1XG2A

Crystal structure of the complex between pectin methylesterase and its inhibitor protein
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
317
structure length
317
Chain Sequence
IIANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVASNKMNLMIVGDGMYATTITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTDPNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKEYSRTVVMESYLGGLINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAKLIQGGSWLRSTGVAYVDGLYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Interaction between Pectin Methylesterase and a Specific Inhibitor Protein
pubmed doi rcsb
source organism Actinidia chinensis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pectinesterase 1
total genus 111
structure length 317
sequence length 317
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1xg2A00
2VJJA 1O88A 3GQAA 3T9GA 3VMWA 2NSPA 1OFLA 4EW9A 4C2LA 2INUA 2QY1A 4NK6A 4XKVA 4XLEA 1JTAA 5C1EA 3VSTA 4YZAA 3SUCA 2X3HA 1IB4A 3KRGA 4U4BA 4XLCA 4OJOA 3ZPPA 4W8SA 5AMVA 5C1CA 4XL9A 1CZFA 1QJVA 4XOTA 2X6YA 2NZMA 3GQ8A 1XG2A 4XNFA 4URRA 1RMGA 2INVA 1O8KA 1HG8A 4YEJA 1KCDA 1IA5A 4YZXA 3LMWA 1WMRA 4MR0A 1RU4A 2NT9A 3B90A 4XOPA 3B8YA 4OJLA 4OJ6A 1OOCA 1O8FA 3GQ7A 2O1DA 3GRHA 2VBEA 4MXNA 1DBOA 2VJIA 3B4NA 2X6WA 4XLAA 2O0WA 2O04A 2NTPA 2X85A 3JURA 3VMVA 2PECA 1PE9A 4HWVA 4XMYA 4XKWA 1O8DA 2ODLA 1PLUA 1O8GA 4OJPA 3FY3A 3VSVA 3UW0A 1O8LA 2BSPA 2Z8GA 1PXZA 2VBMA 3GQ9A 1EE6A 4Z05A 1OGOX 4OZZA 2UVFA 4YZ0A 1O8MA 1BN8A 4W8RA 2PYHA 2EWEA 4W8TA 4XN3A 1JRGA 4YZQA 3EQOA 1O8JA 1IDJA 4XORA 2UVEA 4U49A 2VBKA 4PMHA 4YELA 2QXZA 4OZYA 4Z03A 2NTBA 1NHCA 4OJ5A 1OFMA 3EQNA 2O17A 2NTQA 1DBGA 1VBLA 2PYGA 4AVZA 1O8IA 1KCCA 1QCXA 4XONA 1X0CA 4XLFA 1IDKA 1AIRA 4XM3A 1O8HA 4Z06A 1O8EA 2NSTA 4XN0A 3VSUA 1OGMX 2X6XA 1GQ8A 4XR6A 2QX3A 2IQ7A 3WWGA 4XQFA 4W8QA 4I84A 1RWRA 3ZSCA 2O0VA 2NT6A 4NK8A 1KTWA 1H80A 4XLHA 1BHEA 1K5CA
chains in the Genus database with same CATH superfamily
2YUHA 1LM1A 2VJJA 1O88A 3GQAA 3RIQA 3T9GA 3VMWA 2NSPA 1OFLA 4EW9A 1QQ1A 4KH3A 4C2LA 2INUA 1QA2A 2QY1A 2XT2A 4NK6A 4XKVA 4XLEA 2QYUA 2VFQA 1JTAA 5C1EA 3VSTA 1EA0A 3ML3A 4YZAA 3SUCA 2X3HA 2QZAA 4JRAC 1QRBA 4V02C 3KRGA 1IB4A 4U4BA 4XLCA 3LYCA 4OJOA 3ZPPA 2W7ZA 4W8SA 2BM7A 4YFOA 5AMVA 3SY2A 5C1CA 4XL9A 1CZFA 1QJVA 2BM5A 2XTWA 4XOTA 2X6YA 2NZMA 3GQ8A 3TH0A 1TYXA 3AK5A 1XG2A 4XNFA 4URRA 1RMGA 2INVA 1O8KA 1HG8A 1LLWA 4YEJA 3SQVA 2XTYA 4YCQA 2V5IA 1KCDA 2VFPA 2VFOA 1IA5A 4YZXA 3LMWA 2IOUG 1WMRA 4MR0A 2BM4A 1RU4A 2NT9A 3B90A 4XOPA 3B8YA 4OJLA 4OJ6A 1OOCA 1O8FA 3GQ7A 4XLHA 2O1DA 3GRHA 2VBEA 3N6ZA 5DNSA 3PSZA 1K8FA 4MXNA 1DBOA 1KQ5A 2VJIA 3B4NA 2X6WA 4XLAA 2O0WA 2O04A 2NTPA 2X85A 3JURA 3VMVA 2G0YA 2PECA 1PE9A 2BX6A 4HWVA 4XMYA 4XKWA 1TYUA 4YC5A 1O8DA 2ODLA 1PLUA 1O8GA 2XT4A 4OJPA 1QRCA 1L1IA 3FY3A 3JX8A 3VSVA 3UW0A 1O8LA 2BSPA 2Z8GA 1PXZA 2VBMA 3GQ9A 1EE6A 4Z05A 1OGOX 2VFMA 2UVFA 4OZZA 4YZ0A 3PETA 1O8MA 1BN8A 4W8RA 2PYHA 2XC1A 2EWEA 4W8TA 4XN3A 3BH6B 1HF2A 1JRGA 3EQOA 4YZQA 1O8JA 3PSSA 1IDJA 4XORA 1LLZA 2UVEA 4U49A 1CLWA 2VBKA 1EZGA 1TYWA 4PMHA 4YELA 2QXZA 4OZYA 4Z03A 3LJYA 2NTBA 1NHCA 4OJ5A 1K4ZA 1OFMA 3EQNA 2NTQA 2O17A 3SZEA 1WXRA 1DBGA 1TSPA 1VBLA 2VFNA 2PYGA 4AVZA 1OFEA 2J8IA 4OM9A 1O8IA 1QA3A 1QA1A 1TYVA 1KCCA 5JLVC 1QCXA 3H09A 4XONA 5JMCB 1X0CA 4XLFA 1DABA 3NAWA 1IDKA 4YDTA 1AIRA 3P4GA 4XM3A 1O8HA 4Z06A 1O8EA 2NSTA 4XN0A 3VSUA 4YEIA 1OGMX 2X6XA 3BH7B 1GQ8A 2O6WA 4XR6A 2QX3A 3SYJA 2IQ7A 3WWGA 3DU1X 4XQFA 1OFDA 2BM6A 4W8QA 4I84A 1RWRA 2B0RA 4OPWA 2O0VA 3ZSCA 2NT6A 4NK8A 2F3LA 2XTXA 3NB2A 3N90A 1KTWA 1H80A 2J8KA 1BHEA 1K5CA
chains in the Genus database with same CATH topology
2VJJA 1O88A 3GQAA 3T9GA 3VMWA 2NSPA 1OFLA 4EW9A 4C2LA 2INUA 2QY1A 4NK6A 4XKVA 4XLEA 1JTAA 5C1EA 3VSTA 4YZAA 3SUCA 2X3HA 1IB4A 3KRGA 4U4BA 4XLCA 4OJOA 3ZPPA 4W8SA 5AMVA 5C1CA 4XL9A 1CZFA 1QJVA 4XOTA 2X6YA 2NZMA 3GQ8A 1XG2A 4XNFA 4URRA 1RMGA 2INVA 1O8KA 1HG8A 4YEJA 1KCDA 1IA5A 4YZXA 3LMWA 1WMRA 4MR0A 1RU4A 2NT9A 3B90A 4XOPA 3B8YA 4OJLA 4OJ6A 1OOCA 1O8FA 3GQ7A 2O1DA 3GRHA 2VBEA 4MXNA 1DBOA 2VJIA 3B4NA 2X6WA 4XLAA 2O0WA 2O04A 2NTPA 2X85A 3JURA 3VMVA 2PECA 1PE9A 4HWVA 4XMYA 4XKWA 1O8DA 2ODLA 1PLUA 1O8GA 4OJPA 3FY3A 3VSVA 3UW0A 1O8LA 2BSPA 2Z8GA 1PXZA 2VBMA 3GQ9A 1EE6A 4Z05A 1OGOX 4OZZA 2UVFA 4YZ0A 1O8MA 1BN8A 4W8RA 2PYHA 2EWEA 4W8TA 4XN3A 1JRGA 4YZQA 3EQOA 1O8JA 1IDJA 4XORA 2UVEA 4U49A 2VBKA 4PMHA 4YELA 2QXZA 4OZYA 4Z03A 2NTBA 1NHCA 4OJ5A 1OFMA 3EQNA 2O17A 2NTQA 1DBGA 1VBLA 2PYGA 4AVZA 1O8IA 1KCCA 1QCXA 4XONA 1X0CA 4XLFA 1IDKA 1AIRA 4XM3A 1O8HA 4Z06A 1O8EA 2NSTA 4XN0A 3VSUA 1OGMX 2X6XA 1GQ8A 4XR6A 2QX3A 2IQ7A 3WWGA 4XQFA 4W8QA 4I84A 1RWRA 3ZSCA 2O0VA 2NT6A 4NK8A 1KTWA 1H80A 4XLHA 1BHEA 1K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJJ A;  1O88 A;  3GQA A;  3T9G A;  3VMW A;  2NSP A;  1OFL A;  4EW9 A;  4C2L A;  2INU A;  2QY1 A;  4NK6 A;  4XKV A;  4XLE A;  1JTA A;  5C1E A;  3VST A;  4YZA A;  3SUC A;  2X3H A;  1IB4 A;  3KRG A;  4U4B A;  4XLC A;  4OJO A;  3ZPP A;  4W8S A;  5AMV A;  5C1C A;  4XL9 A;  1CZF A;  1QJV A;  4XOT A;  2X6Y A;  2NZM A;  3GQ8 A;  1XG2 A;  4XNF A;  4URR A;  1RMG A;  2INV A;  1O8K A;  1HG8 A;  4YEJ A;  1KCD A;  1IA5 A;  4YZX A;  3LMW A;  1WMR A;  4MR0 A;  1RU4 A;  2NT9 A;  3B90 A;  4XOP A;  3B8Y A;  4OJL A;  4OJ6 A;  1OOC A;  1O8F A;  3GQ7 A;  2O1D A;  3GRH A;  2VBE A;  4MXN A;  1DBO A;  2VJI A;  3B4N A;  2X6W A;  4XLA A;  2O0W A;  2O04 A;  2NTP A;  2X85 A;  3JUR A;  3VMV A;  2PEC A;  1PE9 A;  4HWV A;  4XMY A;  4XKW A;  1O8D A;  2ODL A;  1PLU A;  1O8G A;  4OJP A;  3FY3 A;  3VSV A;  3UW0 A;  1O8L A;  2BSP A;  2Z8G A;  1PXZ A;  2VBM A;  3GQ9 A;  1EE6 A;  4Z05 A;  1OGO X;  4OZZ A;  2UVF A;  4YZ0 A;  1O8M A;  1BN8 A;  4W8R A;  2PYH A;  2EWE A;  4W8T A;  4XN3 A;  1JRG A;  4YZQ A;  3EQO A;  1O8J A;  1IDJ A;  4XOR A;  2UVE A;  4U49 A;  2VBK A;  4PMH A;  4YEL A;  2QXZ A;  4OZY A;  4Z03 A;  2NTB A;  1NHC A;  4OJ5 A;  1OFM A;  3EQN A;  2O17 A;  2NTQ A;  1DBG A;  1VBL A;  2PYG A;  4AVZ A;  1O8I A;  1KCC A;  1QCX A;  4XON A;  1X0C A;  4XLF A;  1IDK A;  1AIR A;  4XM3 A;  1O8H A;  4Z06 A;  1O8E A;  2NST A;  4XN0 A;  3VSU A;  1OGM X;  2X6X A;  1GQ8 A;  4XR6 A;  2QX3 A;  2IQ7 A;  3WWG A;  4XQF A;  4W8Q A;  4I84 A;  1RWR A;  3ZSC A;  2O0V A;  2NT6 A;  4NK8 A;  1KTW A;  1H80 A;  4XLH A;  1BHE A;  1K5C A; 
#chains in the Genus database with same CATH topology
 2YUH A;  1LM1 A;  2VJJ A;  1O88 A;  3GQA A;  3RIQ A;  3T9G A;  3VMW A;  2NSP A;  1OFL A;  4EW9 A;  1QQ1 A;  4KH3 A;  4C2L A;  2INU A;  1QA2 A;  2QY1 A;  2XT2 A;  4NK6 A;  4XKV A;  4XLE A;  2QYU A;  2VFQ A;  1JTA A;  5C1E A;  3VST A;  1EA0 A;  3ML3 A;  4YZA A;  3SUC A;  2X3H A;  2QZA A;  4JRA C;  1QRB A;  4V02 C;  3KRG A;  1IB4 A;  4U4B A;  4XLC A;  3LYC A;  4OJO A;  3ZPP A;  2W7Z A;  4W8S A;  2BM7 A;  4YFO A;  5AMV A;  3SY2 A;  5C1C A;  4XL9 A;  1CZF A;  1QJV A;  2BM5 A;  2XTW A;  4XOT A;  2X6Y A;  2NZM A;  3GQ8 A;  3TH0 A;  1TYX A;  3AK5 A;  1XG2 A;  4XNF A;  4URR A;  1RMG A;  2INV A;  1O8K A;  1HG8 A;  1LLW A;  4YEJ A;  3SQV A;  2XTY A;  4YCQ A;  2V5I A;  1KCD A;  2VFP A;  2VFO A;  1IA5 A;  4YZX A;  3LMW A;  2IOU G;  1WMR A;  4MR0 A;  2BM4 A;  1RU4 A;  2NT9 A;  3B90 A;  4XOP A;  3B8Y A;  4OJL A;  4OJ6 A;  1OOC A;  1O8F A;  3GQ7 A;  4XLH A;  2O1D A;  3GRH A;  2VBE A;  3N6Z A;  5DNS A;  3PSZ A;  1K8F A;  4MXN A;  1DBO A;  1KQ5 A;  2VJI A;  3B4N A;  2X6W A;  4XLA A;  2O0W A;  2O04 A;  2NTP A;  2X85 A;  3JUR A;  3VMV A;  2G0Y A;  2PEC A;  1PE9 A;  2BX6 A;  4HWV A;  4XMY A;  4XKW A;  1TYU A;  4YC5 A;  1O8D A;  2ODL A;  1PLU A;  1O8G A;  2XT4 A;  4OJP A;  1QRC A;  1L1I A;  3FY3 A;  3JX8 A;  3VSV A;  3UW0 A;  1O8L A;  2BSP A;  2Z8G A;  1PXZ A;  2VBM A;  3GQ9 A;  1EE6 A;  4Z05 A;  1OGO X;  2VFM A;  2UVF A;  4OZZ A;  4YZ0 A;  3PET A;  1O8M A;  1BN8 A;  4W8R A;  2PYH A;  2XC1 A;  2EWE A;  4W8T A;  4XN3 A;  3BH6 B;  1HF2 A;  1JRG A;  3EQO A;  4YZQ A;  1O8J A;  3PSS A;  1IDJ A;  4XOR A;  1LLZ A;  2UVE A;  4U49 A;  1CLW A;  2VBK A;  1EZG A;  1TYW A;  4PMH A;  4YEL A;  2QXZ A;  4OZY A;  4Z03 A;  3LJY A;  2NTB A;  1NHC A;  4OJ5 A;  1K4Z A;  1OFM A;  3EQN A;  2NTQ A;  2O17 A;  3SZE A;  1WXR A;  1DBG A;  1TSP A;  1VBL A;  2VFN A;  2PYG A;  4AVZ A;  1OFE A;  2J8I A;  4OM9 A;  1O8I A;  1QA3 A;  1QA1 A;  1TYV A;  1KCC A;  5JLV C;  1QCX A;  3H09 A;  4XON A;  5JMC B;  1X0C A;  4XLF A;  1DAB A;  3NAW A;  1IDK A;  4YDT A;  1AIR A;  3P4G A;  4XM3 A;  1O8H A;  4Z06 A;  1O8E A;  2NST A;  4XN0 A;  3VSU A;  4YEI A;  1OGM X;  2X6X A;  3BH7 B;  1GQ8 A;  2O6W A;  4XR6 A;  2QX3 A;  3SYJ A;  2IQ7 A;  3WWG A;  3DU1 X;  4XQF A;  1OFD A;  2BM6 A;  4W8Q A;  4I84 A;  1RWR A;  2B0R A;  4OPW A;  2O0V A;  3ZSC A;  2NT6 A;  4NK8 A;  2F3L A;  2XTX A;  3NB2 A;  3N90 A;  1KTW A;  1H80 A;  2J8K A;  1BHE A;  1K5C A; 
#chains in the Genus database with same CATH homology
 2VJJ A;  1O88 A;  3GQA A;  3T9G A;  3VMW A;  2NSP A;  1OFL A;  4EW9 A;  4C2L A;  2INU A;  2QY1 A;  4NK6 A;  4XKV A;  4XLE A;  1JTA A;  5C1E A;  3VST A;  4YZA A;  3SUC A;  2X3H A;  1IB4 A;  3KRG A;  4U4B A;  4XLC A;  4OJO A;  3ZPP A;  4W8S A;  5AMV A;  5C1C A;  4XL9 A;  1CZF A;  1QJV A;  4XOT A;  2X6Y A;  2NZM A;  3GQ8 A;  1XG2 A;  4XNF A;  4URR A;  1RMG A;  2INV A;  1O8K A;  1HG8 A;  4YEJ A;  1KCD A;  1IA5 A;  4YZX A;  3LMW A;  1WMR A;  4MR0 A;  1RU4 A;  2NT9 A;  3B90 A;  4XOP A;  3B8Y A;  4OJL A;  4OJ6 A;  1OOC A;  1O8F A;  3GQ7 A;  2O1D A;  3GRH A;  2VBE A;  4MXN A;  1DBO A;  2VJI A;  3B4N A;  2X6W A;  4XLA A;  2O0W A;  2O04 A;  2NTP A;  2X85 A;  3JUR A;  3VMV A;  2PEC A;  1PE9 A;  4HWV A;  4XMY A;  4XKW A;  1O8D A;  2ODL A;  1PLU A;  1O8G A;  4OJP A;  3FY3 A;  3VSV A;  3UW0 A;  1O8L A;  2BSP A;  2Z8G A;  1PXZ A;  2VBM A;  3GQ9 A;  1EE6 A;  4Z05 A;  1OGO X;  4OZZ A;  2UVF A;  4YZ0 A;  1O8M A;  1BN8 A;  4W8R A;  2PYH A;  2EWE A;  4W8T A;  4XN3 A;  1JRG A;  4YZQ A;  3EQO A;  1O8J A;  1IDJ A;  4XOR A;  2UVE A;  4U49 A;  2VBK A;  4PMH A;  4YEL A;  2QXZ A;  4OZY A;  4Z03 A;  2NTB A;  1NHC A;  4OJ5 A;  1OFM A;  3EQN A;  2O17 A;  2NTQ A;  1DBG A;  1VBL A;  2PYG A;  4AVZ A;  1O8I A;  1KCC A;  1QCX A;  4XON A;  1X0C A;  4XLF A;  1IDK A;  1AIR A;  4XM3 A;  1O8H A;  4Z06 A;  1O8E A;  2NST A;  4XN0 A;  3VSU A;  1OGM X;  2X6X A;  1GQ8 A;  4XR6 A;  2QX3 A;  2IQ7 A;  3WWG A;  4XQF A;  4W8Q A;  4I84 A;  1RWR A;  3ZSC A;  2O0V A;  2NT6 A;  4NK8 A;  1KTW A;  1H80 A;  4XLH A;  1BHE A;  1K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...