1XFQA

Structure of the blue shifted intermediate state of the photoactive yellow protein lacking the n-terminal part
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title The solution structure of a transient photoreceptor intermediate: delta25 photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2004-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xfqA00
2JN7A 2QKPA 3IBRA 4LRYC 4HNBA 4BBTA 3PYPA 2L0WA 3T50A 2J80A 4H6JA 1WA9A 5DKLA 5HDDA 5G4ZA 2V1BA 1T19A 1P97A 2ZBBA 1S4SA 5HD3A 4HHDA 4EXOA 4MN5A 1V9ZA 3BY9A 3MXQA 1UGUA 3IS2A 4GHIB 2OWHA 2ZOIA 2BASA 2K7SA 3SW1A 3E4PA 3E4QA 4WN5A 3P7NA 1LSVA 1GSVA 3K3DA 3MFXA 3NHQA 1JNUA 4R3AA 1V9YA 3ULFA 3C2WA 1T1CA 3LIFA 4NXFA 1P0ZA 3UB9A 4HQAA 1S66L 4HY8A 4WLAA 1D7EA 2QHKA 1OTAA 1OJ5A 3H82B 3C8CA 1DP6A 4KUKA 5HSQA 4BBUA 4DJ3A 3LYXA 3LIEA 2W0NA 1LT0A 2Z6DA 4HJ3A 2ZOHA 3LICA 1F98A 1UWNX 3NOTC 3VE4A 3PHYA 4I38A 3BWLA 2EA9A 5J7EA 2KDKA 1OTIA 3F1OB 3UB6A 5F5YA 4WF0A 1GSXA 1OT6A 4JGQA 4HH2A 5KIZA 2PR6A 4F3LB 4I3IA 3HJKA 2PR5A 4HI4A 5HWVA 2P7JA 4R70A 4L9EA 2L1MA 4LLOB 4JGPA 5TBMB 4WUJA 1OTDA 5J4EA 5EFWA 2A24A 1NWZA 4E04A 2INWA 1VB6A 4R6LA 5DJUA 1S67L 5IS1A 2VEAA 3K3CA 3LUQA 3G6OA 1GSWA 3BY8A 3H7WA 4PKYA 2OOLA 4NXBA 4HJ4A 3ICYA 3D72A 1G28A 3E4OA 4HOIA 5HD5A 3MQOA 4H6JB 1DP9A 5IU1A 2M1CA 2YKFA 3A0SA 3MJQA 4HJ6A 1MZUA 1F9IA 5A8BA 4BBVA 3UMEA 3IS2B 2B02A 5F69A 3EEHA 2WKRA 2VV7A 4EEUA 4I3JA 2Z6CA 5J3WA 1KOUA 4LPZA 5DJTA 3F1PA 4K08A 1S4RA 3F1NA 3KX0X 2PD8A 1N9NA 5DKKA 4L9GA 3MR0A 4HIAA 5HZHA 2R78A 4GS9A 2WKQA 4L9FA 3NOPC 1Y28A 4M4XA 1OTBA 3VE3A 4EESA 3B33A 3FG8A 4JGRA 4LRZE 1T1AA 1LSWA 2KX6A 4JGOA 3UB8A 2QJ5A 3UMDA 4DJ2A 4KUOA 3GECA 1LSXA 4HP9A 3NOUC 1T1BA 2V9AA 1XFQA 1XJ3A 3UB7A 5F68A 4I3AA 2QWSA 2HV1A 4LRXC 3LI8A 4EW7A 4GHIA 4EQ1A 1X0OA 3RH8B 1N9OA 2PD7A 4KQDA 2WKPA 3OLOA 4GCZA 1TS0A 2CMNA 3LIBA 4EEPA 5HDSA 5AVFA 1TS7A 4EETB 3A0VA 1XJ4A 1OTEA 2VV8A 5G4YA 2VLGA 3NJAA 1TS8A 5F6AA 2PYPA 2L4RA 3H82A 4WL9A 3HJIA 1DRMA 3CLOA 1OT9A 2JHEA 3CAXA 4NXEA 1XFNA 2A24B 3LI9A 4XT2A 2H28A 5HWWA 1XJ6A 2YKHA 3GDIA 2W27A 3MQQA 3H7WB 1ODVA 3LIAA 2OWJA 3FC7A 2VV6A 3H9WA 3LIDA 1D06A 3A0RA 2V0WA 3F1OA 1BYWA 5I5LA 4R38A 2V1AA 4MN6A 2D02A 4F3LA 4HP4A 4YWZA 1N9LA 2PDRA 3VOLA 5HWTA 3RTYA 4GW9A 4XT2B 2PYRA 2I9VA 5HDCA 2QJ7A 4RQ9A 1EW0A 4NXGA 1S1ZA 4I39A 2GJ3A 3CWFA 1OJGA 2PHYA 1LL8A 3UE6A 3F1PB 1T18A 4I5SA 1TS6A 3F1NB 1S1YA 5TBMA 4HH3A 5AVEA 4B9OA 2D01A 4GS9B 4EERA 3ZQ5A 2V0UA 1XJ2A 1DP8A 1UWPX 4PKYG 3EWKA
chains in the Genus database with same CATH superfamily
4PHTA 3IBRA 5CXWA 2WGWA 4BBTA 1NRJA 2HJ9C 3BLMA 5CHJA 2V1BA 4P85A 1SDNA 2ZBBA 3BM6A 3HREA 3CPTA 3NC8A 3PBQA 3TE8A 4MN5A 3PBTA 1KE4A 3MXQA 4LCLA 4ZDXA 4CLCA 3VP1A 3DW0A 3Q7VA 2ZOIA 3HLGA 4JXGA 3WS1A 4WN5A 1YPRA 1PYYA 1LSVA 3O88A 1ERQA 1M6KA 3S7OA 2RL3A 1TDGA 3QP2A 1T1CA 2Y2QA 1YMSA 1K0KA 2C6WB 4JF4A 1S66L 4HY8A 4P6BA 3LO7A 1ES2A 1OTAA 1PFLA 3H82B 2M7UA 4YOFA 3OCLA 4DXBA 1K57A 3CZDA 5TR7A 4FH4A 3LYXA 5E2GA 4ZRRA 3LIEA 1SDEA 1ALQA 1LT0A 1WYCA 2ZOHA 1KGEA 5FL3A 2ZQ8A 3LY4A 1I2SA 5E2HA 3QHYA 3ZVWA 3NOTC 4KZBA 1IYSA 5FQIA 4OPYA 3IXHA 4Y0OA 2XLNA 4DE1A 5FQ9A 1PZOA 2WZXA 3BFGA 3SS3A 4P6ZM 3F1OB 1BT5A 5FATA 2NUTC 4CLCE 4UA7A 3EGDC 1DY6A 3DTMA 4Q0IA 1CJFA 4DE0A 5K5BA 1K4FA 1K54A 1NJ4A 1CEGA 1NRFA 2WKHA 5KSCA 4HESA 3IBJA 3KSFA 4Q8IA 3UPPA 5FAQA 3AGFA 3FKWA 2P7JA 4R70A 4L9EA 3LR5A 5F1FA 1O7EA 3UPOA 3LCEA 1VETB 1YAXA 4LLOB 3R7WB 5DTTA 2ZC7A 5TBMB 4DXCA 4WUJA 5J4EA 4BLMA 3BW6A 4XUZA 3BQAA 2B18A 4QHCA 5EVIA 4Q0HA 5DJUA 4PMAA 1ZC2A 1YQSA 2FH5A 5DFXA 4KZ8A 4EU0A 2HP6A 2HJEA 1G28A 3N8RA 3S7QA 3VP3A 2VGLM 4H6JB 1DP9A 2Z2LB 5CGSA 1NXYA 2M1CA 2H5SA 4RYEA 4N1HA 3C7UA 3G2ZA 4ETZA 4YINA 4OVDA 3EQUA 3HUNA 3VP4A 1F9IA 3UMEA 3ZG8B 5CTMA 2B02A 5F69A 4WEKA 5EPHA 1PRQA 4Y2FA 3W4PA 2W3HA 1KOUA 1L0DA 1C3BA 2OLVA 1GHMA 4QB8A 4YFMA 4LGWA 4HEFA 3F1PA 4GD6A 3C30A 3UNWA 3F1NA 4GLQA 1KDSA 4OKPA 2WGVA 1IKGA 5LBRA 4L9GA 1VM1A 4JBFA 1F5MA 2WKQA 1OTBA 2VZWA 4EESA 3FG8A 5CERA 2Y2PA 4FOFA 4X68A 3LEQA 4UQIM 4KZ7A 1LSWA 1JTGA 3V39A 3IXDA 2Y2NA 4K0XA 2KX6A 2Y2HA 3Q82A 3HVFA 3CUEC 3LR4A 4G3WA 3RFBA 1TF1A 3G30A 3UMDA 4NKPA 4DJ2A 1H3QA 2R9XA 2J7VA 1VEUA 1Q2PA 5FQJA 4EUVA 4WBGA 1XA1A 2EX6A 2HV1A 3LI8A 4LRXC 5EOOA 1PI5A 3V5MA 2XD5A 2DRWA 3OPHA 3DTEA 3FYZA 3RH8B 4LV1A 2P04A 2PD7A 5GLAA 4B93A 3UN7A 2O9AA 2IA2A 1SKOB 2WKPA 4GCZA 2WKEA 2Y2OA 2CMNA 4IBRA 3NULA 3KSGA 4BENA 2EWVA 2Y2MA 1H5XA 5HPIA 1XJ4A 3Q1FA 1BLPA 5G4YA 3PBNA 3NJAA 3Q81A 2ZM2A 2PAVP 3CITA 2PYPA 2J9PA 2EFXA 5DF8A 1BTLA 1L0GA 3CLOA 2O99A 3LEZA 1YKDA 1XFNA 3UDXA 3SS5A 4QPRA 2ZMFA 1BULA 1STZA 1E25A 2KLIA 3WWXA 4CLCC 3GDIA 2W27A 1ODVA 4BL2A 1VQQA 4Y0UA 1IEMA 3FC7A 4X69A 1FSYA 4PAUA 1O07A 5FI2A 2XFTA 3AGDA 2WADA 2D02A 4Z9QA 4MBHA 3S4XA 4F3LA 4HP4A 1MBLA 5FDSA 1N9LA 5L09A 3ZYTA 2I9VA 1K25A 5HDCA 2QJ7A 1LL5A 4G3KA 4RQ9A 2J3TD 2DCFA 1ESIA 5DVAA 2G7UA 2GJ3A 3CWFA 4M3KA 3KSIA 3CHWP 1K57C 4GDNA 3GR2A 1TS6A 5DF9A 3V50A 4MLLA 2BLSA 5AVEA 3C4PA 4ZBEA 4WZ5C 1MKIA 3M2KA 2FFFB 3I7JA 1XJ2A 1DP8A 3EWKA 3G4PA 4LRYC 1OPXA 2IWCA 2L0WA 2EWWA 5G4ZA 4X56A 2DMWA 1P97A 3ZG0A 3RJUA 4OLDA 1TD5A 1IYQA 3CMZA 5HD3A 4EV4A 2OSUA 5KMWA 4ARZB 5TGFA 3HLFA 2Y91A 4E3MA 2K31A 3EQVA 1UGUA 3IS2A 5CGXA 2QYBA 5FAOA 1K54C 3IWIA 4OQIA 2HP9A 3IWQA 5FQQA 2BASA 4Y5FA 5FQKA 4EBNA 4GN2A 2HF6A 1H8ZA 3E4PA 3GTCA 2ZC4B 1GSVA 2Y79A 2JBFA 3K3DA 3NHQA 2JKRI 1V9YA 3O3VA 1SHVA 3UE1A 5EVIC 3IX4A 4DDSA 4NXFA 4WLAA 1D1JA 5D3OA 1YLPA 1ONGA 5JYPA 3A3IA 3HUOA 3C8CA 3B3XA 4N92A 2XSSA 3TW8A 3T12B 2HDSA 3KSHA 4KUKA 5HSQA 4JF6A 1LLBA 3O87A 1QMEA 4FH2A 4NK3A 1KE0A 2Z6DA 4HJ3A 3IF6B 4IEDA 1YLJA 2ZL1A 1ERMA 4GKUA 3T1RA 4YNRA 3W4OA 5EOEA 2XA7S 3N4IA 4G3VA 4GJ4A 1P9RA 5F1GA 1PW1A 1FCOA 4X25A 5J7EA 4Y15A 2KDKA 3VOYA 1RGYA 1BLCA 2PRFA 4WF0A 1YMXA 1GSXA 1OT6A 4JGQA 2XQZA 1SZVA 3EGXC 1FR1A 3W4QA 3KYZA 3CI6A 4GB7A 2QPNA 4OOMA 4H8RA 4FUWA 3QNBA 2Y2JA 2Y2KA 5HARA 3VSLA 5CEDA 3G34A 5AQ7A 1W63Q 3RXWA 3ZDJA 2Y2LA 4B4ZA 1NYYA 1K55A 3IQAA 4JGPA 3T4LA 5EFWA 2HDUA 2A24A 4E04A 4R6LA 5IS1A 3NCKA 3G6OA 1KDWA 5HAIA 1GSWA 4DDYA 1BUEA 4FSFA 3BY8A 1I5QA 4UA6A 1WE4A 4NXBA 3ICYA 3D72A 4S2JA 3E4OA 1HD8A 1ES5A 3MQOA 5FDHA 3MXRA 4OOYA 4Y7PA 1ES3A 5IU1A 3BEBA 4B88A 2YKFA 4D60A 3A0SA 3MJQA 5E2FA 5CECA 5A8BA 4BBVA 5EM0A 5KSHA 3ZNTA 3E2LA 4OPZA 5HFOA 3K2NA 5EVIB 5HW3A 1RCJA 5GHZA 4EEUA 4I3JA 1SKFA 3UE0A 2M7VA 2VGJA 4ZJ1A 2VJWA 5DJTA 2Y8HA 1JWZA 3GSGA 3BLSA 1XXMA 2PD8A 5E2EA 3M6BA 3VFFA 3SS4A 5DKKA 4OP5A 4XUXA 5FASA 5EM1A 4GS9A 4L9FA 3NOPC 4M4XA 4WYYA 3C38A 3B33A 3IWOA 2QMIA 2ZC3B 4MNRA 4JGOA 4K91A 4PM5A 1XA7A 2Y2IA 4S2PA 2V8FA 3PTEA 4S2MA 4X55A 2Q9NA 3GECA 3P01A 2RCXA 4HP9A 4AFIA 3LR0A 3ITBA 1T1BA 3IHAA 3IX8A 4FCFA 1XFQA 3Q7ZA 4C3QA 2ZQAA 4N9KA 2P08A 2O9BA 4BJPA 3T4SA 2WGIA 3VP2A 4E3NA 1QMFA 4MCWA 2XROA 5GHXA 1Z09A 4E3OA 3V3RA 2V2FF 2XK1A 1DJAA 2P9VA 5EECA 4KQDA 3IXBA 4O01A 1TS0A 3LIBA 3NBLA 4FTXA 5A92A 2A49A 3A3JA 3FKVA 3N8SA 1YLTA 2VV8A 2O0YA 5EE8A 4ZJ3A 5HL1A 4E6XA 3C7VA 1TVFA 2L4RA 3H82A 2JKFA 4KZ9A 2FZ0A 1YLZA 5FI6A 3HJIA 3JVVA 1OT9A 4E3KA 4N9LA 4NXEA 4R0QA 2W3DA 5FAPA 5C5KA 4ME4A 3QP5A 1XJ6A 4E3LA 3H7WB 2OWJA 5FI7A 2ZMVA 1BZAA 3OBFA 1YLYA 4ID4A 4ETXA 3S7NA 3G35A 3KO6A 3WS2A 3MZDA 3IH8A 1LL9A 2V0WA 3F1OA 1BYWA 2W1RA 2WAEA 3QP1A 1BSGA 4R38A 5E43A 4GD8A 4MN6A 3T4QA 1A0KA 4P87A 3HL9A 5DFYA 2PDRA 1K6RA 3G2YA 2PBYA 3RTYA 2PYRA 2W3FA 4F94A 1LI9A 2XFSA 3MZFA 2H10A 4HBUA 5GL9A 4LV2A 2J3WA 1S1ZA 4I39A 3HLEA 4KZ4A 2W1TB 3JPUA 2PHYA 1LL8A 3VV4A 4PM7A 3GV9A 1Z6FA 1VETA 4S2OA 4KZAA 3R7WA 1CI8A 5TBMA 4LV0A 2HDRA 4QY5A 3ISGA 2EX9A 1L0FA 3ZQ5A 3OCNA 2XEPA 4PKYG 2R9WA 2JN7A 1KGFA 2UV0E 1NYMA 3T50A 2J80A 4H6JA 1WA9A 2XGNA 5DKLA 5HDDA 5A91A 4PPRA 2OV5A 4WMCA 1T19A 5CHUA 4K0WA 3VFHA 4WEJA 1S4SA 2DNSA 1NY0A 1LHYA 4QU3A 3IXGA 4EXOA 2OAP1 1CEFA 1IYPA 1GCEA 3HLDA 4GHIB 1EWZA 1JWPA 4DF6A 2ACGA 4S2NA 1TEMA 4OONA 5M19A 4S2LA 1HZOA 3D4FA 4U0XA 3BFFA 3T4JA 3E4QA 4ZTKA 1KVLA 3UDIA 2Y55A 1KE3A 1K55C 4BD1A 3MBZA 2ZQ9A 4NG2A 4IBXA 3MFXA 3OPRA 4CPKA 3N6IA 5IT5A 1BLSA 3C2WA 3PBSA 1K6SA 3KYEA 3NIAA 4JXWA 4UEYA 5J8XA 3EEAA 1P0ZA 3G32A 3UB9A 1L0EA 3LR3A 1D7EA 3ZGAB 3U4LP 3D9YA 3MZEA 4LENA 2QHKA 1IOUA 1OJ5A 1DP6A 2HDQA 2GDNA 3BRMA 3ZG7B 3ZG9B 2ZD8A 3BFCA 5FEFA 2BTFP 3CJMA 1W79A 2JC7A 1JTDA 4R1GA 1YT4A 2QZ6A 1HLUP 3LICA 1F98A 4RX3A 5L10A 4OPQA 4MBKA 1EROA 1UWNX 1Y4OA 5TJJA 3NDGA 1KGGA 4I38A 3BWLA 2JE5A 1E3UA 3FPWA 3T1SA 4A5RA 3MQ0A 1DJBA 5U47A 3A3DA 1SKOA 3TRCA 3T1XA 3NY4A 2V1ZA 5FA7A 4I3IA 4JPMA 4EBPA 3HJKA 1ZKJA 1L2SA 2E8JA 4R4RA 4C75A 2PR5A 3IH9A 4II7A 3RXXA 3M2JA 3WRZA 3N8LA 5CX7A 3LFVA 2LB9A 5M1AA 4CQHA 2H0YA 4PM6A 4KQRA 1FSWA 5EUAA 2L1MA 1FIKA 3DWKA 3P98A 3ZFZA 1OTDA 3VSKA 4HBTA 1FOFA 1W8YA 1NWZA 2INWA 3W8KA 3B47A 2X71A 2VEAA 3LUQA 3FV7A 1PNEA 5HPFA 2OOLA 1IELA 2WGWB 2WUQA 1SCWA 1PI4A 4HOIA 5HD5A 4QJGA 2OLUA 4Y13A 1H0MA 3NECA 3MFDA 4HJ6A 3WS5A 5BOHA 1MZUA 3CPTB 4PM8A 2ZQCA 4OQGA 2J3TC 3PAGA 3U2AA 2AVXA 4CLCB 4BQMA 3SOIA 3NI9A 3Q7VB 4KQOA 2WKRA 2PU4A 5G18A 1AWIA 1ESUA 5J3WA 2O9CA 2PT7A 4LPZA 4KZ6A 3PBOA 2ZJ9A 4UAAA 4WMCD 1FQGA 3JVUA 4K08A 1S4RA 2ZC5B 3EOIA 4LCMA 2XA7M 1N9NA 1XPBA 5GLCA 2C5WB 3MR0A 1CK3A 1H8MA 3CG5A 1JWVA 2I72A 1Y28A 5HAQA 4JGRA 2WKIA 1NLYA 3VMAA 5CHMA 3MS6A 4LRZE 4DN0A 2VGKA 3S22A 3UB8A 3M6HA 5L8MA 2H0TA 1K56A 1AXBA 4IVKA 1MC0A 4UA9A 1S6RA 4KUOA 1LSXA 5HL6A 2IWDA 1G6OA 4WELA 1Q2QA 2V9AA 3A3FA 3BQ8A 3BFEA 1XJ3A 4JLFA 5AQBA 1HVBA 5F68A 4OH0A 5GLDA 4ARZA 1GA9A 5HAPA 4EW7A 3UO9A 3VP0A 1VHMA 4EQ1A 3HLBA 5CRFA 3ZVTA 3W2ZA 5HX9A 2EX8A 2NUPC 4GNUA 2XRNA 1XGIA 4JF5A 2XD1A 2GX5A 2J9OA 1W8QA 4KZ5A 5HDSA 5AVFA 5DF7A 3OC2A 1TS7A 4KQQA 1K4EA 3A0VA 3UPNA 1OTEA 3GMWA 1TS8A 3V67A 2ZM8A 3T4OA 2HP5A 3OZHA 3BYDA 1E4DA 1DJCA 1E3UD 3T4KA 2ZLYA 1MY8A 2J8YA 2JKGA 2LB5A 1G6AA 4FD8A 1GHIA 3DWZA 2JHEA 2P9VB 4Q0JA 4BMWA 2ZM0A 5FQMA 4KG2A 1BLHA 2JCHA 3LI9A 3IF6A 4XT2A 4BWIA 2H28A 2CC1A 3LGOA 2WAFA 5FEGA 2EXAA 3HBRA 1TDLA 5EVLA 4S2NC 2ZMAA 1IYOA 2EXBA 4LV3A 3UE3A 3H9WA 3HUMA 4X53A 1N9BA 1D06A 3A0RA 4EBLA 2A3UA 3E98A 3MKFA 5KZHA 3PBRA 4R3JA 2JKTI 5HWTA 3DAVA 4GW9A 4RA7A 2HZ5A 4WZ5A 4OQHA 1H8YA 1MKMA 5CTNA 2G2WA 2B5RA 4NXGA 3T4TA 4RVAA 2OAQ1 3FPVA 1OJGA 5F82A 3UE6A 3F1PB 1T18A 1L3LA 4I5SA 1MPLA 2BG1A 3F1NB 1S1YA 4BD0A 4HH3A 3FZCA 2ZQ7A 1U60A 4E6WA 2D01A 4EERA 4IVIA 4P6ZS 4EQIA 4DE3A 2QKPA 3WS0A 4U3TA 1IKIA 2XF3A 4O7DA 4HNBA 1RGZA 3PYPA 3HLWA 5AQAA 3KYQA 3IT9A 5JYOA 3BECA 3GRJA 1VEUB 4KZ3A 3PR6A 3QP4A 2G2UA 4HHDA 1V9ZA 3BY9A 2PBDP 1G5UA 3LY3A 2ZQDA 3PXPA 3C5AA 2OWHA 2VA0A 2PU2A 4QY6A 2IWBA 1MWRA 3MMHA 4MMNA 2K7SA 5L2FA 1YSPA 3SW1A 1K56D 3P7NA 1F2KA 5MC7A 4IUHA 3S7PA 1JNUA 4R3AA 4JXVA 1S0WA 2VGLS 3ULFA 3GQZA 2Z2MB 5A93A 2WYXA 3E2KA 1NZOA 5IHVA 1K38A 1ACFA 3LIFA 5AQ9A 4HQAA 3UDFA 5CEBA 4GDBA 2VX8A 2Q9MA 5CGWA 2A2LA 1XGJA 2VKSA 4NETA 3E0YA 3TSGA 3JYIA 4BBUA 4DJ3A 2V8CA 1JVJA 2W0NA 3OPLA 2XR0A 3WS4A 3SH9A 1PWDA 3BJNA 2X02A 4S2KA 2WZZA 3UB5P 3L7HA 4KG6A 3UY6A 1RP5A 3VE4A 2UWXA 3PHYA 4KG5A 2EA9A 4X6TA 4CLCD 2HPBA 3FWLA 4OP8A 3GVBA 1OTIA 1ES4A 3UB6A 4ZAMA 1GHPA 4UQIS 5F5YA 4HH2A 1PIOA 5EVEA 3ZNYA 5KIZA 2PR6A 4F3LB 3P09A 1PZPA 4IHQA 4EWFA 1Y54A 3D3OA 2XDMA 3ZHHA 4S2IA 3B42A 3IHBA 4LFUA 3V3SA 4HI4A 4WM9A 4R4SA 5HWVA 1XX2A 3ITAA 2KOIA 1CI9A 3C4OA 3TJZC 3R4KA 1OMEA 3L9KA 1NZUA 3QP8A 4WZ4A 2ZC6B 4DMZA 2Q0OA 2E8IA 4ZJ2A 2X01A 2V20A 1WYBA 1ONHA 4U0TA 1VB6A 5DTSA 1S67L 2Y59A 3K3CA 3MXSA 4MDZA 3SZTA 3H7WA 1IFQA 4PKYA 4UHUA 1G68A 4HJ4A 5F83A 3WRTA 1W7FA 1W5DA 3HCYA 3QP6A 1YSQA 2JKRM 1CF0A 1ZG4A 2W3EA 4MEZA 4OOLA 3IS2B 3EEHA 4GOGA 4OPRA 5AJGA 4IUKA 5EV0A 2VV7A 1XKZA 2Z6CA 2WK0A 5DTKA 2W3GA 2W1TA 4O0PA 1YM1A 3A3EA 1ZG6A 3ZCZA 1ZHHB 3KX0X 2VK3A 4HIAA 5HZHA 1M40A 3IF6C 3N7WA 3TG9A 2R78A 1XP4A 1GA0A 4Y3IA 3MSHA 3DTIA 3VE3A 1PW8A 1T1AA 3BFDA 5EVID 4NEED 4X1LA 4Z1WA 4EUZA 1J9MA 5GHYA 2HGVA 4D2OA 3OOVA 1PWGA 2QJ5A 4O8GA 1YLWA 4BL3A 3NOUC 2B95A 3O86A 2XH9A 3SH7A 2K2NA 1I2WA 5GLBA 1MWTA 1LI0A 3O5YA 3UB7A 2GZAA 4P0MA 2ZL1B 4DE2A 4C6YA 5A90A 4I3AA 3TOIA 4QD4A 2QWSA 2P74A 4QWOA 1N4OA 1KVMA 4GHIA 4JKTA 4OLGA 1X0OA 1N9OA 2GNXA 4GZBA 4E3IA 3T1QB 3OLOA 4R23A 4KENB 3DTKA 4EEPA 5TFQA 5L07A 4X1MA 1EI5A 2EFUA 4EETB 3HLCA 4E3JA 2VLGA 1MWSA 1FR6A 4L0LA 5F6AA 3S1YA 1J3WA 4WL9A 1DRMA 3IF5A 3CAXA 3DBAA 3NDEA 3ZG5A 2A24B 2Y4AA 4R3BA 3QNCA 3PAEA 1W63M 4JXSA 1PWCA 4XXRA 5HWWA 3MKEA 2YKHA 4Y17A 3MQQA 1FCMA 3LIAA 1NLZA 4Y0TA 3CUEA 4RX2A 3OPPA 2Y2GA 2VV6A 2MJ6A 1MXOA 5M18A 3LIDA 5I5LA 3IX3A 4DRTA 5FSRA 2V1AA 4DKIA 1ZTUA 4YWZA 5I94A 2JKTM 3VOLA 4N1XA 4PM9A 4XT2B 1FCNA 1HTZA 3VOZA 3Q07A 2FFYA 1EW0A 4IJGA 4MN7A 2EX2A 4OQ0A 3SH8A 3AGEA 4MBFA 4B4XA 1CQAA 3MF0A 4CJNA 4B9OA 1MWUA 4GS9B 1P9WA 1FILA 3G31A 2V0UA 4ESPA 1UWPX
chains in the Genus database with same CATH topology
2JN7A 2QKPA 4PHTA 3IBRA 4LRYC 1OPXA 4HNBA 4BBTA 3PYPA 2L0WA 3T50A 2J80A 3KYQA 4H6JA 1NRJA 1WA9A 2HJ9C 5DKLA 5HDDA 2EWWA 5G4ZA 2V1BA 1T19A 2DMWA 1P97A 2ZBBA 4WEJA 1S4SA 1TD5A 5HD3A 3PR6A 3PBQA 4ARZB 4HHDA 3TE8A 4EXOA 4MN5A 2OAP1 3PBTA 1V9ZA 3BY9A 3MXQA 2K31A 3EQVA 1UGUA 3IS2A 2QYBA 4GHIB 4CLCA 3PXPA 2OWHA 2VA0A 2ZOIA 2BASA 4Y5FA 3MMHA 4MMNA 2K7SA 3SW1A 1YSPA 2HF6A 3E4PA 3T4JA 3E4QA 4WN5A 3P7NA 1LSVA 1GSVA 2Y79A 5MC7A 4IUHA 3S7PA 3K3DA 3MFXA 3NHQA 1JNUA 2JKRI 4R3AA 1V9YA 3S7OA 5IT5A 2VGLS 3ULFA 3C2WA 3PBSA 4UEYA 1T1CA 3LIFA 4NXFA 3EEAA 1P0ZA 3UB9A 3LR3A 4HQAA 1S66L 4HY8A 4WLAA 1D7EA 2QHKA 1OTAA 2VX8A 1IOUA 3H82B 1OJ5A 2M7UA 3C8CA 1DP6A 2A2LA 4YOFA 2VKSA 2XSSA 3TW8A 3OCLA 3E0YA 3KSHA 4KUKA 5HSQA 4BBUA 4DJ3A 3LYXA 4ZRRA 3LIEA 2W0NA 1LT0A 2Z6DA 4HJ3A 2ZOHA 5FL3A 3LICA 1F98A 3BJNA 4YNRA 1UWNX 3NOTC 5TJJA 3VE4A 2XA7S 4G3VA 3PHYA 4I38A 4GJ4A 1P9RA 3BWLA 3FPWA 2EA9A 3MQ0A 4CLCD 5J7EA 2KDKA 4P6ZM 1OTIA 3F1OB 3UB6A 3TRCA 2NUTC 4UQIS 5F5YA 4WF0A 1GSXA 1OT6A 4JGQA 4HH2A 3EGXC 4CLCE 5KIZA 2PR6A 4F3LB 4I3IA 3HJKA 3KYZA 3CI6A 2PR5A 3EGDC 4IHQA 4Q0IA 3D3OA 5K5BA 4OOMA 4II7A 3B42A 3IBJA 4HI4A 3KSFA 5HWVA 2P7JA 4R70A 5CX7A 4L9EA 3LFVA 2LB9A 1W63Q 2KOIA 3LR5A 4CQHA 3TJZC 3R4KA 2L1MA 1YAXA 4LLOB 3R7WB 4JGPA 4DMZA 5TBMB 3T4LA 4WUJA 1OTDA 5J4EA 5EFWA 2A24A 3BW6A 3BQAA 1NWZA 4E04A 2B18A 2INWA 3B47A 1VB6A 4Q0HA 4R6LA 5DJUA 1S67L 5IS1A 2VEAA 3K3CA 3LUQA 3G6OA 4MDZA 1GSWA 2FH5A 4FSFA 5DFXA 3BY8A 3H7WA 4EU0A 1IFQA 5HPFA 4PKYA 2OOLA 4NXBA 3ICYA 4HJ4A 2HJEA 3D72A 1G28A 3E4OA 4HOIA 5HD5A 3MQOA 2VGLM 3S7QA 4H6JB 1DP9A 5IU1A 2M1CA 2YKFA 3HCYA 1YSQA 3A0SA 3MJQA 2JKRM 4HJ6A 4ETZA 1MZUA 3EQUA 2W3EA 1F9IA 5A8BA 4BBVA 3UMEA 4OOLA 2J3TC 3U2AA 3IS2B 5KSHA 2B02A 5F69A 4CLCB 3EEHA 4WEKA 5AJGA 3K2NA 4KQOA 4IUKA 2WKRA 2VV7A 4Y2FA 4EEUA 4I3JA 2W3HA 2Z6CA 5J3WA 2O9CA 2M7VA 2PT7A 1KOUA 2VJWA 4LPZA 5DJTA 2W3GA 2Y8HA 2W1TA 4O0PA 3PBOA 3F1PA 3C30A 3JVUA 1ZHHB 1S4RA 3EOIA 3F1NA 3KX0X 4K08A 4GLQA 2PD8A 2XA7M 1N9NA 5LBRA 5DKKA 4L9GA 3MR0A 4HIAA 1H8MA 5HZHA 1F5MA 2R78A 4GS9A 2WKQA 4L9FA 3NOPC 1Y28A 4Y3IA 4M4XA 1OTBA 2VZWA 3C38A 3VE3A 4EESA 3B33A 3FG8A 4JGRA 1NLYA 4FOFA 4LRZE 4UQIM 1T1AA 1LSWA 4DN0A 4NEED 2KX6A 4Z1WA 4JGOA 3UB8A 5L8MA 3CUEC 2HGVA 3LR4A 4G3WA 3OOVA 3RFBA 2QJ5A 1MC0A 4O8GA 1TF1A 3UMDA 4NKPA 4DJ2A 1H3QA 4KUOA 3GECA 3P01A 1LSXA 5HL6A 4HP9A 4AFIA 1G6OA 3LR0A 1T1BA 3NOUC 4WELA 2K2NA 2V9AA 3BQ8A 1XFQA 1XJ3A 3O5YA 3UB7A 2GZAA 5F68A 4EUVA 4ARZA 2P08A 2O9BA 4I3AA 3T4SA 4BJPA 2QWSA 2HV1A 4LRXC 3LI8A 4MCWA 4EW7A 1VHMA 4GHIA 2XROA 4EQ1A 1X0OA 3RH8B 3W2ZA 1N9OA 2P04A 2PD7A 2NUPC 4B93A 4KQDA 2GNXA 2O9AA 2XRNA 2IA2A 4O01A 2WKPA 3OLOA 4GCZA 1TS0A 2CMNA 3LIBA 4EEPA 3KSGA 2GX5A 5HDSA 5AVFA 2EWVA 3OC2A 1TS7A 4EETB 3A0VA 1XJ4A 1OTEA 5HPIA 2VV8A 5G4YA 2O0YA 3PBNA 2VLGA 1TS8A 3NJAA 3V67A 4L0LA 5F6AA 3T4OA 3CITA 2PYPA 2L4RA 3H82A 3T4KA 4WL9A 2LB5A 2FZ0A 3HJIA 1DRMA 3JVVA 3CLOA 1OT9A 2O99A 2JHEA 4Q0JA 1YKDA 3CAXA 3DBAA 4NXEA 4BMWA 1XFNA 2W3DA 2A24B 5C5KA 4QPRA 3LI9A 4XT2A 1W63M 4BWIA 4ME4A 2ZMFA 2H28A 1STZA 5HWWA 2KLIA 4CLCC 1XJ6A 2YKHA 3GDIA 2W27A 3MQQA 3H7WB 1ODVA 3LIAA 1NLZA 2OWJA 2ZMVA 3CUEA 3FC7A 2VV6A 2MJ6A 3OBFA 3UE3A 3H9WA 4ETXA 3S7NA 3KO6A 3LIDA 1D06A 3A0RA 2V0WA 3F1OA 1BYWA 2W1RA 5I5LA 4PAUA 4R38A 2V1AA 3E98A 1ZTUA 4MN6A 3PBRA 2D02A 4F3LA 4HP4A 4YWZA 2JKTI 3T4QA 1N9LA 2JKTM 5DFYA 2PDRA 3VOLA 3ZYTA 5HWTA 3RTYA 4GW9A 4XT2B 2PYRA 2I9VA 2W3FA 5HDCA 2QJ7A 4G3KA 4RQ9A 2J3TD 1MKMA 1EW0A 4IJGA 4NXGA 2G7UA 2J3WA 1S1ZA 4I39A 2GJ3A 3CWFA 3T4TA 2OAQ1 3KSIA 2W1TB 4MN7A 3FPVA 1OJGA 2PHYA 1LL8A 3UE6A 3F1PB 1T18A 3VV4A 4I5SA 1TS6A 5DF9A 3F1NB 1S1YA 3R7WA 5TBMA 4HH3A 3MF0A 5AVEA 4B9OA 2D01A 4GS9B 1P9WA 4EERA 4P6ZS 3ZQ5A 2V0UA 3OCNA 1XJ2A 1DP8A 1UWPX 4PKYG 3EWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN7 A;  2QKP A;  3IBR A;  4LRY C;  4HNB A;  4BBT A;  3PYP A;  2L0W A;  3T50 A;  2J80 A;  4H6J A;  1WA9 A;  5DKL A;  5HDD A;  5G4Z A;  2V1B A;  1T19 A;  1P97 A;  2ZBB A;  1S4S A;  5HD3 A;  4HHD A;  4EXO A;  4MN5 A;  1V9Z A;  3BY9 A;  3MXQ A;  1UGU A;  3IS2 A;  4GHI B;  2OWH A;  2ZOI A;  2BAS A;  2K7S A;  3SW1 A;  3E4P A;  3E4Q A;  4WN5 A;  3P7N A;  1LSV A;  1GSV A;  3K3D A;  3MFX A;  3NHQ A;  1JNU A;  4R3A A;  1V9Y A;  3ULF A;  3C2W A;  1T1C A;  3LIF A;  4NXF A;  1P0Z A;  3UB9 A;  4HQA A;  1S66 L;  4HY8 A;  4WLA A;  1D7E A;  2QHK A;  1OTA A;  1OJ5 A;  3H82 B;  3C8C A;  1DP6 A;  4KUK A;  5HSQ A;  4BBU A;  4DJ3 A;  3LYX A;  3LIE A;  2W0N A;  1LT0 A;  2Z6D A;  4HJ3 A;  2ZOH A;  3LIC A;  1F98 A;  1UWN X;  3NOT C;  3VE4 A;  3PHY A;  4I38 A;  3BWL A;  2EA9 A;  5J7E A;  2KDK A;  1OTI A;  3F1O B;  3UB6 A;  5F5Y A;  4WF0 A;  1GSX A;  1OT6 A;  4JGQ A;  4HH2 A;  5KIZ A;  2PR6 A;  4F3L B;  4I3I A;  3HJK A;  2PR5 A;  4HI4 A;  5HWV A;  2P7J A;  4R70 A;  4L9E A;  2L1M A;  4LLO B;  4JGP A;  5TBM B;  4WUJ A;  1OTD A;  5J4E A;  5EFW A;  2A24 A;  1NWZ A;  4E04 A;  2INW A;  1VB6 A;  4R6L A;  5DJU A;  1S67 L;  5IS1 A;  2VEA A;  3K3C A;  3LUQ A;  3G6O A;  1GSW A;  3BY8 A;  3H7W A;  4PKY A;  2OOL A;  4NXB A;  4HJ4 A;  3ICY A;  3D72 A;  1G28 A;  3E4O A;  4HOI A;  5HD5 A;  3MQO A;  4H6J B;  1DP9 A;  5IU1 A;  2M1C A;  2YKF A;  3A0S A;  3MJQ A;  4HJ6 A;  1MZU A;  1F9I A;  5A8B A;  4BBV A;  3UME A;  3IS2 B;  2B02 A;  5F69 A;  3EEH A;  2WKR A;  2VV7 A;  4EEU A;  4I3J A;  2Z6C A;  5J3W A;  1KOU A;  4LPZ A;  5DJT A;  3F1P A;  4K08 A;  1S4R A;  3F1N A;  3KX0 X;  2PD8 A;  1N9N A;  5DKK A;  4L9G A;  3MR0 A;  4HIA A;  5HZH A;  2R78 A;  4GS9 A;  2WKQ A;  4L9F A;  3NOP C;  1Y28 A;  4M4X A;  1OTB A;  3VE3 A;  4EES A;  3B33 A;  3FG8 A;  4JGR A;  4LRZ E;  1T1A A;  1LSW A;  2KX6 A;  4JGO A;  3UB8 A;  2QJ5 A;  3UMD A;  4DJ2 A;  4KUO A;  3GEC A;  1LSX A;  4HP9 A;  3NOU C;  1T1B A;  2V9A A;  1XFQ A;  1XJ3 A;  3UB7 A;  5F68 A;  4I3A A;  2QWS A;  2HV1 A;  4LRX C;  3LI8 A;  4EW7 A;  4GHI A;  4EQ1 A;  1X0O A;  3RH8 B;  1N9O A;  2PD7 A;  4KQD A;  2WKP A;  3OLO A;  4GCZ A;  1TS0 A;  2CMN A;  3LIB A;  4EEP A;  5HDS A;  5AVF A;  1TS7 A;  4EET B;  3A0V A;  1XJ4 A;  1OTE A;  2VV8 A;  5G4Y A;  2VLG A;  3NJA A;  1TS8 A;  5F6A A;  2PYP A;  2L4R A;  3H82 A;  4WL9 A;  3HJI A;  1DRM A;  3CLO A;  1OT9 A;  2JHE A;  3CAX A;  4NXE A;  1XFN A;  2A24 B;  3LI9 A;  4XT2 A;  2H28 A;  5HWW A;  1XJ6 A;  2YKH A;  3GDI A;  2W27 A;  3MQQ A;  3H7W B;  1ODV A;  3LIA A;  2OWJ A;  3FC7 A;  2VV6 A;  3H9W A;  3LID A;  1D06 A;  3A0R A;  2V0W A;  3F1O A;  1BYW A;  5I5L A;  4R38 A;  2V1A A;  4MN6 A;  2D02 A;  4F3L A;  4HP4 A;  4YWZ A;  1N9L A;  2PDR A;  3VOL A;  5HWT A;  3RTY A;  4GW9 A;  4XT2 B;  2PYR A;  2I9V A;  5HDC A;  2QJ7 A;  4RQ9 A;  1EW0 A;  4NXG A;  1S1Z A;  4I39 A;  2GJ3 A;  3CWF A;  1OJG A;  2PHY A;  1LL8 A;  3UE6 A;  3F1P B;  1T18 A;  4I5S A;  1TS6 A;  3F1N B;  1S1Y A;  5TBM A;  4HH3 A;  5AVE A;  4B9O A;  2D01 A;  4GS9 B;  4EER A;  3ZQ5 A;  2V0U A;  1XJ2 A;  1DP8 A;  1UWP X;  4PKY G;  3EWK A; 
#chains in the Genus database with same CATH topology
 4PHT A;  3IBR A;  5CXW A;  2WGW A;  4BBT A;  1NRJ A;  2HJ9 C;  3BLM A;  5CHJ A;  2V1B A;  4P85 A;  1SDN A;  2ZBB A;  3BM6 A;  3HRE A;  3CPT A;  3NC8 A;  3PBQ A;  3TE8 A;  4MN5 A;  3PBT A;  1KE4 A;  3MXQ A;  4LCL A;  4ZDX A;  4CLC A;  3VP1 A;  3DW0 A;  3Q7V A;  2ZOI A;  3HLG A;  4JXG A;  3WS1 A;  4WN5 A;  1YPR A;  1PYY A;  1LSV A;  3O88 A;  1ERQ A;  1M6K A;  3S7O A;  2RL3 A;  1TDG A;  3QP2 A;  1T1C A;  2Y2Q A;  1YMS A;  1K0K A;  2C6W B;  4JF4 A;  1S66 L;  4HY8 A;  4P6B A;  3LO7 A;  1ES2 A;  1OTA A;  1PFL A;  3H82 B;  2M7U A;  4YOF A;  3OCL A;  4DXB A;  1K57 A;  3CZD A;  5TR7 A;  4FH4 A;  3LYX A;  5E2G A;  4ZRR A;  3LIE A;  1SDE A;  1ALQ A;  1LT0 A;  1WYC A;  2ZOH A;  1KGE A;  5FL3 A;  2ZQ8 A;  3LY4 A;  1I2S A;  5E2H A;  3QHY A;  3ZVW A;  3NOT C;  4KZB A;  1IYS A;  5FQI A;  4OPY A;  3IXH A;  4Y0O A;  2XLN A;  4DE1 A;  5FQ9 A;  1PZO A;  2WZX A;  3BFG A;  3SS3 A;  4P6Z M;  3F1O B;  1BT5 A;  5FAT A;  2NUT C;  4CLC E;  4UA7 A;  3EGD C;  1DY6 A;  3DTM A;  4Q0I A;  1CJF A;  4DE0 A;  5K5B A;  1K4F A;  1K54 A;  1NJ4 A;  1CEG A;  1NRF A;  2WKH A;  5KSC A;  4HES A;  3IBJ A;  3KSF A;  4Q8I A;  3UPP A;  5FAQ A;  3AGF A;  3FKW A;  2P7J A;  4R70 A;  4L9E A;  3LR5 A;  5F1F A;  1O7E A;  3UPO A;  3LCE A;  1VET B;  1YAX A;  4LLO B;  3R7W B;  5DTT A;  2ZC7 A;  5TBM B;  4DXC A;  4WUJ A;  5J4E A;  4BLM A;  3BW6 A;  4XUZ A;  3BQA A;  2B18 A;  4QHC A;  5EVI A;  4Q0H A;  5DJU A;  4PMA A;  1ZC2 A;  1YQS A;  2FH5 A;  5DFX A;  4KZ8 A;  4EU0 A;  2HP6 A;  2HJE A;  1G28 A;  3N8R A;  3S7Q A;  3VP3 A;  2VGL M;  4H6J B;  1DP9 A;  2Z2L B;  5CGS A;  1NXY A;  2M1C A;  2H5S A;  4RYE A;  4N1H A;  3C7U A;  3G2Z A;  4ETZ A;  4YIN A;  4OVD A;  3EQU A;  3HUN A;  3VP4 A;  1F9I A;  3UME A;  3ZG8 B;  5CTM A;  2B02 A;  5F69 A;  4WEK A;  5EPH A;  1PRQ A;  4Y2F A;  3W4P A;  2W3H A;  1KOU A;  1L0D A;  1C3B A;  2OLV A;  1GHM A;  4QB8 A;  4YFM A;  4LGW A;  4HEF A;  3F1P A;  4GD6 A;  3C30 A;  3UNW A;  3F1N A;  4GLQ A;  1KDS A;  4OKP A;  2WGV A;  1IKG A;  5LBR A;  4L9G A;  1VM1 A;  4JBF A;  1F5M A;  2WKQ A;  1OTB A;  2VZW A;  4EES A;  3FG8 A;  5CER A;  2Y2P A;  4FOF A;  4X68 A;  3LEQ A;  4UQI M;  4KZ7 A;  1LSW A;  1JTG A;  3V39 A;  3IXD A;  2Y2N A;  4K0X A;  2KX6 A;  2Y2H A;  3Q82 A;  3HVF A;  3CUE C;  3LR4 A;  4G3W A;  3RFB A;  1TF1 A;  3G30 A;  3UMD A;  4NKP A;  4DJ2 A;  1H3Q A;  2R9X A;  2J7V A;  1VEU A;  1Q2P A;  5FQJ A;  4EUV A;  4WBG A;  1XA1 A;  2EX6 A;  2HV1 A;  3LI8 A;  4LRX C;  5EOO A;  1PI5 A;  3V5M A;  2XD5 A;  2DRW A;  3OPH A;  3DTE A;  3FYZ A;  3RH8 B;  4LV1 A;  2P04 A;  2PD7 A;  5GLA A;  4B93 A;  3UN7 A;  2O9A A;  2IA2 A;  1SKO B;  2WKP A;  4GCZ A;  2WKE A;  2Y2O A;  2CMN A;  4IBR A;  3NUL A;  3KSG A;  4BEN A;  2EWV A;  2Y2M A;  1H5X A;  5HPI A;  1XJ4 A;  3Q1F A;  1BLP A;  5G4Y A;  3PBN A;  3NJA A;  3Q81 A;  2ZM2 A;  2PAV P;  3CIT A;  2PYP A;  2J9P A;  2EFX A;  5DF8 A;  1BTL A;  1L0G A;  3CLO A;  2O99 A;  3LEZ A;  1YKD A;  1XFN A;  3UDX A;  3SS5 A;  4QPR A;  2ZMF A;  1BUL A;  1STZ A;  1E25 A;  2KLI A;  3WWX A;  4CLC C;  3GDI A;  2W27 A;  1ODV A;  4BL2 A;  1VQQ A;  4Y0U A;  1IEM A;  3FC7 A;  4X69 A;  1FSY A;  4PAU A;  1O07 A;  5FI2 A;  2XFT A;  3AGD A;  2WAD A;  2D02 A;  4Z9Q A;  4MBH A;  3S4X A;  4F3L A;  4HP4 A;  1MBL A;  5FDS A;  1N9L A;  5L09 A;  3ZYT A;  2I9V A;  1K25 A;  5HDC A;  2QJ7 A;  1LL5 A;  4G3K A;  4RQ9 A;  2J3T D;  2DCF A;  1ESI A;  5DVA A;  2G7U A;  2GJ3 A;  3CWF A;  4M3K A;  3KSI A;  3CHW P;  1K57 C;  4GDN A;  3GR2 A;  1TS6 A;  5DF9 A;  3V50 A;  4MLL A;  2BLS A;  5AVE A;  3C4P A;  4ZBE A;  4WZ5 C;  1MKI A;  3M2K A;  2FFF B;  3I7J A;  1XJ2 A;  1DP8 A;  3EWK A;  3G4P A;  4LRY C;  1OPX A;  2IWC A;  2L0W A;  2EWW A;  5G4Z A;  4X56 A;  2DMW A;  1P97 A;  3ZG0 A;  3RJU A;  4OLD A;  1TD5 A;  1IYQ A;  3CMZ A;  5HD3 A;  4EV4 A;  2OSU A;  5KMW A;  4ARZ B;  5TGF A;  3HLF A;  2Y91 A;  4E3M A;  2K31 A;  3EQV A;  1UGU A;  3IS2 A;  5CGX A;  2QYB A;  5FAO A;  1K54 C;  3IWI A;  4OQI A;  2HP9 A;  3IWQ A;  5FQQ A;  2BAS A;  4Y5F A;  5FQK A;  4EBN A;  4GN2 A;  2HF6 A;  1H8Z A;  3E4P A;  3GTC A;  2ZC4 B;  1GSV A;  2Y79 A;  2JBF A;  3K3D A;  3NHQ A;  2JKR I;  1V9Y A;  3O3V A;  1SHV A;  3UE1 A;  5EVI C;  3IX4 A;  4DDS A;  4NXF A;  4WLA A;  1D1J A;  5D3O A;  1YLP A;  1ONG A;  5JYP A;  3A3I A;  3HUO A;  3C8C A;  3B3X A;  4N92 A;  2XSS A;  3TW8 A;  3T12 B;  2HDS A;  3KSH A;  4KUK A;  5HSQ A;  4JF6 A;  1LLB A;  3O87 A;  1QME A;  4FH2 A;  4NK3 A;  1KE0 A;  2Z6D A;  4HJ3 A;  3IF6 B;  4IED A;  1YLJ A;  2ZL1 A;  1ERM A;  4GKU A;  3T1R A;  4YNR A;  3W4O A;  5EOE A;  2XA7 S;  3N4I A;  4G3V A;  4GJ4 A;  1P9R A;  5F1G A;  1PW1 A;  1FCO A;  4X25 A;  5J7E A;  4Y15 A;  2KDK A;  3VOY A;  1RGY A;  1BLC A;  2PRF A;  4WF0 A;  1YMX A;  1GSX A;  1OT6 A;  4JGQ A;  2XQZ A;  1SZV A;  3EGX C;  1FR1 A;  3W4Q A;  3KYZ A;  3CI6 A;  4GB7 A;  2QPN A;  4OOM A;  4H8R A;  4FUW A;  3QNB A;  2Y2J A;  2Y2K A;  5HAR A;  3VSL A;  5CED A;  3G34 A;  5AQ7 A;  1W63 Q;  3RXW A;  3ZDJ A;  2Y2L A;  4B4Z A;  1NYY A;  1K55 A;  3IQA A;  4JGP A;  3T4L A;  5EFW A;  2HDU A;  2A24 A;  4E04 A;  4R6L A;  5IS1 A;  3NCK A;  3G6O A;  1KDW A;  5HAI A;  1GSW A;  4DDY A;  1BUE A;  4FSF A;  3BY8 A;  1I5Q A;  4UA6 A;  1WE4 A;  4NXB A;  3ICY A;  3D72 A;  4S2J A;  3E4O A;  1HD8 A;  1ES5 A;  3MQO A;  5FDH A;  3MXR A;  4OOY A;  4Y7P A;  1ES3 A;  5IU1 A;  3BEB A;  4B88 A;  2YKF A;  4D60 A;  3A0S A;  3MJQ A;  5E2F A;  5CEC A;  5A8B A;  4BBV A;  5EM0 A;  5KSH A;  3ZNT A;  3E2L A;  4OPZ A;  5HFO A;  3K2N A;  5EVI B;  5HW3 A;  1RCJ A;  5GHZ A;  4EEU A;  4I3J A;  1SKF A;  3UE0 A;  2M7V A;  2VGJ A;  4ZJ1 A;  2VJW A;  5DJT A;  2Y8H A;  1JWZ A;  3GSG A;  3BLS A;  1XXM A;  2PD8 A;  5E2E A;  3M6B A;  3VFF A;  3SS4 A;  5DKK A;  4OP5 A;  4XUX A;  5FAS A;  5EM1 A;  4GS9 A;  4L9F A;  3NOP C;  4M4X A;  4WYY A;  3C38 A;  3B33 A;  3IWO A;  2QMI A;  2ZC3 B;  4MNR A;  4JGO A;  4K91 A;  4PM5 A;  1XA7 A;  2Y2I A;  4S2P A;  2V8F A;  3PTE A;  4S2M A;  4X55 A;  2Q9N A;  3GEC A;  3P01 A;  2RCX A;  4HP9 A;  4AFI A;  3LR0 A;  3ITB A;  1T1B A;  3IHA A;  3IX8 A;  4FCF A;  1XFQ A;  3Q7Z A;  4C3Q A;  2ZQA A;  4N9K A;  2P08 A;  2O9B A;  4BJP A;  3T4S A;  2WGI A;  3VP2 A;  4E3N A;  1QMF A;  4MCW A;  2XRO A;  5GHX A;  1Z09 A;  4E3O A;  3V3R A;  2V2F F;  2XK1 A;  1DJA A;  2P9V A;  5EEC A;  4KQD A;  3IXB A;  4O01 A;  1TS0 A;  3LIB A;  3NBL A;  4FTX A;  5A92 A;  2A49 A;  3A3J A;  3FKV A;  3N8S A;  1YLT A;  2VV8 A;  2O0Y A;  5EE8 A;  4ZJ3 A;  5HL1 A;  4E6X A;  3C7V A;  1TVF A;  2L4R A;  3H82 A;  2JKF A;  4KZ9 A;  2FZ0 A;  1YLZ A;  5FI6 A;  3HJI A;  3JVV A;  1OT9 A;  4E3K A;  4N9L A;  4NXE A;  4R0Q A;  2W3D A;  5FAP A;  5C5K A;  4ME4 A;  3QP5 A;  1XJ6 A;  4E3L A;  3H7W B;  2OWJ A;  5FI7 A;  2ZMV A;  1BZA A;  3OBF A;  1YLY A;  4ID4 A;  4ETX A;  3S7N A;  3G35 A;  3KO6 A;  3WS2 A;  3MZD A;  3IH8 A;  1LL9 A;  2V0W A;  3F1O A;  1BYW A;  2W1R A;  2WAE A;  3QP1 A;  1BSG A;  4R38 A;  5E43 A;  4GD8 A;  4MN6 A;  3T4Q A;  1A0K A;  4P87 A;  3HL9 A;  5DFY A;  2PDR A;  1K6R A;  3G2Y A;  2PBY A;  3RTY A;  2PYR A;  2W3F A;  4F94 A;  1LI9 A;  2XFS A;  3MZF A;  2H10 A;  4HBU A;  5GL9 A;  4LV2 A;  2J3W A;  1S1Z A;  4I39 A;  3HLE A;  4KZ4 A;  2W1T B;  3JPU A;  2PHY A;  1LL8 A;  3VV4 A;  4PM7 A;  3GV9 A;  1Z6F A;  1VET A;  4S2O A;  4KZA A;  3R7W A;  1CI8 A;  5TBM A;  4LV0 A;  2HDR A;  4QY5 A;  3ISG A;  2EX9 A;  1L0F A;  3ZQ5 A;  3OCN A;  2XEP A;  4PKY G;  2R9W A;  2JN7 A;  1KGF A;  2UV0 E;  1NYM A;  3T50 A;  2J80 A;  4H6J A;  1WA9 A;  2XGN A;  5DKL A;  5HDD A;  5A91 A;  4PPR A;  2OV5 A;  4WMC A;  1T19 A;  5CHU A;  4K0W A;  3VFH A;  4WEJ A;  1S4S A;  2DNS A;  1NY0 A;  1LHY A;  4QU3 A;  3IXG A;  4EXO A;  2OAP 1;  1CEF A;  1IYP A;  1GCE A;  3HLD A;  4GHI B;  1EWZ A;  1JWP A;  4DF6 A;  2ACG A;  4S2N A;  1TEM A;  4OON A;  5M19 A;  4S2L A;  1HZO A;  3D4F A;  4U0X A;  3BFF A;  3T4J A;  3E4Q A;  4ZTK A;  1KVL A;  3UDI A;  2Y55 A;  1KE3 A;  1K55 C;  4BD1 A;  3MBZ A;  2ZQ9 A;  4NG2 A;  4IBX A;  3MFX A;  3OPR A;  4CPK A;  3N6I A;  5IT5 A;  1BLS A;  3C2W A;  3PBS A;  1K6S A;  3KYE A;  3NIA A;  4JXW A;  4UEY A;  5J8X A;  3EEA A;  1P0Z A;  3G32 A;  3UB9 A;  1L0E A;  3LR3 A;  1D7E A;  3ZGA B;  3U4L P;  3D9Y A;  3MZE A;  4LEN A;  2QHK A;  1IOU A;  1OJ5 A;  1DP6 A;  2HDQ A;  2GDN A;  3BRM A;  3ZG7 B;  3ZG9 B;  2ZD8 A;  3BFC A;  5FEF A;  2BTF P;  3CJM A;  1W79 A;  2JC7 A;  1JTD A;  4R1G A;  1YT4 A;  2QZ6 A;  1HLU P;  3LIC A;  1F98 A;  4RX3 A;  5L10 A;  4OPQ A;  4MBK A;  1ERO A;  1UWN X;  1Y4O A;  5TJJ A;  3NDG A;  1KGG A;  4I38 A;  3BWL A;  2JE5 A;  1E3U A;  3FPW A;  3T1S A;  4A5R A;  3MQ0 A;  1DJB A;  5U47 A;  3A3D A;  1SKO A;  3TRC A;  3T1X A;  3NY4 A;  2V1Z A;  5FA7 A;  4I3I A;  4JPM A;  4EBP A;  3HJK A;  1ZKJ A;  1L2S A;  2E8J A;  4R4R A;  4C75 A;  2PR5 A;  3IH9 A;  4II7 A;  3RXX A;  3M2J A;  3WRZ A;  3N8L A;  5CX7 A;  3LFV A;  2LB9 A;  5M1A A;  4CQH A;  2H0Y A;  4PM6 A;  4KQR A;  1FSW A;  5EUA A;  2L1M A;  1FIK A;  3DWK A;  3P98 A;  3ZFZ A;  1OTD A;  3VSK A;  4HBT A;  1FOF A;  1W8Y A;  1NWZ A;  2INW A;  3W8K A;  3B47 A;  2X71 A;  2VEA A;  3LUQ A;  3FV7 A;  1PNE A;  5HPF A;  2OOL A;  1IEL A;  2WGW B;  2WUQ A;  1SCW A;  1PI4 A;  4HOI A;  5HD5 A;  4QJG A;  2OLU A;  4Y13 A;  1H0M A;  3NEC A;  3MFD A;  4HJ6 A;  3WS5 A;  5BOH A;  1MZU A;  3CPT B;  4PM8 A;  2ZQC A;  4OQG A;  2J3T C;  3PAG A;  3U2A A;  2AVX A;  4CLC B;  4BQM A;  3SOI A;  3NI9 A;  3Q7V B;  4KQO A;  2WKR A;  2PU4 A;  5G18 A;  1AWI A;  1ESU A;  5J3W A;  2O9C A;  2PT7 A;  4LPZ A;  4KZ6 A;  3PBO A;  2ZJ9 A;  4UAA A;  4WMC D;  1FQG A;  3JVU A;  4K08 A;  1S4R A;  2ZC5 B;  3EOI A;  4LCM A;  2XA7 M;  1N9N A;  1XPB A;  5GLC A;  2C5W B;  3MR0 A;  1CK3 A;  1H8M A;  3CG5 A;  1JWV A;  2I72 A;  1Y28 A;  5HAQ A;  4JGR A;  2WKI A;  1NLY A;  3VMA A;  5CHM A;  3MS6 A;  4LRZ E;  4DN0 A;  2VGK A;  3S22 A;  3UB8 A;  3M6H A;  5L8M A;  2H0T A;  1K56 A;  1AXB A;  4IVK A;  1MC0 A;  4UA9 A;  1S6R A;  4KUO A;  1LSX A;  5HL6 A;  2IWD A;  1G6O A;  4WEL A;  1Q2Q A;  2V9A A;  3A3F A;  3BQ8 A;  3BFE A;  1XJ3 A;  4JLF A;  5AQB A;  1HVB A;  5F68 A;  4OH0 A;  5GLD A;  4ARZ A;  1GA9 A;  5HAP A;  4EW7 A;  3UO9 A;  3VP0 A;  1VHM A;  4EQ1 A;  3HLB A;  5CRF A;  3ZVT A;  3W2Z A;  5HX9 A;  2EX8 A;  2NUP C;  4GNU A;  2XRN A;  1XGI A;  4JF5 A;  2XD1 A;  2GX5 A;  2J9O A;  1W8Q A;  4KZ5 A;  5HDS A;  5AVF A;  5DF7 A;  3OC2 A;  1TS7 A;  4KQQ A;  1K4E A;  3A0V A;  3UPN A;  1OTE A;  3GMW A;  1TS8 A;  3V67 A;  2ZM8 A;  3T4O A;  2HP5 A;  3OZH A;  3BYD A;  1E4D A;  1DJC A;  1E3U D;  3T4K A;  2ZLY A;  1MY8 A;  2J8Y A;  2JKG A;  2LB5 A;  1G6A A;  4FD8 A;  1GHI A;  3DWZ A;  2JHE A;  2P9V B;  4Q0J A;  4BMW A;  2ZM0 A;  5FQM A;  4KG2 A;  1BLH A;  2JCH A;  3LI9 A;  3IF6 A;  4XT2 A;  4BWI A;  2H28 A;  2CC1 A;  3LGO A;  2WAF A;  5FEG A;  2EXA A;  3HBR A;  1TDL A;  5EVL A;  4S2N C;  2ZMA A;  1IYO A;  2EXB A;  4LV3 A;  3UE3 A;  3H9W A;  3HUM A;  4X53 A;  1N9B A;  1D06 A;  3A0R A;  4EBL A;  2A3U A;  3E98 A;  3MKF A;  5KZH A;  3PBR A;  4R3J A;  2JKT I;  5HWT A;  3DAV A;  4GW9 A;  4RA7 A;  2HZ5 A;  4WZ5 A;  4OQH A;  1H8Y A;  1MKM A;  5CTN A;  2G2W A;  2B5R A;  4NXG A;  3T4T A;  4RVA A;  2OAQ 1;  3FPV A;  1OJG A;  5F82 A;  3UE6 A;  3F1P B;  1T18 A;  1L3L A;  4I5S A;  1MPL A;  2BG1 A;  3F1N B;  1S1Y A;  4BD0 A;  4HH3 A;  3FZC A;  2ZQ7 A;  1U60 A;  4E6W A;  2D01 A;  4EER A;  4IVI A;  4P6Z S;  4EQI A;  4DE3 A;  2QKP A;  3WS0 A;  4U3T A;  1IKI A;  2XF3 A;  4O7D A;  4HNB A;  1RGZ A;  3PYP A;  3HLW A;  5AQA A;  3KYQ A;  3IT9 A;  5JYO A;  3BEC A;  3GRJ A;  1VEU B;  4KZ3 A;  3PR6 A;  3QP4 A;  2G2U A;  4HHD A;  1V9Z A;  3BY9 A;  2PBD P;  1G5U A;  3LY3 A;  2ZQD A;  3PXP A;  3C5A A;  2OWH A;  2VA0 A;  2PU2 A;  4QY6 A;  2IWB A;  1MWR A;  3MMH A;  4MMN A;  2K7S A;  5L2F A;  1YSP A;  3SW1 A;  1K56 D;  3P7N A;  1F2K A;  5MC7 A;  4IUH A;  3S7P A;  1JNU A;  4R3A A;  4JXV A;  1S0W A;  2VGL S;  3ULF A;  3GQZ A;  2Z2M B;  5A93 A;  2WYX A;  3E2K A;  1NZO A;  5IHV A;  1K38 A;  1ACF A;  3LIF A;  5AQ9 A;  4HQA A;  3UDF A;  5CEB A;  4GDB A;  2VX8 A;  2Q9M A;  5CGW A;  2A2L A;  1XGJ A;  2VKS A;  4NET A;  3E0Y A;  3TSG A;  3JYI A;  4BBU A;  4DJ3 A;  2V8C A;  1JVJ A;  2W0N A;  3OPL A;  2XR0 A;  3WS4 A;  3SH9 A;  1PWD A;  3BJN A;  2X02 A;  4S2K A;  2WZZ A;  3UB5 P;  3L7H A;  4KG6 A;  3UY6 A;  1RP5 A;  3VE4 A;  2UWX A;  3PHY A;  4KG5 A;  2EA9 A;  4X6T A;  4CLC D;  2HPB A;  3FWL A;  4OP8 A;  3GVB A;  1OTI A;  1ES4 A;  3UB6 A;  4ZAM A;  1GHP A;  4UQI S;  5F5Y A;  4HH2 A;  1PIO A;  5EVE A;  3ZNY A;  5KIZ A;  2PR6 A;  4F3L B;  3P09 A;  1PZP A;  4IHQ A;  4EWF A;  1Y54 A;  3D3O A;  2XDM A;  3ZHH A;  4S2I A;  3B42 A;  3IHB A;  4LFU A;  3V3S A;  4HI4 A;  4WM9 A;  4R4S A;  5HWV A;  1XX2 A;  3ITA A;  2KOI A;  1CI9 A;  3C4O A;  3TJZ C;  3R4K A;  1OME A;  3L9K A;  1NZU A;  3QP8 A;  4WZ4 A;  2ZC6 B;  4DMZ A;  2Q0O A;  2E8I A;  4ZJ2 A;  2X01 A;  2V20 A;  1WYB A;  1ONH A;  4U0T A;  1VB6 A;  5DTS A;  1S67 L;  2Y59 A;  3K3C A;  3MXS A;  4MDZ A;  3SZT A;  3H7W A;  1IFQ A;  4PKY A;  4UHU A;  1G68 A;  4HJ4 A;  5F83 A;  3WRT A;  1W7F A;  1W5D A;  3HCY A;  3QP6 A;  1YSQ A;  2JKR M;  1CF0 A;  1ZG4 A;  2W3E A;  4MEZ A;  4OOL A;  3IS2 B;  3EEH A;  4GOG A;  4OPR A;  5AJG A;  4IUK A;  5EV0 A;  2VV7 A;  1XKZ A;  2Z6C A;  2WK0 A;  5DTK A;  2W3G A;  2W1T A;  4O0P A;  1YM1 A;  3A3E A;  1ZG6 A;  3ZCZ A;  1ZHH B;  3KX0 X;  2VK3 A;  4HIA A;  5HZH A;  1M40 A;  3IF6 C;  3N7W A;  3TG9 A;  2R78 A;  1XP4 A;  1GA0 A;  4Y3I A;  3MSH A;  3DTI A;  3VE3 A;  1PW8 A;  1T1A A;  3BFD A;  5EVI D;  4NEE D;  4X1L A;  4Z1W A;  4EUZ A;  1J9M A;  5GHY A;  2HGV A;  4D2O A;  3OOV A;  1PWG A;  2QJ5 A;  4O8G A;  1YLW A;  4BL3 A;  3NOU C;  2B95 A;  3O86 A;  2XH9 A;  3SH7 A;  2K2N A;  1I2W A;  5GLB A;  1MWT A;  1LI0 A;  3O5Y A;  3UB7 A;  2GZA A;  4P0M A;  2ZL1 B;  4DE2 A;  4C6Y A;  5A90 A;  4I3A A;  3TOI A;  4QD4 A;  2QWS A;  2P74 A;  4QWO A;  1N4O A;  1KVM A;  4GHI A;  4JKT A;  4OLG A;  1X0O A;  1N9O A;  2GNX A;  4GZB A;  4E3I A;  3T1Q B;  3OLO A;  4R23 A;  4KEN B;  3DTK A;  4EEP A;  5TFQ A;  5L07 A;  4X1M A;  1EI5 A;  2EFU A;  4EET B;  3HLC A;  4E3J A;  2VLG A;  1MWS A;  1FR6 A;  4L0L A;  5F6A A;  3S1Y A;  1J3W A;  4WL9 A;  1DRM A;  3IF5 A;  3CAX A;  3DBA A;  3NDE A;  3ZG5 A;  2A24 B;  2Y4A A;  4R3B A;  3QNC A;  3PAE A;  1W63 M;  4JXS A;  1PWC A;  4XXR A;  5HWW A;  3MKE A;  2YKH A;  4Y17 A;  3MQQ A;  1FCM A;  3LIA A;  1NLZ A;  4Y0T A;  3CUE A;  4RX2 A;  3OPP A;  2Y2G A;  2VV6 A;  2MJ6 A;  1MXO A;  5M18 A;  3LID A;  5I5L A;  3IX3 A;  4DRT A;  5FSR A;  2V1A A;  4DKI A;  1ZTU A;  4YWZ A;  5I94 A;  2JKT M;  3VOL A;  4N1X A;  4PM9 A;  4XT2 B;  1FCN A;  1HTZ A;  3VOZ A;  3Q07 A;  2FFY A;  1EW0 A;  4IJG A;  4MN7 A;  2EX2 A;  4OQ0 A;  3SH8 A;  3AGE A;  4MBF A;  4B4X A;  1CQA A;  3MF0 A;  4CJN A;  4B9O A;  1MWU A;  4GS9 B;  1P9W A;  1FIL A;  3G31 A;  2V0U A;  4ESP A;  1UWP X; 
#chains in the Genus database with same CATH homology
 2JN7 A;  2QKP A;  4PHT A;  3IBR A;  4LRY C;  1OPX A;  4HNB A;  4BBT A;  3PYP A;  2L0W A;  3T50 A;  2J80 A;  3KYQ A;  4H6J A;  1NRJ A;  1WA9 A;  2HJ9 C;  5DKL A;  5HDD A;  2EWW A;  5G4Z A;  2V1B A;  1T19 A;  2DMW A;  1P97 A;  2ZBB A;  4WEJ A;  1S4S A;  1TD5 A;  5HD3 A;  3PR6 A;  3PBQ A;  4ARZ B;  4HHD A;  3TE8 A;  4EXO A;  4MN5 A;  2OAP 1;  3PBT A;  1V9Z A;  3BY9 A;  3MXQ A;  2K31 A;  3EQV A;  1UGU A;  3IS2 A;  2QYB A;  4GHI B;  4CLC A;  3PXP A;  2OWH A;  2VA0 A;  2ZOI A;  2BAS A;  4Y5F A;  3MMH A;  4MMN A;  2K7S A;  3SW1 A;  1YSP A;  2HF6 A;  3E4P A;  3T4J A;  3E4Q A;  4WN5 A;  3P7N A;  1LSV A;  1GSV A;  2Y79 A;  5MC7 A;  4IUH A;  3S7P A;  3K3D A;  3MFX A;  3NHQ A;  1JNU A;  2JKR I;  4R3A A;  1V9Y A;  3S7O A;  5IT5 A;  2VGL S;  3ULF A;  3C2W A;  3PBS A;  4UEY A;  1T1C A;  3LIF A;  4NXF A;  3EEA A;  1P0Z A;  3UB9 A;  3LR3 A;  4HQA A;  1S66 L;  4HY8 A;  4WLA A;  1D7E A;  2QHK A;  1OTA A;  2VX8 A;  1IOU A;  3H82 B;  1OJ5 A;  2M7U A;  3C8C A;  1DP6 A;  2A2L A;  4YOF A;  2VKS A;  2XSS A;  3TW8 A;  3OCL A;  3E0Y A;  3KSH A;  4KUK A;  5HSQ A;  4BBU A;  4DJ3 A;  3LYX A;  4ZRR A;  3LIE A;  2W0N A;  1LT0 A;  2Z6D A;  4HJ3 A;  2ZOH A;  5FL3 A;  3LIC A;  1F98 A;  3BJN A;  4YNR A;  1UWN X;  3NOT C;  5TJJ A;  3VE4 A;  2XA7 S;  4G3V A;  3PHY A;  4I38 A;  4GJ4 A;  1P9R A;  3BWL A;  3FPW A;  2EA9 A;  3MQ0 A;  4CLC D;  5J7E A;  2KDK A;  4P6Z M;  1OTI A;  3F1O B;  3UB6 A;  3TRC A;  2NUT C;  4UQI S;  5F5Y A;  4WF0 A;  1GSX A;  1OT6 A;  4JGQ A;  4HH2 A;  3EGX C;  4CLC E;  5KIZ A;  2PR6 A;  4F3L B;  4I3I A;  3HJK A;  3KYZ A;  3CI6 A;  2PR5 A;  3EGD C;  4IHQ A;  4Q0I A;  3D3O A;  5K5B A;  4OOM A;  4II7 A;  3B42 A;  3IBJ A;  4HI4 A;  3KSF A;  5HWV A;  2P7J A;  4R70 A;  5CX7 A;  4L9E A;  3LFV A;  2LB9 A;  1W63 Q;  2KOI A;  3LR5 A;  4CQH A;  3TJZ C;  3R4K A;  2L1M A;  1YAX A;  4LLO B;  3R7W B;  4JGP A;  4DMZ A;  5TBM B;  3T4L A;  4WUJ A;  1OTD A;  5J4E A;  5EFW A;  2A24 A;  3BW6 A;  3BQA A;  1NWZ A;  4E04 A;  2B18 A;  2INW A;  3B47 A;  1VB6 A;  4Q0H A;  4R6L A;  5DJU A;  1S67 L;  5IS1 A;  2VEA A;  3K3C A;  3LUQ A;  3G6O A;  4MDZ A;  1GSW A;  2FH5 A;  4FSF A;  5DFX A;  3BY8 A;  3H7W A;  4EU0 A;  1IFQ A;  5HPF A;  4PKY A;  2OOL A;  4NXB A;  3ICY A;  4HJ4 A;  2HJE A;  3D72 A;  1G28 A;  3E4O A;  4HOI A;  5HD5 A;  3MQO A;  2VGL M;  3S7Q A;  4H6J B;  1DP9 A;  5IU1 A;  2M1C A;  2YKF A;  3HCY A;  1YSQ A;  3A0S A;  3MJQ A;  2JKR M;  4HJ6 A;  4ETZ A;  1MZU A;  3EQU A;  2W3E A;  1F9I A;  5A8B A;  4BBV A;  3UME A;  4OOL A;  2J3T C;  3U2A A;  3IS2 B;  5KSH A;  2B02 A;  5F69 A;  4CLC B;  3EEH A;  4WEK A;  5AJG A;  3K2N A;  4KQO A;  4IUK A;  2WKR A;  2VV7 A;  4Y2F A;  4EEU A;  4I3J A;  2W3H A;  2Z6C A;  5J3W A;  2O9C A;  2M7V A;  2PT7 A;  1KOU A;  2VJW A;  4LPZ A;  5DJT A;  2W3G A;  2Y8H A;  2W1T A;  4O0P A;  3PBO A;  3F1P A;  3C30 A;  3JVU A;  1ZHH B;  1S4R A;  3EOI A;  3F1N A;  3KX0 X;  4K08 A;  4GLQ A;  2PD8 A;  2XA7 M;  1N9N A;  5LBR A;  5DKK A;  4L9G A;  3MR0 A;  4HIA A;  1H8M A;  5HZH A;  1F5M A;  2R78 A;  4GS9 A;  2WKQ A;  4L9F A;  3NOP C;  1Y28 A;  4Y3I A;  4M4X A;  1OTB A;  2VZW A;  3C38 A;  3VE3 A;  4EES A;  3B33 A;  3FG8 A;  4JGR A;  1NLY A;  4FOF A;  4LRZ E;  4UQI M;  1T1A A;  1LSW A;  4DN0 A;  4NEE D;  2KX6 A;  4Z1W A;  4JGO A;  3UB8 A;  5L8M A;  3CUE C;  2HGV A;  3LR4 A;  4G3W A;  3OOV A;  3RFB A;  2QJ5 A;  1MC0 A;  4O8G A;  1TF1 A;  3UMD A;  4NKP A;  4DJ2 A;  1H3Q A;  4KUO A;  3GEC A;  3P01 A;  1LSX A;  5HL6 A;  4HP9 A;  4AFI A;  1G6O A;  3LR0 A;  1T1B A;  3NOU C;  4WEL A;  2K2N A;  2V9A A;  3BQ8 A;  1XFQ A;  1XJ3 A;  3O5Y A;  3UB7 A;  2GZA A;  5F68 A;  4EUV A;  4ARZ A;  2P08 A;  2O9B A;  4I3A A;  3T4S A;  4BJP A;  2QWS A;  2HV1 A;  4LRX C;  3LI8 A;  4MCW A;  4EW7 A;  1VHM A;  4GHI A;  2XRO A;  4EQ1 A;  1X0O A;  3RH8 B;  3W2Z A;  1N9O A;  2P04 A;  2PD7 A;  2NUP C;  4B93 A;  4KQD A;  2GNX A;  2O9A A;  2XRN A;  2IA2 A;  4O01 A;  2WKP A;  3OLO A;  4GCZ A;  1TS0 A;  2CMN A;  3LIB A;  4EEP A;  3KSG A;  2GX5 A;  5HDS A;  5AVF A;  2EWV A;  3OC2 A;  1TS7 A;  4EET B;  3A0V A;  1XJ4 A;  1OTE A;  5HPI A;  2VV8 A;  5G4Y A;  2O0Y A;  3PBN A;  2VLG A;  1TS8 A;  3NJA A;  3V67 A;  4L0L A;  5F6A A;  3T4O A;  3CIT A;  2PYP A;  2L4R A;  3H82 A;  3T4K A;  4WL9 A;  2LB5 A;  2FZ0 A;  3HJI A;  1DRM A;  3JVV A;  3CLO A;  1OT9 A;  2O99 A;  2JHE A;  4Q0J A;  1YKD A;  3CAX A;  3DBA A;  4NXE A;  4BMW A;  1XFN A;  2W3D A;  2A24 B;  5C5K A;  4QPR A;  3LI9 A;  4XT2 A;  1W63 M;  4BWI A;  4ME4 A;  2ZMF A;  2H28 A;  1STZ A;  5HWW A;  2KLI A;  4CLC C;  1XJ6 A;  2YKH A;  3GDI A;  2W27 A;  3MQQ A;  3H7W B;  1ODV A;  3LIA A;  1NLZ A;  2OWJ A;  2ZMV A;  3CUE A;  3FC7 A;  2VV6 A;  2MJ6 A;  3OBF A;  3UE3 A;  3H9W A;  4ETX A;  3S7N A;  3KO6 A;  3LID A;  1D06 A;  3A0R A;  2V0W A;  3F1O A;  1BYW A;  2W1R A;  5I5L A;  4PAU A;  4R38 A;  2V1A A;  3E98 A;  1ZTU A;  4MN6 A;  3PBR A;  2D02 A;  4F3L A;  4HP4 A;  4YWZ A;  2JKT I;  3T4Q A;  1N9L A;  2JKT M;  5DFY A;  2PDR A;  3VOL A;  3ZYT A;  5HWT A;  3RTY A;  4GW9 A;  4XT2 B;  2PYR A;  2I9V A;  2W3F A;  5HDC A;  2QJ7 A;  4G3K A;  4RQ9 A;  2J3T D;  1MKM A;  1EW0 A;  4IJG A;  4NXG A;  2G7U A;  2J3W A;  1S1Z A;  4I39 A;  2GJ3 A;  3CWF A;  3T4T A;  2OAQ 1;  3KSI A;  2W1T B;  4MN7 A;  3FPV A;  1OJG A;  2PHY A;  1LL8 A;  3UE6 A;  3F1P B;  1T18 A;  3VV4 A;  4I5S A;  1TS6 A;  5DF9 A;  3F1N B;  1S1Y A;  3R7W A;  5TBM A;  4HH3 A;  3MF0 A;  5AVE A;  4B9O A;  2D01 A;  4GS9 B;  1P9W A;  4EER A;  4P6Z S;  3ZQ5 A;  2V0U A;  3OCN A;  1XJ2 A;  1DP8 A;  1UWP X;  4PKY G;  3EWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...