1XG8A

Crystal structure of protein of unknown function sa0789 from staphylococcus aureus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
108
Chain Sequence
ANLYFQSNAVVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFKYTYIDITKDLTDHDLQFIERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKLVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SA0798
publication title The 2.1A crystal structure of hypothetical protein SA0798 from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus n315
molecule tags Structural genomics, unknown function
total genus 28
structure length 108
sequence length 111
ec nomenclature
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07315 DUF1462 Protein of unknown function (DUF1462)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.30 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Hypothetical protein sa0798. 1xg8A00
1XG8A
chains in the Genus database with same CATH superfamily
22GSA 1GSYA 4TRXA 2JZRA 4BWSA 4BL7A 3FYGA 2K9FA 4WBJA 2DKIA 1SENA 3LFLA 2HZFA 1ZMAA 3QMXA 4WBRD 5CO3A 2PGTA 5IMCA 1USBA 2K18A 3L4NA 1IYHA 2PN8A 2JACA 2H30A 1WWJA 3GKMA 2WGRA 1FOVA 1O8WA 4KF9A 4HZ2A 1ML6A 2HI7A 3UL3A 4XS4B 4FYBA 12GSA 2R0CA 2N5FA 1GSQA 4NV2A 3UMAA 4EXJA 4IELA 3O6TA 1AQVA 4POLA 1GSEA 2L57A 1V58A 3GL5A 2PWJA 13GSA 3GH6A 4WETA 4MZWA 4EKZA 1X5DA 3KD0A 3SWLA 2V41A 5EY6A 3QCPA 4N10A 3N9JA 3IA1A 1BAYA 3M9JA 4YAPA 3ZMLA 1YEXA 3H79A 4HU7A 4F0BA 3NZNA 2X4AA 3TJJA 3RDWA 5F07A 2VL2A 4XTSA 1NW2A 2P0GA 2WCIA 1ILOA 2LS5A 2AYTA 4HSCX 4Z2RA 2C8UA 4FH8A 4ZBDA 1ON4A 1WJKA 3LGCA 4HJ2A 3F4RA 4LLRA 1BQ7A 3CTGA 3FR3A 4EVMA 5J4UA 4PQHA 3GH9A 1E2YA 3IXRA 3HXSA 1XOBA 3ERGA 5GZZB 3KZQA 3KTBA 3VI7A 2E0QA 3US3A 1PL1A 2DJ1A 3BCIA 4IP1A 3MNGA 3HJOA 1DE1A 2OA7A 1SK2A 3LYKA 3GIXA 3G7JA 1M3IA 3VWXA 2A2PA 2L6CA 4PUFC 5ECQB 1TK8B 3G7YA 5DVBA 2QGVA 4TOPA 1A23A 3RHBA 1W89A 4EDZA 4ZBBA 1GNWA 2MMNA 2IMDA 4NMUA 2YCDA 2HZEB 1YJ6A 4CW9A 5LCZA 3A5WA 4WKWA 3HZ8A 4IVFA 4ZXGA 3EYTA 3TKQA 2C4JA 3VWUA 3CYNA 4YQMA 5FT3A 2CX3A 4OCFA 4OFTA 2MYGA 5A5KA 3GURA 3TRXA 1PFOA 2OACA 5D73A 2H66A 4G0KA 1DBYA 3ME8A 1JHBA 2RM6A 4BVXA 1NSWA 2A4VA 5D96A 4NWYA 4PQ1A 1SKWB 1J9BA 1DSBA 3A3TA 2LSTA 4BPYA 1KNGA 1AAZA 4RI7A 2DIYA 2H76A 3F3QA 2EIRA 3RHCA 4ZL9A 3TRQA 1HYUA 4G2EA 1Y6EA 2CVBA 1QFNA 4X0XA 2P31A 4EIQA 3EPTA 3G9BA 4KDXA 5KOWA 4K1FA 1R4WA 4I6XA 2YZUA 2H1BA 3BBYA 3EMXA 2LUSA 4IKHA 5ECKB 4AJ6A 5IMFA 3WT1A 1EWXA 5KN3A 2LNSA 4TN8A 3IK9A 5CNWA 2GZZA 4KNDA 3KEBA 2NVLA 1MD3A 4ECIA 5DCGA 2VD0A 4KB3A 1QK8A 3RAZA 2B5YA 4DSQA 2V6OA 2GSTA 3GA4A 2HRFA 3WD6A 4KH7A 4ILFA 4MA9A 3H4KA 1TU8A 1YF1A 3GX8A 1M9BA 2G0FA 2LRCA 4K5SA 3KTLA 1RW1A 1YKCA 4O5UA 3UOMA 2H0HA 1A2MA 2B7KA 1EGRA 2VCTA 2H1DA 2HT9A 1SL2B 1AC1A 1UA5A 1ZYPA 1KTEA 2X8GA 4KAEA 1SYXA 4Z2UA 3QAGA 1AQWA 4MF7A 3BJ5A 5LD0A 2AAWA 2MBSA 3VURA 4DSRA 3F8UA 3HZ4A 1WOUA 1F6MC 1GTIA 4J56E 1R7HA 5D93A 1SKRB 2V1MA 2ZNMA 1Z5YE 4RQRA 4FIWA 2HRKA 4Z7XA 2GZPA 4K7OA 3QFBC 1TRUA 1V57A 2H0GA 1T7PB 3TJBA 2WRTA 1HNAA 2GQKA 5ID2B 4K7NA 4WR5A 5IIZA 3W6GA 2JADA 3DIEA 4K9ZA 2LJAA 1TXXA 3FMWA 2OE3A 3ERFA 3KM6A 1SD8A 4X4JA 4TKYA 4JE1A 4KGIA 3L9UA 2MBTA 2P5RA 1TKDB 4L8EA 2X64A 1XVWA 1WE0A 4D73A 2R4VA 4HEA2 3SBCA 4Q5QA 5IOWA 3IPZA 1O73A 1MDIA 1FHEA 2DJJA 5CRHA 2LRTA 1GNEA 1SJ6A 5J9CA 3RPPA 2M46A 5ELAA 4ID0A 3P8WA 5HR0A 1OE8A 3BCKA 1A0RP 2PU9C 1PA3A 2IL3A 5G1LA 1U6TA 2M72A 2A2SA 14GSA 4G0LA 2YWMA 2OE0A 2XBIA 1QGVA 4TR1A 1MDKA 4TR0A 1GLPA 1FAAA 4XHMA 1RK4A 2OKAA 1EEJA 4I2TA 2C0FA 2QKEA 3GKNA 5ECPB 4EDYA 3PGTA 3U5RE 5EL8A 1PN0A 4POKA 3PPUA 3ISOA 2FA8A 2CA8A 2IMFA 2C3QA 4IN0A 3FY7A 2H6ZA 4QQ7A 3GL3A 3FR6A 4K2XA 5A4VA 2VD1A 4RQXA 1EP8A 3IAM2 1SYRA 3DYRA 1PN9A 4LL1B 5ABRA 2R6KA 3BOAA 1Z3EA 3O76A 4KCEA 1X9MB 5ECOB 4FO5A 3J7Yk 4MJCA 1K0BA 3ZRDA 1PQNA 2LNTA 3WYWA 2AV4A 3TJKA 3IHQA 5IMAA 4O5QA 1JZDA 1OC8A 2LJRA 3VPQA 1TTZA 1QXHA 5KN0A 3GUSA 3J7Yb 1ZYQB 2DIZA 5KN1A 3GNJA 1TI1A 3WGXA 4TXOB 4WF5A 3I43A 1U87A 3N5OA 2CQ9A 1HQOA 4BIKA 3VPTA 3QD9A 5CP1A 3PINA 2XC2A 2VCQA 4G0IA 5IM9A 4OCEA 3DRNA 3KP8A 1TK0B 4GTUA 3ZMKA 5FHIA 3HVNA 3DVWA 3F4SA 1SL1B 4TVEA 1B9YC 5CRDA 3E3EA 6GSVA 5HFIA 2GS3A 3KIJA 5A4UA 1NHYA 3LW9A 3D21A 2EIOA 5ENUA 2CVKA 4ECBA 2C3NA 2YANA 2H6XA 3ZTLA 3CXGA 2FNOA 5FWGA 5D8IA 1BG5A 2VL3A 2PVOC 4N0ZA 2H1GA 4MK3A 3UJ1A 2NBSA 1GH2A 2C0EA 2EC4A 4G9HA 1AXDA 4PURA 7GSSA 5D9TA 1O6JA 1R5AA 1B9XC 2YP6A 3IDVA 1ABAA 2H73A 4OO5A 2KLXA 4MZBA 4YQUA 5D9VA 1GUHA 2AJQB 3K8NA 2DBCA 2GSRA 3HJPA 2H6YA 4E8HA 2DKHA 2I1UA 4L5LA 2WDUA 5GSSA 2ZCTA 3EC3A 2OBKA 1JZRA 2KP1A 5B7CA 2IFQB 2HYXA 2RIIA 3IC4A 2FLSA 4NHWA 3HVSA 3HVVA 1G7OA 3MWHA 1XWGA 4K6XA 3TRPA 2EIQA 2LRNA 5DJMA 3ZLPA 2AHEA 4GSNA 1K0CA 2M80A 2HSMA 2GLRA 3FEUA 4P3YB 1S3RA 3FRCA 2QC7A 4ZB9A 6GSUA 3WGEA 4V2LA 4HU9A 5DDLA 3M9KA 3KCMA 1THXA 1OKDA 3DXBA 5CRGA 1GWCA 2F3MA 1B48A 3TKSC 1B4QA 4PXOA 3I9V2 4J2FA 3D0ZA 1VF2A 5GAND 1QUWA 1TW9A 4DVCA 3CRUA 5GSTA 1TRSA 2O85A 4GLTA 3FHKA 1K3LA 1XWCA 1GUKA 1NHOA 3TKPA 2J9HA 1BYEA 2VLVA 1UC7A 5B8AA 1TDIA 2FD3A 3Q19A 2LV3A 2ON7A 2A2RA 1ZL9A 1KEBA 3C1RA 1Q98A 2HNLA 2DSAA 1A0FA 3UBKA 4QL9A 3LSZA 4HUAA 1SKSB 3KMOA 1XWBA 4GRFA 4IHUA 4TR3A 1X9WB 4MLYA 2B1KA 4ZB6A 1CQHA 2DMLA 4TXVA 1XWAA 3ZFLA 11GSA 2YV7A 4ZILA 1SK1A 4F82A 3CSIA 2MMZA 5ECSA 10GSA 3MDKA 4ACSA 5DCHA 2DMMA 2REMA 1YEPA 3JCML 3MAKA 5B6NA 1YDKA 3LXZA 5DJLA 4GXZA 5GAPD 4IGJA 4BA7A 5IO0A 4PNFA 1O8XA 2VCWA 1WIKA 4BVYA 5J41A 3HJMA 1K3OA 1T4ZA 3H93A 4IQAA 2DJ3A 1M9AA 3M0FA 2FA4A 2RUEA 5F05A 3GTUA 2D2ZA 1PD21 4L0WA 2E7PA 1XG8A 1GTUA 2WFCA 2QA1A 5AIXA 2GVPA 3GFKA 1BX9A 5AGYA 1AIUA 3ZVJA 1XIYA 2PERA 3ZZXA 2N5BA 1SK0A 2V2GA 2VO4A 2PPTA 3FZ4A 3EINA 2JSYA 1A8YA 3EU3A 2VL9A 3CTFA 1W4VA 4CDOA 5KN2A 1YQ1A 2YWIA 2WS2A 3IRAA 2CX4A 3TKSA 2KUCA 4K5RA 1GSFA 4O5RA 3LJRA 5H5RA 1I5GA 5B8BA 1ZYEA 1A2JA 3DKSA 2YJ7A 3I69A 2ES7A 4AJ7A 4BL7B 1X5EA 3NIVA 1XW6A 1OE7A 2C1YA 2WULA 3DMLA 2WJUA 3C73A 3M8NA 2F8FA 2HSHA 5IPGA 2O7KA 3GKXA 2O87A 2HRAA 2H74A 5EPFA 2VAFA 3MSZA 2VCZA 2F51A 4DSSA 2BMXA 2CT6A 1SU9A 2YWNA 3HKRA 2LQQA 1HNCA 3FK8A 1F3BA 3VLNA 3E0UA 3D4MA 4MJEA 3LYPA 4Q5FA 1JFUA 5JCWA 4LMVA 1EP7A 5DALA 3V1WA 4E8EA 4EE0A 2YPMA 2I4AA 3LWAA 2AB6A 4PTSA 5G2ZA 3TOTA 1KBNA 3MIXA 3TKRA 2DJ2A 2GZYA 3UEMA 3ZIVA 4KA0A 3FW2A 3TJFA 4WR4A 5IMZA 2F9SA 1TJDA 2HFDA 3D4TA 2L59A 1V40A 3LEFA 5IMVA 2GSSA 1ACVA 3WGDA 4KSMA 1G6YA 2V32A 1HD2A 1U88A 1PKZA 4TR4A 5D9XA 4MABA 3UIWA 5G5EA 5INYA 4GQCA 2VLTA 3AY8A 4AJ8A 5C00A 5J9BA 3FZ5A 4DEJA 3EMPA 4EIPA 3M1GA 2KOKA 2R37A 3IC8A 3QR6A 1TK5B 2XPDA 3DWVA 4HI7A 1SJZA 2XHFA 1EGOA 1MTCA 1VRSD 2NTOA 1XW5A 3F0IA 4F9ZA 2E2MA 5BRTA 3QOUA 5EVOA 3HDCA 4BVYB 5CYYA 2K8SA 1A8LA 1XCCA 2FUG2 3OR5A 1VGLA 1PKWA 3KGKA 3GTUB 1H4OA 3R2QA 4G19A 1OYJA 1GUMA 1ERUA 1XOAA 2CZ3A 3C7MA 5HR3A 3GYKA 4JEDA 4BVXB 2R0GA 5D9WA 3HHVA 4YKFA 4JZQA 3TJGA 3HY2A 2V6KA 1WMJA 1EOHA 1ERVA 1AW9A 4N0VA 3C71A 1PRXA 2K8VA 5DAKA 4XS4A 5J3RA 2ALBA 2R0PA 4GCIA 3QFAC 4EC0A 5DQSA 4O32A 4JR6A 2LEGA 1I9DA 3APSA 2VCVA 3F6DA 1GULA 4K0NA 4N30A 1PGTA 3TGZA 1S3DA 2OE1A 3QAVA 5LNKe 1SD9A 2MMOA 2VM1A 4CY8A 4F2IA 4PX1A 4ISDA 1FVKA 5ECIB 1K0AA 1M3JA 5ECNB 4HOJA 2FCHA 4MPFA 4I2UA 4LL4B 3R3EA 3F6FA 4IBPA 1EZKA 1N2AA 4HJMA 4XCSA 3IHGA 2A4HA 3C1SA 1T1VA 2JSZA 4DSSB 4ECCA 1M7TA 2MZCA 1GSUA 3APOA 1EV9A 2IMIA 1XXUA 4GSSA 4OFMA 2VLUA 3TCOA 3PR8A 4MPGA 4K0GA 1T4YA 3H1NA 5DALB 5DBQA 4WXTA 4J57E 3U6VA 2JZSA 3ZIJA 3QPMA 3HYPA 4MJAA 3ZFBA 5AISA 2CAQA 5KOXA 2DC5A 5IQYA 4XS6A 3E9JB 2YV9A 3A5IA 2X8HA 1R5PA 1XPVA 2DJKA 4JR4A 2HZEA 1YF0A 3EWLA 4ML6A 1K0DA 2XPEA 2YWOA 5HQPA 1AUCA 1FW1A 1YY7A 2IIYA 4HZ4A 5H5QA 1OAZA 2QA2A 4POMA 1C72A 4IS0A 2YN1A 1M2BA 2AUVA 4IJIA 4JBBA 1Q4JA 1YZXA 4LMWA 5CAXA 2H75A 1Z7PA 2FGXA 2CVDA 4IW9A 4NXIA 1LBKA 4TW5A 4ZL8A 19GSA 2J23A 3HVXA 3ZVJD 5ECRB 1T00A 1VF4A 1K0NA 1ZZYA 4D73B 5IMDA 17GSA 2KP2A 1M99A 4XRAA 4O7HA 1PSQA 2L6DA 2WB9A 1Z6NA 2ZUPA 3LXTA 4L0UA 1J0FA 1VF1A 2H01A 1TI3A 4AGSA 1RQMA 3Q18A 4HQZA 1PL2A 4TR1B 1K0MA 3P2AA 2X49A 3IK7A 3VWWA 2I9HA 3FZAA 5IPHA 2PBJA 2OBIA 1O85A 1N8JA 3EU4A 4MF5A 3TDGA 1FG4A 4YQVA 4PGTA 4EF0A 4ZB8A 4PNGA 1OC9A 5F06A 4HDEA 2YNXA 3CQFA 5DAKB 4X1UA 3ERWA 4CHSA 4KUNA 4BWQA 1M0UA 4I97A 2FWGA 16GSA 5L71A 18GSA 2G2QA 4GSTA 5H5SA 1BJXA 2FWEA 3TB2A 2CAIA 2L4QA 4IQ1A 3UVTA 1OVNA 4FQUA 2L4CA 3KH7A 1VF3A 4PQIA 1O81A 5J5NA 1MD4A 4KW6A 4FYCA 1NM3A 3P7XA 2WZ9A 1PMTA 3UARA 3GN3A 3O3TA 3EE2A 2JZTA 4ULXA 1B4PA 3F4TA 4GQFA 4NV5A 3VK9A 5G1KA 1X0RA 1U3IA 4QL7A 1OC3A 2F8AA 3CSJA 3W8JA 2H1AA 1TOFA 1GLQA 4PUAA 5ID2A 1FOHA 3ZITA 4Z2TA 4HQSA 4JU5A 3WT2A 2UZ8A 4MMMA 4IJ3A 1A24A 2O89A 1IYIA 1GTAA 4H86A 3P90A 4LA1A 3EVIA 3KXOA 1K0OA 3L0HA 3ZREA 2VOCA 2HLSA 3FR9A 3TUEA 3F9UA 3CMIA 1B8XA 1M2DA 1Z7RA 1MEKA 3CSHA 1A2LA 1U3AA 2R3XA 3IAS2 3HA9A 3TKSE 5JCGA 4ECJA 1O7UA 2H71A 2GQLA 5C04A 2GT5A 5CREA 1G0TA 4N11A 1H75A 3KJYA 2GQMA 2H8LA 5CRWA 1EEMA 5HFGA 3D22A 2IMKA 2PUKC 1FB0A 8GSSA 5G30A 1ERTA 5E4WA 1JLVA 1MDJA 1XVQA 5ECHB 2LJKA 1UN2A 4MH2A 6GSYA 2MMAA 4NPBA 4MNNA 2QSIA 4ICYA 1GSSA 3C8EA 4X43A 1PX7A 2HSYA 3IOSA 5A4WA 1WRYA 5ELGA 2Z9SA 1WP0A 1XZOA 4ZIJA 1SL0B 4OWYA 2LQOA 3IBHA 3D6IA 2PMTA 2H70A 2B1LA 5JWOB 1F37A 4I8BA 1X9SB 3G7IA 1ZGNA 5JWQB 4L5OA 2FWHA 3L9VA 2R2JA 1QMVA 2R5GA 2PVQA 3PH9A 2NDOA 3F3RA 2FHEA 4GWRA 1PX6A 1JLWA 3VFIA 4ML1A 1OC9B 4KX4A 2BJXA 4KE3A 2TRXA 20GSA 1E6BA 2GSQA 3GKKA 4MF6A 4RI6A 3F63A 4MP4A 3M3MA 4KDUA 4TXOA 4JRRA 2XBQA 1THOA 3DGQA 3Q6OA 3I6AA 5IOXA 3HCZA 3QDNA 3L9SA 3ME7A 1SJIA 1JZOA 3HD5A 1M2AA 3ED3A 2VUPA 3GMFA 3W8SA 1GP1A 1V98A 1F2EA 2IWTA 3CRTA 1DUGA 3MYDA 3KP9A 4K7IA 1F3AA 5B6MA 2I81A 2YJHA 3GV1A 5JCUA 2OJLA 2CZ2A 2HXKA 5ECLB 4OFNA 2O8VB 1LU4A 1R26A 2L5LA 5HFKA 2H19A 3UAPA 1GTBA 5DQYA 1GL8A 5G31A 1URMA 3BD2A 4EL1A 4WF4A 6GSXA 1EV4A 4HS1A 1T3BA 2RM5A 5AIVA 1FO5A 4IP6A 1ERWA 3A2WA 2I3YA 4Q5NA 4K2DA 4OD7A 3IE3A 3IV4A 4K8MA 1S3AA 6GSTA 1GSDA 3ZL5A 2E2GA 1XW9A 3GSTA 1UVZA 3APQA 2IFQA 4A5PA 4YKGA 4F0CA 1AQXA 2NPBA 1GRXA 2KHPA 2N5AA 1OKTA 5F0GA 6GSWA 4KCAA 3GHAA 2VM2A 4MJBA 2DLXA 5KEJA 1TRVA 4USSA 2TIRA 3QAWA 4OO4A 5HR1A 2HRNA 3A2VA 3GRXA 2H0IA 3A2XA 3D5JA 2VCXA 2RUFA 3ZYWA 5ECMB 4MCUA 4YAVA 1XFLA 1ZCPA 3FKFA 2FY6A 2X8CA 3GX0A 3EURA 3UVHA 2C0GA 4I5QA 4V1Ag 1F9MA 2RLIA 1WPIA 2X99A 4V2NA 5BMUA 2B5EA 3KMNA 4V2MA 1ST9A 1K3YA 2B3SA 4NHZA 3LQ7A 4OMVA 1T8EB 1Y25A 2OADA 1TP9A 2LKUA 3DD3A 1FB6A 3H8QA 3FZ9A 2IN3A 3LG6A 2B5XA 1V9WA 1EOGA 1HNBA 4XS1A 5AN1A 1JZWA 1XWKA 2YZHA 2LTKA 4G10A 4POBA 2IMEA 2K6VA 2L5OA 1FVJA 3LORA 2DJ0A 1J08A 5F8BA 4O92A 4XIHA 1ZOFA 1YKAA 4GF0A 2GGTA 5HR2A 4XRDA 3VI5A 4MDCA 2TRCP 3S9FA 1TU7A 3Q74A 2CV4A 4V1Ap 5COHA 5E59A 4EO3A 1V2AA 3NOFA 1DE2A 4MZCA 1QQ2A 4YH2A 4NAXA 4F03A 2BTOT 3VWVA 1S3CA 3UBLA 2YOIA 5JWRB 4ZL7A 4KSOA 2VL2C 5IO2A 2JU5A 1ZYNA 3DVXA 5G5FA 2GT6A 4AF2A 1CQGA 2P5QA 2FWFA 4MH3A 4KDYA 2GTUA 1G7EA 2GDRA 4Q5RA 2B7JA 2H72A 3IR4A 4FYUA 1X5CA 3DEXA 1Z6MA 3KH9A 1BEDA 2C80A 4CY6A 1G6WA 1LJRA 1XBSA 2IPAA 4EUYA 3GSSA 6GSSA 1TRWA 1Z9HA 2JL4A 3CBUA 4WEYA 3L78A 2C3TA 4RUVA 2ON5A 9GSSA 2C0DA 3TOUA 3RBTA 2IJYA 4ZBAA 2B6MA 2HE3A 2VIMA 3RPNA
chains in the Genus database with same CATH topology
1XG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XG8 A; 
#chains in the Genus database with same CATH topology
 22GS A;  1GSY A;  4TRX A;  2JZR A;  4BWS A;  4BL7 A;  3FYG A;  2K9F A;  4WBJ A;  2DKI A;  1SEN A;  3LFL A;  2HZF A;  1ZMA A;  3QMX A;  4WBR D;  5CO3 A;  2PGT A;  5IMC A;  1USB A;  2K18 A;  3L4N A;  1IYH A;  2PN8 A;  2JAC A;  2H30 A;  1WWJ A;  3GKM A;  2WGR A;  1FOV A;  1O8W A;  4KF9 A;  4HZ2 A;  1ML6 A;  2HI7 A;  3UL3 A;  4XS4 B;  4FYB A;  12GS A;  2R0C A;  2N5F A;  1GSQ A;  4NV2 A;  3UMA A;  4EXJ A;  4IEL A;  3O6T A;  1AQV A;  4POL A;  1GSE A;  2L57 A;  1V58 A;  3GL5 A;  2PWJ A;  13GS A;  3GH6 A;  4WET A;  4MZW A;  4EKZ A;  1X5D A;  3KD0 A;  3SWL A;  2V41 A;  5EY6 A;  3QCP A;  4N10 A;  3N9J A;  3IA1 A;  1BAY A;  3M9J A;  4YAP A;  3ZML A;  1YEX A;  3H79 A;  4HU7 A;  4F0B A;  3NZN A;  2X4A A;  3TJJ A;  3RDW A;  5F07 A;  2VL2 A;  4XTS A;  1NW2 A;  2P0G A;  2WCI A;  1ILO A;  2LS5 A;  2AYT A;  4HSC X;  4Z2R A;  2C8U A;  4FH8 A;  4ZBD A;  1ON4 A;  1WJK A;  3LGC A;  4HJ2 A;  3F4R A;  4LLR A;  1BQ7 A;  3CTG A;  3FR3 A;  4EVM A;  5J4U A;  4PQH A;  3GH9 A;  1E2Y A;  3IXR A;  3HXS A;  1XOB A;  3ERG A;  5GZZ B;  3KZQ A;  3KTB A;  3VI7 A;  2E0Q A;  3US3 A;  1PL1 A;  2DJ1 A;  3BCI A;  4IP1 A;  3MNG A;  3HJO A;  1DE1 A;  2OA7 A;  1SK2 A;  3LYK A;  3GIX A;  3G7J A;  1M3I A;  3VWX A;  2A2P A;  2L6C A;  4PUF C;  5ECQ B;  1TK8 B;  3G7Y A;  5DVB A;  2QGV A;  4TOP A;  1A23 A;  3RHB A;  1W89 A;  4EDZ A;  4ZBB A;  1GNW A;  2MMN A;  2IMD A;  4NMU A;  2YCD A;  2HZE B;  1YJ6 A;  4CW9 A;  5LCZ A;  3A5W A;  4WKW A;  3HZ8 A;  4IVF A;  4ZXG A;  3EYT A;  3TKQ A;  2C4J A;  3VWU A;  3CYN A;  4YQM A;  5FT3 A;  2CX3 A;  4OCF A;  4OFT A;  2MYG A;  5A5K A;  3GUR A;  3TRX A;  1PFO A;  2OAC A;  5D73 A;  2H66 A;  4G0K A;  1DBY A;  3ME8 A;  1JHB A;  2RM6 A;  4BVX A;  1NSW A;  2A4V A;  5D96 A;  4NWY A;  4PQ1 A;  1SKW B;  1J9B A;  1DSB A;  3A3T A;  2LST A;  4BPY A;  1KNG A;  1AAZ A;  4RI7 A;  2DIY A;  2H76 A;  3F3Q A;  2EIR A;  3RHC A;  4ZL9 A;  3TRQ A;  1HYU A;  4G2E A;  1Y6E A;  2CVB A;  1QFN A;  4X0X A;  2P31 A;  4EIQ A;  3EPT A;  3G9B A;  4KDX A;  5KOW A;  4K1F A;  1R4W A;  4I6X A;  2YZU A;  2H1B A;  3BBY A;  3EMX A;  2LUS A;  4IKH A;  5ECK B;  4AJ6 A;  5IMF A;  3WT1 A;  1EWX A;  5KN3 A;  2LNS A;  4TN8 A;  3IK9 A;  5CNW A;  2GZZ A;  4KND A;  3KEB A;  2NVL A;  1MD3 A;  4ECI A;  5DCG A;  2VD0 A;  4KB3 A;  1QK8 A;  3RAZ A;  2B5Y A;  4DSQ A;  2V6O A;  2GST A;  3GA4 A;  2HRF A;  3WD6 A;  4KH7 A;  4ILF A;  4MA9 A;  3H4K A;  1TU8 A;  1YF1 A;  3GX8 A;  1M9B A;  2G0F A;  2LRC A;  4K5S A;  3KTL A;  1RW1 A;  1YKC A;  4O5U A;  3UOM A;  2H0H A;  1A2M A;  2B7K A;  1EGR A;  2VCT A;  2H1D A;  2HT9 A;  1SL2 B;  1AC1 A;  1UA5 A;  1ZYP A;  1KTE A;  2X8G A;  4KAE A;  1SYX A;  4Z2U A;  3QAG A;  1AQW A;  4MF7 A;  3BJ5 A;  5LD0 A;  2AAW A;  2MBS A;  3VUR A;  4DSR A;  3F8U A;  3HZ4 A;  1WOU A;  1F6M C;  1GTI A;  4J56 E;  1R7H A;  5D93 A;  1SKR B;  2V1M A;  2ZNM A;  1Z5Y E;  4RQR A;  4FIW A;  2HRK A;  4Z7X A;  2GZP A;  4K7O A;  3QFB C;  1TRU A;  1V57 A;  2H0G A;  1T7P B;  3TJB A;  2WRT A;  1HNA A;  2GQK A;  5ID2 B;  4K7N A;  4WR5 A;  5IIZ A;  3W6G A;  2JAD A;  3DIE A;  4K9Z A;  2LJA A;  1TXX A;  3FMW A;  2OE3 A;  3ERF A;  3KM6 A;  1SD8 A;  4X4J A;  4TKY A;  4JE1 A;  4KGI A;  3L9U A;  2MBT A;  2P5R A;  1TKD B;  4L8E A;  2X64 A;  1XVW A;  1WE0 A;  4D73 A;  2R4V A;  4HEA 2;  3SBC A;  4Q5Q A;  5IOW A;  3IPZ A;  1O73 A;  1MDI A;  1FHE A;  2DJJ A;  5CRH A;  2LRT A;  1GNE A;  1SJ6 A;  5J9C A;  3RPP A;  2M46 A;  5ELA A;  4ID0 A;  3P8W A;  5HR0 A;  1OE8 A;  3BCK A;  1A0R P;  2PU9 C;  1PA3 A;  2IL3 A;  5G1L A;  1U6T A;  2M72 A;  2A2S A;  14GS A;  4G0L A;  2YWM A;  2OE0 A;  2XBI A;  1QGV A;  4TR1 A;  1MDK A;  4TR0 A;  1GLP A;  1FAA A;  4XHM A;  1RK4 A;  2OKA A;  1EEJ A;  4I2T A;  2C0F A;  2QKE A;  3GKN A;  5ECP B;  4EDY A;  3PGT A;  3U5R E;  5EL8 A;  1PN0 A;  4POK A;  3PPU A;  3ISO A;  2FA8 A;  2CA8 A;  2IMF A;  2C3Q A;  4IN0 A;  3FY7 A;  2H6Z A;  4QQ7 A;  3GL3 A;  3FR6 A;  4K2X A;  5A4V A;  2VD1 A;  4RQX A;  1EP8 A;  3IAM 2;  1SYR A;  3DYR A;  1PN9 A;  4LL1 B;  5ABR A;  2R6K A;  3BOA A;  1Z3E A;  3O76 A;  4KCE A;  1X9M B;  5ECO B;  4FO5 A;  3J7Y k;  4MJC A;  1K0B A;  3ZRD A;  1PQN A;  2LNT A;  3WYW A;  2AV4 A;  3TJK A;  3IHQ A;  5IMA A;  4O5Q A;  1JZD A;  1OC8 A;  2LJR A;  3VPQ A;  1TTZ A;  1QXH A;  5KN0 A;  3GUS A;  3J7Y b;  1ZYQ B;  2DIZ A;  5KN1 A;  3GNJ A;  1TI1 A;  3WGX A;  4TXO B;  4WF5 A;  3I43 A;  1U87 A;  3N5O A;  2CQ9 A;  1HQO A;  4BIK A;  3VPT A;  3QD9 A;  5CP1 A;  3PIN A;  2XC2 A;  2VCQ A;  4G0I A;  5IM9 A;  4OCE A;  3DRN A;  3KP8 A;  1TK0 B;  4GTU A;  3ZMK A;  5FHI A;  3HVN A;  3DVW A;  3F4S A;  1SL1 B;  4TVE A;  1B9Y C;  5CRD A;  3E3E A;  6GSV A;  5HFI A;  2GS3 A;  3KIJ A;  5A4U A;  1NHY A;  3LW9 A;  3D21 A;  2EIO A;  5ENU A;  2CVK A;  4ECB A;  2C3N A;  2YAN A;  2H6X A;  3ZTL A;  3CXG A;  2FNO A;  5FWG A;  5D8I A;  1BG5 A;  2VL3 A;  2PVO C;  4N0Z A;  2H1G A;  4MK3 A;  3UJ1 A;  2NBS A;  1GH2 A;  2C0E A;  2EC4 A;  4G9H A;  1AXD A;  4PUR A;  7GSS A;  5D9T A;  1O6J A;  1R5A A;  1B9X C;  2YP6 A;  3IDV A;  1ABA A;  2H73 A;  4OO5 A;  2KLX A;  4MZB A;  4YQU A;  5D9V A;  1GUH A;  2AJQ B;  3K8N A;  2DBC A;  2GSR A;  3HJP A;  2H6Y A;  4E8H A;  2DKH A;  2I1U A;  4L5L A;  2WDU A;  5GSS A;  2ZCT A;  3EC3 A;  2OBK A;  1JZR A;  2KP1 A;  5B7C A;  2IFQ B;  2HYX A;  2RII A;  3IC4 A;  2FLS A;  4NHW A;  3HVS A;  3HVV A;  1G7O A;  3MWH A;  1XWG A;  4K6X A;  3TRP A;  2EIQ A;  2LRN A;  5DJM A;  3ZLP A;  2AHE A;  4GSN A;  1K0C A;  2M80 A;  2HSM A;  2GLR A;  3FEU A;  4P3Y B;  1S3R A;  3FRC A;  2QC7 A;  4ZB9 A;  6GSU A;  3WGE A;  4V2L A;  4HU9 A;  5DDL A;  3M9K A;  3KCM A;  1THX A;  1OKD A;  3DXB A;  5CRG A;  1GWC A;  2F3M A;  1B48 A;  3TKS C;  1B4Q A;  4PXO A;  3I9V 2;  4J2F A;  3D0Z A;  1VF2 A;  5GAN D;  1QUW A;  1TW9 A;  4DVC A;  3CRU A;  5GST A;  1TRS A;  2O85 A;  4GLT A;  3FHK A;  1K3L A;  1XWC A;  1GUK A;  1NHO A;  3TKP A;  2J9H A;  1BYE A;  2VLV A;  1UC7 A;  5B8A A;  1TDI A;  2FD3 A;  3Q19 A;  2LV3 A;  2ON7 A;  2A2R A;  1ZL9 A;  1KEB A;  3C1R A;  1Q98 A;  2HNL A;  2DSA A;  1A0F A;  3UBK A;  4QL9 A;  3LSZ A;  4HUA A;  1SKS B;  3KMO A;  1XWB A;  4GRF A;  4IHU A;  4TR3 A;  1X9W B;  4MLY A;  2B1K A;  4ZB6 A;  1CQH A;  2DML A;  4TXV A;  1XWA A;  3ZFL A;  11GS A;  2YV7 A;  4ZIL A;  1SK1 A;  4F82 A;  3CSI A;  2MMZ A;  5ECS A;  10GS A;  3MDK A;  4ACS A;  5DCH A;  2DMM A;  2REM A;  1YEP A;  3JCM L;  3MAK A;  5B6N A;  1YDK A;  3LXZ A;  5DJL A;  4GXZ A;  5GAP D;  4IGJ A;  4BA7 A;  5IO0 A;  4PNF A;  1O8X A;  2VCW A;  1WIK A;  4BVY A;  5J41 A;  3HJM A;  1K3O A;  1T4Z A;  3H93 A;  4IQA A;  2DJ3 A;  1M9A A;  3M0F A;  2FA4 A;  2RUE A;  5F05 A;  3GTU A;  2D2Z A;  1PD2 1;  4L0W A;  2E7P A;  1XG8 A;  1GTU A;  2WFC A;  2QA1 A;  5AIX A;  2GVP A;  3GFK A;  1BX9 A;  5AGY A;  1AIU A;  3ZVJ A;  1XIY A;  2PER A;  3ZZX A;  2N5B A;  1SK0 A;  2V2G A;  2VO4 A;  2PPT A;  3FZ4 A;  3EIN A;  2JSY A;  1A8Y A;  3EU3 A;  2VL9 A;  3CTF A;  1W4V A;  4CDO A;  5KN2 A;  1YQ1 A;  2YWI A;  2WS2 A;  3IRA A;  2CX4 A;  3TKS A;  2KUC A;  4K5R A;  1GSF A;  4O5R A;  3LJR A;  5H5R A;  1I5G A;  5B8B A;  1ZYE A;  1A2J A;  3DKS A;  2YJ7 A;  3I69 A;  2ES7 A;  4AJ7 A;  4BL7 B;  1X5E A;  3NIV A;  1XW6 A;  1OE7 A;  2C1Y A;  2WUL A;  3DML A;  2WJU A;  3C73 A;  3M8N A;  2F8F A;  2HSH A;  5IPG A;  2O7K A;  3GKX A;  2O87 A;  2HRA A;  2H74 A;  5EPF A;  2VAF A;  3MSZ A;  2VCZ A;  2F51 A;  4DSS A;  2BMX A;  2CT6 A;  1SU9 A;  2YWN A;  3HKR A;  2LQQ A;  1HNC A;  3FK8 A;  1F3B A;  3VLN A;  3E0U A;  3D4M A;  4MJE A;  3LYP A;  4Q5F A;  1JFU A;  5JCW A;  4LMV A;  1EP7 A;  5DAL A;  3V1W A;  4E8E A;  4EE0 A;  2YPM A;  2I4A A;  3LWA A;  2AB6 A;  4PTS A;  5G2Z A;  3TOT A;  1KBN A;  3MIX A;  3TKR A;  2DJ2 A;  2GZY A;  3UEM A;  3ZIV A;  4KA0 A;  3FW2 A;  3TJF A;  4WR4 A;  5IMZ A;  2F9S A;  1TJD A;  2HFD A;  3D4T A;  2L59 A;  1V40 A;  3LEF A;  5IMV A;  2GSS A;  1ACV A;  3WGD A;  4KSM A;  1G6Y A;  2V32 A;  1HD2 A;  1U88 A;  1PKZ A;  4TR4 A;  5D9X A;  4MAB A;  3UIW A;  5G5E A;  5INY A;  4GQC A;  2VLT A;  3AY8 A;  4AJ8 A;  5C00 A;  5J9B A;  3FZ5 A;  4DEJ A;  3EMP A;  4EIP A;  3M1G A;  2KOK A;  2R37 A;  3IC8 A;  3QR6 A;  1TK5 B;  2XPD A;  3DWV A;  4HI7 A;  1SJZ A;  2XHF A;  1EGO A;  1MTC A;  1VRS D;  2NTO A;  1XW5 A;  3F0I A;  4F9Z A;  2E2M A;  5BRT A;  3QOU A;  5EVO A;  3HDC A;  4BVY B;  5CYY A;  2K8S A;  1A8L A;  1XCC A;  2FUG 2;  3OR5 A;  1VGL A;  1PKW A;  3KGK A;  3GTU B;  1H4O A;  3R2Q A;  4G19 A;  1OYJ A;  1GUM A;  1ERU A;  1XOA A;  2CZ3 A;  3C7M A;  5HR3 A;  3GYK A;  4JED A;  4BVX B;  2R0G A;  5D9W A;  3HHV A;  4YKF A;  4JZQ A;  3TJG A;  3HY2 A;  2V6K A;  1WMJ A;  1EOH A;  1ERV A;  1AW9 A;  4N0V A;  3C71 A;  1PRX A;  2K8V A;  5DAK A;  4XS4 A;  5J3R A;  2ALB A;  2R0P A;  4GCI A;  3QFA C;  4EC0 A;  5DQS A;  4O32 A;  4JR6 A;  2LEG A;  1I9D A;  3APS A;  2VCV A;  3F6D A;  1GUL A;  4K0N A;  4N30 A;  1PGT A;  3TGZ A;  1S3D A;  2OE1 A;  3QAV A;  5LNK e;  1SD9 A;  2MMO A;  2VM1 A;  4CY8 A;  4F2I A;  4PX1 A;  4ISD A;  1FVK A;  5ECI B;  1K0A A;  1M3J A;  5ECN B;  4HOJ A;  2FCH A;  4MPF A;  4I2U A;  4LL4 B;  3R3E A;  3F6F A;  4IBP A;  1EZK A;  1N2A A;  4HJM A;  4XCS A;  3IHG A;  2A4H A;  3C1S A;  1T1V A;  2JSZ A;  4DSS B;  4ECC A;  1M7T A;  2MZC A;  1GSU A;  3APO A;  1EV9 A;  2IMI A;  1XXU A;  4GSS A;  4OFM A;  2VLU A;  3TCO A;  3PR8 A;  4MPG A;  4K0G A;  1T4Y A;  3H1N A;  5DAL B;  5DBQ A;  4WXT A;  4J57 E;  3U6V A;  2JZS A;  3ZIJ A;  3QPM A;  3HYP A;  4MJA A;  3ZFB A;  5AIS A;  2CAQ A;  5KOX A;  2DC5 A;  5IQY A;  4XS6 A;  3E9J B;  2YV9 A;  3A5I A;  2X8H A;  1R5P A;  1XPV A;  2DJK A;  4JR4 A;  2HZE A;  1YF0 A;  3EWL A;  4ML6 A;  1K0D A;  2XPE A;  2YWO A;  5HQP A;  1AUC A;  1FW1 A;  1YY7 A;  2IIY A;  4HZ4 A;  5H5Q A;  1OAZ A;  2QA2 A;  4POM A;  1C72 A;  4IS0 A;  2YN1 A;  1M2B A;  2AUV A;  4IJI A;  4JBB A;  1Q4J A;  1YZX A;  4LMW A;  5CAX A;  2H75 A;  1Z7P A;  2FGX A;  2CVD A;  4IW9 A;  4NXI A;  1LBK A;  4TW5 A;  4ZL8 A;  19GS A;  2J23 A;  3HVX A;  3ZVJ D;  5ECR B;  1T00 A;  1VF4 A;  1K0N A;  1ZZY A;  4D73 B;  5IMD A;  17GS A;  2KP2 A;  1M99 A;  4XRA A;  4O7H A;  1PSQ A;  2L6D A;  2WB9 A;  1Z6N A;  2ZUP A;  3LXT A;  4L0U A;  1J0F A;  1VF1 A;  2H01 A;  1TI3 A;  4AGS A;  1RQM A;  3Q18 A;  4HQZ A;  1PL2 A;  4TR1 B;  1K0M A;  3P2A A;  2X49 A;  3IK7 A;  3VWW A;  2I9H A;  3FZA A;  5IPH A;  2PBJ A;  2OBI A;  1O85 A;  1N8J A;  3EU4 A;  4MF5 A;  3TDG A;  1FG4 A;  4YQV A;  4PGT A;  4EF0 A;  4ZB8 A;  4PNG A;  1OC9 A;  5F06 A;  4HDE A;  2YNX A;  3CQF A;  5DAK B;  4X1U A;  3ERW A;  4CHS A;  4KUN A;  4BWQ A;  1M0U A;  4I97 A;  2FWG A;  16GS A;  5L71 A;  18GS A;  2G2Q A;  4GST A;  5H5S A;  1BJX A;  2FWE A;  3TB2 A;  2CAI A;  2L4Q A;  4IQ1 A;  3UVT A;  1OVN A;  4FQU A;  2L4C A;  3KH7 A;  1VF3 A;  4PQI A;  1O81 A;  5J5N A;  1MD4 A;  4KW6 A;  4FYC A;  1NM3 A;  3P7X A;  2WZ9 A;  1PMT A;  3UAR A;  3GN3 A;  3O3T A;  3EE2 A;  2JZT A;  4ULX A;  1B4P A;  3F4T A;  4GQF A;  4NV5 A;  3VK9 A;  5G1K A;  1X0R A;  1U3I A;  4QL7 A;  1OC3 A;  2F8A A;  3CSJ A;  3W8J A;  2H1A A;  1TOF A;  1GLQ A;  4PUA A;  5ID2 A;  1FOH A;  3ZIT A;  4Z2T A;  4HQS A;  4JU5 A;  3WT2 A;  2UZ8 A;  4MMM A;  4IJ3 A;  1A24 A;  2O89 A;  1IYI A;  1GTA A;  4H86 A;  3P90 A;  4LA1 A;  3EVI A;  3KXO A;  1K0O A;  3L0H A;  3ZRE A;  2VOC A;  2HLS A;  3FR9 A;  3TUE A;  3F9U A;  3CMI A;  1B8X A;  1M2D A;  1Z7R A;  1MEK A;  3CSH A;  1A2L A;  1U3A A;  2R3X A;  3IAS 2;  3HA9 A;  3TKS E;  5JCG A;  4ECJ A;  1O7U A;  2H71 A;  2GQL A;  5C04 A;  2GT5 A;  5CRE A;  1G0T A;  4N11 A;  1H75 A;  3KJY A;  2GQM A;  2H8L A;  5CRW A;  1EEM A;  5HFG A;  3D22 A;  2IMK A;  2PUK C;  1FB0 A;  8GSS A;  5G30 A;  1ERT A;  5E4W A;  1JLV A;  1MDJ A;  1XVQ A;  5ECH B;  2LJK A;  1UN2 A;  4MH2 A;  6GSY A;  2MMA A;  4NPB A;  4MNN A;  2QSI A;  4ICY A;  1GSS A;  3C8E A;  4X43 A;  1PX7 A;  2HSY A;  3IOS A;  5A4W A;  1WRY A;  5ELG A;  2Z9S A;  1WP0 A;  1XZO A;  4ZIJ A;  1SL0 B;  4OWY A;  2LQO A;  3IBH A;  3D6I A;  2PMT A;  2H70 A;  2B1L A;  5JWO B;  1F37 A;  4I8B A;  1X9S B;  3G7I A;  1ZGN A;  5JWQ B;  4L5O A;  2FWH A;  3L9V A;  2R2J A;  1QMV A;  2R5G A;  2PVQ A;  3PH9 A;  2NDO A;  3F3R A;  2FHE A;  4GWR A;  1PX6 A;  1JLW A;  3VFI A;  4ML1 A;  1OC9 B;  4KX4 A;  2BJX A;  4KE3 A;  2TRX A;  20GS A;  1E6B A;  2GSQ A;  3GKK A;  4MF6 A;  4RI6 A;  3F63 A;  4MP4 A;  3M3M A;  4KDU A;  4TXO A;  4JRR A;  2XBQ A;  1THO A;  3DGQ A;  3Q6O A;  3I6A A;  5IOX A;  3HCZ A;  3QDN A;  3L9S A;  3ME7 A;  1SJI A;  1JZO A;  3HD5 A;  1M2A A;  3ED3 A;  2VUP A;  3GMF A;  3W8S A;  1GP1 A;  1V98 A;  1F2E A;  2IWT A;  3CRT A;  1DUG A;  3MYD A;  3KP9 A;  4K7I A;  1F3A A;  5B6M A;  2I81 A;  2YJH A;  3GV1 A;  5JCU A;  2OJL A;  2CZ2 A;  2HXK A;  5ECL B;  4OFN A;  2O8V B;  1LU4 A;  1R26 A;  2L5L A;  5HFK A;  2H19 A;  3UAP A;  1GTB A;  5DQY A;  1GL8 A;  5G31 A;  1URM A;  3BD2 A;  4EL1 A;  4WF4 A;  6GSX A;  1EV4 A;  4HS1 A;  1T3B A;  2RM5 A;  5AIV A;  1FO5 A;  4IP6 A;  1ERW A;  3A2W A;  2I3Y A;  4Q5N A;  4K2D A;  4OD7 A;  3IE3 A;  3IV4 A;  4K8M A;  1S3A A;  6GST A;  1GSD A;  3ZL5 A;  2E2G A;  1XW9 A;  3GST A;  1UVZ A;  3APQ A;  2IFQ A;  4A5P A;  4YKG A;  4F0C A;  1AQX A;  2NPB A;  1GRX A;  2KHP A;  2N5A A;  1OKT A;  5F0G A;  6GSW A;  4KCA A;  3GHA A;  2VM2 A;  4MJB A;  2DLX A;  5KEJ A;  1TRV A;  4USS A;  2TIR A;  3QAW A;  4OO4 A;  5HR1 A;  2HRN A;  3A2V A;  3GRX A;  2H0I A;  3A2X A;  3D5J A;  2VCX A;  2RUF A;  3ZYW A;  5ECM B;  4MCU A;  4YAV A;  1XFL A;  1ZCP A;  3FKF A;  2FY6 A;  2X8C A;  3GX0 A;  3EUR A;  3UVH A;  2C0G A;  4I5Q A;  4V1A g;  1F9M A;  2RLI A;  1WPI A;  2X99 A;  4V2N A;  5BMU A;  2B5E A;  3KMN A;  4V2M A;  1ST9 A;  1K3Y A;  2B3S A;  4NHZ A;  3LQ7 A;  4OMV A;  1T8E B;  1Y25 A;  2OAD A;  1TP9 A;  2LKU A;  3DD3 A;  1FB6 A;  3H8Q A;  3FZ9 A;  2IN3 A;  3LG6 A;  2B5X A;  1V9W A;  1EOG A;  1HNB A;  4XS1 A;  5AN1 A;  1JZW A;  1XWK A;  2YZH A;  2LTK A;  4G10 A;  4POB A;  2IME A;  2K6V A;  2L5O A;  1FVJ A;  3LOR A;  2DJ0 A;  1J08 A;  5F8B A;  4O92 A;  4XIH A;  1ZOF A;  1YKA A;  4GF0 A;  2GGT A;  5HR2 A;  4XRD A;  3VI5 A;  4MDC A;  2TRC P;  3S9F A;  1TU7 A;  3Q74 A;  2CV4 A;  4V1A p;  5COH A;  5E59 A;  4EO3 A;  1V2A A;  3NOF A;  1DE2 A;  4MZC A;  1QQ2 A;  4YH2 A;  4NAX A;  4F03 A;  2BTO T;  3VWV A;  1S3C A;  3UBL A;  2YOI A;  5JWR B;  4ZL7 A;  4KSO A;  2VL2 C;  5IO2 A;  2JU5 A;  1ZYN A;  3DVX A;  5G5F A;  2GT6 A;  4AF2 A;  1CQG A;  2P5Q A;  2FWF A;  4MH3 A;  4KDY A;  2GTU A;  1G7E A;  2GDR A;  4Q5R A;  2B7J A;  2H72 A;  3IR4 A;  4FYU A;  1X5C A;  3DEX A;  1Z6M A;  3KH9 A;  1BED A;  2C80 A;  4CY6 A;  1G6W A;  1LJR A;  1XBS A;  2IPA A;  4EUY A;  3GSS A;  6GSS A;  1TRW A;  1Z9H A;  2JL4 A;  3CBU A;  4WEY A;  3L78 A;  2C3T A;  4RUV A;  2ON5 A;  9GSS A;  2C0D A;  3TOU A;  3RBT A;  2IJY A;  4ZBA A;  2B6M A;  2HE3 A;  2VIM A;  3RPN A; 
#chains in the Genus database with same CATH homology
 1XG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...