1XFNA

Nmr structure of the ground state of the photoactive yellow protein lacking the n-terminal part
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title The solution structure of a transient photoreceptor intermediate: delta25 photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 14
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2004-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xfnA00
1V9YA 3LI8A 2EA9A 2KX6A 3ULFA 3GDIA 2VV6A 1EW0A 1LSVA 1T1BA 1OTAA 5HDSA 3UB7A 3LIFA 1LL8A 1Y28A 2CMNA 4DJ2A 2PR5A 1N9OA 5J7EA 4EW7A 2W27A 4MN5A 1D06A 4LLOB 1T1AA 4NXFA 3NOPC 3CLOA 2VLGA 4H6JB 4RQ9A 4GCZA 3LICA 2W0NA 2VV7A 4L9GA 3UE6A 1NWZA 2QKPA 4GW9A 3F1PB 4H6JA 3LUQA 5DJTA 1OTDA 1S4SA 1XJ4A 3H82B 2OWHA 1N9NA 5HWWA 3HJKA 2ZOHA 1S1YA 2PHYA 3F1PA 1OTEA 3VE4A 2V1BA 3SW1A 1XJ2A 4LRYC 4EERA 3A0SA 4KUOA 4K08A 3P7NA 4HP9A 1LT0A 4B9OA 2L4RA 4R70A 5F5YA 1T18A 2R78A 1UWPX 1S67L 2D01A 1GSVA 5HZHA 3ZQ5A 3E4QA 1LSWA 1MZUA 1DP6A 1TS7A 4NXBA 3K3DA 3FC7A 4WLAA 5DKLA 4EXOA 2L0WA 2KDKA 2ZOIA 4M4XA 2HV1A 5IS1A 3LIAA 4HJ3A 4HIAA 1TS6A 1TS8A 2I9VA 3H7WB 4EESA 1OT6A 2J80A 5EFWA 1ODVA 2B02A 4I5SA 4HQAA 4I38A 3H7WA 4F3LB 3UB9A 3EWKA 5DKKA 2A24B 4HH3A 4BBUA 1JNUA 1P0ZA 4DJ3A 5HD5A 4F3LA 4HI4A 4KQDA 4I3JA 1P97A 5TBMB 5F6AA 5A8BA 1DP9A 2A24A 4BBVA 3LIDA 1F98A 4R6LA 2QJ5A 1WA9A 5TBMA 3CAXA 4EEPA 2PYRA 2ZBBA 3PYPA 1OTBA 5J4EA 3RH8B 3G6OA 3MXQA 3LYXA 3BY8A 3MJQA 1S66L 3C2WA 3MQQA 5HSQA 1OTIA 4EEUA 3K3CA 4R38A 1N9LA 1BYWA 5I5LA 2PR6A 2OWJA 5HDCA 4HP4A 2L1MA 4YWZA 2QWSA 4R3AA 1XFQA 2V0WA 2P7JA 5F69A 4E04A 1V9ZA 2K7SA 1OJ5A 4I3IA 2JN7A 2WKQA 2H28A 4WF0A 3D72A 1GSXA 4GHIB 4KUKA 3MFXA 4PKYG 4HNBA 3NOTC 4LRZE 2YKFA 4WUJA 3UB8A 5HWTA 1X0OA 3OLOA 4GHIA 1GSWA 2JHEA 4XT2A 3LIEA 4HH2A 3A0RA 1S1ZA 3PHYA 2YKHA 2WKRA 4I39A 4JGQA 2V9AA 1S4RA 4HHDA 3E4PA 3NOUC 5HWVA 5F68A 5HD3A 2GJ3A 3UMEA 2PDRA 4HJ4A 4HJ6A 1T1CA 5J3WA 2PD7A 2V1AA 1OT9A 3HJIA 5AVFA 4L9EA 1G28A 5IU1A 3UMDA 4PKYA 4EQ1A 2VEAA 5G4YA 3B33A 3GECA 1KOUA 4JGRA 1TS0A 4LPZA 3MQOA 2Z6DA 3NJAA 3MR0A 3RTYA 4GS9B 4HY8A 1DP8A 3VE3A 4WL9A 5HDDA 3T50A 2M1CA 3E4OA 4WN5A 4I3AA 5AVEA 2V0UA 4GS9A 1LSXA 1UWNX 2INWA 1OJGA 3A0VA 3VOLA 2QHKA 1T19A 3IBRA 4MN6A 4EETB 1VB6A 3H82A 3KX0X 3C8CA 2PYPA 3H9WA 2OOLA 4NXGA 1XFNA 3BWLA 3LI9A 3F1NB 4NXEA 3FG8A 4HOIA 4JGOA 2Z6CA 1XJ3A 3NHQA 3IS2B 3ICYA 3CWFA 3F1OB 4XT2B 1D7EA 1UGUA 3F1NA 4JGPA 2VV8A 1F9IA 3BY9A 3LIBA 5DJUA 3UB6A 3IS2A 5KIZA 2WKPA 2D02A 4LRXC 3F1OA 1DRMA 2QJ7A 2BASA 1XJ6A 5G4ZA 3EEHA 2PD8A 4BBTA 4L9FA
chains in the Genus database with same CATH superfamily
2JKTM 5L07A 2EA9A 2EFUA 2J7VA 4EBNA 2VV6A 2C5WB 4P6ZM 2ZQ7A 5D3OA 5GLAA 1LL8A 3WWXA 2PR5A 1N9OA 1W5DA 3CUEC 1G5UA 2IWCA 2C6WB 4DKIA 2J8YA 4LLOB 3RJUA 1YPRA 3WS0A 4NXFA 4IJGA 4ZTKA 1JVJA 3KYZA 4U0TA 3UNWA 4GN2A 4JXVA 3V3SA 1FIKA 3VFFA 4GCZA 5CX7A 3ZDJA 4B4ZA 2W0NA 2Z2MB 4KZ9A 4GW9A 3E98A 2XEPA 3S1YA 3LR4A 5DJTA 4R1GA 4IBXA 1GA9A 1MBLA 4UA6A 4F94A 3V67A 4CLCB 1C3BA 1N9NA 3HJKA 4Y0UA 3CITA 4BL2A 3SS5A 5KSHA 2Q0OA 3NC8A 1MC0A 4X69A 4YNRA 2DRWA 3IF6C 3KSHA 4MDZA 1VHMA 1XJ2A 2R9WA 4LRYC 5IT5A 1TEMA 3BEBA 3KYEA 4KUOA 4BD1A 3K2NA 3S7PA 3GV9A 2O9AA 4JF6A 1D1JA 5A92A 4R70A 3DWKA 1K38A 2WKEA 3OCNA 2WUQA 1S67L 1GSVA 3VFHA 3BFDA 4QU3A 4S2JA 2XFSA 1L0EA 2G2WA 4EUZA 3M6HA 5AQBA 2B5RA 3IX3A 3UDIA 3GMWA 1EWZA 2HP9A 4Z9QA 3WS2A 2OSUA 2ZC4B 3BECA 4AFIA 2ZOIA 4DE3A 1LL9A 1EROA 3WRZA 3V3RA 1OPXA 4HJ3A 4HIAA 4UHUA 1CEGA 3IT9A 5CERA 5F1FA 1IYSA 3OPRA 1OT6A 2QYBA 3A3EA 5EFWA 1K6SA 1K4FA 1XP4A 4HQAA 5FDSA 3G32A 4I38A 3IX4A 3BFFA 3MZEA 5IHVA 1PIOA 5EOOA 1NLYA 5E2FA 3IHBA 3BJNA 4E3KA 2ZM0A 1L3LA 4QY5A 4MMNA 5CEBA 2XH9A 1VM1A 1O07A 4K0XA 5GHZA 2HF6A 2ZQAA 4NETA 3LEQA 5TBMB 2P04A 3ZFZA 1ONHA 1DP9A 2A24A 2FFYA 4R6LA 2QJ5A 4UQIM 3PBTA 1FQGA 1LI9A 2BTFP 4OONA 4LGWA 1BLPA 2WAEA 1ZHHB 3UDFA 4MBKA 3VP2A 3P01A 3E2LA 4JPMA 3RH8B 4JKTA 3C7UA 3O3VA 1STZA 3MJQA 4N9LA 5G18A 1Z09A 3TOIA 3BLMA 3MQQA 3Q1FA 3ZYTA 5HSQA 4IHQA 2ZJ9A 2X02A 4OLGA 3HUMA 5A90A 3UPOA 3BM6A 4X1LA 4YWZA 3WS4A 4FSFA 4BJPA 1K54A 1XFQA 4OLDA 1KGEA 3IQAA 4RYEA 4PM8A 1NY0A 1KE4A 4I3IA 2HDSA 2JN7A 2WKQA 1XX2A 4P6ZS 5F83A 3QP5A 3LR0A 4WF0A 3T1QB 2IWBA 3D72A 1VETB 2OLVA 2UV0E 2Y59A 2WYXA 5EE8A 5TJJA 1BLCA 5F82A 1SHVA 2EX2A 5E2HA 3DTEA 5CECA 5U47A 1X0OA 3MFDA 3KSGA 3MSHA 2O99A 1GSWA 3D4FA 3ZCZA 3A0RA 4DXCA 2P08A 4I39A 2WKRA 3JVVA 1M40A 4JGQA 1EI5A 3MF0A 3QP6A 2XFTA 1PI5A 5DTSA 3W2ZA 4ME4A 2CC1A 4QHCA 4DXBA 2J3TC 3LFVA 4BQMA 4CPKA 3CPTA 5DVAA 3UMDA 2A49A 5G4YA 1KGGA 3UE0A 3GECA 4LENA 5AJGA 1K55A 4G3KA 4LPZA 2FZ0A 1ZG6A 2Z6DA 1FSWA 5DF9A 2R9XA 3NJAA 3RTYA 2XA7S 2WGWA 4O8GA 2Y2QA 1IYQA 4HY8A 4YOFA 5J8XA 4ZJ2A 4Q0JA 3VE3A 2ZL1A 4EQIA 5E2EA 3E4OA 3IXBA 4WMCD 4GS9A 2Y4AA 3IBJA 3QP8A 3ITBA 2ZQDA 5EVID 4OOYA 4NG2A 2E8JA 2QHKA 5E43A 3ZHHA 5L8MA 4S2KA 1XGIA 3CJMA 4QD4A 3N6IA 2EWVA 1XKZA 2O9CA 4DDYA 3HLDA 1SDNA 3C8CA 1FR6A 5EVIA 1NJ4A 4NXGA 1XFNA 2NUPC 4WZ4A 4NXEA 4HOIA 1F2KA 2HP5A 1DJCA 4JF5A 1BLHA 1UGUA 5EOEA 2P9VA 3QNBA 4JGPA 4OKPA 3IWIA 1ZG4A 2XD5A 3V50A 4ZDXA 2H0YA 4IVKA 2RCXA 3F1OA 2ZC3B 4UA9A 4NK3A 5FDHA 3EEHA 3NECA 3LCEA 3PBSA 4UQIS 4BBTA 4YFMA 4E3LA 4L9FA 4QY6A 2H10A 3PR6A 1GHIA 3VP0A 4N9KA 4S2PA 3ULFA 3JYIA 3W4PA 4FUWA 4CLCE 3TE8A 4KQOA 1T1AA 2XQZA 1PRQA 1I2SA 5CHUA 3NOPC 4PPRA 4OP8A 4IVIA 2WAFA 3PAEA 3NDEA 3QP1A 4OQGA 5M19A 1RCJA 3LICA 4X55A 1YSPA 3R7WB 4II7A 2UWXA 2VV7A 4DRTA 2NUTC 3ZG5A 4KZ5A 1L0DA 1NWZA 5M1AA 3PBNA 1NZUA 1DY6A 4CLCC 1YLYA 3VP4A 5FAOA 4H6JA 2OAQ1 2EX6A 3LUQA 4EV4A 1OTDA 4KQQA 1XJ4A 3EQVA 2LB9A 2OWHA 5HWWA 4L0LA 2Q9NA 5CGSA 4YINA 1YKDA 1S1YA 3FYZA 2PHYA 1G6AA 1OTEA 3KSFA 4S2IA 2M7VA 3VE4A 1H8ZA 3GTCA 3SW1A 1GA0A 5JYOA 1CI9A 4G3WA 3P7NA 5FQQA 3NBLA 1CEFA 2H0TA 5GLBA 2DMWA 2L4RA 4MBHA 1Y54A 2R78A 1UWPX 2Y2NA 4NKPA 2HZ5A 3HBRA 2Y79A 4R3JA 5HZHA 3ZQ5A 4MNRA 1BLSA 5C5KA 1LSWA 3WRTA 1L0GA 1ES2A 1TS7A 1G68A 2WGVA 2M7UA 5DKLA 2L0WA 2Y2GA 2XLNA 1NRJA 5IS1A 5FL3A 4RX2A 1KGFA 3T1XA 1ES3A 4ARZA 2I9VA 4M3KA 3MBZA 4OPYA 3G34A 1HD8A 3BFGA 4EUVA 3KYQA 1NLZA 3LEZA 1SKOB 3MS6A 1MWTA 3S22A 1P9WA 3H7WA 1NRFA 3UB9A 4E6XA 1TD5A 4LV1A 3EWKA 5DKKA 2A24B 5HX9A 4DE2A 3OCLA 4IUHA 4DJ3A 5CTMA 4F3LA 4KQDA 5L2FA 1NYMA 5DFXA 5F6AA 4BBVA 3EOIA 3GR2A 3RXWA 3VMAA 4PAUA 4S2LA 1TVFA 1BULA 4BD0A 4D60A 2VGJA 2GX5A 4RX3A 4D2OA 3CAXA 3Q7VA 3T4LA 2ZBBA 2HJ9C 1W8QA 3IH9A 3DTIA 4JXWA 1L2SA 3M6BA 3G6OA 1P9RA 1ESIA 4ZJ1A 3LY3A 4Y17A 4OQ0A 1S66L 2XD1A 3KSIA 5MC7A 1PW1A 3HLCA 3CG5A 5FI6A 3UPPA 4R23A 4BENA 3TRCA 1BYWA 1BT5A 1S6RA 5I5LA 2XA7M 3LR5A 4WZ5A 2L1MA 2VGKA 1PNEA 2P7JA 5F69A 2E8IA 4E04A 2K31A 3G4PA 1OJ5A 4WM9A 4ZAMA 2H28A 4OOMA 2XR0A 5HARA 2VA0A 3DTMA 4X56A 1GSXA 5FQKA 2JE5A 1K57A 3WS5A 4OPZA 2IA2A 3MFXA 5FQMA 1DJBA 4HNBA 4WBGA 3BQAA 3NOTC 2FFFB 2P74A 1BTLA 3IHAA 4S2MA 5EVEA 1ALQA 1JWVA 1PWGA 2Y91A 3QHYA 1LL5A 4N1XA 4HH2A 2PAVP 2YKHA 4N1HA 1JWPA 1MKIA 5HWVA 5HD3A 3CPTB 1E3UD 2GJ3A 2I72A 3UB5P 1ES4A 1T1CA 3T4SA 3W8KA 3ZVWA 5E2GA 4FOFA 4KZ7A 3LY4A 2WGWB 4UEYA 1KOUA 2ZL1B 1ERMA 4KG6A 4JGRA 4OPRA 2Y8HA 2JKRI 1GCEA 3A3JA 5EECA 3SS4A 3HLWA 1H0MA 4FCFA 3T1SA 4GS9B 1W8YA 1FCMA 1DP8A 1XXMA 3QP4A 1GHMA 4IEDA 4BLMA 3SS3A 4JXGA 1DJAA 4R3BA 1ERQA 1BSGA 4OVDA 4CLCD 4WN5A 5AVEA 4OQIA 2FH5A 1LSXA 3MKFA 4S2NC 3VP1A 3CZDA 1I5QA 3A0VA 3VOLA 3IBRA 1KVLA 3ZG0A 3CHWP 3T4QA 1K4EA 3S7QA 2HGVA 4Y2FA 1Z6FA 4ETZA 1PWDA 5F1GA 3I7JA 3PBRA 1FILA 1SDEA 5FI2A 4EU0A 3H9WA 3BWLA 1E4DA 4P85A 3PXPA 2P9VB 2WGIA 3FG8A 2EXBA 4KZ8A 1Q2QA 1J3WA 2Z6CA 1XJ3A 3HLBA 2KLIA 2WKHA 2DNSA 5TR7A 4U3TA 2W3HA 3F1OB 4XT2B 3IX8A 4ZJ3A 4WEKA 1Q2PA 4PM6A 1F9IA 3BY9A 3TG9A 4UAAA 4GD8A 1YMSA 4PM5A 2W1RA 4E3OA 1CJFA 1H8MA 3OPHA 3IWOA 1V9YA 3EEAA 4Y0OA 4PHTA 2Y2MA 2KX6A 4X53A 1KE0A 1EW0A 3MXRA 1LSVA 1MWUA 1T1BA 3UB7A 3O88A 3UO9A 4EW7A 4MN5A 1D06A 3N8SA 2V2FF 5FEFA 5HAPA 3CLOA 2VLGA 5EVLA 4H6JB 3OPPA 1CQAA 4HESA 1YM1A 3AGDA 3P09A 5FA7A 2EXAA 5FASA 5HL6A 4L9GA 2V8FA 3HLEA 3UE6A 1ACFA 2QKPA 4LCLA 1ONGA 3CUEA 4LV2A 4BWIA 2Y2PA 2HPBA 3UE1A 4Q0HA 5CRFA 2OAP1 3H82B 4E3NA 3GSGA 3HVFA 3F1PA 3HUOA 2V1BA 2ZLYA 1RP5A 3LR3A 5AQ9A 1YT4A 3SOIA 4WMCA 4N92A 4HP9A 2V8CA 1LLBA 4MCWA 2PRFA 5F5YA 5FAPA 4Y0TA 4NEED 5HPIA 4U0XA 3N4IA 2D01A 1YSQA 3IF6A 5EM0A 1AXBA 5FQIA 3WS1A 1GHPA 1PYYA 3E4QA 1MZUA 3ZGAB 1YMXA 4ARZB 2O0YA 1WYBA 2V20A 3FC7A 1YLWA 3AGFA 4P6BA 1AWIA 2VJWA 2PT7A 4GJ4A 3C5AA 4EXOA 2ACGA 2B18A 4Y15A 4E6WA 2HV1A 5KSCA 3T4OA 1KE3A 2PBDP 3H7WB 1W63M 1K25A 1NYYA 4EESA 1O7EA 3KO6A 4WYYA 5CHMA 1ZTUA 2J80A 1ODVA 3N7WA 2B02A 4F3LB 1MPLA 1U60A 4OQHA 4OPQA 2A3UA 3OPLA 1ZC2A 3CI6A 2H5SA 5CGXA 1JNUA 5HD5A 2ZM2A 5M18A 1IOUA 1P97A 1SZVA 5CHJA 4JXSA 1FOFA 3Q7VB 3LIDA 1K56D 1F98A 1ESUA 4MN7A 2JKGA 3W4QA 2W1TA 1ES5A 2GDNA 3B42A 4JBFA 1YLPA 4PM7A 3VOZA 3PBOA 5L10A 5A93A 2PYRA 3A3DA 4KENB 4Y13A 5HW3A 4KZAA 3DW0A 1OTBA 4P0MA 3IXDA 5J4EA 4XUXA 4OOLA 2X01A 3LYXA 3BY8A 3HREA 4GLQA 4MLLA 5EV0A 2ZMAA 2JBFA 3C2WA 2BG1A 1N4OA 2ZQ8A 3ZNYA 5TFQA 2EWWA 3A3IA 3UPNA 1N9BA 2ZC7A 3UDXA 3C7VA 4R38A 1N9LA 2HJEA 2Z2LB 4B88A 5HDCA 4HP4A 4KG2A 3NIAA 2QWSA 5GL9A 4FH2A 1QMFA 4R3AA 4CJNA 1V9ZA 5K5BA 2K7SA 1XA1A 3B3XA 4RVAA 4EBLA 5FQJA 2ZD8A 5DF7A 1HZOA 3S7OA 1IFQA 3D3OA 2Y2LA 4PKYG 1K6RA 3L7HA 4LRZE 4WUJA 5CXWA 3Q7ZA 5HWTA 2ZMFA 4A5RA 3BQ8A 5I94A 1BZAA 4GHIA 3NI9A 4PMAA 1FCNA 3T1RA 1NXYA 2JHEA 4B93A 3LIEA 1MWRA 1S1ZA 3AGEA 3OBFA 5HFOA 4Y5FA 5HAIA 1FSYA 1HTZA 4Z1WA 3B47A 1S4RA 5HPFA 5HL1A 1K55C 3BYDA 3T4KA 3UMEA 5GHXA 4Y7PA 3ZVTA 4HJ6A 2VZWA 5TGFA 2WZXA 5J3WA 2PD7A 5CGWA 2V1AA 3HJIA 4GB7A 5AVFA 2Y2OA 2Y2KA 4RA7A 4QPRA 1SCWA 4PKYA 3MMHA 2J3TD 4EQ1A 2O9BA 4WELA 5DTTA 2ZMVA 2WK0A 5GLCA 3B33A 1H5XA 1TS0A 1YLJA 3MQ0A 3VSLA 2EX8A 5AQ7A 3HCYA 5FQ9A 4WL9A 3NDGA 2VX8A 1Y4OA 3OOVA 3M2JA 2VKSA 5EVIC 1SKFA 1I2WA 3R4KA 3R7WA 3HL9A 1K0KA 2V0UA 2QPNA 2INWA 2MJ6A 1CK3A 4FH4A 1S0WA 2JKRM 3FWLA 3P98A 5HAQA 3A3FA 4P87A 3QP2A 1W79A 5JYPA 3VP3A 2XDMA 4DN0A 4O01A 4X25A 1VQQA 1IYPA 2OOLA 5FI7A 2OV5A 1VEUA 3V5MA 4KZ3A 3IH8A 4HBTA 4JGOA 3T4JA 1YQSA 2JKTI 4IUKA 3ISGA 3FPVA 3NHQA 4WEJA 3CWFA 2X71A 3F1NA 1W7FA 3TW8A 3TSGA 3C4PA 1CF0A 5DJUA 4R0QA 3GRJA 3IS2A 5FEGA 5KIZA 1YLZA 2WKPA 4LRXC 1WYCA 1PI4A 4R4RA 1DRMA 3FKVA 2BASA 1XJ6A 5G4ZA 2PD8A 3LI8A 4E3IA 3PBQA 3SH8A 3V39A 3GDIA 2EFXA 1OTAA 1RGZA 5HDSA 3G31A 3LIFA 5FATA 2QMIA 1Y28A 2CMNA 4DJ2A 5J7EA 2XSSA 2W27A 2ZQCA 3PAGA 4DF6A 2BLSA 1E3UA 2WZZA 3ZG7B 3VV4A 1SKOA 5DFYA 4XXRA 1G6OA 2W3EA 4BMWA 3SH7A 4RQ9A 2VK3A 4EBPA 1E25A 3MXSA 3S4XA 4MBFA 2WADA 4KQRA 3VOYA 2G7UA 3F1PB 5EPHA 4G3VA 1S4SA 1FCOA 3MZDA 5EM1A 3IXGA 3O86A 3BRMA 5BOHA 4LFUA 2HDQA 5FSRA 2ZOHA 3DAVA 1J9MA 3G35A 5EVIB 3G30A 1FR1A 3RFBA 1MY8A 3G2ZA 1KDWA 4PM9A 4GOGA 2HDUA 3FPWA 4CLCA 4EERA 3A0SA 4K08A 3SH9A 4LV3A 3IF6B 4KG5A 4ESPA 1LT0A 1TF1A 4B9OA 1T18A 3SZTA 3GQZA 2VGLS 3ITAA 3T4TA 3HUNA 2GNXA 1XA7A 3QNCA 5DTKA 3Q81A 3TJZC 4ID4A 1JTDA 3EGDC 3O87A 2J9OA 3C4OA 3RXXA 1DP6A 4NXBA 4FTXA 1YAXA 4C6YA 3K3DA 2B95A 3IF5A 3IXHA 4WLAA 4ZBEA 2KDKA 3MZFA 1F5MA 4M4XA 3CMZA 3NULA 1WE4A 2ZC6B 3LIAA 1M6KA 4DE0A 1TS6A 3O5YA 1TS8A 2A2LA 3U2AA 2G2UA 3Q82A 4DE1A 3D9YA 1PFLA 2OLUA 2Q9MA 4O0PA 1KDSA 4I5SA 3OZHA 5GHYA 2EX9A 1XGJA 2XGNA 4HBUA 4OP5A 1W63Q 3ZG8B 4HH3A 4BBUA 2J3WA 5CEDA 1P0ZA 1PWCA 4X1MA 4FD8A 5GLDA 2W1TB 4EWFA 4HI4A 4I3JA 3FKWA 4Q0IA 2JC7A 5A8BA 4Y3IA 3EQUA 1IYOA 4IBRA 3N8RA 3DWZA 1WA9A 3N8LA 1KVMA 1LI0A 5TBMA 3DBAA 2QZ6A 4EEPA 3E0YA 3C38A 3PYPA 4GDNA 4WZ5C 1PW8A 4GD6A 2W3GA 3MXQA 1H3QA 1IKIA 3E2KA 1MWSA 2ZC5B 1L0FA 1OTIA 1TDGA 1IEMA 2IWDA 4EEUA 3K3CA 4KZ6A 1HVBA 1RGYA 2JCHA 1K57C 5KZHA 2Y2IA 3G2YA 3NY4A 3ZNTA 2PR6A 2OWJA 5CTNA 2LB5A 1JWZA 2V0WA 3NCKA 4DMZA 3LGOA 3HLFA 2W3DA 4Q8IA 4HEFA 5LBRA 3DTKA 3UN7A 4GZBA 1PZOA 1YLTA 5A91A 1OMEA 4GHIB 4KUKA 4LCMA 1ZKJA 3JVUA 4QWOA 1CI8A 4KZ4A 2DCFA 2ZQ9A 4OH0A 2YKFA 3UB8A 4C75A 4GKUA 2XRNA 3OLOA 3ZG9B 1VETA 3PTEA 4E3JA 5L09A 4BL3A 2HP6A 5AQAA 4XT2A 1LHYA 3BW6A 3PHYA 2V9AA 4HHDA 3E4PA 3NOUC 4O7DA 1TDLA 5F68A 4ZRRA 2PDRA 4HJ4A 3FV7A 4QB8A 3VSKA 2GZAA 3OC2A 3BFEA 1OT9A 4UA7A 2PBYA 3LO7A 4B4XA 4L9EA 3GVBA 1G28A 4X68A 4K91A 5IU1A 3T12B 2VEAA 3UE3A 3BFCA 2Y2JA 4H8RA 2KOIA 3MQOA 2RL3A 1HLUP 4C3QA 1A0KA 3MR0A 3U4LP 4GDBA 1K56A 1PZPA 4KZBA 3EGXC 3IWQA 5KMWA 5HDDA 3T50A 2ZM8A 1K54C 2M1CA 2W3FA 1IKGA 5EUAA 4I3AA 4JF4A 2Y55A 1MKMA 1MXOA 1UWNX 3L9KA 1OJGA 2PU2A 3HLGA 2JKFA 4R4SA 1XPBA 2WKIA 4X6TA 1T19A 4MN6A 4E3MA 4ETXA 4EETB 3FZCA 1VEUB 1VB6A 4LV0A 2XK1A 4JLFA 3H82A 3BLSA 1NZOA 4MEZA 2J9PA 3KX0X 2HDRA 5DF8A 4QJGA 2PYPA 2Y2HA 2K2NA 4XUZA 2AVXA 4CQHA 3LI9A 4S2NA 3F1NB 4DDSA 2XF3A 1JTGA 3IS2B 1H8YA 3ICYA 3UY6A 1D7EA 3S7NA 1QMEA 2VV8A 3W4OA 1BUEA 3LIBA 3M2KA 3UB6A 5FAQA 2V1ZA 2D02A 2XROA 3JPUA 4S2OA 2QJ7A 1IELA 2VGLM 2PU4A 4K0WA 3MKEA 4GNUA 3Q07A 3C30A
chains in the Genus database with same CATH topology
1V9YA 3EEAA 3LI8A 3PR6A 2JKTM 4PHTA 2EA9A 2KX6A 3ULFA 3PBQA 3GDIA 2VV6A 1EW0A 4P6ZM 1LSVA 1T1BA 1OTAA 5HDSA 3UB7A 3LIFA 1LL8A 4CLCE 1Y28A 2CMNA 3TE8A 2PR5A 1N9OA 2XSSA 4DJ2A 5J7EA 4EW7A 2W27A 3CUEC 4KQOA 4MN5A 1D06A 4LLOB 1T1AA 4NXFA 3VV4A 3NOPC 4IJGA 5DFYA 3CLOA 3KYZA 1G6OA 2VLGA 2W3EA 4H6JB 4BMWA 4RQ9A 4GCZA 5CX7A 3LICA 1YSPA 3R7WB 2W0NA 4II7A 5HL6A 2VV7A 4L9GA 2NUTC 3UE6A 1NWZA 2QKPA 3PBNA 4CLCC 3CUEA 4BWIA 4GW9A 2G7UA 3E98A 3F1PB 4G3VA 4H6JA 2OAQ1 3LR4A 3LUQA 5DJTA 1OTDA 1S4SA 4Q0HA 1XJ4A 3EQVA 2OAP1 3H82B 3V67A 2LB9A 2OWHA 4CLCB 1N9NA 5HWWA 3HJKA 4L0LA 3CITA 2ZOHA 1YKDA 1S1YA 5KSHA 2PHYA 3F1PA 1OTEA 3KSFA 2M7VA 3RFBA 1MC0A 3VE4A 2V1BA 4YNRA 3SW1A 3LR3A 3KSHA 4MDZA 1VHMA 3FPWA 1XJ2A 4LRYC 4CLCA 4EERA 5IT5A 4G3WA 3A0SA 4KUOA 4K08A 3P7NA 4HP9A 3K2NA 3S7PA 1LT0A 2O9AA 1TF1A 2DMWA 4B9OA 2L4RA 4MCWA 4R70A 5F5YA 1T18A 3OCNA 4NEED 5HPIA 2VGLS 3T4TA 2R78A 1UWPX 1S67L 2D01A 1GSVA 1YSQA 4NKPA 2GNXA 3TJZC 2Y79A 5HZHA 3ZQ5A 5C5KA 3E4QA 1LSWA 3EGDC 1MZUA 1DP6A 1TS7A 4NXBA 1YAXA 4ARZB 2O0YA 3K3DA 3FC7A 4WLAA 2M7UA 5DKLA 2VJWA 4GJ4A 2PT7A 4EXOA 2B18A 4AFIA 2L0WA 2KDKA 2ZOIA 1F5MA 4M4XA 2HV1A 1NRJA 5IS1A 5FL3A 3LIAA 3T4OA 1OPXA 4HJ3A 4HIAA 1TS6A 4ARZA 3O5YA 1TS8A 2I9VA 3H7WB 1W63M 2A2LA 4EESA 3U2AA 4EUVA 3KO6A 1OT6A 2QYBA 1ZTUA 3KYQA 2J80A 5EFWA 1NLZA 4O0PA 1ODVA 2B02A 4I5SA 4HQAA 1P9WA 4I38A 3H7WA 4F3LB 3UB9A 1TD5A 1W63Q 3EWKA 5DKKA 1NLYA 2A24B 3CI6A 4HH3A 4BBUA 1JNUA 2J3WA 3BJNA 1P0ZA 3OCLA 4IUHA 2W1TB 4DJ3A 4MMNA 5HD5A 4F3LA 4HI4A 4KQDA 4I3JA 1IOUA 4Q0IA 1P97A 2HF6A 5DFXA 5TBMB 5F6AA 2P04A 5A8BA 1DP9A 2A24A 4Y3IA 3EQUA 4BBVA 3LIDA 1F98A 3EOIA 4MN7A 4R6LA 4PAUA 2W1TA 2QJ5A 1WA9A 4UQIM 3PBTA 3B42A 5TBMA 2GX5A 3DBAA 3PBOA 3CAXA 3T4LA 2PYRA 4EEPA 2ZBBA 2HJ9C 3E0YA 3C38A 3PYPA 1ZHHB 1OTBA 3P01A 5J4EA 3RH8B 4OOLA 3G6OA 1P9RA 2W3GA 3MXQA 3LYXA 3BY8A 1STZA 3MJQA 1H3QA 4GLQA 1S66L 3C2WA 3MQQA 3KSIA 5MC7A 3ZYTA 5HSQA 1OTIA 4IHQA 2EWWA 4EEUA 3K3CA 4R38A 3TRCA 1N9LA 2HJEA 1BYWA 5I5LA 2PR6A 2OWJA 5HDCA 2XA7M 4HP4A 3LR5A 2LB5A 2L1MA 4YWZA 2QWSA 4FSFA 4BJPA 4R3AA 1XFQA 2V0WA 2P7JA 5F69A 4DMZA 4E04A 2K31A 1V9ZA 2W3DA 5K5BA 2K7SA 1OJ5A 4I3IA 2JN7A 2WKQA 4P6ZS 5LBRA 2H28A 4OOMA 3LR0A 4WF0A 2VA0A 3S7OA 1IFQA 3D72A 1GSXA 3D3OA 4GHIB 4KUKA 2IA2A 3MFXA 3JVUA 5TJJA 4PKYG 4HNBA 3BQAA 3NOTC 4LRZE 2YKFA 4WUJA 3UB8A 5HWTA 2XRNA 1X0OA 2ZMFA 3OLOA 3BQ8A 3KSGA 2O99A 4GHIA 1GSWA 2JHEA 4B93A 4XT2A 3LIEA 4HH2A 3A0RA 1S1ZA 3OBFA 3BW6A 4Y5FA 3PHYA 2P08A 4Z1WA 2YKHA 2WKRA 3JVVA 4I39A 4JGQA 3B47A 3MF0A 2V9AA 1S4RA 4HHDA 5HPFA 3E4PA 3NOUC 5HWVA 5F68A 5HD3A 4ZRRA 3T4KA 2GJ3A 3UMEA 2PDRA 4HJ4A 4HJ6A 3W2ZA 4ME4A 1T1CA 2VZWA 3T4SA 2GZAA 3OC2A 5J3WA 2PD7A 2V1AA 2J3TC 1OT9A 4FOFA 3HJIA 3LFVA 5AVFA 4L9EA 1G28A 4QPRA 5IU1A 3UMDA 4PKYA 3MMHA 2J3TD 4EQ1A 2O9BA 4WELA 2ZMVA 2VEAA 4UEYA 5G4YA 3B33A 3UE3A 3GECA 1KOUA 5AJGA 4G3KA 4JGRA 1TS0A 2Y8HA 4LPZA 2FZ0A 2JKRI 2KOIA 3MQOA 2Z6DA 5DF9A 3NJAA 3MR0A 3RTYA 3MQ0A 2XA7S 4O8GA 4GS9B 4HY8A 4YOFA 3EGXC 1DP8A 3HCYA 4Q0JA 3VE3A 4WL9A 5HDDA 3T50A 2VX8A 2W3FA 2M1CA 3OOVA 2VKSA 3E4OA 4CLCD 3R4KA 3R7WA 4WN5A 4I3AA 5AVEA 2V0UA 2FH5A 4GS9A 1LSXA 3IBJA 1MKMA 1UWNX 2INWA 2MJ6A 1OJGA 3A0VA 3VOLA 2QHKA 1T19A 3IBRA 2JKRM 4MN6A 5L8MA 4EETB 4ETXA 1VB6A 3T4QA 3H82A 2EWVA 3S7QA 2HGVA 4Y2FA 2O9CA 4ETZA 3PBRA 4DN0A 3KX0X 4O01A 3C8CA 4EU0A 2PYPA 3H9WA 2OOLA 2K2NA 4NXGA 1XFNA 3BWLA 4CQHA 3LI9A 2NUPC 3F1NB 3PXPA 4NXEA 3FG8A 4HOIA 4JGOA 3T4JA 2JKTI 2Z6CA 4IUKA 1XJ3A 3FPVA 3NHQA 2KLIA 3IS2B 4WEJA 3ICYA 3CWFA 2W3HA 3F1OB 4XT2B 1D7EA 3S7NA 4WEKA 1UGUA 3F1NA 4JGPA 3TW8A 2VV8A 1F9IA 3BY9A 3LIBA 5DJUA 3UB6A 3IS2A 5KIZA 2WKPA 2D02A 4LRXC 2XROA 3F1OA 1DRMA 2QJ7A 2VGLM 2BASA 1XJ6A 2W1RA 3EEHA 5G4ZA 2PD8A 1H8MA 3PBSA 4UQIS 4BBTA 4L9FA 3C30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9Y A;  3LI8 A;  2EA9 A;  2KX6 A;  3ULF A;  3GDI A;  2VV6 A;  1EW0 A;  1LSV A;  1T1B A;  1OTA A;  5HDS A;  3UB7 A;  3LIF A;  1LL8 A;  1Y28 A;  2CMN A;  4DJ2 A;  2PR5 A;  1N9O A;  5J7E A;  4EW7 A;  2W27 A;  4MN5 A;  1D06 A;  4LLO B;  1T1A A;  4NXF A;  3NOP C;  3CLO A;  2VLG A;  4H6J B;  4RQ9 A;  4GCZ A;  3LIC A;  2W0N A;  2VV7 A;  4L9G A;  3UE6 A;  1NWZ A;  2QKP A;  4GW9 A;  3F1P B;  4H6J A;  3LUQ A;  5DJT A;  1OTD A;  1S4S A;  1XJ4 A;  3H82 B;  2OWH A;  1N9N A;  5HWW A;  3HJK A;  2ZOH A;  1S1Y A;  2PHY A;  3F1P A;  1OTE A;  3VE4 A;  2V1B A;  3SW1 A;  1XJ2 A;  4LRY C;  4EER A;  3A0S A;  4KUO A;  4K08 A;  3P7N A;  4HP9 A;  1LT0 A;  4B9O A;  2L4R A;  4R70 A;  5F5Y A;  1T18 A;  2R78 A;  1UWP X;  1S67 L;  2D01 A;  1GSV A;  5HZH A;  3ZQ5 A;  3E4Q A;  1LSW A;  1MZU A;  1DP6 A;  1TS7 A;  4NXB A;  3K3D A;  3FC7 A;  4WLA A;  5DKL A;  4EXO A;  2L0W A;  2KDK A;  2ZOI A;  4M4X A;  2HV1 A;  5IS1 A;  3LIA A;  4HJ3 A;  4HIA A;  1TS6 A;  1TS8 A;  2I9V A;  3H7W B;  4EES A;  1OT6 A;  2J80 A;  5EFW A;  1ODV A;  2B02 A;  4I5S A;  4HQA A;  4I38 A;  3H7W A;  4F3L B;  3UB9 A;  3EWK A;  5DKK A;  2A24 B;  4HH3 A;  4BBU A;  1JNU A;  1P0Z A;  4DJ3 A;  5HD5 A;  4F3L A;  4HI4 A;  4KQD A;  4I3J A;  1P97 A;  5TBM B;  5F6A A;  5A8B A;  1DP9 A;  2A24 A;  4BBV A;  3LID A;  1F98 A;  4R6L A;  2QJ5 A;  1WA9 A;  5TBM A;  3CAX A;  4EEP A;  2PYR A;  2ZBB A;  3PYP A;  1OTB A;  5J4E A;  3RH8 B;  3G6O A;  3MXQ A;  3LYX A;  3BY8 A;  3MJQ A;  1S66 L;  3C2W A;  3MQQ A;  5HSQ A;  1OTI A;  4EEU A;  3K3C A;  4R38 A;  1N9L A;  1BYW A;  5I5L A;  2PR6 A;  2OWJ A;  5HDC A;  4HP4 A;  2L1M A;  4YWZ A;  2QWS A;  4R3A A;  1XFQ A;  2V0W A;  2P7J A;  5F69 A;  4E04 A;  1V9Z A;  2K7S A;  1OJ5 A;  4I3I A;  2JN7 A;  2WKQ A;  2H28 A;  4WF0 A;  3D72 A;  1GSX A;  4GHI B;  4KUK A;  3MFX A;  4PKY G;  4HNB A;  3NOT C;  4LRZ E;  2YKF A;  4WUJ A;  3UB8 A;  5HWT A;  1X0O A;  3OLO A;  4GHI A;  1GSW A;  2JHE A;  4XT2 A;  3LIE A;  4HH2 A;  3A0R A;  1S1Z A;  3PHY A;  2YKH A;  2WKR A;  4I39 A;  4JGQ A;  2V9A A;  1S4R A;  4HHD A;  3E4P A;  3NOU C;  5HWV A;  5F68 A;  5HD3 A;  2GJ3 A;  3UME A;  2PDR A;  4HJ4 A;  4HJ6 A;  1T1C A;  5J3W A;  2PD7 A;  2V1A A;  1OT9 A;  3HJI A;  5AVF A;  4L9E A;  1G28 A;  5IU1 A;  3UMD A;  4PKY A;  4EQ1 A;  2VEA A;  5G4Y A;  3B33 A;  3GEC A;  1KOU A;  4JGR A;  1TS0 A;  4LPZ A;  3MQO A;  2Z6D A;  3NJA A;  3MR0 A;  3RTY A;  4GS9 B;  4HY8 A;  1DP8 A;  3VE3 A;  4WL9 A;  5HDD A;  3T50 A;  2M1C A;  3E4O A;  4WN5 A;  4I3A A;  5AVE A;  2V0U A;  4GS9 A;  1LSX A;  1UWN X;  2INW A;  1OJG A;  3A0V A;  3VOL A;  2QHK A;  1T19 A;  3IBR A;  4MN6 A;  4EET B;  1VB6 A;  3H82 A;  3KX0 X;  3C8C A;  2PYP A;  3H9W A;  2OOL A;  4NXG A;  1XFN A;  3BWL A;  3LI9 A;  3F1N B;  4NXE A;  3FG8 A;  4HOI A;  4JGO A;  2Z6C A;  1XJ3 A;  3NHQ A;  3IS2 B;  3ICY A;  3CWF A;  3F1O B;  4XT2 B;  1D7E A;  1UGU A;  3F1N A;  4JGP A;  2VV8 A;  1F9I A;  3BY9 A;  3LIB A;  5DJU A;  3UB6 A;  3IS2 A;  5KIZ A;  2WKP A;  2D02 A;  4LRX C;  3F1O A;  1DRM A;  2QJ7 A;  2BAS A;  1XJ6 A;  5G4Z A;  3EEH A;  2PD8 A;  4BBT A;  4L9F A; 
#chains in the Genus database with same CATH topology
 2JKT M;  5L07 A;  2EA9 A;  2EFU A;  2J7V A;  4EBN A;  2VV6 A;  2C5W B;  4P6Z M;  2ZQ7 A;  5D3O A;  5GLA A;  1LL8 A;  3WWX A;  2PR5 A;  1N9O A;  1W5D A;  3CUE C;  1G5U A;  2IWC A;  2C6W B;  4DKI A;  2J8Y A;  4LLO B;  3RJU A;  1YPR A;  3WS0 A;  4NXF A;  4IJG A;  4ZTK A;  1JVJ A;  3KYZ A;  4U0T A;  3UNW A;  4GN2 A;  4JXV A;  3V3S A;  1FIK A;  3VFF A;  4GCZ A;  5CX7 A;  3ZDJ A;  4B4Z A;  2W0N A;  2Z2M B;  4KZ9 A;  4GW9 A;  3E98 A;  2XEP A;  3S1Y A;  3LR4 A;  5DJT A;  4R1G A;  4IBX A;  1GA9 A;  1MBL A;  4UA6 A;  4F94 A;  3V67 A;  4CLC B;  1C3B A;  1N9N A;  3HJK A;  4Y0U A;  3CIT A;  4BL2 A;  3SS5 A;  5KSH A;  2Q0O A;  3NC8 A;  1MC0 A;  4X69 A;  4YNR A;  2DRW A;  3IF6 C;  3KSH A;  4MDZ A;  1VHM A;  1XJ2 A;  2R9W A;  4LRY C;  5IT5 A;  1TEM A;  3BEB A;  3KYE A;  4KUO A;  4BD1 A;  3K2N A;  3S7P A;  3GV9 A;  2O9A A;  4JF6 A;  1D1J A;  5A92 A;  4R70 A;  3DWK A;  1K38 A;  2WKE A;  3OCN A;  2WUQ A;  1S67 L;  1GSV A;  3VFH A;  3BFD A;  4QU3 A;  4S2J A;  2XFS A;  1L0E A;  2G2W A;  4EUZ A;  3M6H A;  5AQB A;  2B5R A;  3IX3 A;  3UDI A;  3GMW A;  1EWZ A;  2HP9 A;  4Z9Q A;  3WS2 A;  2OSU A;  2ZC4 B;  3BEC A;  4AFI A;  2ZOI A;  4DE3 A;  1LL9 A;  1ERO A;  3WRZ A;  3V3R A;  1OPX A;  4HJ3 A;  4HIA A;  4UHU A;  1CEG A;  3IT9 A;  5CER A;  5F1F A;  1IYS A;  3OPR A;  1OT6 A;  2QYB A;  3A3E A;  5EFW A;  1K6S A;  1K4F A;  1XP4 A;  4HQA A;  5FDS A;  3G32 A;  4I38 A;  3IX4 A;  3BFF A;  3MZE A;  5IHV A;  1PIO A;  5EOO A;  1NLY A;  5E2F A;  3IHB A;  3BJN A;  4E3K A;  2ZM0 A;  1L3L A;  4QY5 A;  4MMN A;  5CEB A;  2XH9 A;  1VM1 A;  1O07 A;  4K0X A;  5GHZ A;  2HF6 A;  2ZQA A;  4NET A;  3LEQ A;  5TBM B;  2P04 A;  3ZFZ A;  1ONH A;  1DP9 A;  2A24 A;  2FFY A;  4R6L A;  2QJ5 A;  4UQI M;  3PBT A;  1FQG A;  1LI9 A;  2BTF P;  4OON A;  4LGW A;  1BLP A;  2WAE A;  1ZHH B;  3UDF A;  4MBK A;  3VP2 A;  3P01 A;  3E2L A;  4JPM A;  3RH8 B;  4JKT A;  3C7U A;  3O3V A;  1STZ A;  3MJQ A;  4N9L A;  5G18 A;  1Z09 A;  3TOI A;  3BLM A;  3MQQ A;  3Q1F A;  3ZYT A;  5HSQ A;  4IHQ A;  2ZJ9 A;  2X02 A;  4OLG A;  3HUM A;  5A90 A;  3UPO A;  3BM6 A;  4X1L A;  4YWZ A;  3WS4 A;  4FSF A;  4BJP A;  1K54 A;  1XFQ A;  4OLD A;  1KGE A;  3IQA A;  4RYE A;  4PM8 A;  1NY0 A;  1KE4 A;  4I3I A;  2HDS A;  2JN7 A;  2WKQ A;  1XX2 A;  4P6Z S;  5F83 A;  3QP5 A;  3LR0 A;  4WF0 A;  3T1Q B;  2IWB A;  3D72 A;  1VET B;  2OLV A;  2UV0 E;  2Y59 A;  2WYX A;  5EE8 A;  5TJJ A;  1BLC A;  5F82 A;  1SHV A;  2EX2 A;  5E2H A;  3DTE A;  5CEC A;  5U47 A;  1X0O A;  3MFD A;  3KSG A;  3MSH A;  2O99 A;  1GSW A;  3D4F A;  3ZCZ A;  3A0R A;  4DXC A;  2P08 A;  4I39 A;  2WKR A;  3JVV A;  1M40 A;  4JGQ A;  1EI5 A;  3MF0 A;  3QP6 A;  2XFT A;  1PI5 A;  5DTS A;  3W2Z A;  4ME4 A;  2CC1 A;  4QHC A;  4DXB A;  2J3T C;  3LFV A;  4BQM A;  4CPK A;  3CPT A;  5DVA A;  3UMD A;  2A49 A;  5G4Y A;  1KGG A;  3UE0 A;  3GEC A;  4LEN A;  5AJG A;  1K55 A;  4G3K A;  4LPZ A;  2FZ0 A;  1ZG6 A;  2Z6D A;  1FSW A;  5DF9 A;  2R9X A;  3NJA A;  3RTY A;  2XA7 S;  2WGW A;  4O8G A;  2Y2Q A;  1IYQ A;  4HY8 A;  4YOF A;  5J8X A;  4ZJ2 A;  4Q0J A;  3VE3 A;  2ZL1 A;  4EQI A;  5E2E A;  3E4O A;  3IXB A;  4WMC D;  4GS9 A;  2Y4A A;  3IBJ A;  3QP8 A;  3ITB A;  2ZQD A;  5EVI D;  4OOY A;  4NG2 A;  2E8J A;  2QHK A;  5E43 A;  3ZHH A;  5L8M A;  4S2K A;  1XGI A;  3CJM A;  4QD4 A;  3N6I A;  2EWV A;  1XKZ A;  2O9C A;  4DDY A;  3HLD A;  1SDN A;  3C8C A;  1FR6 A;  5EVI A;  1NJ4 A;  4NXG A;  1XFN A;  2NUP C;  4WZ4 A;  4NXE A;  4HOI A;  1F2K A;  2HP5 A;  1DJC A;  4JF5 A;  1BLH A;  1UGU A;  5EOE A;  2P9V A;  3QNB A;  4JGP A;  4OKP A;  3IWI A;  1ZG4 A;  2XD5 A;  3V50 A;  4ZDX A;  2H0Y A;  4IVK A;  2RCX A;  3F1O A;  2ZC3 B;  4UA9 A;  4NK3 A;  5FDH A;  3EEH A;  3NEC A;  3LCE A;  3PBS A;  4UQI S;  4BBT A;  4YFM A;  4E3L A;  4L9F A;  4QY6 A;  2H10 A;  3PR6 A;  1GHI A;  3VP0 A;  4N9K A;  4S2P A;  3ULF A;  3JYI A;  3W4P A;  4FUW A;  4CLC E;  3TE8 A;  4KQO A;  1T1A A;  2XQZ A;  1PRQ A;  1I2S A;  5CHU A;  3NOP C;  4PPR A;  4OP8 A;  4IVI A;  2WAF A;  3PAE A;  3NDE A;  3QP1 A;  4OQG A;  5M19 A;  1RCJ A;  3LIC A;  4X55 A;  1YSP A;  3R7W B;  4II7 A;  2UWX A;  2VV7 A;  4DRT A;  2NUT C;  3ZG5 A;  4KZ5 A;  1L0D A;  1NWZ A;  5M1A A;  3PBN A;  1NZU A;  1DY6 A;  4CLC C;  1YLY A;  3VP4 A;  5FAO A;  4H6J A;  2OAQ 1;  2EX6 A;  3LUQ A;  4EV4 A;  1OTD A;  4KQQ A;  1XJ4 A;  3EQV A;  2LB9 A;  2OWH A;  5HWW A;  4L0L A;  2Q9N A;  5CGS A;  4YIN A;  1YKD A;  1S1Y A;  3FYZ A;  2PHY A;  1G6A A;  1OTE A;  3KSF A;  4S2I A;  2M7V A;  3VE4 A;  1H8Z A;  3GTC A;  3SW1 A;  1GA0 A;  5JYO A;  1CI9 A;  4G3W A;  3P7N A;  5FQQ A;  3NBL A;  1CEF A;  2H0T A;  5GLB A;  2DMW A;  2L4R A;  4MBH A;  1Y54 A;  2R78 A;  1UWP X;  2Y2N A;  4NKP A;  2HZ5 A;  3HBR A;  2Y79 A;  4R3J A;  5HZH A;  3ZQ5 A;  4MNR A;  1BLS A;  5C5K A;  1LSW A;  3WRT A;  1L0G A;  1ES2 A;  1TS7 A;  1G68 A;  2WGV A;  2M7U A;  5DKL A;  2L0W A;  2Y2G A;  2XLN A;  1NRJ A;  5IS1 A;  5FL3 A;  4RX2 A;  1KGF A;  3T1X A;  1ES3 A;  4ARZ A;  2I9V A;  4M3K A;  3MBZ A;  4OPY A;  3G34 A;  1HD8 A;  3BFG A;  4EUV A;  3KYQ A;  1NLZ A;  3LEZ A;  1SKO B;  3MS6 A;  1MWT A;  3S22 A;  1P9W A;  3H7W A;  1NRF A;  3UB9 A;  4E6X A;  1TD5 A;  4LV1 A;  3EWK A;  5DKK A;  2A24 B;  5HX9 A;  4DE2 A;  3OCL A;  4IUH A;  4DJ3 A;  5CTM A;  4F3L A;  4KQD A;  5L2F A;  1NYM A;  5DFX A;  5F6A A;  4BBV A;  3EOI A;  3GR2 A;  3RXW A;  3VMA A;  4PAU A;  4S2L A;  1TVF A;  1BUL A;  4BD0 A;  4D60 A;  2VGJ A;  2GX5 A;  4RX3 A;  4D2O A;  3CAX A;  3Q7V A;  3T4L A;  2ZBB A;  2HJ9 C;  1W8Q A;  3IH9 A;  3DTI A;  4JXW A;  1L2S A;  3M6B A;  3G6O A;  1P9R A;  1ESI A;  4ZJ1 A;  3LY3 A;  4Y17 A;  4OQ0 A;  1S66 L;  2XD1 A;  3KSI A;  5MC7 A;  1PW1 A;  3HLC A;  3CG5 A;  5FI6 A;  3UPP A;  4R23 A;  4BEN A;  3TRC A;  1BYW A;  1BT5 A;  1S6R A;  5I5L A;  2XA7 M;  3LR5 A;  4WZ5 A;  2L1M A;  2VGK A;  1PNE A;  2P7J A;  5F69 A;  2E8I A;  4E04 A;  2K31 A;  3G4P A;  1OJ5 A;  4WM9 A;  4ZAM A;  2H28 A;  4OOM A;  2XR0 A;  5HAR A;  2VA0 A;  3DTM A;  4X56 A;  1GSX A;  5FQK A;  2JE5 A;  1K57 A;  3WS5 A;  4OPZ A;  2IA2 A;  3MFX A;  5FQM A;  1DJB A;  4HNB A;  4WBG A;  3BQA A;  3NOT C;  2FFF B;  2P74 A;  1BTL A;  3IHA A;  4S2M A;  5EVE A;  1ALQ A;  1JWV A;  1PWG A;  2Y91 A;  3QHY A;  1LL5 A;  4N1X A;  4HH2 A;  2PAV P;  2YKH A;  4N1H A;  1JWP A;  1MKI A;  5HWV A;  5HD3 A;  3CPT B;  1E3U D;  2GJ3 A;  2I72 A;  3UB5 P;  1ES4 A;  1T1C A;  3T4S A;  3W8K A;  3ZVW A;  5E2G A;  4FOF A;  4KZ7 A;  3LY4 A;  2WGW B;  4UEY A;  1KOU A;  2ZL1 B;  1ERM A;  4KG6 A;  4JGR A;  4OPR A;  2Y8H A;  2JKR I;  1GCE A;  3A3J A;  5EEC A;  3SS4 A;  3HLW A;  1H0M A;  4FCF A;  3T1S A;  4GS9 B;  1W8Y A;  1FCM A;  1DP8 A;  1XXM A;  3QP4 A;  1GHM A;  4IED A;  4BLM A;  3SS3 A;  4JXG A;  1DJA A;  4R3B A;  1ERQ A;  1BSG A;  4OVD A;  4CLC D;  4WN5 A;  5AVE A;  4OQI A;  2FH5 A;  1LSX A;  3MKF A;  4S2N C;  3VP1 A;  3CZD A;  1I5Q A;  3A0V A;  3VOL A;  3IBR A;  1KVL A;  3ZG0 A;  3CHW P;  3T4Q A;  1K4E A;  3S7Q A;  2HGV A;  4Y2F A;  1Z6F A;  4ETZ A;  1PWD A;  5F1G A;  3I7J A;  3PBR A;  1FIL A;  1SDE A;  5FI2 A;  4EU0 A;  3H9W A;  3BWL A;  1E4D A;  4P85 A;  3PXP A;  2P9V B;  2WGI A;  3FG8 A;  2EXB A;  4KZ8 A;  1Q2Q A;  1J3W A;  2Z6C A;  1XJ3 A;  3HLB A;  2KLI A;  2WKH A;  2DNS A;  5TR7 A;  4U3T A;  2W3H A;  3F1O B;  4XT2 B;  3IX8 A;  4ZJ3 A;  4WEK A;  1Q2P A;  4PM6 A;  1F9I A;  3BY9 A;  3TG9 A;  4UAA A;  4GD8 A;  1YMS A;  4PM5 A;  2W1R A;  4E3O A;  1CJF A;  1H8M A;  3OPH A;  3IWO A;  1V9Y A;  3EEA A;  4Y0O A;  4PHT A;  2Y2M A;  2KX6 A;  4X53 A;  1KE0 A;  1EW0 A;  3MXR A;  1LSV A;  1MWU A;  1T1B A;  3UB7 A;  3O88 A;  3UO9 A;  4EW7 A;  4MN5 A;  1D06 A;  3N8S A;  2V2F F;  5FEF A;  5HAP A;  3CLO A;  2VLG A;  5EVL A;  4H6J B;  3OPP A;  1CQA A;  4HES A;  1YM1 A;  3AGD A;  3P09 A;  5FA7 A;  2EXA A;  5FAS A;  5HL6 A;  4L9G A;  2V8F A;  3HLE A;  3UE6 A;  1ACF A;  2QKP A;  4LCL A;  1ONG A;  3CUE A;  4LV2 A;  4BWI A;  2Y2P A;  2HPB A;  3UE1 A;  4Q0H A;  5CRF A;  2OAP 1;  3H82 B;  4E3N A;  3GSG A;  3HVF A;  3F1P A;  3HUO A;  2V1B A;  2ZLY A;  1RP5 A;  3LR3 A;  5AQ9 A;  1YT4 A;  3SOI A;  4WMC A;  4N92 A;  4HP9 A;  2V8C A;  1LLB A;  4MCW A;  2PRF A;  5F5Y A;  5FAP A;  4Y0T A;  4NEE D;  5HPI A;  4U0X A;  3N4I A;  2D01 A;  1YSQ A;  3IF6 A;  5EM0 A;  1AXB A;  5FQI A;  3WS1 A;  1GHP A;  1PYY A;  3E4Q A;  1MZU A;  3ZGA B;  1YMX A;  4ARZ B;  2O0Y A;  1WYB A;  2V20 A;  3FC7 A;  1YLW A;  3AGF A;  4P6B A;  1AWI A;  2VJW A;  2PT7 A;  4GJ4 A;  3C5A A;  4EXO A;  2ACG A;  2B18 A;  4Y15 A;  4E6W A;  2HV1 A;  5KSC A;  3T4O A;  1KE3 A;  2PBD P;  3H7W B;  1W63 M;  1K25 A;  1NYY A;  4EES A;  1O7E A;  3KO6 A;  4WYY A;  5CHM A;  1ZTU A;  2J80 A;  1ODV A;  3N7W A;  2B02 A;  4F3L B;  1MPL A;  1U60 A;  4OQH A;  4OPQ A;  2A3U A;  3OPL A;  1ZC2 A;  3CI6 A;  2H5S A;  5CGX A;  1JNU A;  5HD5 A;  2ZM2 A;  5M18 A;  1IOU A;  1P97 A;  1SZV A;  5CHJ A;  4JXS A;  1FOF A;  3Q7V B;  3LID A;  1K56 D;  1F98 A;  1ESU A;  4MN7 A;  2JKG A;  3W4Q A;  2W1T A;  1ES5 A;  2GDN A;  3B42 A;  4JBF A;  1YLP A;  4PM7 A;  3VOZ A;  3PBO A;  5L10 A;  5A93 A;  2PYR A;  3A3D A;  4KEN B;  4Y13 A;  5HW3 A;  4KZA A;  3DW0 A;  1OTB A;  4P0M A;  3IXD A;  5J4E A;  4XUX A;  4OOL A;  2X01 A;  3LYX A;  3BY8 A;  3HRE A;  4GLQ A;  4MLL A;  5EV0 A;  2ZMA A;  2JBF A;  3C2W A;  2BG1 A;  1N4O A;  2ZQ8 A;  3ZNY A;  5TFQ A;  2EWW A;  3A3I A;  3UPN A;  1N9B A;  2ZC7 A;  3UDX A;  3C7V A;  4R38 A;  1N9L A;  2HJE A;  2Z2L B;  4B88 A;  5HDC A;  4HP4 A;  4KG2 A;  3NIA A;  2QWS A;  5GL9 A;  4FH2 A;  1QMF A;  4R3A A;  4CJN A;  1V9Z A;  5K5B A;  2K7S A;  1XA1 A;  3B3X A;  4RVA A;  4EBL A;  5FQJ A;  2ZD8 A;  5DF7 A;  1HZO A;  3S7O A;  1IFQ A;  3D3O A;  2Y2L A;  4PKY G;  1K6R A;  3L7H A;  4LRZ E;  4WUJ A;  5CXW A;  3Q7Z A;  5HWT A;  2ZMF A;  4A5R A;  3BQ8 A;  5I94 A;  1BZA A;  4GHI A;  3NI9 A;  4PMA A;  1FCN A;  3T1R A;  1NXY A;  2JHE A;  4B93 A;  3LIE A;  1MWR A;  1S1Z A;  3AGE A;  3OBF A;  5HFO A;  4Y5F A;  5HAI A;  1FSY A;  1HTZ A;  4Z1W A;  3B47 A;  1S4R A;  5HPF A;  5HL1 A;  1K55 C;  3BYD A;  3T4K A;  3UME A;  5GHX A;  4Y7P A;  3ZVT A;  4HJ6 A;  2VZW A;  5TGF A;  2WZX A;  5J3W A;  2PD7 A;  5CGW A;  2V1A A;  3HJI A;  4GB7 A;  5AVF A;  2Y2O A;  2Y2K A;  4RA7 A;  4QPR A;  1SCW A;  4PKY A;  3MMH A;  2J3T D;  4EQ1 A;  2O9B A;  4WEL A;  5DTT A;  2ZMV A;  2WK0 A;  5GLC A;  3B33 A;  1H5X A;  1TS0 A;  1YLJ A;  3MQ0 A;  3VSL A;  2EX8 A;  5AQ7 A;  3HCY A;  5FQ9 A;  4WL9 A;  3NDG A;  2VX8 A;  1Y4O A;  3OOV A;  3M2J A;  2VKS A;  5EVI C;  1SKF A;  1I2W A;  3R4K A;  3R7W A;  3HL9 A;  1K0K A;  2V0U A;  2QPN A;  2INW A;  2MJ6 A;  1CK3 A;  4FH4 A;  1S0W A;  2JKR M;  3FWL A;  3P98 A;  5HAQ A;  3A3F A;  4P87 A;  3QP2 A;  1W79 A;  5JYP A;  3VP3 A;  2XDM A;  4DN0 A;  4O01 A;  4X25 A;  1VQQ A;  1IYP A;  2OOL A;  5FI7 A;  2OV5 A;  1VEU A;  3V5M A;  4KZ3 A;  3IH8 A;  4HBT A;  4JGO A;  3T4J A;  1YQS A;  2JKT I;  4IUK A;  3ISG A;  3FPV A;  3NHQ A;  4WEJ A;  3CWF A;  2X71 A;  3F1N A;  1W7F A;  3TW8 A;  3TSG A;  3C4P A;  1CF0 A;  5DJU A;  4R0Q A;  3GRJ A;  3IS2 A;  5FEG A;  5KIZ A;  1YLZ A;  2WKP A;  4LRX C;  1WYC A;  1PI4 A;  4R4R A;  1DRM A;  3FKV A;  2BAS A;  1XJ6 A;  5G4Z A;  2PD8 A;  3LI8 A;  4E3I A;  3PBQ A;  3SH8 A;  3V39 A;  3GDI A;  2EFX A;  1OTA A;  1RGZ A;  5HDS A;  3G31 A;  3LIF A;  5FAT A;  2QMI A;  1Y28 A;  2CMN A;  4DJ2 A;  5J7E A;  2XSS A;  2W27 A;  2ZQC A;  3PAG A;  4DF6 A;  2BLS A;  1E3U A;  2WZZ A;  3ZG7 B;  3VV4 A;  1SKO A;  5DFY A;  4XXR A;  1G6O A;  2W3E A;  4BMW A;  3SH7 A;  4RQ9 A;  2VK3 A;  4EBP A;  1E25 A;  3MXS A;  3S4X A;  4MBF A;  2WAD A;  4KQR A;  3VOY A;  2G7U A;  3F1P B;  5EPH A;  4G3V A;  1S4S A;  1FCO A;  3MZD A;  5EM1 A;  3IXG A;  3O86 A;  3BRM A;  5BOH A;  4LFU A;  2HDQ A;  5FSR A;  2ZOH A;  3DAV A;  1J9M A;  3G35 A;  5EVI B;  3G30 A;  1FR1 A;  3RFB A;  1MY8 A;  3G2Z A;  1KDW A;  4PM9 A;  4GOG A;  2HDU A;  3FPW A;  4CLC A;  4EER A;  3A0S A;  4K08 A;  3SH9 A;  4LV3 A;  3IF6 B;  4KG5 A;  4ESP A;  1LT0 A;  1TF1 A;  4B9O A;  1T18 A;  3SZT A;  3GQZ A;  2VGL S;  3ITA A;  3T4T A;  3HUN A;  2GNX A;  1XA7 A;  3QNC A;  5DTK A;  3Q81 A;  3TJZ C;  4ID4 A;  1JTD A;  3EGD C;  3O87 A;  2J9O A;  3C4O A;  3RXX A;  1DP6 A;  4NXB A;  4FTX A;  1YAX A;  4C6Y A;  3K3D A;  2B95 A;  3IF5 A;  3IXH A;  4WLA A;  4ZBE A;  2KDK A;  3MZF A;  1F5M A;  4M4X A;  3CMZ A;  3NUL A;  1WE4 A;  2ZC6 B;  3LIA A;  1M6K A;  4DE0 A;  1TS6 A;  3O5Y A;  1TS8 A;  2A2L A;  3U2A A;  2G2U A;  3Q82 A;  4DE1 A;  3D9Y A;  1PFL A;  2OLU A;  2Q9M A;  4O0P A;  1KDS A;  4I5S A;  3OZH A;  5GHY A;  2EX9 A;  1XGJ A;  2XGN A;  4HBU A;  4OP5 A;  1W63 Q;  3ZG8 B;  4HH3 A;  4BBU A;  2J3W A;  5CED A;  1P0Z A;  1PWC A;  4X1M A;  4FD8 A;  5GLD A;  2W1T B;  4EWF A;  4HI4 A;  4I3J A;  3FKW A;  4Q0I A;  2JC7 A;  5A8B A;  4Y3I A;  3EQU A;  1IYO A;  4IBR A;  3N8R A;  3DWZ A;  1WA9 A;  3N8L A;  1KVM A;  1LI0 A;  5TBM A;  3DBA A;  2QZ6 A;  4EEP A;  3E0Y A;  3C38 A;  3PYP A;  4GDN A;  4WZ5 C;  1PW8 A;  4GD6 A;  2W3G A;  3MXQ A;  1H3Q A;  1IKI A;  3E2K A;  1MWS A;  2ZC5 B;  1L0F A;  1OTI A;  1TDG A;  1IEM A;  2IWD A;  4EEU A;  3K3C A;  4KZ6 A;  1HVB A;  1RGY A;  2JCH A;  1K57 C;  5KZH A;  2Y2I A;  3G2Y A;  3NY4 A;  3ZNT A;  2PR6 A;  2OWJ A;  5CTN A;  2LB5 A;  1JWZ A;  2V0W A;  3NCK A;  4DMZ A;  3LGO A;  3HLF A;  2W3D A;  4Q8I A;  4HEF A;  5LBR A;  3DTK A;  3UN7 A;  4GZB A;  1PZO A;  1YLT A;  5A91 A;  1OME A;  4GHI B;  4KUK A;  4LCM A;  1ZKJ A;  3JVU A;  4QWO A;  1CI8 A;  4KZ4 A;  2DCF A;  2ZQ9 A;  4OH0 A;  2YKF A;  3UB8 A;  4C75 A;  4GKU A;  2XRN A;  3OLO A;  3ZG9 B;  1VET A;  3PTE A;  4E3J A;  5L09 A;  4BL3 A;  2HP6 A;  5AQA A;  4XT2 A;  1LHY A;  3BW6 A;  3PHY A;  2V9A A;  4HHD A;  3E4P A;  3NOU C;  4O7D A;  1TDL A;  5F68 A;  4ZRR A;  2PDR A;  4HJ4 A;  3FV7 A;  4QB8 A;  3VSK A;  2GZA A;  3OC2 A;  3BFE A;  1OT9 A;  4UA7 A;  2PBY A;  3LO7 A;  4B4X A;  4L9E A;  3GVB A;  1G28 A;  4X68 A;  4K91 A;  5IU1 A;  3T12 B;  2VEA A;  3UE3 A;  3BFC A;  2Y2J A;  4H8R A;  2KOI A;  3MQO A;  2RL3 A;  1HLU P;  4C3Q A;  1A0K A;  3MR0 A;  3U4L P;  4GDB A;  1K56 A;  1PZP A;  4KZB A;  3EGX C;  3IWQ A;  5KMW A;  5HDD A;  3T50 A;  2ZM8 A;  1K54 C;  2M1C A;  2W3F A;  1IKG A;  5EUA A;  4I3A A;  4JF4 A;  2Y55 A;  1MKM A;  1MXO A;  1UWN X;  3L9K A;  1OJG A;  2PU2 A;  3HLG A;  2JKF A;  4R4S A;  1XPB A;  2WKI A;  4X6T A;  1T19 A;  4MN6 A;  4E3M A;  4ETX A;  4EET B;  3FZC A;  1VEU B;  1VB6 A;  4LV0 A;  2XK1 A;  4JLF A;  3H82 A;  3BLS A;  1NZO A;  4MEZ A;  2J9P A;  3KX0 X;  2HDR A;  5DF8 A;  4QJG A;  2PYP A;  2Y2H A;  2K2N A;  4XUZ A;  2AVX A;  4CQH A;  3LI9 A;  4S2N A;  3F1N B;  4DDS A;  2XF3 A;  1JTG A;  3IS2 B;  1H8Y A;  3ICY A;  3UY6 A;  1D7E A;  3S7N A;  1QME A;  2VV8 A;  3W4O A;  1BUE A;  3LIB A;  3M2K A;  3UB6 A;  5FAQ A;  2V1Z A;  2D02 A;  2XRO A;  3JPU A;  4S2O A;  2QJ7 A;  1IEL A;  2VGL M;  2PU4 A;  4K0W A;  3MKE A;  4GNU A;  3Q07 A;  3C30 A; 
#chains in the Genus database with same CATH homology
 1V9Y A;  3EEA A;  3LI8 A;  3PR6 A;  2JKT M;  4PHT A;  2EA9 A;  2KX6 A;  3ULF A;  3PBQ A;  3GDI A;  2VV6 A;  1EW0 A;  4P6Z M;  1LSV A;  1T1B A;  1OTA A;  5HDS A;  3UB7 A;  3LIF A;  1LL8 A;  4CLC E;  1Y28 A;  2CMN A;  3TE8 A;  2PR5 A;  1N9O A;  2XSS A;  4DJ2 A;  5J7E A;  4EW7 A;  2W27 A;  3CUE C;  4KQO A;  4MN5 A;  1D06 A;  4LLO B;  1T1A A;  4NXF A;  3VV4 A;  3NOP C;  4IJG A;  5DFY A;  3CLO A;  3KYZ A;  1G6O A;  2VLG A;  2W3E A;  4H6J B;  4BMW A;  4RQ9 A;  4GCZ A;  5CX7 A;  3LIC A;  1YSP A;  3R7W B;  2W0N A;  4II7 A;  5HL6 A;  2VV7 A;  4L9G A;  2NUT C;  3UE6 A;  1NWZ A;  2QKP A;  3PBN A;  4CLC C;  3CUE A;  4BWI A;  4GW9 A;  2G7U A;  3E98 A;  3F1P B;  4G3V A;  4H6J A;  2OAQ 1;  3LR4 A;  3LUQ A;  5DJT A;  1OTD A;  1S4S A;  4Q0H A;  1XJ4 A;  3EQV A;  2OAP 1;  3H82 B;  3V67 A;  2LB9 A;  2OWH A;  4CLC B;  1N9N A;  5HWW A;  3HJK A;  4L0L A;  3CIT A;  2ZOH A;  1YKD A;  1S1Y A;  5KSH A;  2PHY A;  3F1P A;  1OTE A;  3KSF A;  2M7V A;  3RFB A;  1MC0 A;  3VE4 A;  2V1B A;  4YNR A;  3SW1 A;  3LR3 A;  3KSH A;  4MDZ A;  1VHM A;  3FPW A;  1XJ2 A;  4LRY C;  4CLC A;  4EER A;  5IT5 A;  4G3W A;  3A0S A;  4KUO A;  4K08 A;  3P7N A;  4HP9 A;  3K2N A;  3S7P A;  1LT0 A;  2O9A A;  1TF1 A;  2DMW A;  4B9O A;  2L4R A;  4MCW A;  4R70 A;  5F5Y A;  1T18 A;  3OCN A;  4NEE D;  5HPI A;  2VGL S;  3T4T A;  2R78 A;  1UWP X;  1S67 L;  2D01 A;  1GSV A;  1YSQ A;  4NKP A;  2GNX A;  3TJZ C;  2Y79 A;  5HZH A;  3ZQ5 A;  5C5K A;  3E4Q A;  1LSW A;  3EGD C;  1MZU A;  1DP6 A;  1TS7 A;  4NXB A;  1YAX A;  4ARZ B;  2O0Y A;  3K3D A;  3FC7 A;  4WLA A;  2M7U A;  5DKL A;  2VJW A;  4GJ4 A;  2PT7 A;  4EXO A;  2B18 A;  4AFI A;  2L0W A;  2KDK A;  2ZOI A;  1F5M A;  4M4X A;  2HV1 A;  1NRJ A;  5IS1 A;  5FL3 A;  3LIA A;  3T4O A;  1OPX A;  4HJ3 A;  4HIA A;  1TS6 A;  4ARZ A;  3O5Y A;  1TS8 A;  2I9V A;  3H7W B;  1W63 M;  2A2L A;  4EES A;  3U2A A;  4EUV A;  3KO6 A;  1OT6 A;  2QYB A;  1ZTU A;  3KYQ A;  2J80 A;  5EFW A;  1NLZ A;  4O0P A;  1ODV A;  2B02 A;  4I5S A;  4HQA A;  1P9W A;  4I38 A;  3H7W A;  4F3L B;  3UB9 A;  1TD5 A;  1W63 Q;  3EWK A;  5DKK A;  1NLY A;  2A24 B;  3CI6 A;  4HH3 A;  4BBU A;  1JNU A;  2J3W A;  3BJN A;  1P0Z A;  3OCL A;  4IUH A;  2W1T B;  4DJ3 A;  4MMN A;  5HD5 A;  4F3L A;  4HI4 A;  4KQD A;  4I3J A;  1IOU A;  4Q0I A;  1P97 A;  2HF6 A;  5DFX A;  5TBM B;  5F6A A;  2P04 A;  5A8B A;  1DP9 A;  2A24 A;  4Y3I A;  3EQU A;  4BBV A;  3LID A;  1F98 A;  3EOI A;  4MN7 A;  4R6L A;  4PAU A;  2W1T A;  2QJ5 A;  1WA9 A;  4UQI M;  3PBT A;  3B42 A;  5TBM A;  2GX5 A;  3DBA A;  3PBO A;  3CAX A;  3T4L A;  2PYR A;  4EEP A;  2ZBB A;  2HJ9 C;  3E0Y A;  3C38 A;  3PYP A;  1ZHH B;  1OTB A;  3P01 A;  5J4E A;  3RH8 B;  4OOL A;  3G6O A;  1P9R A;  2W3G A;  3MXQ A;  3LYX A;  3BY8 A;  1STZ A;  3MJQ A;  1H3Q A;  4GLQ A;  1S66 L;  3C2W A;  3MQQ A;  3KSI A;  5MC7 A;  3ZYT A;  5HSQ A;  1OTI A;  4IHQ A;  2EWW A;  4EEU A;  3K3C A;  4R38 A;  3TRC A;  1N9L A;  2HJE A;  1BYW A;  5I5L A;  2PR6 A;  2OWJ A;  5HDC A;  2XA7 M;  4HP4 A;  3LR5 A;  2LB5 A;  2L1M A;  4YWZ A;  2QWS A;  4FSF A;  4BJP A;  4R3A A;  1XFQ A;  2V0W A;  2P7J A;  5F69 A;  4DMZ A;  4E04 A;  2K31 A;  1V9Z A;  2W3D A;  5K5B A;  2K7S A;  1OJ5 A;  4I3I A;  2JN7 A;  2WKQ A;  4P6Z S;  5LBR A;  2H28 A;  4OOM A;  3LR0 A;  4WF0 A;  2VA0 A;  3S7O A;  1IFQ A;  3D72 A;  1GSX A;  3D3O A;  4GHI B;  4KUK A;  2IA2 A;  3MFX A;  3JVU A;  5TJJ A;  4PKY G;  4HNB A;  3BQA A;  3NOT C;  4LRZ E;  2YKF A;  4WUJ A;  3UB8 A;  5HWT A;  2XRN A;  1X0O A;  2ZMF A;  3OLO A;  3BQ8 A;  3KSG A;  2O99 A;  4GHI A;  1GSW A;  2JHE A;  4B93 A;  4XT2 A;  3LIE A;  4HH2 A;  3A0R A;  1S1Z A;  3OBF A;  3BW6 A;  4Y5F A;  3PHY A;  2P08 A;  4Z1W A;  2YKH A;  2WKR A;  3JVV A;  4I39 A;  4JGQ A;  3B47 A;  3MF0 A;  2V9A A;  1S4R A;  4HHD A;  5HPF A;  3E4P A;  3NOU C;  5HWV A;  5F68 A;  5HD3 A;  4ZRR A;  3T4K A;  2GJ3 A;  3UME A;  2PDR A;  4HJ4 A;  4HJ6 A;  3W2Z A;  4ME4 A;  1T1C A;  2VZW A;  3T4S A;  2GZA A;  3OC2 A;  5J3W A;  2PD7 A;  2V1A A;  2J3T C;  1OT9 A;  4FOF A;  3HJI A;  3LFV A;  5AVF A;  4L9E A;  1G28 A;  4QPR A;  5IU1 A;  3UMD A;  4PKY A;  3MMH A;  2J3T D;  4EQ1 A;  2O9B A;  4WEL A;  2ZMV A;  2VEA A;  4UEY A;  5G4Y A;  3B33 A;  3UE3 A;  3GEC A;  1KOU A;  5AJG A;  4G3K A;  4JGR A;  1TS0 A;  2Y8H A;  4LPZ A;  2FZ0 A;  2JKR I;  2KOI A;  3MQO A;  2Z6D A;  5DF9 A;  3NJA A;  3MR0 A;  3RTY A;  3MQ0 A;  2XA7 S;  4O8G A;  4GS9 B;  4HY8 A;  4YOF A;  3EGX C;  1DP8 A;  3HCY A;  4Q0J A;  3VE3 A;  4WL9 A;  5HDD A;  3T50 A;  2VX8 A;  2W3F A;  2M1C A;  3OOV A;  2VKS A;  3E4O A;  4CLC D;  3R4K A;  3R7W A;  4WN5 A;  4I3A A;  5AVE A;  2V0U A;  2FH5 A;  4GS9 A;  1LSX A;  3IBJ A;  1MKM A;  1UWN X;  2INW A;  2MJ6 A;  1OJG A;  3A0V A;  3VOL A;  2QHK A;  1T19 A;  3IBR A;  2JKR M;  4MN6 A;  5L8M A;  4EET B;  4ETX A;  1VB6 A;  3T4Q A;  3H82 A;  2EWV A;  3S7Q A;  2HGV A;  4Y2F A;  2O9C A;  4ETZ A;  3PBR A;  4DN0 A;  3KX0 X;  4O01 A;  3C8C A;  4EU0 A;  2PYP A;  3H9W A;  2OOL A;  2K2N A;  4NXG A;  1XFN A;  3BWL A;  4CQH A;  3LI9 A;  2NUP C;  3F1N B;  3PXP A;  4NXE A;  3FG8 A;  4HOI A;  4JGO A;  3T4J A;  2JKT I;  2Z6C A;  4IUK A;  1XJ3 A;  3FPV A;  3NHQ A;  2KLI A;  3IS2 B;  4WEJ A;  3ICY A;  3CWF A;  2W3H A;  3F1O B;  4XT2 B;  1D7E A;  3S7N A;  4WEK A;  1UGU A;  3F1N A;  4JGP A;  3TW8 A;  2VV8 A;  1F9I A;  3BY9 A;  3LIB A;  5DJU A;  3UB6 A;  3IS2 A;  5KIZ A;  2WKP A;  2D02 A;  4LRX C;  2XRO A;  3F1O A;  1DRM A;  2QJ7 A;  2VGL M;  2BAS A;  1XJ6 A;  2W1R A;  3EEH A;  5G4Z A;  2PD8 A;  1H8M A;  3PBS A;  4UQI S;  4BBT A;  4L9F A;  3C30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...