1XFPA

Crystal structure of the cdr2 germline reversion mutant of cab-lys3 in complex with hen egg white lysozyme
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
VQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINSGGGSTYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Basis for the Affinity Maturation of a Camel Single Domain Antibody
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system/hydrolase
molecule keywords heavy chain antibody
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2004-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xfpA00
1A4JA 3NFNB 5L6YH 4N8VG 15C8L 1TITA 1DVFB 2EH7H 2QHRL 3HG1D 4QRRA 2DWEA 3TWCL 4OCRL 1UM4H 2HT4D 1KELL 4G8GE 4NQSB 4M7ZB 4A2MA 2AK4E 1XIWA 3R0NA 2ESVA 43C9B 4Z5RB 4JLRA 3VDBA 1TCRB 4PP2A 4U1KA 1P2CA 4FG6C 3V4PL 4XBGB 3GIVA 2DLGA 1UWXK 2O5YH 3HG1A 2IQ9H 4RGNB 1FVDB 1YEJL 4FQQB 2A77L 3L9RB 1MCCA 1YUHA 5C7XL 1P2CB 1XCQB 2BSED 1VFAB 4MLSA 1AD0A 1NCWH 1K2DA 2OCFD 2DQCH 2IG2L 2P5WB 5E8EB 3RZCA 5HD8C 4Z8FL 3IFNL 1OAKL 1VFMA 3J7HA 4F37F 1OW0C 5JZ7D 5DVKA 4CADA 1TIUA 1J1XH 3SCMA 3OHXB 32C2B 4Y4FB 1JRHL 1NGXA 1JGUH 4HSQA 4R4FH 2LABA 2GEEA 3DXAA 5BVJA 1ZLSL 2CDEA 1R3KB 1M71B 1B0GB 4KI5E 4W6XB 3KXFE 5C70A 5EZJA 3IDGB 3QG6B 3PWNA 4YFDB 4FZEL 3UTPD 1A8JH 5I1EL 3PL6C 4B41A 1REIA 4PPTA 1M6OB 1PX4A 3P9MA 3NA9H 5I8CA 2BNRE 2LVCA 3DGGA 4Y4HB 3OMZA 3OKYA 4TRPH 4EN3B 1T1XB 2DL9A 1T0PB 1G7QB 1MHCB 1RZ7H 3IDGA 3QG6A 4D9QE 5ITFA 2WP3O 1VSCA 3EFFA 2GSIB 1CLYL 2ATPB 2BNQE 3L6FB 3P9MB 3SO3C 4FFYH 3SDDD 1JK8A 4M7KH 1FIEA 4Y4HA 4EN3A 1RULL 3HUJF 1KLUA 2BRRH 2VLLB 2X9XA 3FRUA 4HWBH 3V0AC 4UIKL 5HGAA 4U6XA 2JELH 3O6FC 3SO3B 5ABDE 3DBXA 2HJLA 2VWEC 1L0XA 2H1PH 3PDDA 1ACZA 4BK5A 4HS3A 5ADPH 4AQ1B 3KYKH 4JN2B 4PJ5A 4OZFH 4L9LB 4JFDE 1XF2B 1IAIH 3MODL 3CXDH 2R1WB 5I0DA 3V52H 1CGXA 3MNVB 5IW1A 2D7MA 3MYJB 2VNCA 1FZMA 3MFFB 5ERWB 1G9MC 5T3XL 3GK8L 2FCBA 5DGQA 5C0DB 1T1YA 1QBLL 3KPQA 4PJIA 4HGWB 4JDTL 4OD3L 1HINL 4EIZC 4XCYB 4KKAC 3AUVA 1QR1A 4LSRL 3VWKD 2W38A 3FB5A 5F7LB 5MHSE 1TJIH 1N0XH 4TULH 4OCMC 3VXRD 1F4WH 2QHRH 4GMSH 1N3NA 3ARDA 1I3UA 5DO2D 1Y0LB 3MCKB 5ITBL 1YA5A 1JUFA 5A3ID 5JHLH 4P5KB 2R29H 2YXMA 3BP5A 3NFNA 4GG6E 3H9SE 4L9DA 2C26A 5IV2B 3CFKB 1N3NB 3ARDB 3WXVL 1RSFA 3V6ZA 3WUZA 2CGRL 2QJDA 1ZHLB 2CLRB 3MV7B 4FQHA 4FXLA 2EE2A 3PIQA 1T20B 1ZLUK 3JZ7A 3FQXB 4OAWA 4CW1B 4EUPH 2JCCA 3TCLB 4QXTB 1AXTH 2O61A 2AXHA 1KIPB 5F88A 1C5CL 4JJHA 5FYJH 3P4OA 3IU4L 5KSBB 3H9SD 1IAOA 3KPMA 4H26A 4X4XB 4NZJA 1BEYL 3NAAL 5TE4L 3QEHB 1BD2A 1BQSA 1U58B 4LLMA 1T0MB 2J7LA 2CUMA 4LGSB 5DZOA 2ZJSL 3OSKA 1CZ8L 3A6BH 3ARFD 3ZDZE 2YBRB 3DX8B 4TVPL 4TSAL 1A6ZB 5KVFL 3B9AA 3RX8A 35C8H 3L5XH 2E9JA 2PO6C 2IMNA 1KN2H 3LD8B 1CT8A 3ZL4L 2MWCA 1G7IB 2J5LB 3P30H 3DUUA 4TRPL 4GG6A 3VXSE 1IEHA 5FYKE 3HMXH 3CVIL 2FEEL 3EJJX 2F58H 3D18A 5I8EB 3NVQA 1Z0NA 3O4LE 4GBXB 4KHTH 1XGYH 4M93B 2ORBL 2VLJD 3ZKMD 1NEZB 1MFBH 1U41A 2IJ0C 2MKWA 2A1WH 1HSAA 3FHAA 1M7XA 4GAFB 4MZ3A 3WDJA 3ULVL 2G2RB 3VFWA 5JW4N 4QLRA 1HI6B 5AWNL 2VL5A 1QRND 2PTTB 5CAYB 3QI9D 4MD0B 3H7BB 2F8OA 1A6AB 2EYTB 1OSPL 2PR4H 1QSEE 3VXUB 4PJEA 4ONHB 2VZ3A 2XZAH 3TM6A 2BOCA 5DJ8A 3LPFA 2A6IA 1C7TA 2ZWLT 1R6VA 3ULVF 5GS2H 3O4LD 4XB7A 5KZCB 3GIZL 1KEMH 3ARSA 4NBYB 2Z4QB 1BWWA 2R0ZH 5C0EB 2AXFA 3OHXA 2R23B 1F42A 4ONHA 3G08B 4PRBB 5JXEA 1EJOL 3NACH 4X6BA 2ZUXA 3GHEH 3QI9A 4L9LA 1Z5LA 4O4YL 1N8ZA 2VZSA 1I9RL 3N50A 1BJMA 1DBBH 1T03L 3BISA 1LNUB 1OAUH 3H9HB 4IDJL 5D8JH 3BD4A 2XPGA 4X5WA 4WW2C 4OFIA 5GISH 2NY7L 1SY6L 3QIWA 1NJ9B 4J7RA 2YD1A 4R0LC 4YHKL 4R96B 2Z92B 1H15A 3WD5L 1T66D 3P40A 1BFTA 2G5RA 4CU7A 5DJ0A 1UA6H 4JKPH 4BQCA 3GJFB 2X4RB 1IGYA 4LCIH 4NZRL 3OXSB 3UX9B 5ALBH 5I1EH 3EJYC 3QCTL 2QKIA 4WO4C 5IEHB 3QIWB 3GIZH 4M6NL 1RUKH 5IBLD 2WUCH 2RB8A 2DQDH 4Q2ZA 3ZTNH 1IKFL 3GJFA 1FE8L 4CADB 3IDYB 4L4JA 5C0CD 2R2EA 3V0VB 2X4NB 3TPUB 5SV4A 3D2UA 1R5WA 4S1SL 2WIIA 2B8OT 4WI7A 2ZUQC 3EDEA 4J3WA 1M4KA 4HS6B 4WW1B 5TGBB 1QSFD 4O2EA 3T09A 4RMWA 1G1YA 2GAZB 4OIBA 2XZAL 4K3GA 2DRUA 5H2BB 3TYGL 3GMQB 4NHUB 2R1XA 4XPTL 2HFFB 7FABH 4LCCB 1FNFA 3T3ME 3W5MA 3UTPE 4IRJD 5SX5H 3HMXL 4RMSA 2IH3B 4MXVF 4JRXA 4BK4A 4MJ5A 4XNYL 3UZVB 5IOPB 3RBSA 3QUMB 4JR9H 5AYUL 1QVOB 4X83A 4MAUH 4NYLB 4IJ3C 4OUOA 5FA3B 2NW3B 1OT1A 5EO1B 3JWDH 4XVTH 4M03A 2VH5L 3WNMA 2MSPA 4LSTL 3MTRA 3VWJB 1KB5H 3RZCD 3ALWA 4XTRD 2VDPH 1BEYH 3EOTL 3NAAH 1ZSDA 2OS7A 2MMXA 4OM1L 4LRIA 1CG9A 2PETA 1BBDL 3OF6A 2MOVA 3QQ4A 5GQBA 3FJTA 2EDFA 4YNYB 4GLRI 2DQGL 2HFTA 4ZQKB 1ZXQA 2X4OA 3HC3H 4QHKJ 1TJIL 5EC2B 5F6HI 4F7EA 4L3AA 4ZUTB 1ROWA 5BVPH 1N6UA 3QUMH 5E5RB 1CG9B 4K8RD 2Y4SA 5DHYA 3ARPA 4KRLB 5EUOB 1J1PL 4WDIB 1BZ7A 3QDHA 2VDKH 2YPVH 3MRPB 5L2KE 1V05A 4UTBH 5EORL 4HV8B 1WWAX 4H25B 2V9TA 4QNPF 4S2SA 3VXUA 3FB5B 2J8UA 1ZTXH 3GUTB 5IMKA 2QEJA 2BOCB 4B50A 5C0RH 5E8NA 2XKSA 2Q8AL 1WTGT 2G60H 4LLMB 1EAPA 1QLEL 1AQDA 2IBZX 5IJKA 1DL7L 5EUOA 5C2BH 3KXFD 5T3XE 4FN0A 5D6CA 4RQQB 1MHPL 4RNRB 5IHZB 4JY4B 4J1UB 1CQYA 2NR6C 5F72S 5FIEA 3CH1B 4MB4A 5EN2A 2YRLA 1AKJB 5KS9E 3UYRL 3QWOB 3QUZB 1FL3B 3C9NA 3H9HA 4LF3A 3L1OL 4PJGB 4LSRH 5M7QA 4R26L 2BVEA 5EU7C 3H9YA 4RGOL 5D7LD 3L7FA 4N8PA 3BDYL 3HNVL 5MEPA 1HH6B 2H45A 5LWYH 3JWOL 4WI5A 1MJUH 4LBEA 2DLHA 4PLJC 4I9WE 1ED3B 5GJTL 3HZMA 4LGRB 3LN5A 3O6MH 1IVLA 4G8GA 3O8XB 2EDHA 2AK4A 4UI2A 2APXA 4KJYB 4H1LG 4J23A 1MAML 1NGPH 3IJYB 5HVGB 5TFSH 1UG9A 4NKOA 1NCCL 1D9KA 5HYSA 5T33L 4CMMB 1QO3B 2VL4A 3T0BA 4UQ2A 5LVEA 2JB5L 1A1NA 2B39A 4H8WH 4X7SL 1DEEB 1EO7A 4N8CL 2CK2A 5FDYA 4PJ8B 4W70A 4GBXA 4KJWD 4IRSB 4F57H 3E6HB 1FVEB 5CD5D 3JV4A 5HSFA 4BH7B 5GS0L 1CBVL 1RHHA 4F8QA 3MUGA 2R56L 2C1OB 1JPGB 1MHEB 4Q9QL 3FO0H 1I8LC 3C6SB 3O3DA 3BIKA 3LEXB 1EEZB 1W8NA 4IMLA 4MJ6A 5DUBB 5C3LD 3SKNB 2L7JA 4TN9A 1YMHA 5LGHH 4PY8I 4LASL 2UV3A 1MWAB 5SV3A 1PQZA 1PZ5B 4IHOA 4PRPD 4URTB 3JV4B 2YD7A 3IGAB 4A2LA 2NQCA 3RY6C 5GRWA 1A7PL 5HHNA 1MQKL 3KPSB 2Y6SC 4RFNC 1EERB 2CUHA 1IL1B 1GXEA 1IZJA 5EOTB 2XKNB 2Q8BH 1Q94B 3DTXA 3G5YB 2VUYA 3SDYH 2D4DA 1DCLA 5DEFB 4OI7A 3QUYC 3VFRB 3BKCH 3BPLB 3K0WA 5JDSA 3NGBB 4FABH 1S7UB 3LQAH 3I6KA 4PRPA 4LIQH 5DI8A 2VXTH 1Q94A 3CK0L 4HBCH 3NPZB 4X7TA 2A9MH 4P4KB 1KYOJ 4QF1B 1C1EL 1N2RB 1PLGH 4PGCB 1FO0L 5DURD 3EOAB 3TJHD 5JMRA 2FEDD 3ES6B 4LPVA 3FB7B 3HPLB 4UBDD 1BQLH 5KSAB 3MO1B 3OAUL 1FH5L 4M7LL 2DTMH 1J5OH 4M48L 1ZGLP 4RAHA 1YDPA 3B9KA 4APQD 5DRNB 4OTXL 3M1BA 3AS2A 3ZTJH 4UOW0 3TWCH 3L3GA 4Z7WE 4K7PY 4FNLH 4ZFOA 2V6HA 3K80A 4MNHA 2XWJA 4JPWH 4WV1B 4EXKA 1DBAL 1U2CA 3EYVA 4XC3H 1AGCA 4ZNEE 5GS1B 1RIUL 5D7LB 3O0RH 1NCUA 2BY1A 4RAUA 3RL1B 5GZNC 2HWZH 1IT9L 1TVBB 5I0ZA 3MRMB 2O93L 5IMMA 1WIOA 4QRQB 1UA6L 4P48A 3UTTD 3WFDH 4U7SA 5DHYB 4CVXA 1JGEA 4YDJA 1EO8H 2GJ6B 2YC1A 5L0QC 2YD9A 4JFXB 4YGVB 5GGVH 4K7PL 1CL7L 4LRNH 2QQKL 3VMOA 4RAUB 3RL1A 5GGTH 4JPIB 1MFAL 5J6HA 1GAFH 1MAKA 3WLWC 4O58L 5B38A 5TH2A 1HXMB 2YOCA 5I1KL 5L2KD 4HC1H 1INQB 2A9ML 4XNUL 1ODAA 2AK1H 2GYSA 4JO1L 4PBVC 5GJSH 2VXTL 1FGVL 2GT9A 3BHBA 4NNPH 5C0CB 2ITCA 1EIBA 4LARL 1KXVC 1U8OA 4PGEB 3PP3K 1WT5A 1A9BA 3SDCA 3EYUL 1O7VA 3ZKXB 4HWZB 4OIIH 2JCCB 5AWNH 3TPUA 3KYNB 1HEZB 3SKJL 1H3WM 3WSQL 3L95A 3VXTA 3DGGB 3T3PE 1MNUH 4J3OC 1YN6A 4XCCH 3MBXH 3UPRB 2R8SL 1A7RH 5DK2A 3O11B 2X4SB 3TBSB 4ODUB 2R69H 3I9GL 2NZ9D 4CAGA 1JHKH 4D3CL 4K7PH 3M45A 2EH8H 2W60B 3O6LH 1O5DT 5FA4B 4KDTC 5GRUH 2IAMC 5DK2B 4IIQA 4AG4L 2XWBA 2NY7H 2CKNA 4KRMB 4UOW1 4R8WH 1G9NC 3A6BL 5BMFL 3E2HB 5MP6H 1FPTL 1R3HA 3UTOA 1VPOL 1SEBA 4H0GA 1WCBB 3S36L 2P48B 5EOTA 4DK6A 3LKNB 2Z91B 5T3ZL 2EDBA 4KY1L 1Q0YH 1G6RH 3W5NA 4NOBA 1JFQH 3IDNA 4IRJC 2LVEA 1GIGL 4L3ED 4UIMA 5IROC 3CGTA 4CU8A 4NWTH 4HPYH 1U93B 1HILA 4HT1L 3BEWB 1S9VA 5C0CE 3E8UL 1EH9A 1AXIB 4NQXA 1MRDH 2DI7A 3DUHA 1J1PH 3ARZA 2AJVH 1RHHB 5DDHA 2DQEH 3O2DH 3RNQA 1C5CH 2IQAA 3U0PB 1C5DB 5GGSY 2VDOH 4MNGE 4PYHA 5EBLA 4CN1A 4UNUA 1BVLA 4TUOA 4QCIA 4O5LH 3FAWA 2CIKA 3C60B 3QYCA 4X6BB 4YGAB 1KCSL 1NLBL 5E2UL 5IV2A 1IC4L 1OP5K 4DQOH 3NCYS 1YEKL 2YA1A 1CICC 3P9WB 5CEZD 3F62A 1JWMA 4JEGB 1A22B 2IWGA 3N1QC 5J6GB 1IC4H 1W72A 4GMSL 3GI8L 4YPGA 3H0TA 1YYLL 4HW6A 4MJ2A 4MX7B 5HVFB 3L5HA 5D2LB 3TBYA 3WHE0 4AL8L 2DQJH 1WLHA 4PJGF 4QOKB 4P9HL 5B4MC 2QKIB 2NY2D 4Z0BH 3MBED 3QEQA 3DIFA 4IBLT 4G7VH 1IFHL 1M7DB 1YMHB 4HUXB 3AMKA 4PJHE 3TVMC 4J3SA 2DDQH 1S9WA 2KH2B 2NZIA 4Z7VF 2NY1B 5I16A 3VFNA 1NC2A 3PHOB 1CFQB 3CD4A 3D2UB 4MQXD 3V5DA 1VFAA 5K9JL 1TPXB 3RKDC 4GRLB 1JYXA 2VXQH 5FKAA 1T1WB 1P5UA 5C6PB 3RVTC 3D3VA 4JPKH 1R5IB 3U4EB 4YDVA 5K9OA 4ZO6A 4KK6D 2VQUA 4BUHA 3MZTA 1MLBB 1HI6A 1GGBL 3ZE0F 2N56A 5F1OB 4GH7B 3MRMA 4ZUSB 3T65A 4NYLA 5F7YC 5SWQB 2YEZB 3TO4A 3BDBA 2A6IB 3WD5H 5IW6B 4OZHF 4OCLC 1QBLH 1XGQB 5J13B 5I1JH 4NRZA 3PJSB 3TN0B 4I0PB 4O51B 4PGDA 5CD3B 2YA2A 5B39B 2APVA 3O2VL 4XB8A 4UDUB 3UYRH 5D9SA 3D85D 4JFEA 1NCWL 1U95B 4L29A 2NY0D 1BAFH 1C5BL 1Z5LB 4QTIL 4YNYA 4W68A 3NTCH 2ZOLB 2EIZB 2AJ3B 2HTLD 5T3ZD 1AGFB 5FYKU 5GRYA 2V5TA 3IRZA 4ZS6D 2OTPA 3S36X 2IBBA 3EHBD 3DO7B 1NSNL 2EXWD 5KSBE 4U1LB 1FE8H 5INDB 1G7PA 3T4YA 2LQRA 1UB6B 1MCOH 3FQUB 4JHAL 1U93A 4LSSL 3E6FA 2Z8WC 4YDLB 3AVEA 3WFBH 3P73B 3O11A 1OAXH 5I1KH 3QPQC 4MGXA 3EDJA 2YPVL 1S7VB 4RZCA 4XBPA 1ZEAH 4RRPA 1GRWA 3CFEA 3MBEC 5SX4I 3AXLB 5IMKB 1MRCL 5ERWA 1Y6KR 5B4MD 1P4LB 1QQDA 1HSAB 1WAAA 2WQRA 4PYGA 5DD3L 4Z7VB 4WJ5B 4ZNEA 4FZ8L 1T5WB 4D2NA 2EDLA 2YN5A 4PV8A 3QUML 3MOBL 2W9EL 2DI8A 3KPOA 3OG4B 1E6JH 1IM3B 1U3ZA 2RCSL 2NTSP 1KC5H 4N0CC 3D39A 2QADC 1UM4L 4J1UA 2R2EB 4J8RB 1INQA 2VZUA 3JVGA 4C57C 1D5ZA 4FMKA 3RWFB 5DFVD 1S78D 1SEBB 4M3KB 2OR7A 2A6DB 3BT2H 3HI5L 1OSZA 4HWUA 4KJPC 5JQHC 5D93B 2DQUH 1A7OH 2BY3A 4IMKA 3LN4A 3KPSE 2F19H 1JNHA 1XCTA 4HF5L 4E42B 4N90D 5DJCA 1EEUA 4ETYA 2WLZA 2WNGA 5AYUH 4GKNB 1LO2H 1ZA3B 1HH6A 3MFFA 4PBWD 2XI9A 5LG1A 3ARXA 2XV6B 2CJUH 5D72L 4ZS7L 3E2HC 3MGTA 3VFSB 2H41A 4HGWA 2X4QB 4K8RH 4N0UA 1EO8L 2XZZA 4TSCL 4QCIB 4YWGL 1OD7A 2ARJA 4OGXH 3OB0H 1N26A 1NC2B 1DN0A 5C0GA 4ZAKB 1R3HB 4S1SH 3QZWA 1GHFH 4TNVF 1QNZH 2H32H 4ZFFA 2DMBA 3V6FA 4JO2L 3IDUA 3DURB 3LAFA 1KCVL 4RISL 1J0JA 4IRSA 4LVOC 2FZ3B 3ZE1F 4JZJC 2X4NA 1EHLH 5JPNA 2P46B 4Y5YB 1G7LA 1R5IA 4DGVH 3X13B 1I3VA 1NCNA 3FO0L 4MA7H 5HGBA 2AEIT 4W4NA 4JVPA 4LP5A 5DJXA 5F70A 4K71B 3P0YH 4LASH 2VISA 1V7ML 1IILE 2NW2B 4KRPD 1XGRB 5JUEH 3C6LD 5IB5A 1JN6A 4P2QB 3T3MF 2HKHH 1FN4A 1DDHB 2FDBP 1I1AA 3DMMA 1FNHA 1JHTB 5DYOA 4AMKH 4EDWL 4RQQA 2YPKA 3K2UH 5IBLC 3VXMB 2BSSA 4QNPE 4HLZG 3LS5H 3QQ9D 3V52L 3C60A 4DJMA 3KJ4C 1U8JA 2QSCL 4HG4J 4WUKH 5EOQH 5ALCH 5IFAH 3MRCA 2Z31D 1CD8A 2AKRA 1NEZG 3IDJB 5DA0B 4MNQA 3GGWA 1JWMB 2AK4D 3SDXE 4M7JH 1P7QB 4I2XE 1N2RA 4PGCA 1H3TA 3MRQB 3WLBB 5SWZE 4X9BA 2ZUTA 4TQEL 5F44A 5BV7C 1U8MA 5C07D 4OZ4A 5D1QC 3D5OF 3ALPA 5MERB 2WM0A 3ABZA 2XXMB 1F4WL 2BSTA 1GH7A 1CD0A 1N5YH 1S7VA 2FWOB 2R0WH 4XH2A 3HN3A 4G43B 4OI9A 3DVGB 5LGHL 3TH2T 4ZTOL 1CDIA 1BFSA 2PTTA 3DXAD 2A9NL 2OZ4L 4P49A 4GKSA 1MHPH 2RGSA 1CIUA 4KQ4L 2XN9E 1ONQB 4N0YH 4KXZI 5E8NB 3LMJH 4N9OB 2MCG1 1QLRB 3MXVL 4PS4L 4DCQB 5DEGA 4YIQB 5HYJE 5I1DA 1KJ2L 1DLFH 3KJ6H 2ICWJ 2R1WA 5HHXL 1OY3B 5D7JB 5GZND 2IALA 1AP2A 5D7SH 2AJSH 5TDOB 2DLTA 1E27B 2VABB 4AENA 4P23A 1QLEH 5FCUH 5JOFB 2QSCH 4Z7WA 3KDMB 4HS8H 1P6AB 3KVQA 5IMLB 2CLVA 2EDRA 4ZUSA 4GG8A 1F3JA 3FB6A 1E4XH 5I73C 4IRSD 3KJ4B 3L5WB 3OKNB 3VD4A 4JRWA 4NP4H 2GT9B 3BHBB 1K6QL 2AEPH 2OXGA 4PJHF 4N0UB 3VGDA 4LHUG 3P0YL 4PLKD 1U8OB 5DZLA 4YHYB 4XP9H 4ZXBD 1KACB 1I1CA 4OT1H 5DS8A 3VW3L 3TJHC 3ZT5A 4G3YH 3I3EA 3VG9C 1T2JA 3D85B 4U1NB 1AGEA 3G04A 3HUJB 3HC0B 5DLML 2YK1L 1JWUA 4X7TB 2FL5B 1ZT7A 1PY9A 3VFVB 4MXVE 5TDPA 1ZVYA 3QWQB 4N68A 3ZE0E 3PHQB 2CO6B 2XYCA 1VHPA 1GGUA 1UVQB 1U8IB 2D0HA 5IBUB 4P5TA 2XTJE 2QHLA 4HKJA 4LCCA 1DBML 5DD0L 2NTFB 5TPWL 2EECA 4R97C 2F5AL 3VWKC 4OZIA 2CXKA 2VXVH 2BJML 4QRRD 5K9QG 1I7ZA 1DDHA 4H88L 5E8DH 3LCYA 1I1AB 5DYOB 2YRPA 3WUWA 4ORGB 2H2PC 3NZ8A 4ZO7A 3OG6B 5IB3A 1DE4B 3BGAA 1KELH 2DWDA 5FOJA 4DKDC 4LEOA 5BZWA 5LAXB 1BD2E 3QUXD 3KXFB 5GS1A 1FJ1B 1H3PH 1IM9D 3VD7A 3FFCD 3GRWA 1MPAH 1ZGLB 3BQUB 4LSVL 2FO1A 3C08H 2AV7A 4F2MA 5FUOL 3QCVH 4YDKL 1FCGA 4OLZL 3MRDA 3ZKND 1UKQA 4P3WA 4R2GC 5C0AE 3MLRL 4M7LT 3EYOB 1OWRM 3PV7A 4Y5YA 4JM2F 1W8OA 4G9FD 1S7RA 2X70B 3RI5K 4TNWK 4PB9L 4NN6B 3ZO0A 4JFPB 1F00I 4KDWA 3ORJA 4P4KA 2DI9A 4OGZA 3MOBH 3EYFA 4JQVC 5CJQH 3PXJA 3IAPA 2VITB 4YLQT 3QJFA 2GHWB 3QAZB 4QRPA 1NFDF 4D3CH 4FQLL 3EBAA 3NMEA 1VGKB 3PABA 4ZPTB 3HHRB 1FSKC 3RKDD 1AR1C 4LNRA 1ZWIB 4AEIH 1T0NB 5ACLA 5FO8B 4NC0B 3X12A 3Q2CA 1FDLL 1AC6A 4E41D 3T2QA 1AXSA 4TSBL 1AQDB 3V7AG 4E9LA 4PRHB 3H0TB 4XNZB 1TENA 1ND0B 5IBUG 1ED3A 1W72H 4ZPTA 1KULA 2F19L 1QYGL 3I6GA 4OSUL 5DK3A 3S88L 3RGHA 3TNNA 4MQXC 4RMUA 1OGAB 1FIGL 3FT2A 3L3IA 1L7IH 5JZ7C 3VFMA 1F58H 2VIRA 1JBJA 3MLTA 4HKZA 4MA3B 4C56D 3RFZC 1JJUA 3JUYA 4EVNB 3NCJL 5MENA 1SBSH 3DV4A 1U8KB 3SEPA 4O00A 4G8FA 2JKXA 2YUXA 2ZUQB 3W2DH 2LAGB 2LU4A 3KYAA 1G0XA 4QRSB 3RIFF 1II4E 4HIJB 4G6JL 4M6MH 5E2TL 3DX6A 4JQIL 4N5ED 1KTLA 1GGTA 4JY5L 4KWUA 1MIEL 1OAXL 1T3FB 1CT8B 3K3QA 1T04B 4G9FE 2Y07L 3DX7B 3V6FB 3ULUH 1MEXL 2OP4H 1W0VB 4GQ9L 3G04B 2BHZA 4WO4B 3T0DA 2QQLL 2VXUH 2BVOA 1LDPH 4JPWL 4MA8H 4GFTB 4XPFL 5DRZA 3CFJA 2KDGA 2AJZA 3UBXB 5B21A 1LE5A 1H5BB 4EUPG 1XZ0A 2XKUA 5K9JH 1MCKA 2Z35A 4ZFGL 4WUUE 2X1WL 1XGQA 1F2XK 4G8EA 3VI3F 4HEPG 1TETL 2HT2C 4JHWL 4KKNA 5J12C 3N9GH 2DLFH 3RDTD 5I74B 3CVHB 5HDBE 5JW4M 3MX0A 1XZ0B 4POZC 3EYSL 4G8GD 3RP1A 4UZGA 5E24E 4P3DB 3UPCA 3MGOA 3O9WC 1OM3H 4JFOB 4K3JL 3MR9B 3VXOA 8CGTA 3BPOB 4KTEL 5DK0A 3PGCA 1CIDA 5EU6A 5B8CC 5CP3A 3G08A 3AFLA 1YEFL 1HDMA 3MGOB 1KLUB 3FRUB 4YPGB 1AH1A 3FQUA 4NOFA 4ZFOB 3CLEH 4U31A 1OARL 3VXOB 4HFUL 1NFDA 1QFOA 3QA3A 4LPCA 3MLVH 1DZBA 2ICEB 3BUTA 5KAQF 4TTGA 4XBPB 4NFCA 1RFDH 4QOKD 5ITBH 4JDTH 2V9RA 4QYOB 2DICA 2ERJB 1R0AL 1K85A 4ENEC 4OT1L 5DJZB 5IESH 1UGNA 5HYJA 1H8NA 1N64H 2QL1A 4NT6A 1WZ1L 3AC0A 3MBEA 2OK0H 1I8MB 2Y5TA 4NM4H 1NCAL 1QRKA 2HN7A 1CLZH 4YHLH 2P24A 4H1LB 4I18C 5J1AB 3CX2A 1CFQA 3B5HA 1D5IH 2IPUK 4JFXA 4YGVA 4BA8A 2HFGH 1JZ7A 3VGGA 4HWEL 2OZ4A 1GJIA 3P9LB 3L3HB 3Q6GL 1MCWW 2P5ED 4NCC2 3GBML 3TIEA 1BF2A 1I7UA 3EO1B 5D71H 3VRLF 4PGBA 4B5EA 4NUGH 1CFTB 2LTQB 2RAMA 2DD8L 1GGBH 2V7HB 5H37G 3T2NH 4PLNC 3TO2B 3OKDB 3PV6A 4JFHD 5D5MF 1VEPA 5F1IB 1A14H 5L2KB 2EXYC 5T3ZH 4DKAA 2E27H 4FP8H 1ORSB 4KMLB 1G6RA 1FCCA 3MLYL 4I3SL 3KYNA 4KKCD 2Z0BA 5ESAA 1D5MB 3GSXB 3EIFA 2UUDH 4L3CA 2Y36H 2I9TA 4ZSOE 4MA3A 3TO4C 4K55A 3CDGB 4QHUA 5F7DB 2FX8L 1CXLA 3Q5OA 4P5MB 3BDYH 1EMTL 1OAQH 5T1MB 1MCWM 1D5MA 3WBDA 3HC4H 1X5AA 1IBGH 4N0FB 1P7KB 5C08B 5J6HB 1JHKL 1I7ZB 4FFZH 5HJ3B 3FQNB 4D0CA 1T0NA 3EKCA 1PG7L 3CSBA 4F7CB 1KT2B 3A0OA 3WNKA 3X3GH 3HB3D 2JCCE 2ILLA 2YMXH 2PO6D 1U58A 1NAKL 1FJ1A 2DF3A 2VR5A 3WSQH 1CXKA 3P4NA 4UT7H 5CLWA 4RGND 3I6GB 3I3DA 4GS7B 1B4RA 3QBTB 1NGYA 3EYUH 4H1LH 4YHYC 3HRZB 1T1WA 1NGWB 4YAQB 1VKXB 4ZAKC 1TCRA 2I25N 4UIMB 4HH8A 1K8IA 1L6XA 2PW1A 2YSSA 4PJXF 1LVEA 4N1EA 3MACH 2FR4A 5EZLA 1LILA 5T1KB 1QFWL 5CINL 2UVEA 1JTTA 5KW9L 4P5TB 3L5IA 4KUCD 3MRHB 4GW4B 3UTSE 1VKXA 2AI0H 1OP5H 4KTEH 5GGVL 5BZDA 5DQDL 1OAZH 5E70A 3VJ6A 2H9GA 4KJPD 1G7JB 2VB5A 4XNZC 1CI5A 4PJ7E 5IHUL 1JHLH 1ERNA 2ED9A 2FHFA 4J4PD 1WZKA 3RVVD 2XICA 3HC3L 5SWZA 4PJEB 3MCG1 4Q0XH 5GHWH 3ARWA 4WWKD 4TUJB 5DJ8B 5CJ5A 5F1KC 4L29B 4YHIB 1HDMB 5DMGC 5IBTH 1RK1A 1PY4A 4OM1H 5DJAA 1ZGLM 4NWTL 2Z91A 1JP5A 5DUMH 3N0PB 3FOLA 2YS4A 3RWGA 4X0KA 1A64A 2IFGA 2PUQT 5INDA 3A6CH 2EDKA 5D1ZB 4QYOA 1NLDL 4B7LA 3ARBB 1G7QA 4EZMA 3QXAA 5DVOA 4MHHG 1CFVH 1IGIL 5MEPB 1MH5A 1KENH 2YKLH 2BHYA 5MEOA 1HYSC 5J4MA 1TLKA 3LSOB 2AEWA 3MFGB 3WFZA 3P77B 4ZXBC 4KU1A 3HS0A 3QEQB 5I8OL 4FQ2L 1QFHA 3V7AE 4JFYB 4G8IA 3O6LL 4RDQG 3DBXB 1MH5B 4UNVA 2IALB 4KJQD 4GRWF 4HV8A 5TF0A 3REWA 4W4OA 4L4VA 4G6FB 1KN4L 5DFWH 1MREL 1NCBL 1RVFL 3PWJA 4LLDA 5LGKA 4BYHA 5F9OH 1J12A 1TZHA 4NDMA 4NSKB 1LWRA 3HNSH 4HDIB 5I71C 1F4YH 2I24N 4L8SC 4YO0B 5J11B 3CSPA 3QFJE 4RNRA 4LDOB 2ZSVB 3ME0A 3MOQA 4L4VB 3TBVA 1QSVA 4JQXA 4U6YA 3VXUD 2WUCL 3PWJB 1ACYH 2GK2A 4OSUH 3DJ9A 4LEXL 5DRWA 1JNHB 1LO0H 2W9DH 4BQ8A 2ZPKH 3GKWH 2D7QA 3FCTA 1MRFH 4TNVK 5EU3A 4CN4A 5FGBA 2NY5C 4EVNA 4JKKA 2UZYB 1F90H 1MWAA 3FT3A 5J13C 4ODHL 3V4UH 2HJFB 4AY0A 4QT5A 3ZZ1A 1PVHA 3DMMD 5IVXB 4TVPD 5FHAH 1CR9H 4L5FL 2AKRB 2R2HB 4Y4KB 4U1MA 1QVOA 1WT5C 3SDCC 5GRZA 4HUWA 2GJ6E 4W6YB 5GS0C 2EIBA 3QQ3A 3P4MA 4NC2B 3VI4E 3ZDYE 5AD0A 3G6AB 3BP4A 2GFBB 2QSTA 3C5ZB 4DGYH 3CXHJ 3MREA 3PIQB 1N6QH 2DBLL 2VZVA 3GSNH 4EDXA 1CXHA 1ORQB 2NY5H 2PYEB 2F74B 5IGXL 1EVTC 5IBTL 5I6XB 1C16B 1UB6A 4BFGA 1FRGL 3GMNB 5DRXA 4N0UE 5CZVH 1SJVA 3RDTB 3CFCH 5KAQG 5C08E 2CXGA 3TZVD 1E6OL 1OAYH 1A1MA 4QHUB 4EI5C 1INEL 4BFIB 3PDGA 1FVEA 2WANA 3BZFB 3T08A 1U6AH 1IGTB 4MD4B 2CH8A 4KAQL 4U6HB 3Q5YA 1F6FB 1P7KA 3GMRB 1GC1C 5F8QC 3UROR 1NGQL 2MTPA 4R6UA 1XGYL 1Z6JT 1RJZA 1FNSH 1KENL 2FRGP 5IR1B 2BSSB 1N7ML 3VMNA 1U8JB 4J8RA 4PUBH 5IIEB 2J4WH 2X4UA 3S34L 5J3HC 1CFTA 4HX1B 2D0GA 1K2DB 5E99H 1EZVX 5DEZA 4CDGC 1ZT4A 4S0SD 3BEWA 5HYSG 1J1OL 4Y2DB 1BQHG 2VXQL 4YHOL 5L2KA 3BRDA 5HGDA 3CC5A 3LKSA 1HCVA 1L7TL 2BNQB 1Q8MA 5EO0A 4F3FA 3ROLA 5DI8B 1VFBA 1PKQB 2VL5B 1AKJD 4YBQD 5ICZB 3S35L 1MQKH 3S37L 5EZOL 4ZO9A 1JMZA 3U4AA 3BOVA 4XWGL 4R2GB 1CE6B 1NBZB 3CC5B 4ELMA 2HLFC 3MMEB 5CJOH 3ZYZA 2I60H 3DVIA 4XRCB 1FO0A 2MHAB 1NBQA 3VJ6B 3TEUA 4QXUL 1X5ZA 2QLVB 4YHLL 3TBWB 3MCKA 5EIIB 4HUVB 3MUHL 4Q9QH 1JWUB 2JF1A 1A3RL 2FHBA 1F11A 5FYLE 3BESR 4GXVL 1MHHA 1CLOL 2X1XR 3GSOB 4EOWH 3B9EA 5AUMA 3P11H 4GRWB 4YHPB 5FUCE 5HYQA 4R4NC 1Q72H 1I8KA 1PBYA 4IRZL 5L88L 3QHFL 1R3JB 2GJ6D 4EI5B 2BMKB 4M1GH 5E1AA 3HRZA 1OARH 2NLJB 3QRGH 4KK8D 4QWWC 4KV5E 2VLME 1A7QL 3U7AA 1CDBA 1A1OA 1DQML 3GSXA 1SM3L 2ESVD 3DIFB 3VWKB 4AYFA 3HE6C 3DSFH 1O0VA 3AAZB 4DWHA 3TZVC 4X8JA 3RWDB 1OCWL 2B5IC 4U7KA 5JLZB 2DQFA 5DJ0B 1GPOL 1NANH 2O5XH 3SE3C 2X4TB 3A67L 5ICXA 3EAKA 1S78C 3FT3B 1TZIA 1ES0B 3PWPE 2WMPA 3JBG7 1FQ9C 4LVOB 2VQ1A 1NMAH 2KBGA 1Q0XH 1AD9B 4U1KB 5C0JA 3SKNA 2DM7A 1NAML 2AV7B 4F2MB 5CFHA 1D9KC 4YDIH 3I2CH 5A3IC 4MWFB 2AGJL 3WXWH 4HULB 4X6FA 1N64L 2WWMC 3U0TA 3IKCA 4OFKA 1DUZB 4XCNA 4X6DB 1XCQA 4ELKA 5FYKL 3DUUB 1TZHB 3FB8B 4NDMB 1Y0LA 1FYTA 3RTQA 3BMWA 2GSGA 3RPKA 5F9JA 5KOVC 4WCYH 1WF5A 4LPYA 2IAND 4BJLA 5I66B 3QUZC 2R2BB 2YEZA 3TO4B 2P45B 5FHBH 5T1KD 2DJ4A 4NO3A 4P57B 1C5DA 4TPRL 2VSDA 3GSUB 5F89B 5EZJB 1OGAD 2GSGB 3B6SA 2J8HA 4XP6L 5MEND 2Z9TA 5CILL 1CDHA 2B4CH 5LBSH 4I18A 3IJSA 4K23L 1SY6H 3S4SG 5T1LB 1JWSA 3VXSB 3ZKNC 2JIXA 2HH0H 1D7FA 5FUZL 3HI6H 4LCYB 4D8PA 1YJDH 2EKJA 4KMQA 4F15B 1I7TB 2BP3A 4LPWA 4NJAH 4JFEE 3MV9A 1DFBL 3E0GA 5JXED 1I9EA 4HKZB 1JGDB 2HG5B 1XR9B 3G5XA 4XMKL 4J6RH 2K3TA 1UENA 4P4KC 4KQ3L 3R06B 2X1PA 1KB5A 3W0WD 4F7TA 4PJXA 4PG9B 3V5KA 2Z93B 1EVUA 5B8CA 3UMTA 1PKQA 3I85A 3Q5TA 1YECL 2FD6L 4Q6IB 4Z7WB 1S9VB 3NCFB 4QHMA 4XNQB 4MSWA 1YY9C 3MV8E 4PFEA 4S2SB 4OD2B 2DQHH 4PRNB 3MXWL 3MJ8A 4PB0L 1YEGL 5E8PA 2IC2A 4XP5L 1S9KC 4WEBL 3GMRA 4XT1C 1VGKA 1U3YA 3PABB 3U0WL 2P7TA 1S5IH 3HPJA 4JHZA 7FABL 4U4BA 4PV9B 2A0LD 2AQ3A 3EYQD 5HHMD 5JXAL 2ARJQ 1LO4L 2X4UB 3MRRA 1K9TA 3QQ9C 2QR0B 2Z35B 2BNRD 2GKIA 3OJMB 3T04D 1ZANL 2XG5A 5HYQB 1BLNB 3ZT7A 4KGJA 1NKRA 1INDH 4OKDA 1F8TL 2CPCA 3WO3B 4P5TC 1FORL 2W0KA 4NQUA 3F58H 3UTZA 3MSPA 4X8JB 3RWDA 2B1HH 5E08H 4YXHH 4LFHD 3O45A 2DQFB 1BFVH 3U4BL 3KYOA 5DQ9A 2C3XA 5JHDB 3OX8A 1IQWH 5ICYB 4X9HA 4UV4L 4WEMB 3ARGB 3RQ3A 3AROA 2P44B 4HUMB 5ID1A 4DUWA 4LAJH 3X3FH 3OGCA 2Z92A 4FZ8H 3DETC 2DJSA 2A1WL 1IM9A 1C08B 4XP6H 3GHBH 1KIRB 1EA9C 3W9EB 4IOIA 2IFFH 3DO3A 1U92A 4NKOB 1FVCB 1V3LA 2MQ0A 3IF1A 3UTSD 5I1AA 5L9DH 1MHHB 1RZIB 2OM5A 4PRHD 5DZNA 4OGYL 1V5JA 4PJAB 5EO9B 2KL6A 4AH2B 2PXYA 3VRJA 1YEGH 1P53A 1YNLH 4XCEA 2DQHL 4L8CB 3K7UA 3HZKA 4YJZL 5HYJD 1NAMB 4LDEB 1T21B 3VA2C 1P4LA 1EDQA 4HJGA 1MLBA 1FZKA 1MF2H 2VDNL 3QB7C 3NTCL 3QFJB 3RWIA 2D7PA 5D1QD 1IQDA 2EKSB 4KI5F 5F9WB 3KYMA 2CMRL 3LZFL 4KZEH 4L3EA 4AEHH 1V7NL 3RNQB 3B5GA 4WO4D 1D5ZB 3QJFB 1S8DB 5HI5C 3BMVA 2J6EH 4JFOA 1E4XL 2X1OA 3LKOB 4NHCL 2VC2L 2AS5M 3DRTA 5IMOA 3O6KH 5JW4Q 3WUWB 2WAHA 3OKKA 4NO0B 2EC8A 1IAII 2EDTA 4XMLL 3S3SA 5ID0A 3EYQC 4FXKB 1T7ZA 1MFNA 3CMOH 3WXVH 1TVHA 4NUJA 4FQXC 2P43B 3Q48A 3V8CA 1K3ZA 3EDFA 2AABH 5I1CL 2E6QA 3P3YA 4M6AA 5D1XD 5GS1C 1I85A 4FQJL 2Y1VA 2MCPL 1JZ5A 3T4YB 3B9KC 3G6DL 3MXVH 4PS4H 4UT9H 3U30B 2N1KA 2BZDA 4GKZA 4NQEA 3T2PA 3B4NA 3IU3A 1JZ2A 2BVQB 3TYFA 4P2RD 3BKYH 4LHQB 4LCWA 4F33A 3RUGF 1EHAA 1IC5H 4HFWA 5DRNA 2FECL 3VU2A 4AJ0A 3V6OC 3MRJB 4U1SB 1QFWM 4PRHE 2BJMH 5I19H 3WS3A 4YC2C 1B2WH 4KGLA 4MZ2A 3BUYB 1KXTB 3BPLC 2J8OA 3QR2A 4BKLB 5J9PA 3G5VB 1RZJL 1QFUL 1I7RA 1J0HA 3VD3A 3DMMC 3TBVB 1NGWA 3QG7L 2VDRL 5CZKA 1CLCA 3DX7A 1B0RA 2H8PB 5E2VL 3FB8A 1SYVA 1SM3H 2EDQA 3MNVA 2FJHA 1OHQA 1YEDB 2IBGA 3CZFA 3G5ZB 4MNQE 4X99A 3RPIB 1J1OH 5EFIA 4CVXB 3WNOA 2WW8A 3RDTC 4XAKE 3FN0L 2C3VA 4LU5L 4V1DA 1X4YA 3RVWD 1R5VA 4XCYA 4JPIA 5KG9A 4WGWB 2OJZL 2XA8L 3OBAA 1FL3A 3C9NB 1U8KA 4PRIB 4K71C 3C09C 1CLYH 4OQTH 4KHXH 4NHUA 2N4IA 3FOMA 3MGTB 4MMZC 3RVTD 3BPNC 1U9KA 3UPAA 4N0FA 4O9HH 3PGFH 1CGVA 3TBTA 3T2OA 5B3JE 4YR6B 3NA9L 4HD9A 4PY7B 2ARJB 5T5NG 2DOCA 4N8VB 1UWGH 4P23C 4I3RH 4NJ9H 5D9SB 5JW5A 4UOJA 1QG3A 3LEYL 3QZWB 4M4PA 3CXDL 1X5KA 4LLQB 1HHIB 3PWNB 4U6VH 1I3GL 4FTVB 5HDQL 5F9JB 3RIAF 3EJZC 3IFOB 3O3EB 1QO3A 5JPNB 3R06A 4F7TB 1T22B 2VH5H 3QIBD 3H2WA 3R4DA 3MLUL 1OTTC 5GGRY 3VXME 5GS2D 4JRYE 5E6ID 1P84K 5J57B 1QOKA 4WGVB 2ESVB 3QIBC 3MRHA 4GW4A 1NKOA 2BHUA 5HBBA 4P23D 1T5XA 1MI5D 1S7SA 4DGIH 4MJIA 4PTTA 2CJUL 2I07A 5D72H 1QA9A 4NM8H 4WFEE 1IM9B 4LCYA 1A6ZA 1ZV5A 5F1SA 4NO2A 1U91A 2YZ8A 3IGAA 4PJ7F 2W0FA 4P59H 2B20A 4FQCH 3W9DB 2FGZA 3QISA 1UZ6E 3GSNB 3GFUA 5C6TH 3FZUD 3K8MA 3PQYA 4V2BA 5CBAB 1J8KA 5LCVL 3TT3L 1LO3H 1A21A 4TQEH 3LKPA 4Y4FA 2JJTA 3PWVA 2DBLH 5HYIA 1VA9A 5LCVH 3TT3H 4QXWA 4QRRE 1B4JH 5F7HA 1FGNL 4ODWA 5JA9A 4L4TE 2IFFL 4K3EL 3KLSA 1ZWIA 4KK6C 4JZNA 2OL3B 2VLKA 4JO4H 5GZOC 3AREB 5C92A 4HUWB 3FFCE 3LKQB 3QDGA 2WQ8A 5ID1B 1JNLL 1I8IA 3KLHD 3ELAT 5KANI 4ODTL 3ILPB 1EFXA 1HZHL 3HPJB 3AGVA 3GMOB 4PGEA 3P9LA 5DR5H 4PRAA 3BEVB 4EDXB 3PWLA 5JQ6L 1KT2A 2Q7YA 4WI3A 3HI1B 1NDMB 1X3DA 4JHAH 4Y4KD 4LRIC 2VDNH 1S7QB 4JZJA 1E28A 4LOUD 1LK2B 4ZUWB 5GGUA 3WJLA 4HIIA 1ZHLA 2AEQH 3IB4A 4GUPB 4XAWH 4XPGH 1BECA 3TBSA 2XQYK 4ZD3H 4LHUB 1U8IA 3VXMD 1HKLL 3QFDB 4KROB 3FO2B 3HZKB 4ZMAT 5I1HL 1CDCA 1KPVB 1NJ9A 2YSSB 4H5SA 4XXCA 2VE6A 4Z95H 2Y06H 4L3CB 1P4IL 4TOYH 1X5JA 1TVBA 4RA0C 2PR4L 2DS4A 1RJZB 1YY8B 43C9A 4HPOL 1X6LA 2DQTL 3QUXB 3GHBL 2CIIB 2Y25A 2M8XA 5H94A 3SE8H 3TESA 5IB4A 3OXRA 4X7CC 1A6PA 5F7EL 3W11C 3SGDH 3KS0J 5KVDL 1GC1H 4HJ0D 4XWOC 4UUJB 5TQ2H 3IDYC 1S9XB 3HKFA 3TF7C 2Q6WB 3D25A 1K4CA 12E8L 5LGJA 5IB4B 3D69B 4R4BA 1VCAA 1IGIH 4OLEA 1EGJH 1EZVY 1JPTH 4DEPB 4JGMA 1QRNA 3BH8B 1HILB 1JUFB 2I26N 3FRPG 4H20H 4JKLA 5D7IF 4I9WD 5KVGL 4Y4HD 4EN3D 5JDJA 4XCEB 1RIHL 3PWPA 1XGTA 3EYFB 1NMBH 4YE4H 5D1ZA 3JVGC 2ZJSH 4WY7H 1MSPA 3PDOB 4P4RB 5CHNB 1DQDL 3JSSA 1MVFA 4UMGA 2EDJA 4Y5VC 3MJ7B 1IQDB 3VDAA 2I5YH 2Z8SA 5GRVL 5H8DA 2HFEA 4HFWB 1BWMA 1S7WB 2DLIA 1X44A 2EDYA 4GAGL 4PJIE 1QBML 1WISA 1QPXA 4Z18A 1I1AD 4JB9H 5GGSA 1S7XB 4Z77A 1BJ8A 5KSBA 5AZ2H 4OFPA 1ZEAL 3IS0X 2F8VA 4NZUL 3UYPA 5DJYB 4JFDD 4L9LC 3VXPB 3WO4C 3P0VL 3HR5B 4PRID 1CF8L 1CXFA 4U6XB 4KI1A 3MQIA 5CEXB 4P46D 2IPUG 4MNHB 1TJGL 4OKVA 3U36A 5CJXC 4AT6B 2PF6A 2ZNXA 3WN5B 3HMWH 2BY0A 2CK0L 4WHYG 4U6TA 5LQBH 3SDAA 5KJRL 4M5ZL 4K94C 3T8XA 5EBWB 1M7DA 4WW2F 4Y19E 2P7TB 3BZDA 2YMXL 5D2NB 5K9QI 4HHAA 5CGYC 1BM3H 4LSUH 3TV3H 3HAEA 4TUKL 4PRIA 3UJJH 3F65A 4UV7L 5FUCC 3THML 1QFUH 4Q9CA 4GSDH 5AAWA 4PJDE 3UC0L 3ZHDA 4O02H 3ULVE 3FTGA 3S6CA 4XWOD 2RQ8A 2C3GA 2OXHA 4MD0A 4J3VA 1PKQE 2IPTL 4UV7H 5L2JB 4MQSB 4PRAB 4QOKE 5A16B 1VERA 4JFQA 2P8PB 1LO5A 4ODVL 4M00A 4YDVB 5K9OB 1B0RB 4Y4FC 1FLRL 1T7VA 4MHHI 5F3HB 4U1NA 1HWGB 1CFSB 4K9EL 2WUBH 3H8NA 1PZUB 5SWSD 1R3JA 5C07B 1KCUH 2VDQH 3U7YL 1HHHB 2JELL 2HFFA 1OQOA 4D0BA 4E41A 2CSPA 3B3IA 4DGYL 1N8ZB 4NKIL 2NY2B 5CD5C 2AJYH 2D03L 4ACPA 3MV7A 4FQHB 1UVQA 2G60L 3U46B 5D7JD 1ZLWK 5JPMB 4DAGH 1KTDA 2VDOL 1AY1L 4HIHA 3QXTA 2X4PA 1DVFC 1D5IL 1HIMH 1D6VL 1UFUA 2I5YL 5F7NC 1YJDC 1A6VL 2RJMA 4K3DL 2R69L 2P49B 4NO2B 3SDXB 1UM5L 4X6CE 1TETH 3C6LB 1K4CB 2W0FB 3Q6GH 4HLZH 1CN4A 3WE6B 5IEHA 4D9LH 4UQ2B 3LEVL 3UO1L 4PREB 4JZJB 5EU7E 2YXFA 4PG9A 1QHOA 1MFDH 3BP4B 1WK0A 3V7MA 3BJ91 2L0DA 3DUSA 4LL9A 1YC7A 5KVEH 5JIKA 4KTDH 3SKOA 2VJXA 5DSCB 1RU9L 2P47B 1KCRH 3DNKA 1B0WA 3J8F7 3KPRE 3RJQB 4MVBC 2JJSA 2P24B 4H1LA 4AQOA 1B3JA 3BGFB 2ADFH 3HB3C 1YYML 4KUCF 5HI3D 4WJ5A 1A3LH 4KFZC 1UJ3B 1IC7H 3DUSB 4OCYL 1NMBL 1SJXA 3V2AR 4CNIB 4L4TB 3RAJH 5DHVA 3RIFK 4UAOC 5DJ2B 3EUUA 3T1WA 4YQXH 1EAPB 3RWFA 4K2UH 5DMIL 1U8PB 4IS6B 2V7HA 1A5FH 4LKXA 3MR9A 1BLNA 2FHCA 1AJ7L 3MA7A 1B6UA 4M4RA 3SJVB 4OFYA 3LHPH 3PWLB 1Q9KB 3DSNA 2W07A 3B2VH 1MVUA 1ADQL 3VGFA 4PRHA 3FFCA 2EIZA 4IRJA 1RUQL 4Y2DC 3S3PA 5GGUB 5L8KB 1JPFA 3QXWA 3BKJL 5B22A 4HPOH 1EV2E 1SYSA 1W2KT 5DD5H 5MEQA 3NFSL 3CDFA 4K9EC 3UTTA 1CE1L 1CDUA 4HMEA 4JFZH 5C0BE 4G42A 5LXGL 4GJTB 1A6WL 1QRNE 5GPRA 5DJZA 1R3LB 1N6VA 3KPQB 4PJIB 1A9EB 1U8LA 4PJHB 5HJ3A 3DVNA 2ICWA 3HMXA 5ICXB 2BVYA 4NRXB 2R1YA 4M5YL 3AREA 3RA7L 3REWB 1RIHH 4MXWH 5AYQA 5IVZB 4XPAH 1U3HB 3WJJA 4I48A 4H20L 2D2OA 1NC2D 1KTRL 5E6ZA 2O5ZL 3KR3L 3N85H 5F9DC 3O41A 4A6YA 1S9XA 2J12B 3MCLL 1KFAL 1MELA 3VCLA 3CLFL 2Q7YB 2FBJL 5K9KB 3RIAK 1ETZB 1OAYL 3ZKXC 4OCNC 1L9MA 5E2WH 1S7QA 4FABL 5DRWB 5EU5A 1YQVL 1SEQH 5I75B 1LP9A 5BOPA 5GGTA 4LQ1A 3QFJA 4M02A 1FZMB 2P5EA 3IXTB 3SDDC 1YQVH 1XGRA 2EE9A 4X7FC 1Z3GL 1YQ2A 4YHMH 5DC0A 5E56A 3U4EA 4Z7UA 4F58L 5EUKB 5C0BA 3DYOA 5DJCB 2JJSC 4PTUA 4RWHA 4WUUA 4JO1H 5GJSL 4ZUVA 3ARBD 3MPCA 4KKCC 1QEWA 1ZOXA 4YHNB 4U3XA 1D6VH 4LHUD 1ZLUH 1RZ8A 4Y2OA 3T77B 5T1LA 3ARYA 3V5HB 4ZUVB 2EO1A 5IB2B 1NGZA 3I84A 1ZT7B 1AFVH 1CXIA 4M62L 3WL9B 32C2A 3EO0A 2J1KA 4ETQA 2A6JB 5I15L 5EU6E 1RZIA 2HLAA 1WVZA 3BW9B 3CH8A 3I02B 4IOFC 5I9QB 1C16A 1CK0H 4DKFL 3B2UD 2MQCA 4P3CL 5HD8D 2PXYC 3SKMB 3VFGH 5I1LA 3CUPB 3QDAA 5C07A 3IXAA 4HJJL 1IARB 1MIML 2HLAB 1LEKA 3DECA 3BGMB 3H3PL 1HXYA 4OJFH 3X13A 1A7NH 3CZJA 4HJGB 3ARVA 3V5KB 5C2UB 1VFOA 1QFWI 3QIUC 3MUJA 5LWYL 4QHMB 3CLFH 3PXHA 4NKDB 3HAEB 4XHQA 3H3BC 3MLRH 3CFEB 1IMHC 1DE4A 1RQ5A 2M26A 3MROB 1HKFA 3MUGB 2DWDB 3QRFM 4G6ML 5J1AA 1FYTD 1VENA 4OGAD 1U8PA 4XXDB 3L3JA 3CPLA 5KSVA 4JKWA 5C0AA 4RWYH 4DW2L 4FQ1H 3SN6N 2H3NB 25C8L 2C3HA 1L4IA 3I2CL 4XZUB 5F7FA 1A4KB 1UQSB 3OL2A 4HWNA 1RURL 4MB5A 4R90L 3DPBA 4XNMB 3RWEB 4F7PB 5BXFB 4P46A 3PP4H 2ESVE 4OQTL 5DEFA 5IHZA 3PWUB 5IB1B 2WBJB 4JANB 5E9DD 1FV1B 3RVXC 1G6RB 4POZD 4CRPA 3TV3L 4JG1L 1TJGH 1Q9WB 3OKLB 3ULVD 5DLMH 3RY6A 1XCTB 4OM0H 3SDAC 2WZPD 1WWCA 1UM5H 3O3BB 1FC1A 1SVZA 5HDOA 4S1QL 1FG2A 4G6KL 1HXMA 4LVHB 3B9DA 3U6RB 1U3HA 2F8XC 3V4VH 4GW5A 3EFDH 1KGCD 4KPHH 3P11L 4JM4L 2A74A 2ZKHH 3BO8B 5FCSH 3HUJA 4U0QB 3W0WA 4WUUD 8FABB 2E7CA 3ARGD 3K1DA 2PO6B 1FNEB 4JM4H 4NGHL 5HGAB 2CUIA 3BZEA 4G6MH 2A74B 3LKRB 4HH9B 5CKAA 5I76B 1IAKA 1F4XL 1T20A 5ACMA 3E3QE 5T5FH 3IAQA 5C08D 4HKJB 4LSQL 3UTTB 4YAQA 2CRYA 3UJTH 1QSFB 1RIVL 4DVRL 4HZLA 1CK0L 3TCXA 2H32A 2XZQH 2OP4L 3G6DH 3S97C 2H2PD 5GJTH 1SMOA 1T1ZA 1YMMD 4F9PC 1KBGH 2X7LA 2FO4A 2X4RA 5E03A 1HN1A 3D9AL 4GG8B 2P8MA 3K4DA 4OF7A 2HJFA 5BW7C 4ONOA 3IKCB 3QEQE 4WWKC 5FOBB 4OCXL 3WIFB 3C60D 3I75A 3DX8A 5I15H 1XGUA 5HVHC 4XBEH 1DBKH 2EDXA 2XQYG 4MAYA 4OF5A 4X9GA 4OZHE 1FVDA 4XVUC 3LY6A 1MQ8A 1T83A 1T4KB 4YXKH 1GC1L 3QNYB 4JFFA 3U7WH 4QRTA 2E6JA 3CNKA 3JV5A 4HGMA 2FBOJ 5D2LE 4CJ0A 5I1HH 2DQDL 4U49A 3ZMRA 4JM2A 5HYFA 5IQ9A 4XPHH 3WFCH 1BBJA 5A2IH 1VFUA 2P42B 1FZKB 2CLRA 3QI9C 4G6AD 1YC8A 4KKAD 4LCIL 5C0ND 2YWZA 4JB9L 5AG8A 1FFPA 2V2XA 4JM2B 1MCPH 2BK8A 3D0VB 1D5XA 3MRJA 4U1SA 5EPMA 3QHZH 2ZUSA 3NN8B 4ZG1A 4YBLB 2Z8RA 5ITFB 1NGZB 1OAUL 5I1GL 3NIDF 4XMLH 2CDGB 1ZK9A 1YZZA 4P2CG 2DMKA 3WN5A 3D0VA 2XRAH 4RIRB 3LQZA 1MF2L 4ZFGH 3PE9A 1P1ZA 5I8KH 3L3KA 3QDJE 1WCBA 2FX9L 3NACL 1AO7E 2D7NA 1F4HA 2E9BA 4UBDC 4WV1A 5MEQB 3TBYB 1NFKA 5KVGH 4JO4L 1LQSR 5IVNA 1MCHA 3QQNA 3PWVB 5J3HD 4WTZA 4K3EH 5DC4B 2OYPA 4GG6B 1D9KD 4PTUB 3WCYA 1KEGL 1YEFH 1LEGB 1ACYL 3BKML 5IQ7H 1INDL 5ANMB 5HHOA 4OGXL 1X5LA 3DYPA 3L5JA 5EOCH 5I17A 2G2RA 3VFWB 2XY1A 3C8KA 3OWEA 3SBWA 2NZ9C 3H7BA 3VGAB 5BRZD 3CFDA 4ODBD 2MKLC 3BFOA 4JO3H 3SGDI 1KN4H 4U1MB 2C4FT 4L8DA 3T0EC 5KSUB 4LKCA 1AJ7H 5K9KA 4ETQB 3GSQB 3FQRA 2SEBB 2X41A 3V9FA 4P2OB 2WIIB 5DURB 1I9JH 3WV0A 4LLWB 3ZL4H 2EZ0D 5BW7A 5J1TC 3BSZL 2PN5A 3F58L 2VLKE 4OFVA 4P2QD 2UZXB 3FO2A 2CRMA 4XCFH 3OKEB 1I4FB 5B3JF 3SY0B 2PYEA 2OTUB 1K5NA 2J88L 5D4QA 1GOFA 4GQ9H 2VRAA 3DROB 3NBNA 3C8DA 1TNNA 1DANU 3UPRA 1RUKL 2V5YA 5GRJH 4LCUA 4MJ5B 5IOPA 4ODUA 4XBGA 4XCFL 2CRIA 1KC5L 4JCLA 1OGTB 4FFVD 4YEEA 1WZLA 4WHTB 4Y19D 2FGWL 3BKJH 2E9WA 3ARDC 1VEMA 3UO1H 2JB6B 3KHOA 4XP5H 2HMIC 2W9LA 3P4OB 3DTXB 3G5YA 4ONGH 1MRCH 1OGTA 4XXCC 3JV6B 3KNBB 1FYHB 4XMPL 2Y36L 2NXZC 5GSRB 1T4KA 4PJFF 1NC4B 4X5LA 2NXYD 2HT2D 3GMLB 3HUJE 3WKNA 4TYUA 1UWEL 3DVFA 4NT6B 3DETD 3MRDB 4YBQC 4CNIA 5E4IA 3WJLC 5GGRA 3LKPB 2NYYD 1EO5A 4P2OC 1H8OA 1TXKA 1TJHL 4OCYH 3CIQA 1J0YA 1HH9A 1T5WA 3LPGA 5F89A 1T2QL 4BUGA 2OMBA 2VUOA 5JORA 2M2DA 1J18A 1DQJB 3D6GA 1J87A 1CE6A 1NBZA 3SCMD 1MWAL 1FNGB 2CLZB 4XMKH 1QPPA 1WBZB 4NHCH 2HFGL 4HAFA 5A1AA 1YEHL 1FLRH 4KZDL 4X9IA 2XZCH 3LIZL 3FAXA 2Z31C 4UAOB 4TUKH 1EMTH 3UJJL 1IRAY 4D8PB 4PJ7B 3GMMA 1DBKL 3WDHA 3GMPB 1PG7H 1WIUA 2P4AB 4K3DH 3WS6C 1A6TB 1QBBA 3QDMD 1FZJB 1G6VK 3MRFB 1B0GA 2JJTC 3C8HA 2JTDA 2D03H 2AJ3A 3EGSB 5MERA 2CK0H 3NIGF 1NFDB 5I2IB 4HMCA 2W92A 1FBIH 1XR9A 3U46A 3U36B 3BN9C 4FTVE 1HHJB 2BOBB 4WU7A 3QI9B 3GBLA 5KVFH 1Q9LB 2G75B 3FB7A 4M6OL 4LGPB 5E2UH 3REVB 4RFEB 4YXKL 4NJ9L 2BDNH 4TULL 4MX7A 3QRGL 2W59A 1KUMA 2ADGB 4FQCL 1FC2D 3ULUE 4Y2DD 2AV1B 3C6LC 1OW0A 1XF5B 4KRPC 4OFDA 1IAMA 2IPTH 3SE9H 3CSYB 4P3CH 4MXQD 1LE9A 3LIZH 5BS0D 4HQQL 4M9OA 1H15B 5H37H 1LP9B 4QRSA 4OLYL 2WWKT 2HT3D 4QXGH 5L2JA 2QBWA 5AZ2L 5IK3B 1ZKAA 5CP7A 5FO9A 4BQ6A 5FF6A 4HS3B 1NCDH 4NWUL 2ZCHL 4P23B 1ITCA 1R3KA 2FIKA 1IFHH 4GAJH 2HVKB 3OV6A 1MCEA 3ROOB 1ZMYA 2KQNA 5DMKB 3RTQB 3HAEH 3KLHC 2X2YA 1CLZL 5DHVB 4EIGB 1P9MA 1RMFH 1S9YA 4PJBF 4N90E 3LN4B 1MHEA 4QT5B 2GTZA 1EEZA 2Y07H 1W0YT 2LE9A 4PJFE 2FYYA 4G8EB 4M7ZC 3CCHB 3HZVB 3KYOB 5DQ9B 1FFPB 4YK4C 1QSZA 5F3BB 4R90H 5GRUL 3RKPA 4G7YL 1G7HA 5DVNA 5EOCL 3FFCB 4I77L 2NXYB 2JIXB 1U36A 5GGSB 4M8QB 4E5XA 4HGKC 3MLWL 2CR6A 1ADQA 1AGBA 43CAB 5TDPB 3R1GL 4HS8L 1HYSD 3EOBA 1PJ9A 4KMTH 3H3PH 4OJFL 1F6AA 5D7JC 1OM3L 4XP1H 3AREC 1WBYB 2MPAL 1QLFB 3H42L 5GGRB 1J86A 4DZBB 5FAAA 1UJTA 4OZGA 1CGYA 4MCYB 4DKFH 1IKFH 3OAYK 3LDBC 3LQAC 2FR4B 1GL4B 1CVRA 4S11A 3IRPX 1FFOB 1RPQA 3NIGE 3JTTA 3VWJD 2XZCL 3V6OA 2AEQL 1HNGA 4XAWL 4XPGL 3IVKB 4UU9B 2OZ4H 2UVFA 5K59E 4MNGB 1RZ7L 5JR1L 3LKOA 1ZHNA 3LKNA 1ADQH 1GVIA 4XX1E 1SVCP 1I1FA 2Z31B 4JN2A 4PJ5B 3MRGB 4J3TA 1E6OH 3JXAA 5EO0B 3L3OB 1NH6A 1YPZF 3V6ZB 3CAFA 1TVHB 2YPLD 4NUJB 4ZS6C 3QULA 1U8HB 3U48A 4P9ML 3S96B 1YNLL 4OZHB 4KQ3H 3RZCC 4HUUA 2XWTB 3BQUC 5E1HB 2PNDA 1DR9A 1JGEB 2Q3AA 4OD1L 4LVEA 1J0ZA 2MQ3A 1AI1H 2FD6H 2UWEE 3T8XB 2C4FU 1F6LL 1A3LL 4PRDA 4MMXC 3VFUB 3VRLE 3TGXA 4ZOEA 3HCVA 1A0QL 4QF1A 4XHJC 5MEOB 5H35B 3NZHH 2NY4D 3U7WL 4UT6L 5I17B 1BD2B 1FNEA 1T0MA 3HZYA 4CVZA 1F02I 2XXCB 1RVFH 2DQIH 4HIIB 2APTA 1WQVT 1LO2L 4ZNCD 1PEWA 1XIWB 4U0RC 4HXBL 1D3CA 3M1BB 3QZWG 4LBEB 1KPVA 3F7VB 1W72B 5JHDE 3NCYP 1T22A 1Z9LA 3ZDYF 2PW2A 2CQVA 3TIDB 3VFTA 2DYPB 1SYVB 1UB5A 3GMLA 2K7QA 1BPVA 5DMKA 3SGKC 3CFBA 1KJMA 1I1RA 4JM2D 2HAZA 4X5WB 1WJ3A 3BSZH 3OKEA 3QUXA 4NBZB 2X40A 1T21A 5CWSA 3RGVA 1T5XB 5EOCJ 4Q9BA 3M17B 5C0JB 3IFLL 2VLMD 5SWSB 3A6CL 3LHPL 4HUXA 3HAEG 4LSQH 3CFBB 4BZ2H 3H42H 5MENE 4Y4FD 3T0EA 3RTQC 1RUAH 3EZJB 1TTUA 3B9KD 4APQA 2NY2C 5I16B 3PGFL 4I4WA 5DQJB 4AIZB 3VGAC 4DN3H 3O4OC 4JFEB 4WI6A 4H88H 5FYKD 4KMTL 3SBWC 4KVCH 5CGYD 4WI9A 1UXWB 1MCSA 4Q6IC 2BVOB 4R9HA 4LAQL 1QSEB 3UZEA 1VEOA 4X98A 5KW9H 4NO0D 1NUDA 2AJXH 4PRBA 3OF6D 1GGYA 1ITBB 1OTSC 3FO1B 4OM0L 5D93C 5E08L 2VXSH 2EC9U 5JR1H 1XR8A 3R0MA 4HF5H 3QEGH 4GMTL 5B38G 5CUSH 5EZIH 4R4ND 1IJ9A 2NY4B 1KCRL 1KPUA 5I2IA 4G6KH 2BFVH 3BKCL 4NRYA 2GSIA 3SE3A 3UDWA 3BI9X 2J8UF 1S3KH 3L7EA 5C8JA 2FNBA 4HG4K 3SQBA 4NWUH 4H8WC 3S34H 3MRKB 2VWEE 5HHVL 4OCWH 3PJSA 3TN0A 1FL6A 2GK0B 5CJXA 4PGDB 1RJLA 4RBPH 3WN5C 5I1GH 4M1DH 5C3TA 1NGQH 2A9NH 2EEAA 8FABA 1XH3A 4G43A 3VXRB 1JL8A 4P2OD 3UDWC 4YX2L 3BE1H 3HS0B 1YNKL 1KF9B 1RHFA 2CD0A 3KLDA 3T4AA 2P5WD 3BRFA 1CF8H 1I1YA 2V17L 3QEUB 2UWEF 3L3DB 1JF1B 5C0IB 3WNNA 2HMID 3GSRB 3MYJA 3EFFB 5JIHA 4NQVB 1BMGA 3LB6C 5D1QB 1Q9KA 5HXMA 5LAXA 1KB5B 3HTLX 3QO0A 4KPHL 5HPMB 3O9WB 2HVKA 1DLHA 3MLXH 1OP3K 4U3CA 4ZYKA 4RDQF 2R56H 3ISWA 5HGDB 4Z9KB 3VFGL 3ARFC 3GJFK 1OP3H 4G8FB 3GMQA 2ATKB 4AEEA 3SPVA 5H94B 4APQC 2O26U 4M1CD 4Z7UB 4GRWE 3VG0L 1KJ2H 3GRWH 5D71L 4AM0A 5HVHB 4PV8B 4PJ5D 2NY3D 4ALAL 5GSVA 3KPOB 4R8WL 4XI5C 5D7SL 1XF5A 2DB8A 3SPVB 4MAYC 1NAMH 3NCCB 3QUXC 1DN0B 1I9IH 3SDDB 1XGPA 2OI9B 1AHWA 2ZCKH 4JQVA 3VWJC 1ZLWH 4EI5D 2BNRB 1U3JA 1EGJA 4GMTH 2R4RL 4Y7MA 5E6IC 5ILTL 2ZCHH 1NAKH 1BVLB 5D2NE 2DN7A 2B4CL 2R0KL 3RVUD 1F90L 3BEVA 4HWEH 3B8SA 3O3UN 1PKOA 4QXGL 2R4RH 1WFUA 4Y5YC 4OIAA 5DS8B 3SY0A 3CVHH 2QQNH 1KJ2A 1Z9MA 3P4MB 1BBJB 3MRIA 2I9LA 4C55A 3U2SB 2V7NA 2EDOA 5ACZB 1GZPA 1PEZA 3CDGA 4LPXA 4EI5A 3TFKD 3E6HA 4HWZA 3CVHA 1QP1A 4U0RB 3VG0H 4OGYH 5FGCB 2ZG2A 5D70H 3WLWD 5KS9A 4J4PC 4M9PA 5FYKH 5ADOH 3U9PH 1RFDL 3IDXH 4BQ9A 1KFAH 1KIRA 4XVSL 1PQZB 3VXMA 4XP4L 4L1HA 1I7TA 1DQQA 2BCKB 5CGTA 2EDDA 1K4DB 3M8OH 1J05B 1U42A 3GO1L 1MCLA 4Y89A 3UZQA 3DURA 5ALCL 1M7IB 3RBGA 4O2FB 3NZ8B 3KPLB 3HE6A 2CMRH 3LZFH 4KZEL 2YA0A 3TN0D 3W9DA 2XNAA 3X11A 2AW2A 5J06A 1K4DA 2C7UA 5E8OB 5FM4A 5CP3H 5IF0A 2HWZL 2WBJC 4G80B 5HHQA 4KK9D 1G9ML 2VYRE 5JNYB 3ZKSD 4YE4L 1IQWL 1Q1JL 4Y1AB 3U9UB 5I1LB 1TJHH 1JFQL 4ODXB 4PJEE 1SQ2N 4X6CB 3AB0C 4LF3B 1RURH 1ZANH 4IRZH 4MCZA 1NBYA 3FMGH 5CMAA 1JN6B 5BO1H 4WHCA 4ISVA 2VAAB 2YPLA 1MJ8H 2W9DL 2ZUYA 4H0HB 3TO4D 4J12A 4JQIH 5AAMA 1FHGA 5CSGA 2KZ1B 5DD5L 5IP4A 2OL3A 3MRNA 1I75A 1YEEL 2WV3A 1A5FL 4XRCA 2XY2A 1IGFH 3NCMA 4JO2H 2RR3A 4KVNL 5FGCE 3CPLB 4QRPE 5DMJB 3TO2A 1N59A 1LD9B 5D7JA 1GGIH 1LK3H 1JV5B 1FAKT 3RWGB 2YKLL 4NQVA 4M5YH 2XN9B 1BJ1J 1P4IH 2B4CC 4NQEE 4WEBH 4Y5XA 4ZXBA 2EYRA 1A9EA 5TF1H 3C5ZC 3K8KA 4BZYA 2ICEA 5BV7H 5IQ7L 2F54A 2NY6C 5IMLA 4KTDL 1M6OA 4Z5RA 1F3JB 3OX8B 3DVGA 1T1XA 3RVVC 2ADFL 5KSAA 3VFMB 5EWIL 3P73A 4M6NH 1NLDH 1WEJL 12E8H 5BMFH 2NY0B 4JFHE 1FORH 3WNPA 1FG2B 3D0LA 2BRQA 4Q0XL 3PF2A 1YDPB 2BFVL 5CSZA 5EBGA 5FYLD 1CL7H 4LRNL 5DUML 1AIFA 4FXGB 2G5BA 1VADB 1GZQB 4YFLI 5E8EA 3NZHL 3VXSD 5CILH 1OF2B 3U82B 2BSRA 1YJDL 2FL5A 4X98B 3MNWA 2ID5A 2ZUUA 3K74B 1B4JL 3LB6D 4R3SB 5ELIA 1DBBL 4OUUB 4YHML 3OAYH 5T1KA 3INUH 5CJQL 1IAKB 4YUEL 2NXYC 2EKSA 3CCHA 3HZVA 5TFSL 1R24B 2RFXA 1CTNA 1G9NH 3RVXD 2G9HB 1BIIA 5BCAA 4DUXA 1S8DA 1UC6A 3O45B 4LKXB 3N1MC 4Z7OF 3D2UD 3F12B 4QEGA 5F7DA 1EJOH 3KWWB 4Y16A 1KJVB 2D0FA 1TTGA 1ZHBB 4K7FB 1IAIM 1XH3B 3LV3A 4O02L 3MRCB 5I1JL 1H0DA 4XPAL 4MDJA 3CDCA 4QTIH 5GXBB 4PJFA 3F12A 4O2FA 5GRVK 4OGAC 4EQ3A 5JQ6H 3IXAB 1UKSA 4XVSH 3CK0H 4CL7A 2IF7A 2F74A 3EJYD 4DGIL 4PJXE 1S7UA 5IT2L 1CU4L 4ZFFB 3GKWL 5FK9A 4MQTB 5DD0H 3WFCL 2DM4A 4WI2A 1X7QB 1X5XA 3EZ8A 2AV1A 2VDQL 1KCUL 4UQ3A 3U7YH 3WHXB 1PSKL 2A73A 3GZKA 2VLJB 3HLAA 2XZQL 2F58L 3BKYL 3LVEA 4P5TD 1RIVH 5J1SC 3CVHL 4I3RL 2R0LL 1VGEH 5EBLB 3RWIB 3UBXG 1NUGA 4LNRB 3O3AB 4UNTA 3FFDB 1T66C 2MCPH 3MLSL 1PAMA 2KZWA 4M61A 2AGJH 5DUPH 4FQXA 4LLDB 1J05A 5I30H 2E7LC 2HTKD 2VLLA 5DEGB 1WC7A 5CBEA 3T4AB 2DLEA 1AKJA 3TH3T 4NUGL 3DRTB 1SMAA 4S10A 4GSDL 3O4LB 1XMWA 3GMMB 3FT4A 3GBMH 3BGFC 3H9ZA 4PJGA 1V3JA 2W65B 4XBEL 2GJZB 3GI9H 2VZOA 5D7KE 2PYEE 4NCC1 3ROLB 2VR9A 5T1LD 1N4XH 1J0IA 1H3GA 5JNYA 1X4ZA 3TA3C 1JPFB 1CFSA 2PYED 3DYMA 5ACZA 1G7MB 5E00A 3FT4B 4P9HC 4AEHL 4BZ1L 2NY4C 4QXTA 5E2VH 2MHAA 3VMPA 3QWRA 4WFGD 4E42A 4GKZB 4U2YA 1KB5L 3BZ4A 4PJCF 3IU3B 4ZOBA 1S3KL 3NIDE 1KPRB 4HIXH 1NUNB 2VTFA 2XWBB 3G6JA 5E00B 5B38B 3D0LB 1OWWA 4R7DA 1KG0B 4CJ1A 1DQQB 3QEGL 3QHFH 4Q7DA 5JHLL 4U1GC 4HIEB 4MJ4A 4O9HL 1QBAA 1ZS8A 5C0NC 5KTEH 3BZEB 1E4WH 4NGHH 2DYPA 4YX2H 2GITA 1YMME 3G6JB 4KC3B 4UINL 4BKLA 5IVOA 2DQEL 1MAJA 5IK3A 2QTEA 4DW2H 1VGEL 2EYSA 3GSQA 5ESQB 4O5LL 1HEZA 1B90A 4OCWL 4ZAKA 1LEKB 4L1DA 4Y16D 4YIQA 4HT1H 5E5UB 4HDIA 3P4NB 2UY7A 3OZ9L 1TQBC 2GITB 3ALXA 1UEMA 2R0WL 2FJGB 2ZOKA 3FQTA 1FBIL 2AJVL 3WFEL 4KK5C 3IDMA 4WFHE 1YPZA 5HHPA 3N9GL 3CFCL 2OJZH 2OMNA 2EDNA 2XA8H 1GYAA 2B0SH 1CU4H 4HIXL 4M6OH 1WWWX 1PG7W 1FFNB 4MJIB 1ZE3C 2IH3A 4LCUB 4FQJH 2VDRH 3MV7D 2A77H 4HAGA 4DKEH 1E4XI 4E0RA 5E9DA 1KIUA 3UTTE 3STLB 3STZB 5FA3A 1PX3A 5D5MB 1BZ9B 2QADD 1BD2D 5EBMA 1GOHA 1IEBA 5I19L 3WEXA 1OD9A 1ZT4B 1RJYA 2YPLE 3S3JA 1FPTH 1BOGA 3MLZH 4CDHA 4PUBL 4GAYA 4X4MA 3IDNB 4PJ7A 1IKNA 3STLA 3STZA 2VDLL 1MCJA 1MI5E 1LDSA 3S98A 1PFCA 2YRZA 3WEXB 15C8H 1CWVA 4KJWC 5HYJB 3BN3B 2NY3B 3PWPD 1HHGB 2WBKA 4JDVB 2LU7A 3O3BA 1CCZA 2DAVA 2F54B 5SWQA 1HKLH 4YEFA 4UDTB 3T0VA 5I18H 1RJCA 4LCWD 4AK1A 4ZFZB 3JV0A 1D5XB 2DJUA 4LARH 4MAYD 3ZDZF 1FL5A 5ENWB 3HE7D 4XCCL 5D2NC 1EHLL 4NQCB 2FBJH 3PNWB 4IDLA 2FH8A 1XF3A 2WBJD 5CGMA 1A47A 4YUEH 1NBVH 5D7IB 4KROD 2J8UB 2R4SL 4CGTA 4C56E 3HI1A 3C2AL 1A7BA 3C5JB 4NBXB 4PGBB 1HZHH 3LQZB 3VGEA 5AUMB 3V5DB 3WS3B 4FQLH 4HK0B 5I8KL 5KSAD 1MREH 1NCBH 1Q9OB 1KCLA 3RA7H 2VDLH 3S4SA 1Z0MA 2DL2A 4QRQA 4AMKL 1FZJA 5IVXE 1A4KA 1OOAA 3ULUF 5EN2B 1R5WB 4FQ2H 1ZGLA 3BRGC 4H5SB 4JRYA 5HYEA 5FKPA 5KBNC 3P30L 2DQUL 5DWUL 2HVJB 3S96A 2HJKB 3PP3H 4OD2A 5J12B 2ZNWA 3QUZD 3MLVL 3TVMD 5IW6A 3D3VE 2BNRA 2ZSWA 3D48R 5F9OL 3VW3H 4DFHA 1LP9E 1BZQK 3NFPA 3QDMA 1DQTA 4JO3L 5A2FA 4P59L 5M95B 3SDCB 4M61B 5BQ7B 3V79C 2SEBA 3QDGB 4NP4L 3ARFA 3BN9D 4CVZB 1YEEH 3PL6D 3UBXI 1VACB 5ETUB 4PLOB 4BELD 3H6JA 5TH2B 4J3UA 1LE5B 1S5IL 3FQXA 2E7HA 1MJ8L 4OAWB 4KV5F 5INCB 2DTML 2ZP0T 2IGFH 4D0BB 4E41B 4XI5D 1CFVL 3BW9A 3I02A 3L7EB 5C8JB 1K8IB 1U3HD 2PW1B 1BQLL 2PW2B 1T2XA 5FK9B 1KB9J 3E6FB 3WYRA 1HHIA 1UB5B 4MYWB 1NCCH 4HKXB 3OKMB 1C8PA 4YC2B 1T89C 4ZUTA 2VSCA 1LEIA 5AG9A 3MV8B 1WICA 1U3HC 2FLBT 3IFOA 3O3EA 5HHXH 5C07E 1KBGL 4WHYH 1GOGA 4HZLB 1HXYB 4JN1L 2H32B 3FONB 4UTAL 5D7LE 1I1YB 2PXYD 5MI0B 2FEEI 4H0IA 1RU9H 4XNXH 1TZIB 3HG1B 3HNVH 1KJVA 3SE4C 1IC1A 1U8QA 4TTDC 5GSRA 2A83B 2XFXB 4G80A 1Q72L 1UACL 2OSLB 1S7SB 3ECBA 4MNGA 5DJAB 2ITDB 1ZT1B 1JGDA 3D18B 5KSBF 3VDCA 5HDBF 5DXWA 3T0XA 1TCMA 3S5LG 3JWNC 4X6FB 4OLYH 2NX5A 4FFZL 2BDNL 1G1CA 2ATKA 4GW1B 1N0LA 1DUZA 4XCNB 4MS8C 3GDBA 3LS4L 1F58L 4DFIA 5I1IH 3QXDB 3MLPA 5CBAA 1U8MB 1RZGB 3ARBC 2BX5A 1VESA 4Z76A 3QULB 2JE8A 3L5XL 2Q87A 2CR3A 4DZ8A 5B39G 1WV7T 3LPWA 4K94L 1MAMH 4P2QE 3WIIH 2VLKD 3QNZB 4NN5C 4LSSH 2Q8AH 2AQ1A 1PSKH 3FN0H 1KPRA 5I18L 1KB9K 2VLRA 1MOEA 1NCDL 4D9LL 3LMJL 4M7KL 2VERN 4ELMB 3HE7C 3NABL 2FATH 5K33A 5A16A 3IVKA 5A43C 1RZJH 2MFNA 4Y88A 5DA4A 4NQDE 2VITA 5KVEL 3IJHA 4Z78A 3QNZA 3MUY1 1MFDL 1AY1H 5F7KC 3SGKA 2UYLA 1TQCB 2A6DA 2WINB 1BIHA 3DI2B 3K4AA 3MLZL 1IC5L 5F9WC 5EA0H 3U83A 1R3IH 3QXVA 3ZYIA 4PJDB 1KOAA 1SBBA 3Q6FA 1E28B 1B2WL 3WIHH 3AS1A 2Y7QB 5CJBA 5LQBL 2BNUA 1ULVA 4OKVB 5HHME 3DVNB 2ADGA 1MLCA 1F13A 2XWTA 4XP4H 3QFDA 3W0WE 4U6VL 5C0FA 2PTVA 2H2SD 3HR6A 3DXAE 4C56B 1I3RA 2AABL 2FECI 2C1OA 1SHMA 3IFNH 4EOWL 2NY6D 3VFOB 5GIRB 2DD8H 2JJWA 4I0PC 3BUYA 1N0XL 3BP7A 4LHJB 1QR1B 3GIVB 1I8MA 4GXUN 3LS5L 4FS0A 5CP7B 5FO9B 2Y6SD 3LOWA 2GJJA 4LCCC 1XGPB 1YNKH 5E4EC 3BE1L 1HSBA 5GIRA 3CMOL 4FMFA 4YO0A 1Z9SA 2WK2A 4ODVH 1C12B 4O2EB 3S5LB 3SKOB 3MOAH 2FZ3A 2YUVA 5HI3C 4NFBA 1U8NB 2NY1D 4LKCB 1HNFA 1H3XA 1UZ8B 2VDKL 5C1MB 4JN1H 3QDJB 1IAIL 2V2WB 3QUYA 2VMFA 4K3HA 4A6YH 1QACA 3PUCA 5SWSE 3OKDA 4L8SB 4JFFE 4NRZB 2Z8VC 4PJ8A 1JE6A 5C09D 1DQJA 5DD1L 4XNXL 3NABH 4XWGH 2XQBL 1J10A 2PCPA 3MRNB 2R29L 1XGTB 3EOAA 3BZFA 5GRJL 1UZ8A 4Y1AD 2YC1B 4HPYL 1EGJL 4FQPA 1FL5B 5ENWA 2A6KA 5LXGH 5KS9B 1MCBA 3GSWB 1GHFL 4BFBD 2I9TB 4NN7B 3GI8H 5GGQL 1X9QA 1G6RL 3T0EB 4K94H 5DVLA 4JKPL 4JPVL 1I8LA 2APBA 1OGAE 4DOHE 1KJ3H 3EO9L 2EH8L 4U1IB 3HNSL 1SEQL 3G6AA 2HT3C 3BP6A 3STBA 3KPTA 4Y2DA 4GRWH 4ZS7H 5D8JL 3LQMA 4F7CA 4U2ZA 4FZEH 5L7XL 3K4ZA 3X11B 3IFLH 5ESVA 3N85L 4YXHL 2F54D 2BVUA 1RZGA 3ULUC 1UACH 1U6AL 4JFPA 3D87B 2FGWH 2N7AA 1A1MB 1RUAL 4WDIA 1NSNH 3KDMA 3G5XB 3KYKL 4J6RL 4WWID 5FEBA 4NQXB 4JE4B 4PRIE 1KTKE 2HP4A 4KUZH 1EEQA 3BIBX 3TP4A 3OJDA 4NNPL 1WFOA 1HOCB 1DLFL 2R9HD 3KJ6L 3ZLQC 2OJEA 3BPCB 2BRRL 1JMXA 1ZHNB 1A2YA 1J8HB 4GKSB 5J89A 5J9PB 1MIEH 2IQ9L 3OAZH 3MC0A 3AS3A 4FFWC 5DT1H 5ANMA 2ATPA 3L6FA 1HE7A 1FNGA 3K8LA 1QYGH 1HOCA 3IJHB 4PJ9C 5C0AD 5JUEL 1UQSA 2BC4B 1HK6A 4NSKA 2FSEB 1TNMA 3FQWB 5C0CA 4NZTL 3GSRA 1UJ3C 3IKKA 5DVMA 2EE6A 1A0QH 5D1QA 4ENED 2BMKA 1M05A 3OB0K 4LAQH 1E27A 2VABA 3SGJA 4AENB 4QWWD 2W91A 3CFKA 2APWA 1RZFL 1RUPH 2FYYB 5GISL 4DZ8B 3OJVC 4OV5B 5A2JH 5C0FB 4M7JL 3SKUD 1OAKH 3K2MC 5C0GB 5J56B 4C83B 5C0DA 4OI8A 1LO0L 3ARBA 3RNKA 3VFPB 2RIKA 1IC7L 2IANA 1A7NL 3QXAB 5F9AC 5HTSA 1I9RH 5BO1L 1I1AC 5ISZE 3BO8A 3FKUS 4YR6A 4NJAL 3ZYJA 4E5XB 5BQ7A 3KR3H 2ZZUT 5F1NA 1G0DA