1XG2A

Crystal structure of the complex between pectin methylesterase and its inhibitor protein
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
317
structure length
317
Chain Sequence
b'IIANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVASNKMNLMIVGDGMYATTITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTDPNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKEYSRTVVMESYLGGLINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAKLIQGGSWLRSTGVAYVDGLYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pectinesterase 1
publication title Structural Basis for the Interaction between Pectin Methylesterase and a Specific Inhibitor Protein
pubmed doi rcsb
source organism Actinidia chinensis
molecule tags Hydrolase/hydrolase inhibitor
total genus 111
structure length 317
sequence length 317
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1xg2A00
1VBLA 2QX3A 4C2LA 3B4NA 3VSVA 3GQ8A 5C1CA 2VBKA 4NK8A 1PE9A 3JURA 4NK6A 4PMHA 3EQNA 2NT9A 1HG8A 2QXZA 2O17A 2IQ7A 1O8HA 1GQ8A 4U4BA 4XLAA 2EWEA 1XG2A 2NSPA 4I84A 3VMVA 3KRGA 1RWRA 2X6YA 1IDKA 1H80A 1O8EA 1O8LA 3T9GA 3ZSCA 1QCXA 4XM3A 1JTAA 2NSTA 4OJPA 1K5CA 3UW0A 3GQ9A 4OJOA 4YZ0A 1PXZA 4W8RA 1BN8A 1O8MA 2VBMA 4YZAA 2X85A 1KTWA 4HWVA 4EW9A 4Z05A 4W8QA 4XN3A 3GQ7A 2NT6A 4XOTA 1O8KA 1O8JA 4Z03A 2ODLA 1CZFA 2UVEA 5C1EA 4XQFA 4OJ5A 4XLFA 2INVA 4YZXA 1BHEA 4MR0A 3GRHA 1O8GA 2QY1A 4OZYA 1O8IA 2VJJA 3B8YA 1X0CA 2PYHA 4XOPA 2PYGA 3ZPPA 2O1DA 4XKWA 4YEJA 2BSPA 4MXNA 3VSTA 4XN0A 4OJLA 4XL9A 2NTBA 4YELA 1O88A 3GQAA 3VSUA 2X6WA 2NTPA 4XLCA 4XKVA 1WMRA 2X6XA 1OGOX 4XORA 1DBOA 2O0WA 4YZQA 2O0VA 1AIRA 2NZMA 1O8DA 1RU4A 2VBEA 1QJVA 4OJ6A 3VMWA 4XONA 1O8FA 4URRA 1JRGA 2VJIA 2X3HA 4XLEA 1EE6A 3SUCA 1OFMA 1OOCA 1PLUA 1IDJA 3FY3A 1KCDA 4XNFA 1IB4A 4OZZA 1IA5A 1NHCA 5AMVA 2Z8GA 1KCCA 2O04A 1OFLA 4XR6A 3WWGA 2PECA 4Z06A 3EQOA 4W8SA 3B90A 4U49A 2UVFA 1OGMX 2INUA 4XMYA 1DBGA 1RMGA 3LMWA 4AVZA 4XLHA 4W8TA 2NTQA
chains in the Genus database with same CATH superfamily
2VFMA 1VBLA 2BM7A 2QX3A 4C2LA 2BM4A 3SZEA 3B4NA 3VSVA 3GQ8A 5C1CA 2VBKA 4NK8A 1PE9A 3JURA 4NK6A 4PMHA 1LLZA 1LM1A 2XC1A 3EQNA 1OFDA 2NT9A 1DABA 1HG8A 2QXZA 2O17A 2IQ7A 5JLVC 1O8HA 1LLWA 1K8FA 2BX6A 1GQ8A 1K4ZA 5DNSA 4U4BA 4XLAA 2EWEA 1XG2A 2NSPA 4I84A 3VMVA 1TYWA 3KRGA 1RWRA 2J8IA 1IDKA 2X6YA 1H80A 1O8EA 1O8LA 3T9GA 2QYUA 2VFPA 1QCXA 3N90A 3PSZA 3ZSCA 1WXRA 4XM3A 1JTAA 2NSTA 3RIQA 4OJPA 1K5CA 1QA2A 3UW0A 3NB2A 3GQ9A 4OJOA 1QQ1A 4YZ0A 1PXZA 3TH0A 2VFQA 4W8RA 1BN8A 1O8MA 2VBMA 4KH3A 2X85A 2XTYA 1TYXA 4YZAA 1KTWA 4HWVA 4EW9A 4Z05A 4W8QA 4XN3A 3GQ7A 2NT6A 3PSSA 1O8KA 2F3LA 4XOTA 2B0RA 1O8JA 2G0YA 1QA1A 4JRAC 4Z03A 2ODLA 1CZFA 2YUHA 1HF2A 2UVEA 5C1EA 4YCQA 4XQFA 4OJ5A 1OFEA 1EZGA 2INVA 4XLFA 4YZXA 1BHEA 2QZAA 4MR0A 3GRHA 4YEIA 1O8GA 2QY1A 1KCDA 5JMCB 4OZYA 2VFOA 2XT4A 1O8IA 2VJJA 3B8YA 3AK5A 2BM6A 1X0CA 2PYHA 3ML3A 2PYGA 4XOPA 3ZPPA 2O1DA 4XKWA 4YEJA 2BSPA 4MXNA 3BH7B 3VSTA 4XN0A 4OJLA 3PETA 4XL9A 1KQ5A 2NTBA 3SY2A 4YELA 1O88A 3GQAA 4YDTA 1QRBA 4V02C 2VFNA 3VSUA 2X6WA 3LYCA 2NTPA 4XLCA 4XKVA 1WMRA 1TYVA 2BM5A 3DU1X 2X6XA 1OGOX 4XORA 1CLWA 1DBOA 2O0WA 1QRCA 4YZQA 3SQVA 2O0VA 1TSPA 4OPWA 1AIRA 3SYJA 2NZMA 1O8DA 1RU4A 2VBEA 1QJVA 3LJYA 4OJ6A 3VMWA 1L1IA 4XONA 1O8FA 4URRA 1JRGA 3P4GA 2VJIA 2X3HA 4XLEA 2O6WA 1EE6A 3SUCA 1OFMA 1OOCA 2XT2A 4OM9A 1PLUA 1IDJA 1TYUA 3FY3A 3JX8A 3N6ZA 3BH6B 3NAWA 4OZZA 4XNFA 1IB4A 4YFOA 1IA5A 1NHCA 5AMVA 2W7ZA 2Z8GA 1KCCA 2O04A 2XTWA 1OFLA 4XR6A 3WWGA 2PECA 2XTXA 4Z06A 3EQOA 2J8KA 4W8SA 3B90A 4U49A 3H09A 2V5IA 4YC5A 2UVFA 1QA3A 1OGMX 2INUA 4XMYA 1DBGA 1RMGA 3LMWA 4AVZA 4XLHA 4W8TA 1EA0A 2NTQA 2IOUG
chains in the Genus database with same CATH topology
1VBLA 2QX3A 4C2LA 3B4NA 3VSVA 3GQ8A 5C1CA 2VBKA 4NK8A 1PE9A 3JURA 4NK6A 4PMHA 3EQNA 2NT9A 1HG8A 2QXZA 2O17A 2IQ7A 1O8HA 1GQ8A 4U4BA 4XLAA 2EWEA 1XG2A 2NSPA 4I84A 3VMVA 3KRGA 1RWRA 2X6YA 1IDKA 1H80A 1O8EA 1O8LA 3T9GA 3ZSCA 1QCXA 4XM3A 1JTAA 2NSTA 4OJPA 1K5CA 3UW0A 3GQ9A 4OJOA 4YZ0A 1PXZA 4W8RA 1BN8A 1O8MA 2VBMA 4YZAA 2X85A 1KTWA 4HWVA 4EW9A 4Z05A 4W8QA 4XN3A 3GQ7A 2NT6A 4XOTA 1O8KA 1O8JA 4Z03A 2ODLA 1CZFA 2UVEA 5C1EA 4XQFA 4OJ5A 4XLFA 2INVA 4YZXA 1BHEA 4MR0A 3GRHA 1O8GA 2QY1A 4OZYA 1O8IA 2VJJA 3B8YA 1X0CA 2PYHA 4XOPA 2PYGA 3ZPPA 2O1DA 4XKWA 4YEJA 2BSPA 4MXNA 3VSTA 4XN0A 4OJLA 4XL9A 2NTBA 4YELA 1O88A 3GQAA 3VSUA 2X6WA 2NTPA 4XLCA 4XKVA 1WMRA 2X6XA 1OGOX 4XORA 1DBOA 2O0WA 4YZQA 2O0VA 1AIRA 2NZMA 1O8DA 1RU4A 2VBEA 1QJVA 4OJ6A 3VMWA 4XONA 1O8FA 4URRA 1JRGA 2VJIA 2X3HA 4XLEA 1EE6A 3SUCA 1OFMA 1OOCA 1PLUA 1IDJA 3FY3A 1KCDA 4XNFA 1IB4A 4OZZA 1IA5A 1NHCA 5AMVA 2Z8GA 1KCCA 2O04A 1OFLA 4XR6A 3WWGA 2PECA 4Z06A 3EQOA 4W8SA 3B90A 4U49A 2UVFA 1OGMX 2INUA 4XMYA 1DBGA 1RMGA 3LMWA 4AVZA 4XLHA 4W8TA 2NTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBL A;  2QX3 A;  4C2L A;  3B4N A;  3VSV A;  3GQ8 A;  5C1C A;  2VBK A;  4NK8 A;  1PE9 A;  3JUR A;  4NK6 A;  4PMH A;  3EQN A;  2NT9 A;  1HG8 A;  2QXZ A;  2O17 A;  2IQ7 A;  1O8H A;  1GQ8 A;  4U4B A;  4XLA A;  2EWE A;  1XG2 A;  2NSP A;  4I84 A;  3VMV A;  3KRG A;  1RWR A;  2X6Y A;  1IDK A;  1H80 A;  1O8E A;  1O8L A;  3T9G A;  3ZSC A;  1QCX A;  4XM3 A;  1JTA A;  2NST A;  4OJP A;  1K5C A;  3UW0 A;  3GQ9 A;  4OJO A;  4YZ0 A;  1PXZ A;  4W8R A;  1BN8 A;  1O8M A;  2VBM A;  4YZA A;  2X85 A;  1KTW A;  4HWV A;  4EW9 A;  4Z05 A;  4W8Q A;  4XN3 A;  3GQ7 A;  2NT6 A;  4XOT A;  1O8K A;  1O8J A;  4Z03 A;  2ODL A;  1CZF A;  2UVE A;  5C1E A;  4XQF A;  4OJ5 A;  4XLF A;  2INV A;  4YZX A;  1BHE A;  4MR0 A;  3GRH A;  1O8G A;  2QY1 A;  4OZY A;  1O8I A;  2VJJ A;  3B8Y A;  1X0C A;  2PYH A;  4XOP A;  2PYG A;  3ZPP A;  2O1D A;  4XKW A;  4YEJ A;  2BSP A;  4MXN A;  3VST A;  4XN0 A;  4OJL A;  4XL9 A;  2NTB A;  4YEL A;  1O88 A;  3GQA A;  3VSU A;  2X6W A;  2NTP A;  4XLC A;  4XKV A;  1WMR A;  2X6X A;  1OGO X;  4XOR A;  1DBO A;  2O0W A;  4YZQ A;  2O0V A;  1AIR A;  2NZM A;  1O8D A;  1RU4 A;  2VBE A;  1QJV A;  4OJ6 A;  3VMW A;  4XON A;  1O8F A;  4URR A;  1JRG A;  2VJI A;  2X3H A;  4XLE A;  1EE6 A;  3SUC A;  1OFM A;  1OOC A;  1PLU A;  1IDJ A;  3FY3 A;  1KCD A;  4XNF A;  1IB4 A;  4OZZ A;  1IA5 A;  1NHC A;  5AMV A;  2Z8G A;  1KCC A;  2O04 A;  1OFL A;  4XR6 A;  3WWG A;  2PEC A;  4Z06 A;  3EQO A;  4W8S A;  3B90 A;  4U49 A;  2UVF A;  1OGM X;  2INU A;  4XMY A;  1DBG A;  1RMG A;  3LMW A;  4AVZ A;  4XLH A;  4W8T A;  2NTQ A; 
#chains in the Genus database with same CATH topology
 2VFM A;  1VBL A;  2BM7 A;  2QX3 A;  4C2L A;  2BM4 A;  3SZE A;  3B4N A;  3VSV A;  3GQ8 A;  5C1C A;  2VBK A;  4NK8 A;  1PE9 A;  3JUR A;  4NK6 A;  4PMH A;  1LLZ A;  1LM1 A;  2XC1 A;  3EQN A;  1OFD A;  2NT9 A;  1DAB A;  1HG8 A;  2QXZ A;  2O17 A;  2IQ7 A;  5JLV C;  1O8H A;  1LLW A;  1K8F A;  2BX6 A;  1GQ8 A;  1K4Z A;  5DNS A;  4U4B A;  4XLA A;  2EWE A;  1XG2 A;  2NSP A;  4I84 A;  3VMV A;  1TYW A;  3KRG A;  1RWR A;  2J8I A;  1IDK A;  2X6Y A;  1H80 A;  1O8E A;  1O8L A;  3T9G A;  2QYU A;  2VFP A;  1QCX A;  3N90 A;  3PSZ A;  3ZSC A;  1WXR A;  4XM3 A;  1JTA A;  2NST A;  3RIQ A;  4OJP A;  1K5C A;  1QA2 A;  3UW0 A;  3NB2 A;  3GQ9 A;  4OJO A;  1QQ1 A;  4YZ0 A;  1PXZ A;  3TH0 A;  2VFQ A;  4W8R A;  1BN8 A;  1O8M A;  2VBM A;  4KH3 A;  2X85 A;  2XTY A;  1TYX A;  4YZA A;  1KTW A;  4HWV A;  4EW9 A;  4Z05 A;  4W8Q A;  4XN3 A;  3GQ7 A;  2NT6 A;  3PSS A;  1O8K A;  2F3L A;  4XOT A;  2B0R A;  1O8J A;  2G0Y A;  1QA1 A;  4JRA C;  4Z03 A;  2ODL A;  1CZF A;  2YUH A;  1HF2 A;  2UVE A;  5C1E A;  4YCQ A;  4XQF A;  4OJ5 A;  1OFE A;  1EZG A;  2INV A;  4XLF A;  4YZX A;  1BHE A;  2QZA A;  4MR0 A;  3GRH A;  4YEI A;  1O8G A;  2QY1 A;  1KCD A;  5JMC B;  4OZY A;  2VFO A;  2XT4 A;  1O8I A;  2VJJ A;  3B8Y A;  3AK5 A;  2BM6 A;  1X0C A;  2PYH A;  3ML3 A;  2PYG A;  4XOP A;  3ZPP A;  2O1D A;  4XKW A;  4YEJ A;  2BSP A;  4MXN A;  3BH7 B;  3VST A;  4XN0 A;  4OJL A;  3PET A;  4XL9 A;  1KQ5 A;  2NTB A;  3SY2 A;  4YEL A;  1O88 A;  3GQA A;  4YDT A;  1QRB A;  4V02 C;  2VFN A;  3VSU A;  2X6W A;  3LYC A;  2NTP A;  4XLC A;  4XKV A;  1WMR A;  1TYV A;  2BM5 A;  3DU1 X;  2X6X A;  1OGO X;  4XOR A;  1CLW A;  1DBO A;  2O0W A;  1QRC A;  4YZQ A;  3SQV A;  2O0V A;  1TSP A;  4OPW A;  1AIR A;  3SYJ A;  2NZM A;  1O8D A;  1RU4 A;  2VBE A;  1QJV A;  3LJY A;  4OJ6 A;  3VMW A;  1L1I A;  4XON A;  1O8F A;  4URR A;  1JRG A;  3P4G A;  2VJI A;  2X3H A;  4XLE A;  2O6W A;  1EE6 A;  3SUC A;  1OFM A;  1OOC A;  2XT2 A;  4OM9 A;  1PLU A;  1IDJ A;  1TYU A;  3FY3 A;  3JX8 A;  3N6Z A;  3BH6 B;  3NAW A;  4OZZ A;  4XNF A;  1IB4 A;  4YFO A;  1IA5 A;  1NHC A;  5AMV A;  2W7Z A;  2Z8G A;  1KCC A;  2O04 A;  2XTW A;  1OFL A;  4XR6 A;  3WWG A;  2PEC A;  2XTX A;  4Z06 A;  3EQO A;  2J8K A;  4W8S A;  3B90 A;  4U49 A;  3H09 A;  2V5I A;  4YC5 A;  2UVF A;  1QA3 A;  1OGM X;  2INU A;  4XMY A;  1DBG A;  1RMG A;  3LMW A;  4AVZ A;  4XLH A;  4W8T A;  1EA0 A;  2NTQ A;  2IOU G; 
#chains in the Genus database with same CATH homology
 1VBL A;  2QX3 A;  4C2L A;  3B4N A;  3VSV A;  3GQ8 A;  5C1C A;  2VBK A;  4NK8 A;  1PE9 A;  3JUR A;  4NK6 A;  4PMH A;  3EQN A;  2NT9 A;  1HG8 A;  2QXZ A;  2O17 A;  2IQ7 A;  1O8H A;  1GQ8 A;  4U4B A;  4XLA A;  2EWE A;  1XG2 A;  2NSP A;  4I84 A;  3VMV A;  3KRG A;  1RWR A;  2X6Y A;  1IDK A;  1H80 A;  1O8E A;  1O8L A;  3T9G A;  3ZSC A;  1QCX A;  4XM3 A;  1JTA A;  2NST A;  4OJP A;  1K5C A;  3UW0 A;  3GQ9 A;  4OJO A;  4YZ0 A;  1PXZ A;  4W8R A;  1BN8 A;  1O8M A;  2VBM A;  4YZA A;  2X85 A;  1KTW A;  4HWV A;  4EW9 A;  4Z05 A;  4W8Q A;  4XN3 A;  3GQ7 A;  2NT6 A;  4XOT A;  1O8K A;  1O8J A;  4Z03 A;  2ODL A;  1CZF A;  2UVE A;  5C1E A;  4XQF A;  4OJ5 A;  4XLF A;  2INV A;  4YZX A;  1BHE A;  4MR0 A;  3GRH A;  1O8G A;  2QY1 A;  4OZY A;  1O8I A;  2VJJ A;  3B8Y A;  1X0C A;  2PYH A;  4XOP A;  2PYG A;  3ZPP A;  2O1D A;  4XKW A;  4YEJ A;  2BSP A;  4MXN A;  3VST A;  4XN0 A;  4OJL A;  4XL9 A;  2NTB A;  4YEL A;  1O88 A;  3GQA A;  3VSU A;  2X6W A;  2NTP A;  4XLC A;  4XKV A;  1WMR A;  2X6X A;  1OGO X;  4XOR A;  1DBO A;  2O0W A;  4YZQ A;  2O0V A;  1AIR A;  2NZM A;  1O8D A;  1RU4 A;  2VBE A;  1QJV A;  4OJ6 A;  3VMW A;  4XON A;  1O8F A;  4URR A;  1JRG A;  2VJI A;  2X3H A;  4XLE A;  1EE6 A;  3SUC A;  1OFM A;  1OOC A;  1PLU A;  1IDJ A;  3FY3 A;  1KCD A;  4XNF A;  1IB4 A;  4OZZ A;  1IA5 A;  1NHC A;  5AMV A;  2Z8G A;  1KCC A;  2O04 A;  1OFL A;  4XR6 A;  3WWG A;  2PEC A;  4Z06 A;  3EQO A;  4W8S A;  3B90 A;  4U49 A;  2UVF A;  1OGM X;  2INU A;  4XMY A;  1DBG A;  1RMG A;  3LMW A;  4AVZ A;  4XLH A;  4W8T A;  2NTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...