1XG2A

Crystal structure of the complex between pectin methylesterase and its inhibitor protein
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
317
structure length
317
Chain Sequence
IIANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVASNKMNLMIVGDGMYATTITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTDPNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKEYSRTVVMESYLGGLINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAKLIQGGSWLRSTGVAYVDGLYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Interaction between Pectin Methylesterase and a Specific Inhibitor Protein
pubmed doi rcsb
source organism Actinidia chinensis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pectinesterase 1
total genus 111
structure length 317
sequence length 317
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1xg2A00
1EE6A 1X0CA 2VBMA 2O0VA 3ZPPA 2X6YA 2ODLA 3KRGA 4MXNA 4XNFA 1O8DA 4OJ6A 3GQAA 3VMWA 1K5CA 4XQFA 5AMVA 1CZFA 2NSTA 1XG2A 2QX3A 2NT9A 2O1DA 4MR0A 1WMRA 4XKWA 4YZAA 1O8MA 2NTQA 1JRGA 2UVEA 3GQ7A 4Z06A 3WWGA 4W8TA 4I84A 3B90A 2PECA 2X85A 4YZXA 2NSPA 1OGMX 1GQ8A 4W8RA 2NTBA 3GQ8A 4OZZA 3B4NA 1JTAA 4XONA 1BN8A 4Z03A 2NT6A 4XOTA 2VJJA 4U4BA 4C2LA 4XR6A 3VSUA 4XN0A 1BHEA 2Z8GA 4PMHA 2X3HA 4EW9A 2BSPA 4OJPA 1KTWA 1RWRA 4URRA 3VMVA 1DBOA 1O8EA 3VSVA 2QY1A 4XM3A 1QJVA 1RU4A 3ZSCA 2PYGA 2X6XA 4XKVA 4HWVA 1KCCA 1O8JA 4W8QA 1O8GA 4NK8A 2IQ7A 1OFMA 4OJ5A 4YEJA 4YZ0A 4XLEA 1PLUA 4XOPA 3GQ9A 3JURA 4W8SA 1IB4A 1HG8A 3T9GA 1DBGA 2O0WA 1RMGA 3SUCA 3EQNA 3B8YA 1IA5A 4NK6A 1O8LA 3LMWA 2QXZA 3EQOA 1PXZA 2VJIA 4OJLA 1O8FA 4XLFA 1H80A 4XLAA 4AVZA 5C1CA 2INUA 1OFLA 2X6WA 4XORA 1NHCA 2VBKA 1IDJA 1VBLA 3VSTA 1O8HA 5C1EA 4OJOA 2VBEA 4XMYA 2NZMA 2EWEA 4XLHA 3FY3A 2O04A 4YELA 1IDKA 1PE9A 1OOCA 4Z05A 1OGOX 1AIRA 4OZYA 2O17A 1O8KA 3GRHA 4U49A 4XLCA 2PYHA 4YZQA 1KCDA 2NTPA 1O88A 4XN3A 1O8IA 2UVFA 3UW0A 1QCXA 2INVA 4XL9A
chains in the Genus database with same CATH superfamily
1EE6A 1X0CA 2VBMA 2O0VA 2G0YA 3N90A 2X6YA 2ODLA 3KRGA 3ZPPA 2BM6A 2XT2A 4MXNA 1O8DA 1TYUA 4OJ6A 4XNFA 3GQAA 4YEIA 2F3LA 2O6WA 3VMWA 5JLVC 3ML3A 1K5CA 4XQFA 5AMVA 2QZAA 1EA0A 2W7ZA 1CZFA 2NSTA 4YDTA 1XG2A 2QX3A 2NT9A 2O1DA 4MR0A 1WMRA 4XKWA 4YZAA 1O8MA 2NTQA 1K4ZA 3SY2A 3AK5A 2VFMA 1JRGA 3PSSA 2VFPA 2UVEA 3GQ7A 4Z06A 1QA3A 4KH3A 1QRCA 3WWGA 4W8TA 4I84A 2PECA 3B90A 4V02C 2X85A 1EZGA 4YZXA 2NSPA 1OGMX 3SYJA 1QA1A 2IOUG 1LLZA 1GQ8A 4W8RA 2NTBA 1TYWA 3GQ8A 3SQVA 4OZZA 3B4NA 1JTAA 4XONA 1BN8A 4Z03A 3JX8A 2V5IA 2NT6A 3BH7B 4XOTA 2VJJA 4U4BA 2YUHA 3NB2A 4C2LA 2XTXA 4XR6A 3VSUA 4XN0A 1BHEA 2Z8GA 4PMHA 2X3HA 4EW9A 1OFDA 2BSPA 4OPWA 1KTWA 1RWRA 1QQ1A 1KQ5A 4OJPA 4URRA 3VMVA 3P4GA 1DBOA 1O8EA 3VSVA 2QY1A 4XM3A 1QJVA 1RU4A 3ZSCA 2PYGA 2X6XA 4XKVA 5JMCB 4HWVA 4YFOA 1KCCA 1O8JA 2XC1A 4W8QA 1O8GA 4NK8A 2IQ7A 1OFMA 4OJ5A 4YEJA 4YZ0A 2VFOA 4YCQA 4XLEA 1PLUA 4XOPA 3GQ9A 3JURA 4W8SA 3LJYA 1IB4A 1HG8A 3T9GA 1DBGA 2O0WA 1TSPA 1RMGA 2XTWA 3DU1X 3EQNA 3B8YA 3SUCA 1IA5A 2B0RA 4NK6A 1LLWA 1LM1A 1O8LA 3LMWA 2QXZA 1WXRA 1HF2A 3EQOA 1PXZA 2BM7A 2VJIA 3LYCA 1O8FA 3PETA 4OJLA 4XLFA 1L1IA 1H80A 4XLAA 3PSZA 4OM9A 4AVZA 3H09A 5C1CA 1QA2A 2INUA 1OFLA 2X6WA 4XORA 3SZEA 2QYUA 1NHCA 2VBKA 1IDJA 2BM4A 2XTYA 1VBLA 3VSTA 1O8HA 2BX6A 5C1EA 1OFEA 2XT4A 4OJOA 2VBEA 3BH6B 4XMYA 2NZMA 1QRBA 2EWEA 4XLHA 3FY3A 2O04A 4YELA 2J8IA 1IDKA 1PE9A 3N6ZA 1OOCA 2J8KA 1OGOX 1AIRA 4OZYA 4Z05A 2O17A 1O8KA 3GRHA 4U49A 4XLCA 3NAWA 2PYHA 4YC5A 3RIQA 1DABA 4JRAC 4YZQA 2BM5A 1KCDA 2NTPA 1O88A 4XN3A 1O8IA 2VFNA 1TYVA 5DNSA 2UVFA 1TYXA 3UW0A 1QCXA 2INVA 1K8FA 3TH0A 1CLWA 4XL9A 2VFQA
chains in the Genus database with same CATH topology
1EE6A 1X0CA 2VBMA 2O0VA 3ZPPA 2X6YA 2ODLA 3KRGA 4MXNA 4XNFA 1O8DA 4OJ6A 3GQAA 3VMWA 1K5CA 4XQFA 5AMVA 1CZFA 2NSTA 1XG2A 2QX3A 2NT9A 2O1DA 4MR0A 1WMRA 4XKWA 4YZAA 1O8MA 2NTQA 1JRGA 2UVEA 3GQ7A 4Z06A 3WWGA 4W8TA 4I84A 3B90A 2PECA 2X85A 4YZXA 2NSPA 1OGMX 1GQ8A 4W8RA 2NTBA 3GQ8A 4OZZA 3B4NA 1JTAA 4XONA 1BN8A 4Z03A 2NT6A 4XOTA 2VJJA 4U4BA 4C2LA 4XR6A 3VSUA 4XN0A 1BHEA 2Z8GA 4PMHA 2X3HA 4EW9A 2BSPA 4OJPA 1KTWA 1RWRA 4URRA 3VMVA 1DBOA 1O8EA 3VSVA 2QY1A 4XM3A 1QJVA 1RU4A 3ZSCA 2PYGA 2X6XA 4XKVA 4HWVA 1KCCA 1O8JA 4W8QA 1O8GA 4NK8A 2IQ7A 1OFMA 4OJ5A 4YEJA 4YZ0A 4XLEA 1PLUA 4XOPA 3GQ9A 3JURA 4W8SA 1IB4A 1HG8A 3T9GA 1DBGA 2O0WA 1RMGA 3SUCA 3EQNA 3B8YA 1IA5A 4NK6A 1O8LA 3LMWA 2QXZA 3EQOA 1PXZA 2VJIA 4OJLA 1O8FA 4XLFA 1H80A 4XLAA 4AVZA 5C1CA 2INUA 1OFLA 2X6WA 4XORA 1NHCA 2VBKA 1IDJA 1VBLA 3VSTA 1O8HA 5C1EA 4OJOA 2VBEA 4XMYA 2NZMA 2EWEA 4XLHA 3FY3A 2O04A 4YELA 1IDKA 1PE9A 1OOCA 4Z05A 1OGOX 1AIRA 4OZYA 2O17A 1O8KA 3GRHA 4U49A 4XLCA 2PYHA 4YZQA 1KCDA 2NTPA 1O88A 4XN3A 1O8IA 2UVFA 3UW0A 1QCXA 2INVA 4XL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EE6 A;  1X0C A;  2VBM A;  2O0V A;  3ZPP A;  2X6Y A;  2ODL A;  3KRG A;  4MXN A;  4XNF A;  1O8D A;  4OJ6 A;  3GQA A;  3VMW A;  1K5C A;  4XQF A;  5AMV A;  1CZF A;  2NST A;  1XG2 A;  2QX3 A;  2NT9 A;  2O1D A;  4MR0 A;  1WMR A;  4XKW A;  4YZA A;  1O8M A;  2NTQ A;  1JRG A;  2UVE A;  3GQ7 A;  4Z06 A;  3WWG A;  4W8T A;  4I84 A;  3B90 A;  2PEC A;  2X85 A;  4YZX A;  2NSP A;  1OGM X;  1GQ8 A;  4W8R A;  2NTB A;  3GQ8 A;  4OZZ A;  3B4N A;  1JTA A;  4XON A;  1BN8 A;  4Z03 A;  2NT6 A;  4XOT A;  2VJJ A;  4U4B A;  4C2L A;  4XR6 A;  3VSU A;  4XN0 A;  1BHE A;  2Z8G A;  4PMH A;  2X3H A;  4EW9 A;  2BSP A;  4OJP A;  1KTW A;  1RWR A;  4URR A;  3VMV A;  1DBO A;  1O8E A;  3VSV A;  2QY1 A;  4XM3 A;  1QJV A;  1RU4 A;  3ZSC A;  2PYG A;  2X6X A;  4XKV A;  4HWV A;  1KCC A;  1O8J A;  4W8Q A;  1O8G A;  4NK8 A;  2IQ7 A;  1OFM A;  4OJ5 A;  4YEJ A;  4YZ0 A;  4XLE A;  1PLU A;  4XOP A;  3GQ9 A;  3JUR A;  4W8S A;  1IB4 A;  1HG8 A;  3T9G A;  1DBG A;  2O0W A;  1RMG A;  3SUC A;  3EQN A;  3B8Y A;  1IA5 A;  4NK6 A;  1O8L A;  3LMW A;  2QXZ A;  3EQO A;  1PXZ A;  2VJI A;  4OJL A;  1O8F A;  4XLF A;  1H80 A;  4XLA A;  4AVZ A;  5C1C A;  2INU A;  1OFL A;  2X6W A;  4XOR A;  1NHC A;  2VBK A;  1IDJ A;  1VBL A;  3VST A;  1O8H A;  5C1E A;  4OJO A;  2VBE A;  4XMY A;  2NZM A;  2EWE A;  4XLH A;  3FY3 A;  2O04 A;  4YEL A;  1IDK A;  1PE9 A;  1OOC A;  4Z05 A;  1OGO X;  1AIR A;  4OZY A;  2O17 A;  1O8K A;  3GRH A;  4U49 A;  4XLC A;  2PYH A;  4YZQ A;  1KCD A;  2NTP A;  1O88 A;  4XN3 A;  1O8I A;  2UVF A;  3UW0 A;  1QCX A;  2INV A;  4XL9 A; 
#chains in the Genus database with same CATH topology
 1EE6 A;  1X0C A;  2VBM A;  2O0V A;  2G0Y A;  3N90 A;  2X6Y A;  2ODL A;  3KRG A;  3ZPP A;  2BM6 A;  2XT2 A;  4MXN A;  1O8D A;  1TYU A;  4OJ6 A;  4XNF A;  3GQA A;  4YEI A;  2F3L A;  2O6W A;  3VMW A;  5JLV C;  3ML3 A;  1K5C A;  4XQF A;  5AMV A;  2QZA A;  1EA0 A;  2W7Z A;  1CZF A;  2NST A;  4YDT A;  1XG2 A;  2QX3 A;  2NT9 A;  2O1D A;  4MR0 A;  1WMR A;  4XKW A;  4YZA A;  1O8M A;  2NTQ A;  1K4Z A;  3SY2 A;  3AK5 A;  2VFM A;  1JRG A;  3PSS A;  2VFP A;  2UVE A;  3GQ7 A;  4Z06 A;  1QA3 A;  4KH3 A;  1QRC A;  3WWG A;  4W8T A;  4I84 A;  2PEC A;  3B90 A;  4V02 C;  2X85 A;  1EZG A;  4YZX A;  2NSP A;  1OGM X;  3SYJ A;  1QA1 A;  2IOU G;  1LLZ A;  1GQ8 A;  4W8R A;  2NTB A;  1TYW A;  3GQ8 A;  3SQV A;  4OZZ A;  3B4N A;  1JTA A;  4XON A;  1BN8 A;  4Z03 A;  3JX8 A;  2V5I A;  2NT6 A;  3BH7 B;  4XOT A;  2VJJ A;  4U4B A;  2YUH A;  3NB2 A;  4C2L A;  2XTX A;  4XR6 A;  3VSU A;  4XN0 A;  1BHE A;  2Z8G A;  4PMH A;  2X3H A;  4EW9 A;  1OFD A;  2BSP A;  4OPW A;  1KTW A;  1RWR A;  1QQ1 A;  1KQ5 A;  4OJP A;  4URR A;  3VMV A;  3P4G A;  1DBO A;  1O8E A;  3VSV A;  2QY1 A;  4XM3 A;  1QJV A;  1RU4 A;  3ZSC A;  2PYG A;  2X6X A;  4XKV A;  5JMC B;  4HWV A;  4YFO A;  1KCC A;  1O8J A;  2XC1 A;  4W8Q A;  1O8G A;  4NK8 A;  2IQ7 A;  1OFM A;  4OJ5 A;  4YEJ A;  4YZ0 A;  2VFO A;  4YCQ A;  4XLE A;  1PLU A;  4XOP A;  3GQ9 A;  3JUR A;  4W8S A;  3LJY A;  1IB4 A;  1HG8 A;  3T9G A;  1DBG A;  2O0W A;  1TSP A;  1RMG A;  2XTW A;  3DU1 X;  3EQN A;  3B8Y A;  3SUC A;  1IA5 A;  2B0R A;  4NK6 A;  1LLW A;  1LM1 A;  1O8L A;  3LMW A;  2QXZ A;  1WXR A;  1HF2 A;  3EQO A;  1PXZ A;  2BM7 A;  2VJI A;  3LYC A;  1O8F A;  3PET A;  4OJL A;  4XLF A;  1L1I A;  1H80 A;  4XLA A;  3PSZ A;  4OM9 A;  4AVZ A;  3H09 A;  5C1C A;  1QA2 A;  2INU A;  1OFL A;  2X6W A;  4XOR A;  3SZE A;  2QYU A;  1NHC A;  2VBK A;  1IDJ A;  2BM4 A;  2XTY A;  1VBL A;  3VST A;  1O8H A;  2BX6 A;  5C1E A;  1OFE A;  2XT4 A;  4OJO A;  2VBE A;  3BH6 B;  4XMY A;  2NZM A;  1QRB A;  2EWE A;  4XLH A;  3FY3 A;  2O04 A;  4YEL A;  2J8I A;  1IDK A;  1PE9 A;  3N6Z A;  1OOC A;  2J8K A;  1OGO X;  1AIR A;  4OZY A;  4Z05 A;  2O17 A;  1O8K A;  3GRH A;  4U49 A;  4XLC A;  3NAW A;  2PYH A;  4YC5 A;  3RIQ A;  1DAB A;  4JRA C;  4YZQ A;  2BM5 A;  1KCD A;  2NTP A;  1O88 A;  4XN3 A;  1O8I A;  2VFN A;  1TYV A;  5DNS A;  2UVF A;  1TYX A;  3UW0 A;  1QCX A;  2INV A;  1K8F A;  3TH0 A;  1CLW A;  4XL9 A;  2VFQ A; 
#chains in the Genus database with same CATH homology
 1EE6 A;  1X0C A;  2VBM A;  2O0V A;  3ZPP A;  2X6Y A;  2ODL A;  3KRG A;  4MXN A;  4XNF A;  1O8D A;  4OJ6 A;  3GQA A;  3VMW A;  1K5C A;  4XQF A;  5AMV A;  1CZF A;  2NST A;  1XG2 A;  2QX3 A;  2NT9 A;  2O1D A;  4MR0 A;  1WMR A;  4XKW A;  4YZA A;  1O8M A;  2NTQ A;  1JRG A;  2UVE A;  3GQ7 A;  4Z06 A;  3WWG A;  4W8T A;  4I84 A;  3B90 A;  2PEC A;  2X85 A;  4YZX A;  2NSP A;  1OGM X;  1GQ8 A;  4W8R A;  2NTB A;  3GQ8 A;  4OZZ A;  3B4N A;  1JTA A;  4XON A;  1BN8 A;  4Z03 A;  2NT6 A;  4XOT A;  2VJJ A;  4U4B A;  4C2L A;  4XR6 A;  3VSU A;  4XN0 A;  1BHE A;  2Z8G A;  4PMH A;  2X3H A;  4EW9 A;  2BSP A;  4OJP A;  1KTW A;  1RWR A;  4URR A;  3VMV A;  1DBO A;  1O8E A;  3VSV A;  2QY1 A;  4XM3 A;  1QJV A;  1RU4 A;  3ZSC A;  2PYG A;  2X6X A;  4XKV A;  4HWV A;  1KCC A;  1O8J A;  4W8Q A;  1O8G A;  4NK8 A;  2IQ7 A;  1OFM A;  4OJ5 A;  4YEJ A;  4YZ0 A;  4XLE A;  1PLU A;  4XOP A;  3GQ9 A;  3JUR A;  4W8S A;  1IB4 A;  1HG8 A;  3T9G A;  1DBG A;  2O0W A;  1RMG A;  3SUC A;  3EQN A;  3B8Y A;  1IA5 A;  4NK6 A;  1O8L A;  3LMW A;  2QXZ A;  3EQO A;  1PXZ A;  2VJI A;  4OJL A;  1O8F A;  4XLF A;  1H80 A;  4XLA A;  4AVZ A;  5C1C A;  2INU A;  1OFL A;  2X6W A;  4XOR A;  1NHC A;  2VBK A;  1IDJ A;  1VBL A;  3VST A;  1O8H A;  5C1E A;  4OJO A;  2VBE A;  4XMY A;  2NZM A;  2EWE A;  4XLH A;  3FY3 A;  2O04 A;  4YEL A;  1IDK A;  1PE9 A;  1OOC A;  4Z05 A;  1OGO X;  1AIR A;  4OZY A;  2O17 A;  1O8K A;  3GRH A;  4U49 A;  4XLC A;  2PYH A;  4YZQ A;  1KCD A;  2NTP A;  1O88 A;  4XN3 A;  1O8I A;  2UVF A;  3UW0 A;  1QCX A;  2INV A;  4XL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...