 1K8IB 4L3CA 2VLKD 4JN1L 1ZT7A 3W9DB 5GRUL 4FNLL 1T0PB 2D0FA 1AGEB 2XRAL 4HS6A 4J4PC 4OCSH 3OF6A 5F44A 4RGNC 3SDCB 1KB5B 3BFOA 5F89A 5JOPD 4NHCH 2DTMH 5EU6B 1AC6A 2FHFA 2DLEA 2ZKHL 2VDRH 2HH0H 4U7SA 2B1HL 2F9BT 1UH4A 3FT3B 4P5MA 3V4UH 1OARL 1RZFL 4F2MA 5I2IB 4HG4K 3D0VA 1T5WB 1ZTXL 3EYSL 3QEQD 5A2LH 4Z7VE 2ZCLL 4KUCF 1YDPA 2BP3A 5ANME 5IB5A 1NMAH 4UBDC 3L95A 4P99A 1EEYA 4CMHB 4ZS6C 1JZ6A 3SDXA 2ICEB 4KJYB 1RUPL 1YEHL 4PRNB 4YEFA 5HYQA 3WBDA 4JCMA 2XNAB 3STZA 1EV2E 3EO9L 2FJFB 3VD3A 3LQMA 5IVNA 1U92A 3MGTA 1N4XH 4LVNB 1HQRB 1A7QL 4P59L 5E8PA 2F19L 3D2UA 3QQNA 1LO5A 1XH3B 2X4RA 2R2BA 5CSZA 4PJIA 3HZVA 4TVPH 1ORQB 1DL7H 2ESVE 4JHBA 4UT6L 4Z95H 4ELMA 3ZT5A 4OGZA 5EU4B 5I9QB 1HKLL 4MZ2A 3D85D 3FN0H 1JGUL 4UAOC 4IRJB 2R4SL 3MJ9H 3CFEB 3B9KD 3RUGF 3QFDA 4P46C 3K4AA 5C0AA 1CFQA 2J8OA 3MUY1 1B0RA 1NCAL 1D5ZA 2ESVB 5D6DA 4JFOB 1L0QA 3QQ3B 4K07A 2QHRL 4L4VD 3NFSH 4ODTH 1YEJH 3FHQA 1KUMA 3NZ8A 4JKLA 3V2AR 4EI6A 3GSXA 3ZTJG 4ELKB 1TTGA 3UTQA 1OT2A 2XOTA 1BJ1H 4DVBB 3HCVB 5F3BA 3PHQA 1UXSA 4KDTC 1W8NA 4S11A 2V17L 4G6AC 3QEQB 1NMCC 3ARFD 3UTPD 3FOMB 2B0SL 4FXLA 4NM8H 4RX4D 3BKYH 4FHBD 3WD5H 3O0RH 1HCVA 3QCTL 1AKJD 4L4TB 1NFKA 2H32B 3BD4A 3OBAA 3PWJA 3TYFA 4Z7NE 4LDEB 2YR3A 4HJ0D 5EBMB 3PJSB 1V8HA 4LLDB 4P59H 4WU5A 1JZ3A 2E27L 4JRXE 4L8BA 4P2OD 1HEZB 1QQDB 1NKOA 5IF0B 3O11A 4ZSOA 4ODHL 4HKJB 2JB6A 4AEHL 1KBGH 4HUWB 3PXHA 4JZNB 2WW8A 4HUKB 2ILLA 1CT8A 2Z35A 3G6DH 4S10A 2NY3B 5EC1B 2IPTH 4ZTOL 4JM2B 3BGAA 3HAEH 3FFDB 3MFFB 1HHKB 5JUEL 2ZCHL 4PRHA 4TVSa 3MJ8A 1B2WL 4HIHB 2DWDA 1YECL 4FFYL 2VDLL 5KANI 1JTOA 1G7JB 4WRLA 4MJ6B 4P4KB 3NCCB 4D9RD 1UWXH 2FDBP 4Q97A 3FQTA 1QFHA 2ARJB 5A2JH 3D18B 1UM4L 4XTRC 2VDKL 3QHZH 3RIFF 1HNGA 5DF0A 2APTA 5CGYC 3U4EA 3OAYH 3HE6C 3H7BB 3VWKD 5KVGH 5FOBB 3FB7B 2BNQE 4OQTH 3GNMH 1Q9OB 3SOBL 4LLQB 3IFPB 5TJWK 1FZOA 1HQ4B 2PO6D 4HUXA 4IRZL 3LKSA 4YR6B 4YAQB 1CD0A 1ZLUH 3RKDC 3L7EA 1EZVY 1MFEH 5DVMA 2H32H 1R3KA 1I1AD 2FECL 5FYKH 3GIVA 1AGBB 4ZUWB 3T0BA 5MERB 2ATKB 5IGXL 1BLNB 4IRJC 4JY4B 4O02L 4QT5A 5T3XD 3QXDA 1BX2B 1MCCA 1JHTB 4M7KH 3S3PA 1AGCA 2UYLA 4JLRB 1F4XL 1A21A 4W6XB 1LK2A 2P5EB 1TZIB 5DQ9A 1QP1A 5DR5L 5IVZB 1AE6L 1JTTA 1G7PA 4AH2B 2J6EA 4HJGB 3KPSD 4NKMA 2Y06H 2V2TB 2HT3D 4RMQA 3GBNH 3ZL4L 3HZYA 4M9PA 3TEUA 1YNKL 5EZIH 3RWFB 4V1DD 1S7SA 1J18A 1MHCB 5T1LD 4LCWE 1I4FB 1X7QA 1BEYL 4FN0A 1J86A 4DUVA 4Y19D 4KWUA 2BMKB 3O8XB 2DBJA 5KSBF 4X7TB 1U8JA 2BOBA 2BVTA 5HDBE 3GJFB 4POZC 3LIZH 3LB6D 3RWCA 4BELD 4R97B 1OSPH 4P49A 3S35L 4PJHB 1INDL 4PJXF 5B3JE 1MUJB 1D5XB 4XX1G 2VL5B 3HNTL 4F7EA 1R5WB 4FXKB 4MD5A 3T8XB 4E41B 4YPJA 4OLXH 5L8JB 1UH2A 4NZJA 4X80H 4TTDD 3AY4C 5EA0L 5CEZD 2VXUH 3MROA 1SYSA 1ZLSH 3MV9D 5F71A 1BFSA 5KG9A 3PGDB 1G9MC 1P6AB 4OUUA 1MRDH 4U6HA 2OX5A 3LH2L 4M6NH 5E8OB 1QO3B 1GGIH 3SO5A 4HUVB 4ODSH 1J0YA 5GISL 1LO3H 1N7MH 5IFAL 4MWFA 2AJVH 3OKYA 4J2XA 4ELKA 5DJ0B 3D87B 1BQSA 4GG6A 2C1OB 4RSVA 2H41A 4K3EL 3O81A 1PZUB 1XGRA 2EIBA 2Y7QA 1AXTL 4HK3N 3T1FA 1I9IL 1VGKB 1CF8L 2LQRA 2C3HA 1A4JB 4XPGH 2NW3A 4PRBB 4F57H 2WBJC 2YS4A 4LVNC 2NZIA 3UJJL 1QBMH 1J05A 1WCBA 2WNGA 4N8VA 2V9TA 5DZOA 4JDVA 1CK0L 3PQYE 3U2SB 3KXFD 5K59F 1F3RB 3U7YH 2KZWA 1MPAH 2OK0H 1Z0NA 3IJYA 3GIZH 3QZWG 2EC8A 1U8MA 2YD2A 2Y07H 4H88H 1RAMA 1R3LB 3DETD 4N5ED 4YEEA 2B5IC 4LRNH 1OT1A 1IGTB 5IBLC 1BZQK 2VB5A 1DEEA 1V3MA 1J87A 3SGJA 1NPUA 4ALAL 3BXNB 4RA3A 3GSRB 1A6AB 3D6GA 4FQXB 5D9SA 2ID5A 2P49B 4FTVA 4WFGD 5LGJB 2GJ6B 3DXAB 4OCLC 1II4E 4XI5C 1K3ZA 1RK1A 2Y06L 1HZHH 4N5UA 3EUUA 4GG8B 3RAJL 1IKFL 4UNTA 3SDAB 5KVDL 2O5ZH 3C2AL 3FL7A 3SKNA 4PRID 4RRPG 5DJ8B 4A6YL 3GUTA 1G0YR 1UENA 3FCTB 4FTVE 4JFXB 4M5ZH 4XMPH 1UWXK 3U30C 1ITCA 2XV6B 4HV8B 4XCYA 4K3JL 4ZOEA 5J11C 1M1SA 3REWB 3X13A 3CJJA 2W9EH 2PTTB 1ZT4B 4HIJA 4UUJB 4NRZA 4WHTB 1IQDB 2QQLL 2CK0H 4JO4L 4EI5D 1AH1A 1O0VA 3IJHA 3MRGA 5B22A 2Y25A 4WY7L 4YAQA 1NFDF 4LLWB 1HE7A 2VQ1B 3X3GL 1CFNB 1P9MA 4Z7NF 2DQDL 3I9GL 5EPMA 3S5LB 5DJ2A 5TGBA 1JHKH 3RA7H 1LEIA 2BERA 1UYWL 4MXQD 2XWJA 4O02H 4EN3D 4GRLA 4X6DB 1N6QL 4GUPB 4TOYL 3VGFA 4NO0A 3E6FB 2YD5A 4PJ8B 5D7KE 2VWEC 4YFLI 5E6ID 4MNGB 4PJCB 2UUDH 4X4ZA 2V5SA 2BVOB 1NC4B 2BY2A 3CFKB 5DZLA 5I1IH 3LRSA 4WI8A 3O4LE 3QI9A 5D5MF 3OKLA 4IJ3C 2Y23A 4XPFL 4HJGA 1XF5A 4F15C 2KPNA 1J0JA 4OLWH 1BGXL 4QHUB 4RDQF 3THML 2WINA 5EZJA 1D5IH 2BFVH 1VHPA 4Z5RB 4YO0A 1H5BC 2NZ9D 3S6CA 4D0DB 4QHMA 4KRPD 4XVJL 5E5RB 2IBZY 2EIZA 4PJIF 4NRYA 4L4VE 1CGUA 4ZNEA 3OKMA 5C1MB 1QR1B 4LFHD 2EYTB 4NFBA 4APQC 4I0PB 5EZLB 3VD9A 5I73C 1BJMA 2Z8WC 2R0WL 2ERJC 1YUHB 5BOPA 1O7SA 1JJUA 4TRPH 2X4TB 2Q8BL 3N1PC 2ZCHH 5L7XH 1LQSR 4JAMB 1MEXL 1T89A 2BHUA 3DYMA 1ETZB 3EDKA 2NY6D 3VXPA 4ZFOA 3ZSTA 4LGSB 4BZ2H 2QSQA 1AO7B 1EEYB 1T6VN 1T1YB 4NC1C 4QXUH 5FV1L 2NXYC 5EUKA 1HSAA 1X5IA 4Z7WE 3C08L 3QO1B 3VXNA 1C5BH 1M4KA 1BWMA 1XIWA 4GRWE 5ICYB 1EJOH 5L88L 1ZVSA 2ICES 4OCNC 1FL3B 2R1XB 4O58L 4BQ8A 3D2UB 1Y18A 1F02I 4G8IA 4JY5H 3IU3A 1CDCA 1EGJA 3MOQA 3EFDL 5HGBB 5BVJA 4X5XB 3PWLA 4JE4B 4PJFB 4LSUH 2OJZH 4PGCA 4K71B 2RQ8A 5GS0C 4WTXA 1PD6A 1MRFL 1MCOL 1WFNA 3MXVL 3K46A 3B3IB 3SQBA 1JNHA 3MJ9L 1OW0A 3DUHA 3BP7A 2BY3A 5DQJA 5E00B 1K6QH 4Z76B 4LPWA 4LSRH 1CXEA 5HHPB 4UDUA 5I74B 2X70B 2HTKD 1NAKH 3NGBB 2QHRH 3P4OA 4HFWB 3O9WC 4XCNB 3NPSC 2YHGA 4Y2DC 3VFRB 4WDIB 3BDXA 5KTEL 2BRRH 2P24B 1ZE3C 3QHTC 3KPNA 5CD5C 3BP5B 1C5BL 1FLRH 2WIIB 5DJCA 1OP3K 1UWGL 2OP4L 1IKNC 4HMDA 5CZKA 5DMKA 4X98A 3BDYL 1CGYA 3I6LD 2P5ED 2X9XA 4Y16A 3V7AE 1T22A 4PJFE 4QTHA 3BZ4B 5F7LB 1U8QA 1NDGB 2ZCLH 3V5KA 1A7RL 1A6UL 1QFWI 3HUJB 4FOMA 4YXKH 1U36A 3VWJA 4CU8A 3OKKB 3PV6B 2ZUTA 1FJ1B 1UFUA 5HHXH 3IF1B 3KPLB 5DRXA 3VWKB 3BJ91 1T7ZA 5I71C 5FYKE 3S4SG 1C7SA 2HJFA 4RAUB 1EPFA 1D7FA 1JGDB 3GSWB 4PFEA 4UUJA 4K94L 1GOHA 1MOEA 3MLRL 2ADGB 1EVTC 4L9DA 4KZDH 3QWOA 4XNYH 4BSWB 3EOAB 4Z77A 2C26A 4XVSL 1XR8A 3I50L 5IGXH 5C9JA 4JDZB 3UAJD 3TESA 1OTSC 3KYNA 4ALAH 3WEXB 4HXBL 3L7FA 3CIQA 4HKZB 5TE4L 1QSFE 4N0CC 4M7LL 8CGTA 3BUYB 4XBPB 1ZEAH 3D39A 5AZEL 5BJTB 1HIMH 1EFXD 3QQ3A 2AJSH 3S97C 2ZJSL 3B8SA 2HT2C 2IAMB 5IESL 4JPWH 3WFHB 4M4RA 5FUZL 1IAOB 3C5ZC 3KYMA 4JDTH 4KQ3L 4NSKB 4WI7A 1BVLB 1DBKH 1RJCA 4P5TA 4EZMA 3OKEB 5KVGL 1NCBH 2BNRA 4U1JB 2AK4E 4Z5RA 4M61B 5T3XE 1TJHH 3ZO0A 1TPXB 4YBLC 2W60A 1XF2A 1NCUA 3PWUB 7FABH 4DGYL 5J12B 1DSFL 4XNXL 4WWKD 3SDCA 1SVZA 3HRZA 2A74B 4XNUL 2LTQB 4RISL 1BOYA 1E0OB 1FZJB 3ARSA 5EORL 1XAUA 4LNRB 2A6DB 3P0VH 3B6SA 4JAMA 4UAOB 4G9DA 1U3HC 4L8DA 3VXUE 3O3DB 3QI9C 4H8WH 3X14B 1MCLA 2ZZUT 3KNBB 3TV3L 4KJPD 3DGGB 3ABZA 1F2XK 4IRJA 4U1LA 1T5WA 4N0YH 4DZ8A 1KENH 2ICWA 4XGZA 3C6SB 5D7LD 4IRSB 5E8OA 3V6FB 4PJDA 2YC1B 4KJQC 1U41A 4UQ3A 5D71L 2WLZA 4X4YA 3MYJA 4U1SB 4R7NB 3IU3B 3TN0C 3FO1A 3MTRA 4P46D 5KW9L 4L3EE 4M8QB 3HC0A 4P2YA 5E94B 4S1QH 3VGDA 4YXLL 1JHLL 1Z9MA 1CVSC 2DQFB 5D96C 4ERSH 2DBLL 5C0DA 4IDLA 4J1UA 4R0LC 4PJ7E 4PJIB 1F11A 3BHBA 1U42A 3DI3B 1MCOH 3D3VA 1JNHB 4UTAL 4G43B 5J1AA 4HT1L 5IBLD 4PGDA 5I8EB 1DVFB 4WWKA 3WHE1 1HDMB 3BO8B 2DQGL 2D2OA 3GJEB 2O5XH 4QCIA 4NQCD 1CGSL 3DV6A 3JV0A 4NOFA 3B2UD 5K9KA 1XGRB 4HPYH 2NLJA 2X4SA 1ZKAA 5JW3H 1KCSH 2A2QT 5CZXD 3WMSA 1VERA 4OLVL 3TBYB 4KKBD 5BS0D 4X8JA 3AXLA 3E1F1 2EYSB 4OLYH 5DJCB 4LHUG 3MRCA 1A6ZA 1TJGH 5ADOL 1A7BA 4LLMA 1ZA3B 1RZJC 5D1QB 5DMJB 4PS4L 1T6WA 2JB5H 3PL6A 5JZ7D 2DKSA 3ZE2E 1KTKE 2CGRH 1KT2A 2AW2A 5E6IB 1IJ9A 4X99B 2J8UF 3VXSD 3SCMC 5FO7B 1RK1B 4HXAL 2X6MA 1U8IB 2XQBL 3MJ6A 2GTZB 4L8BB 1DEEB 1EFXB 1MHHA 5CEXB 5JA8B 1U3JA 1CICC 5IEKA 2GJJA 5C0AD 3QSKB 5DFWH 5ISZE 4NDMA 4NO2B 2VLRD 4HEPG 4KK6C 2R0LL 2PTTA 5AZ2H 3GDBA 3DMMB 4WUUD 4O9HH 1OAXL 4QRTB 3C87A 5GRVL 2OTUB 5DD5L 2FBOJ 1CXLA 1UGNA 3P73B 2ADGA 5I1HH 4KQ4L 3ROLB 3MRJA 4YLQT 3UTSB 2XTJD 2NXZD 4P23D 3DRTA 1WSST 2VXUL 4Q9CA 3OX8B 3QJFA 4OLUH 4AMKL 3WLWD 5JUEH 1RZIB 4GAYA 4HV8A 4ODWA 4WJ5B 5MEPA 1DBKL 2AGJL 3CNKA 4JFYB 2WK2A 2P8MB 2FECI 3MRHA 1OPGH 1QLRB 1I7ZA 4ZPVA 2AJSL 2UY7A 5A1AA 1QEWB 4B0MM 2I07B 5IV2A 1LD9B 3STBA 3VFNA 4MDIB 2A0LD 2QADC 3S5LA 1OP9A 1J8HA 5H37H 1M05A 5FF6A 4PJAE 3MRIA 4TTGA 3EGSB 1K8DB 4HKBB 1JFQL 5DVKA 2Q76B 4RAHA 4KAQH 3UJTH 1DQQA 1HYSC 2BZDA 2VDOL 4G6ML 4IHOB 5SV4A 1CD1A 1T1XA 3ZT6A 1OAYL 1X5AA 3O2VL 1G7QB 3DUSB 4PP1C 1R5IA 1CFSA 4PJDF 5F7NC 2ICCA 5IOPA 1NGZB 5EIIB 3ZKNC 4BH7B 2AERT 3K81A 3V8OA 5IROC 4HWNA 5IMOB 4YDLB 5FM5M 4D0CA 1CU4L 3QWQB 1EUTA 2NY4C 4ZFFB 4EDWL 3S4SA 3VFMB 4IOIA 5EZOH 1INQB 2AJYL 2Z31D 1MSPA 2HFGL 3JVGC 2XA8H 1OF2B 4U1LB 4AQ1B 3ILPB 2R2EA 4JDTL 4KQ3H 5K9QI 3FO2B 4GAGL 5IT2L 4GG6F 3MV01 4YXKL 1HHIA 1T66C 1YQVH 3SOBH 3CC5A 3PF2A 4TUJB 4FZ8H 2X4TA 3KLHD 3K8KA 1ADQL 3QUMA 5DJ0A 3KWWA 4I4WA 4IMLA 2C1OA 1CL7I 1TVHA 2ZSWB 2GITA 3RVTD 3MV8A 1NH6A 4NN7B 1D5XA 3BVNA 5CZXC 3I3EA 3LEXB 4NGHH 4JEGB 1GIGL 4JFXA 3VGAB 1L9MA 4OZGF 4ZFZA 3HMWH 1FNHA 1UVQB 4OZIB 2PYED 1BFVH 3H9SB 5D1ZD 2Z8SA 2R0LH 4PJHE 3C6LA 1U2CA 5C0FA 4YHZH 2GK0B 1FSKB 2D03L 3OGCB 3TFKC 3QDGE 4RBPK 4NIKB 4WWID 5HY9A 3EYSH 5HGBA 1TZGL 3DUUA 1LO3L 5IFAH 1SY6H 5EO9B 5FB8B 4HCRL 3PP3K 5I8KH 2P42B 1B6UA 4RGNE 1GJIA 4GBXC 3GSUA 4YXLH 4HIIB 2H2SD 1KN4L 4S1RH 5E5MA 4XRCB 3O8XC 4XCEB 4UB0H 2DB8A 4PJ5D 3MGAA 4N0FB 1WZMA 2XRAH 5IJVA 4NQVA 4OLEA 3HPLA 4IRSC 1OP5H 3OKLB 2CIKA 4QXGH 1A1NA 2ZOLA 4LRIC 2C4FU 1FC2D 5EUOB 3MLZL 4UILH 4ZMAT 3OXSA 2VN7A 2CKBL 3MBXH 1KJMA 4LSDA 2HJFB 3OR6B 1FH5L 4ZXBD 4ZOCA 4UZGA 5CJ8A 5EBLA 2NY5C 1WIUA 1PYWB 4Y7MA 4POYA 3SCMB 4PYHA 2P5WA 3H6JA 4OM1L 4L29A 1ZXQA 1ZA6B 4H0IA 5BQ7A 3DSFH 5D70L 1A9BB 1DP0A 4X9GA 4M62H 3U6RB 3UMTA 1CBVH 5MHSD 4K9EL 5EZLA 4JFFA 4Q6YA 4IDJL 3AMKA 4YPGA 4Y1AD 1IZJA 3E0GA 3WV0A 3RU8L 4W6WB 1I85C 3FO0L 5KVFH 3MRMA 3RNQB 4JDZA 4LDLB 2O5YH 5KW9H 5BV7L 3V4VH 3O6ML 4LLYB 3DMMC 2MKWA 1FYTB 4XXCC 5KJRL 1HOCA 4MNGA 5ECJE 4X0KA 5EUKB 1XGPA 3QG7L 4OQTA 4PJBE 5DXWA 5EO1A 4TSCH 4U3XA 3PWVB 3N06B 3DROA 4QGTA 3VE0A 1DQMH 1HINH 4LCUA 1CDBA 4P2QB 2OCFD 3RBSA 5H37G 3QG6A 3DURB 3RQ3A 2CDFA 1KIPB 5HGDB 4XP9H 5CILH 2H2PD 3REVB 4RNRB 2DM4A 2R29H 3KPSA 3G6JE 3H42L 2UWEB 5F9JA 4YHLH 5INCA 3QI9D 2A1WH 3L7FB 1MHPL 4TQEL 5J89A 2FYYB 3G08A 2J8HA 3I50H 4HDIB 4R4FL 4Z7UB 1IC7L 5FFLA 5CEYB 4EDWH 1A22B 1RZFH 5IB4A 4ELME 4XNQB 4Q9RL 3FJTA 3N0PB 5SX4H 4KHXL 4MCZB 3HAEA 4L4TD 3MUZ1 4MB4A 3V8CA 5F9OH 1J8KA 3MNWB 4KJWC 4TUOA 2NR6D 3PUCA 1YEKL 5IKCB 4Q9QL 4FTVD 2VABB 2AI0H 1GGYA 3GZKA 5HBBA 2D4FA 3QUYA 1PVHA 5DQDH 3VFUB 3HZMB 1VCAA 3BZFB 1ZT1B 4XWOC 4OCWH 3S3SA 4HWBL 4AY0A 1T1YA 5J4MA 1UM5L 3X12A 3LKNA 2P24A 4M6OH 5DUPL 4GXVH 2EDFA 4F7CA 1RJLB 1KGCD 1JNLH 1YMHB 2IMNA 5GRYA 5GGVL 4P57B 3O4OB 5JXAL 2ADIA 3LKQB 5BXFB 2A77L 3LKRA 4PLKC 5ESAB 2PO6A 2NXYB 5HHQB 4IIQC 3P2TA 4B5EA 4NRYB 1JTPA 4NBYB 4WHDA 5TE7H 3OAUH 4RMSA 1B88A 1F4AA 3MV8B 4GJTB 1DLHB 1JHKL 4O00A 4LFHG 2VLLA 3B9VA 2DQDH 1E28A 3I02B 5BCAA 5C0JA 3QEUA 4DKEL 1TVBB 5C6WH 3ALPA 3ULUC 4Z7QF 1KC5L 2FEEI 4HK3J 3MLVL 2NW2B 5DEGA 5HD8D 3TC9A 5IWLA 4LKCA 1GSMA 1QSEA 1I1RA 4PJ9D 2AV7A 4DTGH 1JGDA 3GSWA 1HDMA 4MA7H 3GI9H 5E95B 5FKPA 3U0TB 2AEPH 1AJ7L 4DVBA 3HKFA 1YEJL 5C09A 5J6GB 1SJEA 2X10A 4KRPC 3V5HB 4JPIA 5CJBA 2IQAA 3S96A 4FXGA 1OAZH 4IRSD 4R7DB 3L3DA 2QQNL 3CDYA 1UACH 4Z77B 2GUOB 3ECBB 2I5YL 3QQ9D 1JPTL 3CSYA 3MV7D 1P84J 2C3VB 1WBZB 5FYLH 4OCXL 5C7XL 4R90L 2XY1A 3NFNA 1DVFA 4LQFL 4WWKB 4HG4J 1MREH 1WCQA 2NTSP 2PW1A 1ZVHA 2X9WA 4HK0A 3KPOB 1QBBA 2YD9A 2WQ8A 1FO0B 5J56B 5ILTH 1CL7H 4NRXA 2CIKB 4XCCL 2H9GA 3PDGA 5AYUL 3HC3H 1BMGA 3CGTA 1S9YB 12E8H 3NN8B 7CGTA 4ZFOL 1SBBA 4XPBH 4XCCH 2GFBA 4U1JA 3EAKA 3HE7D 4RA0C 3HNVL 4FFVC 4HQQH 4N0UE 3QR2A 4OLVH 2OK0L 1YEEH 3ILQC 3BYYA 5EO0A 4JR9H 1CI5A 4NDMB 4NO2A 3VXMD 2HLFD 3QXVA 4MAUL 1MEXH 1KLGB 3W0WB 4I18A 5E99L 3NH7L 2OZ4H 1Y0LB 2YMXL 2Q7YB 1ZTXH 2PW2B 4RWYL 1KJ3H 4NKOA 1DBJH 4WHCA 3QT2A 4GBXA 1OARH 4R26H 4PLNC 5GSVA 4GXUM 3KDMA 4MLIA 1XR8B 2QSCH 1NQBA 4DN3L 3QH3B 2FJHB 1HYRC 1RJYA 1RZ7H 4E5XA 5KANG 5JQ6H 2EZ0C 4BKLA 2C9AA 1GIGH 2IAMA 4KK9C 4NN6B 3V6FA 1MHEB 4YE4H 1D3CA 5J6HB 1LO5B 1JGLL 3X13B 3CDFA 5FEBA 4QYOB 4NC2B 4PTTA 4MD4B 3GSNB 5IK3B 1LP9A 2DYPB 5C0BE 2YXMA 2AQ2A 2C3GA 1Z9LA 5GS1C 4EUPB 2XWTA 4K7PH 5TQ2H 1U95A 4QRRD 1U58B 4OLXL 5L7XL 4HW6A 4M43L 4UTBL 1T1WB 2WBJD 3SKOA 1A7PL 4P0DA 5C0AB 1LEIB 4OZHE 2IBZX 4A6YB 3MCG1 3M45A 4KUCD 1T2QH 3C09B 3SGDI 5TH2A 4PJ5E 1DFBL 4GKSB 3QG7H 1D9KB 4PJGA 4PR5A 1H0DA 4Z78B 2CH8A 2YPLA 2VDKH 3QHZL 3UTTB 1RUAH 1UZ8B 1TITA 1FV1A 1KCKA 4XMPL 1H3PL 3VXRB 2L0DA 1FSKC 2AVGA 4YXHL 5D2LF 3TGXA 3RP1A 1NUDA 5C0BA 1FAIL 5K9JH 4YHKL 1H3VA 1W72B 4UBDD 3BKCH 3OXRB 2X4RB 5CSZB 4ZAKB 1I7RB 4ZS7H 2VR9A 3GHEL 4Y4KD 3LY6A 2WAHA 3QFJA 4NQEB 2IPTL 4HIEB 3T0AA 3CMOL 2YBRA 3DNKA 4IOFD 1FFNB 2X09A 4ODHH 2F74A 3ZDZE 3EJYC 1NC2B 1A0QH 2MFNA 4NQTA 4JZNA 3N9GL 3MBEC 5CGYD 2V5MA 5DTFA 4EBQH 3VFVA 1NLDL 1IC1A 1CLOL 1LK3H 3C60C 1I8MA 4BK4A 1A2YB 3DRQA 3CUPA 2I9LB 4P4RA 1ZANH 3Q3GA 5KJRH 2IH3A 5KVEH 5HGAA 1GCFA 1S9KC 2W9DH 1ZHLB 5C7XH 3ZDYE 1WBXA 4OV5A 1DFBH 1HCFX 3UTZB 4JZJC 2QSCL 4X4YB 3ZE1E 3O4LB 3LPWA 4KROB 4M6MH 5T1MB 2QLVB 4GQPH 1I3GL 2P8PB 4Y89A 1AHWA 4XP5L 3MJ7A 1M7DB 3N1FC 4Q0XL 1BZ9A 4PG9A 1AIFB 2PTVA 1HQ4A 4HUXB 5F7DA 3B3IA 1EX0A 4L3CB 4BSJA 1NAMH 2IEPA 3BPCB 4UT9H 4GW5B 5FM5O 5E0QA 3HMWL 3M8OH 3VW3L 1N2RA 4PBWD 4OSUH 5GS2D 5I17A 3RX8A 2BSRA 5GRJH 3BIKB 5DURD 5IB1A 1ZLSL 3IDMA 3U36A 3DHJA 1TJIH 2D7QA 1P4BH 3PDOA 5GHWL 4ZDHB 3LB6C 4X7CC 4FTVB 5C0CD 4PJ8D 3RVWD 3JTSA 2H6PB 4XVTH 3FT4B 3O0RL 3CZJA 4BZ1H 5GGVH 3ROLA 2DMCA 4PG2A 4WUKL 5EN2B 4MB5A 4ONFH 4HKXB 1DJSA 1CE6B 4ZFFA 3ZTJH 5D7KD 1MCWM 5EU5B 3L1OL 3UZQA 1X5ZA 1F45A 1UWEH 4YIQB 5HXMA 1VKXB 4PRPE 3MOBL 2YN3A 5DLMH 1S5IH 4X0KB 2IQ9H 1I3GH 2IG2L 1W2KT 3F7PC 3LKSB 4MJ2A 5C6PB 4E42A 3IDGB 3QCVL 2ZUSA 5ENWB 4MAYC 4XX1E 1FGNL 2PXYA 4HIHA 1ORSB 2IGFL 3VFOA 1JVKA 1T0NB 4WTZG 3WNKA 1HK6A 2AP2A 4XPTL 3RWHA 1FYTA 1ZANL 5ICXB 4X6CB 1RV6X 3I75B 1UJ3A 2B1AL 3RKDD 1SMAA 3EYVA 2NY2B 1BIIB 3UYOD 1PLGH 4AQOA 4OF6A 1ED3B 3OB0K 2P7TB 4G7VH 3EO0B 3ROOB 3QHFH 2I5YH 1NL0L 2AJUH 5IQ9B 3MUGB 3L6FA 1JYWA 3HE6D 5I1KH 5DZNA 3ARQA 1OAZL 2AJYH 3L3KA 1U3ZA 1U8NB 5CINH 4R96A 3S3JA 4K3JH 2XZQL 2X1PA 1QLEL 3ZL4H 1JV5B 4NM4H 1VACA 4Y4HA 1A4KB 4H1LH 5TQ0L 1OGAA 5CEZH 4MDJA 2AABH 4TPRH 5DK3A 1NCBL 5SWSA 1L7IL 3AB0B 4BJLA 1WGOA 1TMCB 3DGCR 5E2TL 3V0VA 4N1HB 1G0DA 4H1LG 4JDVB 1EERB 3LQZB 4Y5VB 3KWWB 3A67H 1A7PH 3QUKA 3WIFA 1BQHG 3PXJA 4PJXE 4TNVK 4NQDE 4ZTOH 2D7TL 1FH5H 5CSGA 1CIDA 5JHDD 1B0WA 2GAZB 2IALB 4U05A 3RWFA 1QUNA 5B8CB 5HSFA 3L3HB 3LS5L 1F42A 2H3NA 1INQA 1ZWIA 1UA6H 4RGOH 4J3SA 4MWFB 1TVDA 2APWA 3LKRB 2UVFA 2EDNA 4P4RB 3MLWH 3ZHLA 3R06A 5F7YC 1KULA 4ZUSA 2HAZA 1IARB 3TVMC 3WDJA 1E27B 1GL4B 3PWLB 3EKCA 1QSED 3F7RA 3LDBC 3BP6A 5B3JF 3UO1L 4F7TB 1A4JA 2FH6A 2WUCH 3SKNB 5C0GA 25C8L 1NC2D 3ECBA 3N85H 2BOCA 5JNYB 1QACA 5EB9A 3L3JA 4OD1H 1MH5B 4PJXA 1FVDA 4PLJC 4ZAKD 5B39B 2E8ZA 2BY0A 3IFOA 1OB1B 3GFUA 2GSIA 3TH2T 4OZFG 1BVKB 2VJXA 5EOTB 2OP4H 4OKDA 2AJ3B 5C0FB 4G8GA 1LEKA 4GW4B 2EKJA 3O8XD 3QHFL 3C5ZB 3AY4A 4M1DL 5CP3H 5KN5A 4JANB 4GFTB 1OTUD 2AJZA 5DK2A 1A5FL 2VDQH 3FMGL 4NWTL 4PY8J 5B38B 3VMNA 4DZBA 4LAQL 2D9CA 4NC1E 5FO9A 1HI6A 2BNRD 4OLYL 1KN4H 4S1RL 4TUOB 4V1DA 1K2DB 3LKOB 3MRPB 5BZDB 1N4XL 4S1SH 3T0VA 3V0WH 4YDLC 3VWKA 4QHUA 3SDAA 1Q9WA 4GAGH 4KKNA 3CDGA 4QXTB 5KSBA 1CL7L 3OR7A 3FB6B 1OLLA 1W0YT 1KEML 3F6LA 4X4XA 1J88A 4U1MA 4QRRE 4KRLB 2QQQA 3DO7B 3T0DA 4HS6B 4NZDA 3ARZA 3AS3A 1TNNA 4N0RA 4AM0A 1I1CA 1S9WB 1Y0LA 3JWNC 3O2DL 5JOFB 1WAAF 3ARBC 4EN3B 5ELIA 1IM9B 3U7WL 3C5JA 3MLUL 3WNOA 5D93B 2BX5A 1I7TB 1KC5H 3D1MC 4NO3B 5E8EA 3TYGH 4BFGA 1AD0B 1HKLH 3BI9X 1T0NA 3SKJH 3F5WB 1IGMH 1F4XH 5IB2A 3DX7B 4NZUH 3GSNH 1K4DB 5IB3B 2H2SC 4G42A 4P4KD 3SKMB 2UVEA 4NWTH 3G08B 1OVZA 4PREB 2WZPD 3GB7B 2VLLB 2OQJA 2Z0BA 1HH6B 4XNZB 3RHWK 1LILA 2CIIB 3I3BA 3LQAH 2J5LC 1DUYA 5ANMA 4NKIL 4LSQL 3C8DA 1AY1H 3DV4B 1U8NA 1UJ3C 5F9DC 3M07A 4M48H 1ZLUK 4IMKC 2I07A 4LSVH 3PHQB 5ITFA 3BEVA 3NA4A 1SEQH 3WL9A 2PF6A 3J8F7 3A6CH 5BRZE 4DKFL 4CUCA 3KPRA 3MRFB 2FBJL 1V3LA 1X4ZA 2OMBA 2PETA 1MELA 2NPLX 2FRGP 4OTXH 3ZKQD 5L2KE 1S5HA 5FM8A 4JG0H 4X6FA 3WSQL 43C9B 4KHXH 1LK2B 3CK0L 4JB9H 5DRWA 5AZ2L 2YA0A 4XCNA 3VXPB 4MNQD 2X7LA 4RGMB 4TQEH 3MA9L 5IWLC 4C55A 3T4AB 4YHPB 4QNPE 3X11B 5MEOB 4DZ8B 5GGUB 2ICWB 3ES6B 5B3NA 3VXNB 5MENE 5B8CA 3RVVD 4LGPB 3UP1A 3BWUC 1XZ0A 2FZ3A 3VFVB 1YJDC 5EBWB 5KSUB 2BCKB 4H20L 1KEGH 3BQUA 3U79A 1SM3H 3KYOB 3RY5A 1PGRB 4Z7VB 4YHOH 5BVJB 4FQHB 3HC0B 5E94A 2RCSH 3ULUD 2RBLA 4D8PB 3QJHA 5B8CC 5I1GH 2O93L 4J8RA 4C58B 2IGFH 4NCC1 1PX4A 1P9MC 3L5WB 4ELMB 3ARTA 4PJBF 3RGVC 2DM3A 4U6XA 3T2PA 1EVUA 1EGJH 1VEOA 4EJ1C 3RWGB 2PW1B 1RUQL 2NZ9C 5DUML 5KSAA 4JFEE 1K5NB 4YDVB 2WP3O 4JO3H 2X4SB 5JO5B 2N7AA 1X5YA 5EPMB 4UIMB 3V6ZB 4LRIA 1KJ3L 1LP9B 2DYPA 4GG6B 1SJVA 1KB9J 4G7VL 4PJBB 3DSFL 1T0MA 3PABB 4HGWA 5F1IB 5IBUG 2YRPA 5EO9A 3MOAL 4XNZC 2P5EA 2FEDC 5E9DE 5ACLA 4TSAL 3G04B 2F53B 4NJ9H 4PJ5A 4P5KA 1H8SA 4V1DB 2NX5D 2PYFB 1JF5A 1FC1A 3W5NA 2DL9A 3KYMB 1G7LA 4JRWA 3ILQD 4XRCA 2V2TA 3QEHB 3CVHA 3EO9H 4NNXA 3WD5L 5FKAA 3VFGL 1VGEL 3CX5K 3KDMB 4KKAD 4PJGB 4A2MA 3AREA 4GO6B 3IAPA 3MLUH 4Q9BA 1AGEA 1MREL 2XQYK 4MYWB 1TQBC 5F9WB 3T3PE 3OZ9H 1HXYA 1UM6H 1OLZA 1D5MB 2YPKA 1WC7A 3QNYB 1RVFH 5EORH 1BX2A 3V4UL 4K8RC 2V2WA 4PGJA 5JLZA 5L9DH 4G6JH 4K2UH 1NDGA 3S37L 3VI3F 3QQ9C 1KG0A 3GSNA 1DBJL 4YBLB 2LVCA 4U1IB 3WHXA 1MCHA 4NKOB 4YGVB 3VXRE 3FRPA 5BOZG 3D0VB 4PREA 5CHNA 4YK4C 1MCDA 2OLDA 5FA4A 2FJGB 5J13C 4L3EA 4PS4H 2DWEA 4JM2C 1CDIA 1F6AB 3OJ2C 5E7FA 3O6FD 2CRZA 4RMVA 5HJ3B 4UQ3B 3QH3A 3VJ6B 3STLB 3VG0L 2XNAA 5I1CL 5ILTL 4XPHH 3RUGE 3HRPA 1T04A 3HZKA 4PJHA 2EDKA 3HS0A 4KMTL 4LPVA 4B50A 4JKMA 3HG1A 2YWZA 4F7PA 2Z31C 3C09C 4GOSA 3NTCH 1KIPA 4CNIB 5J7CC 2EKSB 2MJWA 5T1MA 2EXYD 5EFIA 5FUOL 2ZG3A 3P77B 5E2TH 3FRPG 5DEFB 1P4LA 1OCWL 3P0YL 3ARGA 3BGFC 1BOGB 4GH7B 4ODUB 5EZOL 2E9BA 3W39B 2FGZA 3I6GB 3QUYD 3ARGC 32C2A 2I24N 3NIFE 4OB5H 1X4YA 2HT2D 3VGEA 3NFPA 4P2CG 5FGCE 3OAZH 4Q58C 3AXLB 1DLFL 3QRGL 4HH9B 2KQMA 5IROA 4N9GA 4QHKJ 5HI4C 2FX9H 5EULV 1BBDH 2GY7B 3O6LH 1YZZA 1UCTA 2B8OT 1N3NA 1S7XB 3CC5B 2WUBL 5HHMD 2VOTA 3FOMA 4PGEB 3LEVH 1A7RH 4ZOBA 1RJLA 1MCQA 3VWJB 2Y4SA 5HHME 2EYTA 1S7UB 1T83A 3MODL 5JW5B 5MP6H 1T1ZA 1T89C 2CLRA 1H8NA 4HMCA 4ZS7L 1J1PL 3OXRA 4NHUA 1WIOA 4W4OA 5BMFL 4HS8L 1KLUB 4RAVB 1BJ8A 2WWMC 5JIHA 2EO1A 3O3DA 2BXZA 1VFUA 4D3CL 4DK3A 3H9SA 4QNPF 3EJJX 4K71C 2PTUA 3R4DA 1F3JB 1ZHNB 3PHOB 4K94H 1TVBA 2E9IA 2VDLH 4HFWA 4TSBL 3WLBA 3F7YA 4KK5C 2GSIB 2J4WH 4KXZH 3CUPB 1FQ9C 5DSCA 4ZOAA 1ZVYA 4LLUA 2G60H 4FQLH 4MCYA 3E2HB 1HYSD 1BECA 2Y72A 3QXAB 4GUPA 5AAMA 5AZEH 1A3QA 1DN0A 4EUPH 1GRWA 4WO4B 4JQIH 4OFIA 3VD4A 2N4IA 3MODH 2VLJE 5FHAL 3RGVA 1CXKA 5M94B 1FL5A 4W70A 5CIPA 2ED8A 3ARBD 3VXTA 5DYOB 2NTFB 1ZT4A 4HIJB 4L8SB 3VFGH 3PJSA 3GSOB 4WFHE 3R8BB 2EEBA 2HA1A 1JRHH 1KOAA 5JQ6L 5T1KD 4ACPA 5EA0H 3IDYC 1FNAA 4GW1A 1EEUA 3S34H 4HC1A 1A4KA 3BQUC 3TH4T 2HN7A 5CZVL 5I17B 1IAMA 1CGSH 3LKPB 3DMMA 1IGYB 4LLAA 4XC1H 5JOFA 1HHGA 3Q5YA 3VFSA 5KZCD 2GTWA 2XXCB 2RFXB 1CICD 4ZFGH 3V5KB 1SY6L 3ESUF 4K3DH 2OR9L 5J11B 1L0YA 3CXDH 4WVRA 4PJHF 2OZ4L 3KYNB 4U0RC 2UWEF 4UOJA 3KNBA 3SGDH 4MLSA 1OM3H 3I75A 3KPLA 1H3XA 2NCMA 3EFDH 5CFHA 1AQKL 4D9QD 3BDYH 4LEOB 2AQ1A 3GBNL 3DI2B 4OLWL 1YPZF 3B9EA 1I4FA 1F6AA 1X7QB 3N1MC 3U4EB 4ZG1A 3ZSSA 5IHUH 4D9LL 3AGVA 4CBPA 2NY0D 4LASL 1IQDA 2EIEA 3GIZL 4HS3A 3VRLE 5JA9A 4OGAD 2HRPL 3WXVH 4E42B 4NPYB 3ARDD 2QTEA 1T7VA 1EEZA 4JPVL 3KR3L 3KJ4C 4NC0B 4XBGB 3LN5B 3TA3B 3SCMD 3QUXA 2X44D 4M1GL 2Q8BH 4HX1B 4XXDA 5KZCB 3X3GH 2R0WH 1I9JH 2E6PA 4Y5XB 5J06A 3RWHB 5J1AB 2B4CL 1XEDA 5DVOA 5I8EA 2BK8A 2XACC 3IDIB 1DUYB 4AENA 2YEZB 2UZXB 4OM0H 5DA4A 4LLVA 4WWKC 3EO0A 1FN4A 3ZE1F 3DTXA 4IS6A 1FIEA 4J4PA 1N7ML 4O2CB 4N1CA 5EC2B 5ESQB 4KMQA 4A6YH 2AJXL 4MNQA 4JZJA 1JIBA 4R8WL 4NN6C 3QB7C 1GPOH 1KPRA 1U3HD 2IPKA 3WXWH 2Q87A 2VAJA 5DD1H 3GSUB 1N64L 4M93B 5GGVY 3BPLB 3PP4H 3F58H 2ZJSH 2Z31A 2PKDA 1PY4A 1T80A 4P48A 1BFOA 3SJVA 4F37K 4YZFF 1ORQA 4DZBB 5TPWL 3M17B 4YHOL 3QPQD 1XGQA 1MHPH 1J05B 3H3KA 1UCBH 3AROA 5LJYH 3Q6FB 2OSLA 1RPQA 5I1EH 1GC1C 3TJHC 3ULUH 2ICWI 3EHBD 5CBAB 1LWRA 1ETZA 2EC9T 2BOCB 4JM2A 2QADD 1L7TH 4TNWK 5EUOE 1PYWA 1SYSB 4JG1L 2V7NB 2Y5TB 2F58L 4FQIH 4WFGE 4LP4A 5GGTA 4HXBH 1INEL 1NFDE 1F3JA 2JKXA 4AT6A 5GGTH 4XPAL 1QYGH 3O4LD 1RY7B 2VZ3A 1ZVSB 5F70A 1D5IL 3T08A 4HJ0C 4NZUL 1NUGA 3DRQB 5C70A 4DOHE 3FO0H 3TCXA 4HWBA 5DD0H 4RGNB 3SDCC 1HXMB 3K2UL 4NT6A 4XPGL 3CMGA 1TVHB 5C0CA 4BUHA 5HHXL 3ZHDA 2DQIH 5TQ0H 4B41A 1T21A 5CEZL 5HYIA 3BX7C 5JHDE 3BRDA 3BUYA 4XBPA 4YHIB 3V79C 1I7ZB 1F4HA 2IH1A 4LSVL 1K5NA 3QDJD 3C9NA 3H42H 4ZPVB 2AEWA 3B5TA 1FFPB 3OKOA 4G43A 2UZYB 1U6AL 3KR3H 3PL6D 1CIUA 1AY1L 3BP7B 1NUFA 3L7EB 4PJCF 3L3IB 3H9SE 3QG6B 4PJXB 1MWAB 1MLBB 2HRPH 3I9GH 3WXVL 1MFEL 3E6HA 4NRZB 1G7HB 1MJJB 1HSBB 4W81A 3AREB 4C56B 4MZ3A 1I9RH 3IU4L 3EYUH 5D7IB 5JIPA 4K23H 2B1AH 3B4NA 4OIIH 1O7VA 5EDXA 1PEZA 1SJXA 5KS9E 1YYLL 4LIQH 3SPVB 3A6OA 3MA9H 3GI8L 2F53A 1MVUB 1KPUA 3MOAH 5F72S 1HWHB 2ARJQ 2EE9A 4EN3A 3BP4A 3NCJH 4ENED 5D1ZA 3QEGL 3FQTB 3QISA 2YRZA 3A6BH 3PWPB 3TBTA 1KXQE 4XAKD 1I1AB 1VEMA 5FGBA 3BGMA 4Y4FD 3QUYB 4GMSL 3BXNA 1KCSL 1KG0B 1FO0L 2J2ZA 1R0AH 3RVUD 2R0KL 4U1KA 1ZT7B 1MF2L 4G8FB 3T4AA 1IMHC 3E8UH 2BOBB 3MBED 4HD9A 3F7VA 2CXKA 1QLRA 4U31A 5FYLD 3CLFL 3GJFH 3K74B 4GKZA 3GMQB 3WO3B 5EBWA 3FRUA 4JVUA 4NNYB 3MLZH 3GBML 4UILL 2NY2D 3JTTB 4XVUC 1TETH 3OMZA 5C0RH 5JW4N 4O51B 5F6HJ 3WS3B 5I1GL 1F5WA 1IAIH 4RCAA 3QWOB 1IQWH 3WL9B 3QJHB 1YMMB 2X4QA 1I7TA 4NZTH 5JR1H 3LN9A 3QEUB 3EYUL 3F12B 1FAKT 4XNQA 4Z9KB 3BIAX 1JZ5A 5T5NF 3MRMB 3RNQA 4HX1A 4FRWA 5E1AB 5DGQA 1PEWA 3RIFK 4QHKI 3O9WA 3FQNA 3PIQA 4NKDB 5GPRA 3DMMD 1S7WB 3QDMB 1H8OA 2Q20A 5HY9B 4N68A 1TZGH 3DUUB 4Z18A 1T03H 4K3EH 4Y4FA 3JSSA 2V7HB 1P84K 5D7JD 3O3AA 4ZYKB 1LO2H 2CMRH 3ZKMD 4RMRA 1P7HL 3W0WD 3VH8B 5J0BA 1GZQB 1ZHBA 4PTUB 3KVQA 3H3BC 4Z7WB 2IPKB 4FQJL 5IVXA 1JPGA 4P2OB 1YC7A 5F88A 3JWDC 3QZWB 2IANE 4EXKA 4R0LA 1BQHB 5GGSA 4KMLB 4ERSL 1MY5A 4S1QL 1G6VK 3MJGX 32C2B 4POZD 1XF3B 3PWNA 5MP6L 4KJWD 4D8PA 4UNVA 3OF6D 1KF9B 3NZ8B 4QRUB 4EI6B 3TO4A 5HDQL 4H25B 4GRLD 2GQHA 3RA7L 3P4OB 4OCRL 4L4VB 2YUVA 4R2GD 3DVFA 5IB5B 1ADQA 1GGCH 1X9QA 1MCWW 4NP4L 4NNPH 3SCMA 3X12B 5C2UB 2DS4A 1Z2KA 1BBDL 3TBVB 4Y8DC 2HFGH 1I8LC 3BMWA 4CMMA 2HLAB 5DUPH 1KTRL 2GY5A 1BEYH 5ABDE 2PW2A 5ICYA 1S7UA 1EK3A 1PW3A 1OY3B 5D1XA 3LKQA 3GGWA 2O5YL 2H8PA 5I16A 1G9NC 5J9PA 3JUZA 1EHAA 1JMZA 4IMLB 4XAWH 4OFVA 5K9JL 5KVDH 4WIQA 5E8DL 4X5XA 3N85L 4EDXA 1E27A 5D1QC 1S78D 1DSFH 3SE9H 5E5MB 4MJIA 2B20A 2D31B 2P8LA 1IRAY 2R8SL 4GXUN 5IW6B 4ZUVB 4BFIA 4C59B 1S5IL 5KS9A 2ZG1A 5HDBF 4P9HL 1CFVL 1MH5A 4MDIA 1NCWH 4P5TC 5DSCB 4WW2F 4POUB 4MX7A 2A73A 1OTSD 2GHWB 2EH8H 1BLNA 1TTUA 2X42A 4EUPA 3SGEI 1FPTL 2N1KA 5HDQH 2BDNH 5EO0B 1YYML 5EOQL 2FSEB 1NBVL 1AGDA 3H9HB 4TUKL 3MXWH 1U8HB 2D7TH 1E4XH 5D7LA 2Z92B 3VFPB 1CLZH 4H8WC 1OTTC 3C60B 4QTIL 5T1KA 4XVSH 1CXHA 1J0IA 3BP4B 4NKMB 4MVBC 3TYFB 4YDIL 5BV7H 5IKCA 3R0NA 3OAZK 1PG7L 2VABA 3PP4L 1JK8B 2GJ6E 3BKYL 1P7KB 3DXAE 2APFA 5C09D 4CN6A 1IZKA 2CD0A 3UTTD 2Q86B 4Q7DA 1QSFA 1RHHB 4Y5VC 2BMKA 3SQOL 2AV1A 1WICA 3C6LC 2H1PL 4HUWA 5D7JC 4F7CB 1AGBA 3OB0H 3ZTNL 1FGVH 4UIKL 4DAGH 4Z8FL 4P2QD 1BF2A 3MXVH 2Y36H 2YUZA 4LLWA 4U1MB 5LXGL 3MJ8B 3PGFH 4LMQE 2RFXA 5FGSA 5I15H 1S3KL 4ZAKA 3T2OA 4WW2C 1CE1L 5SV3A 1OP3H 1NSNH 2VDRL 1OAKH 3M1BA 5D7IF 3NH7H 1QKZH 2FO4B 1A7OH 4FQXC 1UM6L 1TJIL 3GSVB 3NCYP 1Z9SA 5DO2C 3UYRL 3LEXA 1GGIL 4WHYH 3DVGB 1J1OH 3T65B 4DW2H 1A5FH 1KIQB 1WISA 2VDQL 5ADOH 5DMGC 4PB0L 1I9EA 1RZIA 1CLOH 1LK3L 4S1DC 2UUDK 2VDML 3L6FB 4RWHA 2EH7H 1S7WA 3CSBA 1G9NL 4M03A 1K8IA 2R9HD 3W9DA 6FABL 1BHGA 3SDXF 5GIRB 3ETBF 5JW4Q 1U6AH 4H1LA 4HF5L 1IAOA 2CDGA 4R90H 1C7TA 5HGHA 4LLUB 1JPFB 1T4KB 4MD0A 3FQUA 3W0WE 3LD8B 4X4ME 2HP4A 3IETA 2BSTB 4O2EB 4FG6D 1AQDA 4J1UB 3BVNB 1NCDH 3UX9B 3SHSA 1JGUH 4LLDA 3O6KL 3MQIA 3KPOA 2HFEB 1G7PB 1FO0A 1UADC 2EDXA 2HG5B 4WEMB 1U93B 1CFTA 1I8IB 1MFBH 1A6PA 5GSRA 1WWAX 4JRXA 5FYKL