1XG8A

Crystal structure of protein of unknown function sa0789 from staphylococcus aureus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
108
Chain Sequence
ANLYFQSNAVVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFKYTYIDITKDLTDHDLQFIERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKLVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SA0798
publication title The 2.1A crystal structure of hypothetical protein SA0798 from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus n315
molecule tags Structural genomics, unknown function
total genus 28
structure length 108
sequence length 111
ec nomenclature
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07315 DUF1462 Protein of unknown function (DUF1462)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.30 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Hypothetical protein sa0798. 1xg8A00
1XG8A
chains in the Genus database with same CATH superfamily
5F0GA 1EEJA 3R3EA 3C7MA 4GQFA 5HQPA 3C73A 1ZOFA 4G0KA 5A5KA 2X8HA 1ZYNA 3QFAC 4XCSA 2VIMA 4EIPA 2OBKA 4IW9A 2R3XA 3W6GA 2FGXA 4TR1B 1JZRA 2DIZA 3EE2A 2YWMA 2DMLA 1B9XC 1UC7A 1PN9A 3DRNA 2FCHA 4AJ6A 2H72A 4ICYA 1PL1A 6GSTA 1GSYA 3IRAA 3QAVA 2ALBA 5J41A 4ZBAA 2A4HA 3TJKA 1EOHA 3GKKA 4YQMA 2B7KA 2D2ZA 5DALA 3P90A 2KOKA 1NSWA 1ZL9A 2ZCTA 4NV2A 4KDXA 2YJ7A 3IV4A 1PRXA 4K8MA 2LS5A 5AISA 2DJ2A 4JE1A 1ERVA 2PGTA 2YCDA 1PSQA 4HS1A 2WRTA 2H0IA 2CA8A 2FWHA 4I6XA 5J5NA 2NBSA 2GDRA 3NZNA 2QA1A 1G0TA 1HQOA 3CMIA 5A4UA 1W4VA 1ERUA 5DQSA 3KCMA 2M46A 3IAM2 5ID2A 2HNLA 3M9JA 5CAXA 4MH2A 1U3AA 5AN1A 2CV4A 1U6TA 4OFTA 3D21A 2QSIA 2CVBA 2R0CA 4KDYA 5IOXA 3F6FA 3WGXA 2X49A 4LL4B 3MYDA 1XPVA 2LJRA 3ZFLA 4X43A 3WT1A 2B3SA 1ON4A 3ZITA 4H86A 3F4SA 4KE3A 4YKFA 4IN0A 2LUSA 3TCOA 5A4WA 10GSA 4AJ7A 3TKPA 1G6YA 1WIKA 1XW9A 4JZQA 2LQOA 1OAZA 1FHEA 2CT6A 3KGKA 3F0IA 3M1GA 5DVBA 2OJLA 2HRAA 2HYXA 4HU9A 2VM2A 3VK9A 5ABRA 2E7PA 1QUWA 2IFQB 2QKEA 1EP7A 1QFNA 3RHBA 4MF6A 4HQZA 2LEGA 5H5RA 2B7JA 2L57A 5IQYA 1AUCA 1GUMA 1WOUA 2PWJA 1Z3EA 2GLRA 3G7JA 5DDLA 5B8AA 3APSA 2JSZA 1EV9A 4YH2A 4BL7B 5DJMA 1ST9A 1GLPA 4NPBA 1R5PA 5ELAA 5JCWA 3CTFA 4RQRA 1WP0A 5HR2A 3GA4A 4K1FA 1YF1A 2V6KA 2YANA 3QPMA 1X5DA 1GH2A 2C1YA 2J23A 5DCHA 1DSBA 1G7OA 1T3BA 6GSXA 1TK5B 3PPUA 2RUFA 1O73A 2I3YA 3ZZXA 3GV1A 2GZZA 1XBSA 1MEKA 4N10A 2MBSA 2EC4A 1E6BA 3PH9A 1NW2A 2H6ZA 1M3JA 2PU9C 3GTUB 4ML6A 4PQHA 1F9MA 2FA4A 5ECSA 1V40A 1N2AA 4NAXA 2LTKA 5EVOA 1LBKA 3M9KA 4ZL9A 3MIXA 2VD1A 3EU4A 2O85A 1F3BA 4Z2UA 1YF0A 3C71A 3LW9A 4HDEA 5HFGA 2R4VA 1SU9A 4F0BA 4GTUA 3DGQA 2QA2A 5F05A 2CAIA 1PGTA 3EURA 2TIRA 1QMVA 4MJCA 3S9FA 3KH7A 4HQSA 3NIVA 1BEDA 4PX1A 3G9BA 4G9HA 3WGDA 1XWGA 5FWGA 1EEMA 2B5YA 4F9ZA 5DJLA 4LLRA 3F3QA 5IIZA 4F0CA 1GRXA 2PUKC 3ERWA 4YAVA 1HNBA 4MK3A 4LMWA 2P5RA 2PN8A 4Q5RA 3HDCA 1S3DA 5IMVA 1A23A 1OC8A 4KH7A 3BJ5A 3UIWA 1GSFA 4L0WA 4K9ZA 4PURA 2X64A 1A24A 5CO3A 2GVPA 5JWQB 4MJEA 2HZFA 4N30A 1O81A 3O76A 4MP4A 1B4PA 2ON5A 2K9FA 1K3OA 3CQFA 3HJOA 2RM5A 2CVKA 4ZIJA 4P3YB 3ERFA 3ZRDA 3A5IA 4MLYA 3KJYA 4MH3A 5ECPB 4Z2RA 2CX3A 1ZMAA 1XWKA 2XC2A 2FD3A 1GTUA 5DALB 4EDYA 3OR5A 1SL1B 1A8YA 4N0ZA 4EKZA 1X9SB 1GSEA 3F6DA 2VOCA 1BQ7A 2HT9A 2WJUA 3DVXA 1G7EA 3QCPA 1GLQA 2E0QA 1X9WB 3DD3A 1VF1A 1R4WA 3DVWA 2H75A 2KLXA 4NMUA 1YJ6A 3TKRA 3UVTA 3FEUA 5GSTA 5FT3A 3UAPA 2V41A 2VCWA 3BD2A 4PNFA 1USBA 2VCXA 2YP6A 2A2SA 1NM3A 1XVWA 5IO0A 2GZPA 3VWWA 4WBRD 2DJJA 4HOJA 3HJPA 4HZ2A 4ZL7A 2H74A 4G10A 4QL9A 3FZAA 2OE0A 1SENA 4J57E 4JR4A 5ID2B 4V2LA 2P31A 3EMXA 3IPZA 3EPTA 3GHAA 1TI1A 1AQWA 4V1Ap 4Q5QA 1WPIA 4F82A 4OFNA 2H70A 2FWEA 3VPQA 3FRCA 5C00A 1ZCPA 1GNEA 3BBYA 1ML6A 3I69A 2KHPA 2MBTA 3EMPA 2YOIA 3WT2A 5DAKA 2H6YA 2IMIA 4F2IA 4X0XA 2LRCA 3I43A 4G0LA 1TRVA 3KXOA 1EOGA 3M0FA 4HU7A 2HSHA 3L0HA 5LD0A 4TN8A 2L5LA 1TKDB 2PERA 4HI7A 4K5SA 1EGOA 3GH6A 5D93A 3GSSA 3QDNA 2H66A 1TXXA 3RDWA 1HD2A 3TGZA 1TI3A 4YQUA 2LRNA 1HNAA 1EZKA 1FG4A 2IWTA 1VGLA 4MPGA 5ELGA 3GN3A 2N5FA 3VURA 4GQCA 4IHUA 3WD6A 1Z6NA 4ZILA 3F63A 4PXOA 1A2MA 4IBPA 3UMAA 3UOMA 1VF3A 2VD0A 5ECQB 4OMVA 2X8CA 4GF0A 1A8LA 1Z6MA 3RHCA 3F8UA 3LGCA 5ECMB 2L6CA 8GSSA 4JBBA 3HVXA 3ME8A 5COHA 4K7OA 5CRDA 3CSJA 1FAAA 3CRTA 4MNNA 5D9TA 1SL0B 2DJKA 4YQVA 4JEDA 4TR4A 1XOBA 1FB6A 3IBHA 3DEXA 3ZIJA 2YWOA 3BOAA 4MPFA 2LKUA 4F03A 3GX0A 4IQ1A 2EIRA 2PVOC 4ECIA 3Q19A 4FYBA 4LL1B 5JWOB 4RI7A 2B1KA 2OE1A 1AQVA 5JWRB 2G0FA 3CRUA 4PQ1A 3N9JA 4OFMA 2PPTA 3MSZA 4JR6A 4RQXA 4DSRA 2IMKA 3H8QA 3O6TA 3LXZA 4V1Ag 4Z7XA 2RLIA 2L59A 2IMFA 4FIWA 3FR6A 1TU8A 1OVNA 3HA9A 1VF2A 2R6KA 4O5UA 3L9UA 4FO5A 1JLWA 1YKCA 4EO3A 1Q98A 4X4JA 1T7PB 2C0DA 3ED3A 2GQKA 2N5BA 1ZYEA 20GSA 1GNWA 2NDOA 1TOFA 4L8EA 5G31A 3FW2A 4EXJA 2GTUA 3C1SA 1T00A 2H01A 1ERWA 3EINA 4XRAA 2VCQA 4NV5A 2M72A 3APQA 1PX6A 1OC3A 1V58A 3GKNA 6GSSA 1ILOA 1OC9A 2GT6A 1K0OA 4K0NA 3F3RA 1QQ2A 2QGVA 1K0MA 1A0RP 4POKA 2V32A 3E0UA 3EVIA 4XS6A 4HSCX 4YAPA 1FOVA 4TXOA 4ZL8A 2IMDA 4IQAA 2HZEA 3RAZA 5F07A 2WB9A 1O8XA 3D4MA 3SBCA 2DMMA 5ECNB 2AAWA 3FZ9A 2L4QA 1J0FA 2VO4A 2GSQA 5KN0A 4K6XA 2PBJA 1XZOA 4K7NA 5D73A 3HYPA 5ECOB 1YEXA 2H73A 2DKIA 4EIQA 4NWYA 14GSA 5B7CA 1SKWB 2CX4A 3CXGA 4HJ2A 4IS0A 4KNDA 2FA8A 4NHWA 1YEPA 3PR8A 3CBUA 4GCIA 2FNOA 5J3RA 1Z7RA 4BVXB 4IGJA 2C0FA 2GSTA 2YZUA 4PTSA 5BMUA 1K3LA 2AB6A 4L5LA 2H19A 3LEFA 3RBTA 3ZVJD 1FO5A 3W8JA 3ZLPA 2M80A 3TDGA 1Z7PA 4HJMA 3FZ4A 2K18A 5LNKe 2F3MA 3GIXA 1XVQA 4KDUA 3TRXA 4TR0A 4IJ3A 2A2RA 5LCZA 2LSTA 3PINA 1I9DA 1O85A 3TKQA 2A2PA 5B6MA 4HEA2 2IL3A 3GX8A 3WGEA 3IDVA 3LG6A 1O7UA 1FVJA 2AYTA 5HR0A 2VL2C 1OYJA 4CW9A 1XWAA 4TOPA 4TR1A 5G5FA 1OKTA 1M0UA 3TRPA 1SJ6A 5ECRB 3M3MA 3GH9A 2X4AA 5KOXA 4V2NA 1PA3A 4OD7A 3GNJA 1Q4JA 2P0GA 3HY2A 1K0DA 5ECIB 5DAKB 5J9BA 1FVKA 1MD3A 5CRHA 4TKYA 3IC4A 3RPPA 6GSUA 1X9MB 3TJBA 3H93A 4AJ8A 1T1VA 1WWJA 2AUVA 3TKSC 4TW5A 4YKGA 4L0UA 1PFOA 5CRGA 3UJ1A 1YQ1A 5IMFA 4Q5FA 1X0RA 1Z9HA 4FH8A 1U88A 4EF0A 4WR5A 2RM6A 1EGRA 1XCCA 1PD21 4ML1A 1KTEA 1M2BA 2H1DA 4MZWA 5CYYA 2I1UA 1M3IA 4EVMA 3GKMA 4XS4A 5IMCA 3MAKA 1XW6A 1F2EA 1SKSB 2AV4A 3TUEA 2VCZA 4NHZA 2I4AA 3DKSA 4K2XA 5INYA 4OO4A 1SL2B 3QD9A 3WYWA 2LQQA 3BCIA 5BRTA 3A3TA 1JLVA 2LRTA 4FYCA 3BCKA 1TJDA 1KEBA 4V2MA 3K8NA 1ZYQB 5G30A 1YKAA 4PUFC 2OE3A 3CSHA 4GLTA 2F9SA 2GZYA 4KUNA 6GSYA 3EU3A 4LA1A 4PGTA 5KN2A 4EDZA 5A4VA 2HSYA 3TOTA 2H1AA 1QXHA 19GSA 1BX9A 3LFLA 4CDOA 2TRXA 3HZ4A 3I9V2 2FUG2 4A5PA 3IOSA 3UARA 3IXRA 4IKHA 2R0PA 4BVYA 2GGTA 3SWLA 1M2AA 1S3RA 4RUVA 4I97A 1VRSD 1V2AA 5D9XA 1DBYA 5JCUA 1YDKA 2IN3A 2QC7A 3W8SA 2L4CA 2JU5A 3O3TA 2YN1A 2NTOA 1TTZA 4E8EA 2VCTA 3P2AA 2DKHA 1X5CA 2FWFA 3TOUA 2MMNA 3VLNA 1F3AA 3UEMA 3KZQA 1PMTA 2FHEA 3UBLA 1YY7A 3QOUA 1TDIA 2OBIA 2YWIA 3HVVA 3FR3A 4EE0A 1AC1A 2FWGA 5G1LA 4MABA 5ENUA 4DEJA 4POLA 5KOWA 1B48A 3E9JB 1MDJA 4MF5A 2YV9A 2IJYA 1ZGNA 3Q6OA 5IMDA 3LWAA 2HSMA 3A2XA 1XIYA 1O6JA 2CQ9A 3JCML 2YJHA 2DBCA 2F8FA 5IM9A 3FZ5A 3L9SA 3H4KA 5F8BA 2DC5A 4CY8A 1TRSA 1OC9B 1K0BA 1XW5A 2MMAA 2XBIA 1B4QA 4DSSA 1W89A 2V6OA 3QR6A 3J7Yk 2DJ1A 2C3NA 2VM1A 4ID0A 3Q74A 4I8BA 5ECHB 3H79A 4TRXA 2VL9A 4USSA 1FB0A 2JADA 3GL5A 3GRXA 5GAPD 3DIEA 16GSA 3E3EA 2RIIA 3VPTA 2WCIA 5G5EA 5EPFA 3GTUA 3CSIA 4BWQA 1S3AA 3ZL5A 4GSTA 1Y6EA 5L71A 3FR9A 2WFCA 2DSAA 4GSSA 2KUCA 4X1UA 4WXTA 4TXVA 9GSSA 1EWXA 2HRKA 4KGIA 4EC0A 4ISDA 4KSOA 1SK0A 1V98A 5AIVA 1RW1A 2BTOT 2IMEA 5E4WA 2HE3A 3F4TA 4WEYA 1M99A 2YPMA 2VUPA 5C04A 4D73A 3A2VA 1GULA 1GSUA 5DQYA 3IR4A 1MDKA 3FMWA 4AF2A 3ME7A 1WJKA 4OCFA 1S3CA 3HD5A 2GS3A 1H75A 3IHGA 1C72A 3KM6A 2B5XA 2R2JA 3ZVJA 2LJKA 2EIOA 2LNTA 3GSTA 2WZ9A 3GUSA 3IHQA 1UN2A 3FYGA 5D9VA 4EUYA 2N5AA 4ILFA 2B1LA 3ISOA 4GRFA 5CRWA 3GKXA 4KSMA 2AHEA 1GP1A 2YV7A 1TP9A 5H5QA 4BWSA 1K0AA 5AGYA 3LJRA 4GXZA 2MMOA 4KAEA 2V1MA 1O8WA 1SYXA 5IO2A 1T4YA 2LNSA 1DE1A 4WKWA 2C4JA 3H1NA 4QQ7A 1BYEA 1YZXA 3G7YA 3L4NA 3KH9A 5D96A 3QMXA 1R7HA 2EIQA 1TK0B 1AW9A 2I81A 3TRQA 4O5RA 3LXTA 1R5AA 1QGVA 3DMLA 1TK8B 1M9AA 6GSVA 2VL2A 2X99A 3IC8A 4DVCA 3R2QA 3KMOA 3IK9A 3F9UA 1SD8A 1QK8A 4OWYA 4ZB6A 1RK4A 4ZB9A 5KN1A 4DSQA 4J2FA 3V1WA 1WRYA 2CZ2A 4ACSA 3KTLA 2OACA 3DWVA 4IVFA 4IELA 1OKDA 5DBQA 1M9BA 4I2UA 4CY6A 3TKSA 4XS4B 1R26A 4XTSA 3GMFA 2J9HA 2BJXA 3KTBA 3P7XA 3IA1A 1SD9A 1GUHA 1T4ZA 2JL4A 3FKFA 5GZZB 1SYRA 17GSA 2VLTA 2OA7A 1EV4A 2A4VA 4ZB8A 3U6VA 2FLSA 3IK7A 5J9CA 4TVEA 2VAFA 4OCEA 1AAZA 2IPAA 4WETA 1MDIA 4O92A 5IMZA 1CQHA 5F06A 3EC3A 4PNGA 4MZCA 3VWUA 3HVSA 3D5JA 1THOA 4O7HA 1TU7A 3VWVA 5E59A 1GUKA 4RI6A 2L5OA 3GL3A 3VI7A 2GT5A 2H76A 2WS2A 2C80A 4EL1A 5HFIA 1JZDA 2H0HA 4BVYB 3C8EA 2V2GA 3EYTA 1IYHA 2X8GA 5IOWA 2YNXA 4KB3A 3CYNA 1UA5A 1KBNA 5JCGA 3TJGA 4KF9A 2TRCP 2H1GA 1I5GA 4OO5A 4O5QA 1PN0A 1LJRA 4K2DA 2G2QA 3J7Yb 2K8SA 4ZBDA 1SK1A 2YWNA 1PL2A 3LYKA 4PUAA 3PGTA 3KP9A 4MF7A 4E8HA 3KP8A 4WF4A 3D0ZA 5H5SA 4KW6A 1A2LA 2XPEA 3RPNA 1RQMA 2C3TA 4QL7A 1GWCA 4ZBBA 1EP8A 2C0GA 2VCVA 3DXBA 2B6MA 3P8WA 1A0FA 3ZMKA 2CAQA 2OADA 3GURA 1GSSA 2KP1A 1Z5YE 3TJFA 5IMAA 5D9WA 4DSSB 3UBKA 2HI7A 5KEJA 1G6WA 2P5QA 5KN3A 5IPGA 3NOFA 4POBA 2FY6A 2OKAA 2F51A 1JZOA 2GSSA 4MMMA 4MCUA 3LYPA 2DIYA 3TJJA 1OE7A 1B8XA 1XXUA 1VF4A 2DJ0A 1FW1A 2CVDA 5HR3A 22GSA 3ZREA 5EL8A 2B5EA 4GWRA 1CQGA 2JSYA 3L78A 1ZZYA 1V9WA 3U5RE 2O89A 4FYUA 1SK2A 4K5RA 2XPDA 3C1RA 3GFKA 2I9HA 1V57A 1BG5A 4GSNA 3IE3A 2IIYA 2GQLA 3DYRA 2C0EA 1THXA 1GTAA 2H6XA 3A5WA 4I2TA 2CZ3A 5DCGA 1XOAA 3LORA 4D73B 2XHFA 4ULXA 2F8AA 3CTGA 5B8BA 1ABAA 2VLUA 3ERGA 5ECLB 2JZTA 5CNWA 1H4OA 4MA9A 2LJAA 2KP2A 5CREA 2HRFA 4I5QA 5GAND 4NXIA 1JZWA 4BA7A 2MZCA 1JFUA 1GSQA 1PKZA 3TB2A 3HJMA 2LV3A 4G19A 4O32A 5B6NA 1KNGA 3D6IA 1K3YA 2H1BA 3F4RA 2RUEA 4JRRA 4L5OA 4IJIA 18GSA 3G7IA 3VWXA 2K8VA 4ECJA 1URMA 3UVHA 2Z9SA 4KA0A 1NHYA 4G0IA 1B9YC 1SJIA 3HHVA 2H0GA 2GSRA 1HYUA 3HZ8A 5G2ZA 3TKSE 2R0GA 3LQ7A 3ZIVA 3QAWA 6GSWA 1A2JA 2JACA 5EY6A 1Y25A 1IYIA 2HRNA 2H71A 4XHMA 1N8JA 1FOHA 3VI5A 2ZUPA 3HKRA 2WULA 2HFDA 1TRUA 5ECKB 1GL8A 1J9BA 2DLXA 1E2YA 1AXDA 3IAS2 4XRDA 2JZSA 4BPYA 2PMTA 1GSDA 5HFKA 4FQUA 4MDCA 4IP1A 2IFQA 4MZBA 3ZMLA 2E2MA 2AJQB 2HLSA 1ZYPA 4BVXA 3QAGA 7GSSA 1AIUA 2C8UA 2HXKA 2E2GA 5FHIA 1U87A 1UVZA 3D22A 4BL7A 3MNGA 4MJBA 4AGSA 4WBJA 4IP6A 2L6DA 4JU5A 1HNCA 2BMXA 13GSA 1TW9A 1M7TA 2R5GA 3APOA 2R37A 3FY7A 4CHSA 4WR4A 1GTBA 3HCZA 4HZ4A 4MJAA 1SJZA 1WMJA 3A2WA 1MD4A 1OE8A 2MYGA 4TR3A 1BAYA 1XWBA 1GTIA 1NHOA 3AY8A 4LMVA 4TXOB 1PX7A 2HZEB 4KCEA 11GSA 4Z2TA 3KEBA 3HXSA 5D8IA 4XIHA 1X5EA 3I6AA 2UZ8A 4WF5A 2PVQA 3FK8A 2O7KA 2O8VB 2O87A 5HR1A 1TRWA 1ACVA 1K0NA 1XG8A 1PQNA 5IPHA 2VL3A 3M8NA 1LU4A 2ES7A 3UL3A 3MWHA 2MMZA 2NPBA 3US3A 4K7IA 1WE0A 1XFLA 1DE2A 12GSA 1BJXA 3HVNA 2VLVA 1MTCA 4KX4A 1F6MC 1F37A 4KCAA 4HUAA 2NVLA 3D4TA 3FHKA 4K0GA 5G1KA 2ZNMA 3Q18A 3EWLA 2REMA 2C3QA 2H8LA 3N5OA 4N0VA 5J4UA 4N11A 4PQIA 4ZXGA 1PKWA 2WGRA 2DJ3A 3KD0A 4Q5NA 2YZHA 3ZYWA 4G2EA 2XBQA 4J56E 4BIKA 1SKRB 1J08A 2WDUA 3QFBC 1JHBA 1AQXA 3ZFBA 1U3IA 2H30A 4POMA 1DUGA 2JZRA 1ERTA 3ZTLA 4ECCA 4ECBA 1T8EB 3L9VA 2GQMA 5AIXA 3GYKA 3KIJA 4XS1A 1K0CA 2ON7A 3MDKA 3KMNA 3VFIA 1M2DA 1XWCA 2K6VA 5GSSA 5CP1A 3LSZA
chains in the Genus database with same CATH topology
1XG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XG8 A; 
#chains in the Genus database with same CATH topology
 5F0G A;  1EEJ A;  3R3E A;  3C7M A;  4GQF A;  5HQP A;  3C73 A;  1ZOF A;  4G0K A;  5A5K A;  2X8H A;  1ZYN A;  3QFA C;  4XCS A;  2VIM A;  4EIP A;  2OBK A;  4IW9 A;  2R3X A;  3W6G A;  2FGX A;  4TR1 B;  1JZR A;  2DIZ A;  3EE2 A;  2YWM A;  2DML A;  1B9X C;  1UC7 A;  1PN9 A;  3DRN A;  2FCH A;  4AJ6 A;  2H72 A;  4ICY A;  1PL1 A;  6GST A;  1GSY A;  3IRA A;  3QAV A;  2ALB A;  5J41 A;  4ZBA A;  2A4H A;  3TJK A;  1EOH A;  3GKK A;  4YQM A;  2B7K A;  2D2Z A;  5DAL A;  3P90 A;  2KOK A;  1NSW A;  1ZL9 A;  2ZCT A;  4NV2 A;  4KDX A;  2YJ7 A;  3IV4 A;  1PRX A;  4K8M A;  2LS5 A;  5AIS A;  2DJ2 A;  4JE1 A;  1ERV A;  2PGT A;  2YCD A;  1PSQ A;  4HS1 A;  2WRT A;  2H0I A;  2CA8 A;  2FWH A;  4I6X A;  5J5N A;  2NBS A;  2GDR A;  3NZN A;  2QA1 A;  1G0T A;  1HQO A;  3CMI A;  5A4U A;  1W4V A;  1ERU A;  5DQS A;  3KCM A;  2M46 A;  3IAM 2;  5ID2 A;  2HNL A;  3M9J A;  5CAX A;  4MH2 A;  1U3A A;  5AN1 A;  2CV4 A;  1U6T A;  4OFT A;  3D21 A;  2QSI A;  2CVB A;  2R0C A;  4KDY A;  5IOX A;  3F6F A;  3WGX A;  2X49 A;  4LL4 B;  3MYD A;  1XPV A;  2LJR A;  3ZFL A;  4X43 A;  3WT1 A;  2B3S A;  1ON4 A;  3ZIT A;  4H86 A;  3F4S A;  4KE3 A;  4YKF A;  4IN0 A;  2LUS A;  3TCO A;  5A4W A;  10GS A;  4AJ7 A;  3TKP A;  1G6Y A;  1WIK A;  1XW9 A;  4JZQ A;  2LQO A;  1OAZ A;  1FHE A;  2CT6 A;  3KGK A;  3F0I A;  3M1G A;  5DVB A;  2OJL A;  2HRA A;  2HYX A;  4HU9 A;  2VM2 A;  3VK9 A;  5ABR A;  2E7P A;  1QUW A;  2IFQ B;  2QKE A;  1EP7 A;  1QFN A;  3RHB A;  4MF6 A;  4HQZ A;  2LEG A;  5H5R A;  2B7J A;  2L57 A;  5IQY A;  1AUC A;  1GUM A;  1WOU A;  2PWJ A;  1Z3E A;  2GLR A;  3G7J A;  5DDL A;  5B8A A;  3APS A;  2JSZ A;  1EV9 A;  4YH2 A;  4BL7 B;  5DJM A;  1ST9 A;  1GLP A;  4NPB A;  1R5P A;  5ELA A;  5JCW A;  3CTF A;  4RQR A;  1WP0 A;  5HR2 A;  3GA4 A;  4K1F A;  1YF1 A;  2V6K A;  2YAN A;  3QPM A;  1X5D A;  1GH2 A;  2C1Y A;  2J23 A;  5DCH A;  1DSB A;  1G7O A;  1T3B A;  6GSX A;  1TK5 B;  3PPU A;  2RUF A;  1O73 A;  2I3Y A;  3ZZX A;  3GV1 A;  2GZZ A;  1XBS A;  1MEK A;  4N10 A;  2MBS A;  2EC4 A;  1E6B A;  3PH9 A;  1NW2 A;  2H6Z A;  1M3J A;  2PU9 C;  3GTU B;  4ML6 A;  4PQH A;  1F9M A;  2FA4 A;  5ECS A;  1V40 A;  1N2A A;  4NAX A;  2LTK A;  5EVO A;  1LBK A;  3M9K A;  4ZL9 A;  3MIX A;  2VD1 A;  3EU4 A;  2O85 A;  1F3B A;  4Z2U A;  1YF0 A;  3C71 A;  3LW9 A;  4HDE A;  5HFG A;  2R4V A;  1SU9 A;  4F0B A;  4GTU A;  3DGQ A;  2QA2 A;  5F05 A;  2CAI A;  1PGT A;  3EUR A;  2TIR A;  1QMV A;  4MJC A;  3S9F A;  3KH7 A;  4HQS A;  3NIV A;  1BED A;  4PX1 A;  3G9B A;  4G9H A;  3WGD A;  1XWG A;  5FWG A;  1EEM A;  2B5Y A;  4F9Z A;  5DJL A;  4LLR A;  3F3Q A;  5IIZ A;  4F0C A;  1GRX A;  2PUK C;  3ERW A;  4YAV A;  1HNB A;  4MK3 A;  4LMW A;  2P5R A;  2PN8 A;  4Q5R A;  3HDC A;  1S3D A;  5IMV A;  1A23 A;  1OC8 A;  4KH7 A;  3BJ5 A;  3UIW A;  1GSF A;  4L0W A;  4K9Z A;  4PUR A;  2X64 A;  1A24 A;  5CO3 A;  2GVP A;  5JWQ B;  4MJE A;  2HZF A;  4N30 A;  1O81 A;  3O76 A;  4MP4 A;  1B4P A;  2ON5 A;  2K9F A;  1K3O A;  3CQF A;  3HJO A;  2RM5 A;  2CVK A;  4ZIJ A;  4P3Y B;  3ERF A;  3ZRD A;  3A5I A;  4MLY A;  3KJY A;  4MH3 A;  5ECP B;  4Z2R A;  2CX3 A;  1ZMA A;  1XWK A;  2XC2 A;  2FD3 A;  1GTU A;  5DAL B;  4EDY A;  3OR5 A;  1SL1 B;  1A8Y A;  4N0Z A;  4EKZ A;  1X9S B;  1GSE A;  3F6D A;  2VOC A;  1BQ7 A;  2HT9 A;  2WJU A;  3DVX A;  1G7E A;  3QCP A;  1GLQ A;  2E0Q A;  1X9W B;  3DD3 A;  1VF1 A;  1R4W A;  3DVW A;  2H75 A;  2KLX A;  4NMU A;  1YJ6 A;  3TKR A;  3UVT A;  3FEU A;  5GST A;  5FT3 A;  3UAP A;  2V41 A;  2VCW A;  3BD2 A;  4PNF A;  1USB A;  2VCX A;  2YP6 A;  2A2S A;  1NM3 A;  1XVW A;  5IO0 A;  2GZP A;  3VWW A;  4WBR D;  2DJJ A;  4HOJ A;  3HJP A;  4HZ2 A;  4ZL7 A;  2H74 A;  4G10 A;  4QL9 A;  3FZA A;  2OE0 A;  1SEN A;  4J57 E;  4JR4 A;  5ID2 B;  4V2L A;  2P31 A;  3EMX A;  3IPZ A;  3EPT A;  3GHA A;  1TI1 A;  1AQW A;  4V1A p;  4Q5Q A;  1WPI A;  4F82 A;  4OFN A;  2H70 A;  2FWE A;  3VPQ A;  3FRC A;  5C00 A;  1ZCP A;  1GNE A;  3BBY A;  1ML6 A;  3I69 A;  2KHP A;  2MBT A;  3EMP A;  2YOI A;  3WT2 A;  5DAK A;  2H6Y A;  2IMI A;  4F2I A;  4X0X A;  2LRC A;  3I43 A;  4G0L A;  1TRV A;  3KXO A;  1EOG A;  3M0F A;  4HU7 A;  2HSH A;  3L0H A;  5LD0 A;  4TN8 A;  2L5L A;  1TKD B;  2PER A;  4HI7 A;  4K5S A;  1EGO A;  3GH6 A;  5D93 A;  3GSS A;  3QDN A;  2H66 A;  1TXX A;  3RDW A;  1HD2 A;  3TGZ A;  1TI3 A;  4YQU A;  2LRN A;  1HNA A;  1EZK A;  1FG4 A;  2IWT A;  1VGL A;  4MPG A;  5ELG A;  3GN3 A;  2N5F A;  3VUR A;  4GQC A;  4IHU A;  3WD6 A;  1Z6N A;  4ZIL A;  3F63 A;  4PXO A;  1A2M A;  4IBP A;  3UMA A;  3UOM A;  1VF3 A;  2VD0 A;  5ECQ B;  4OMV A;  2X8C A;  4GF0 A;  1A8L A;  1Z6M A;  3RHC A;  3F8U A;  3LGC A;  5ECM B;  2L6C A;  8GSS A;  4JBB A;  3HVX A;  3ME8 A;  5COH A;  4K7O A;  5CRD A;  3CSJ A;  1FAA A;  3CRT A;  4MNN A;  5D9T A;  1SL0 B;  2DJK A;  4YQV A;  4JED A;  4TR4 A;  1XOB A;  1FB6 A;  3IBH A;  3DEX A;  3ZIJ A;  2YWO A;  3BOA A;  4MPF A;  2LKU A;  4F03 A;  3GX0 A;  4IQ1 A;  2EIR A;  2PVO C;  4ECI A;  3Q19 A;  4FYB A;  4LL1 B;  5JWO B;  4RI7 A;  2B1K A;  2OE1 A;  1AQV A;  5JWR B;  2G0F A;  3CRU A;  4PQ1 A;  3N9J A;  4OFM A;  2PPT A;  3MSZ A;  4JR6 A;  4RQX A;  4DSR A;  2IMK A;  3H8Q A;  3O6T A;  3LXZ A;  4V1A g;  4Z7X A;  2RLI A;  2L59 A;  2IMF A;  4FIW A;  3FR6 A;  1TU8 A;  1OVN A;  3HA9 A;  1VF2 A;  2R6K A;  4O5U A;  3L9U A;  4FO5 A;  1JLW A;  1YKC A;  4EO3 A;  1Q98 A;  4X4J A;  1T7P B;  2C0D A;  3ED3 A;  2GQK A;  2N5B A;  1ZYE A;  20GS A;  1GNW A;  2NDO A;  1TOF A;  4L8E A;  5G31 A;  3FW2 A;  4EXJ A;  2GTU A;  3C1S A;  1T00 A;  2H01 A;  1ERW A;  3EIN A;  4XRA A;  2VCQ A;  4NV5 A;  2M72 A;  3APQ A;  1PX6 A;  1OC3 A;  1V58 A;  3GKN A;  6GSS A;  1ILO A;  1OC9 A;  2GT6 A;  1K0O A;  4K0N A;  3F3R A;  1QQ2 A;  2QGV A;  1K0M A;  1A0R P;  4POK A;  2V32 A;  3E0U A;  3EVI A;  4XS6 A;  4HSC X;  4YAP A;  1FOV A;  4TXO A;  4ZL8 A;  2IMD A;  4IQA A;  2HZE A;  3RAZ A;  5F07 A;  2WB9 A;  1O8X A;  3D4M A;  3SBC A;  2DMM A;  5ECN B;  2AAW A;  3FZ9 A;  2L4Q A;  1J0F A;  2VO4 A;  2GSQ A;  5KN0 A;  4K6X A;  2PBJ A;  1XZO A;  4K7N A;  5D73 A;  3HYP A;  5ECO B;  1YEX A;  2H73 A;  2DKI A;  4EIQ A;  4NWY A;  14GS A;  5B7C A;  1SKW B;  2CX4 A;  3CXG A;  4HJ2 A;  4IS0 A;  4KND A;  2FA8 A;  4NHW A;  1YEP A;  3PR8 A;  3CBU A;  4GCI A;  2FNO A;  5J3R A;  1Z7R A;  4BVX B;  4IGJ A;  2C0F A;  2GST A;  2YZU A;  4PTS A;  5BMU A;  1K3L A;  2AB6 A;  4L5L A;  2H19 A;  3LEF A;  3RBT A;  3ZVJ D;  1FO5 A;  3W8J A;  3ZLP A;  2M80 A;  3TDG A;  1Z7P A;  4HJM A;  3FZ4 A;  2K18 A;  5LNK e;  2F3M A;  3GIX A;  1XVQ A;  4KDU A;  3TRX A;  4TR0 A;  4IJ3 A;  2A2R A;  5LCZ A;  2LST A;  3PIN A;  1I9D A;  1O85 A;  3TKQ A;  2A2P A;  5B6M A;  4HEA 2;  2IL3 A;  3GX8 A;  3WGE A;  3IDV A;  3LG6 A;  1O7U A;  1FVJ A;  2AYT A;  5HR0 A;  2VL2 C;  1OYJ A;  4CW9 A;  1XWA A;  4TOP A;  4TR1 A;  5G5F A;  1OKT A;  1M0U A;  3TRP A;  1SJ6 A;  5ECR B;  3M3M A;  3GH9 A;  2X4A A;  5KOX A;  4V2N A;  1PA3 A;  4OD7 A;  3GNJ A;  1Q4J A;  2P0G A;  3HY2 A;  1K0D A;  5ECI B;  5DAK B;  5J9B A;  1FVK A;  1MD3 A;  5CRH A;  4TKY A;  3IC4 A;  3RPP A;  6GSU A;  1X9M B;  3TJB A;  3H93 A;  4AJ8 A;  1T1V A;  1WWJ A;  2AUV A;  3TKS C;  4TW5 A;  4YKG A;  4L0U A;  1PFO A;  5CRG A;  3UJ1 A;  1YQ1 A;  5IMF A;  4Q5F A;  1X0R A;  1Z9H A;  4FH8 A;  1U88 A;  4EF0 A;  4WR5 A;  2RM6 A;  1EGR A;  1XCC A;  1PD2 1;  4ML1 A;  1KTE A;  1M2B A;  2H1D A;  4MZW A;  5CYY A;  2I1U A;  1M3I A;  4EVM A;  3GKM A;  4XS4 A;  5IMC A;  3MAK A;  1XW6 A;  1F2E A;  1SKS B;  2AV4 A;  3TUE A;  2VCZ A;  4NHZ A;  2I4A A;  3DKS A;  4K2X A;  5INY A;  4OO4 A;  1SL2 B;  3QD9 A;  3WYW A;  2LQQ A;  3BCI A;  5BRT A;  3A3T A;  1JLV A;  2LRT A;  4FYC A;  3BCK A;  1TJD A;  1KEB A;  4V2M A;  3K8N A;  1ZYQ B;  5G30 A;  1YKA A;  4PUF C;  2OE3 A;  3CSH A;  4GLT A;  2F9S A;  2GZY A;  4KUN A;  6GSY A;  3EU3 A;  4LA1 A;  4PGT A;  5KN2 A;  4EDZ A;  5A4V A;  2HSY A;  3TOT A;  2H1A A;  1QXH A;  19GS A;  1BX9 A;  3LFL A;  4CDO A;  2TRX A;  3HZ4 A;  3I9V 2;  2FUG 2;  4A5P A;  3IOS A;  3UAR A;  3IXR A;  4IKH A;  2R0P A;  4BVY A;  2GGT A;  3SWL A;  1M2A A;  1S3R A;  4RUV A;  4I97 A;  1VRS D;  1V2A A;  5D9X A;  1DBY A;  5JCU A;  1YDK A;  2IN3 A;  2QC7 A;  3W8S A;  2L4C A;  2JU5 A;  3O3T A;  2YN1 A;  2NTO A;  1TTZ A;  4E8E A;  2VCT A;  3P2A A;  2DKH A;  1X5C A;  2FWF A;  3TOU A;  2MMN A;  3VLN A;  1F3A A;  3UEM A;  3KZQ A;  1PMT A;  2FHE A;  3UBL A;  1YY7 A;  3QOU A;  1TDI A;  2OBI A;  2YWI A;  3HVV A;  3FR3 A;  4EE0 A;  1AC1 A;  2FWG A;  5G1L A;  4MAB A;  5ENU A;  4DEJ A;  4POL A;  5KOW A;  1B48 A;  3E9J B;  1MDJ A;  4MF5 A;  2YV9 A;  2IJY A;  1ZGN A;  3Q6O A;  5IMD A;  3LWA A;  2HSM A;  3A2X A;  1XIY A;  1O6J A;  2CQ9 A;  3JCM L;  2YJH A;  2DBC A;  2F8F A;  5IM9 A;  3FZ5 A;  3L9S A;  3H4K A;  5F8B A;  2DC5 A;  4CY8 A;  1TRS A;  1OC9 B;  1K0B A;  1XW5 A;  2MMA A;  2XBI A;  1B4Q A;  4DSS A;  1W89 A;  2V6O A;  3QR6 A;  3J7Y k;  2DJ1 A;  2C3N A;  2VM1 A;  4ID0 A;  3Q74 A;  4I8B A;  5ECH B;  3H79 A;  4TRX A;  2VL9 A;  4USS A;  1FB0 A;  2JAD A;  3GL5 A;  3GRX A;  5GAP D;  3DIE A;  16GS A;  3E3E A;  2RII A;  3VPT A;  2WCI A;  5G5E A;  5EPF A;  3GTU A;  3CSI A;  4BWQ A;  1S3A A;  3ZL5 A;  4GST A;  1Y6E A;  5L71 A;  3FR9 A;  2WFC A;  2DSA A;  4GSS A;  2KUC A;  4X1U A;  4WXT A;  4TXV A;  9GSS A;  1EWX A;  2HRK A;  4KGI A;  4EC0 A;  4ISD A;  4KSO A;  1SK0 A;  1V98 A;  5AIV A;  1RW1 A;  2BTO T;  2IME A;  5E4W A;  2HE3 A;  3F4T A;  4WEY A;  1M99 A;  2YPM A;  2VUP A;  5C04 A;  4D73 A;  3A2V A;  1GUL A;  1GSU A;  5DQY A;  3IR4 A;  1MDK A;  3FMW A;  4AF2 A;  3ME7 A;  1WJK A;  4OCF A;  1S3C A;  3HD5 A;  2GS3 A;  1H75 A;  3IHG A;  1C72 A;  3KM6 A;  2B5X A;  2R2J A;  3ZVJ A;  2LJK A;  2EIO A;  2LNT A;  3GST A;  2WZ9 A;  3GUS A;  3IHQ A;  1UN2 A;  3FYG A;  5D9V A;  4EUY A;  2N5A A;  4ILF A;  2B1L A;  3ISO A;  4GRF A;  5CRW A;  3GKX A;  4KSM A;  2AHE A;  1GP1 A;  2YV7 A;  1TP9 A;  5H5Q A;  4BWS A;  1K0A A;  5AGY A;  3LJR A;  4GXZ A;  2MMO A;  4KAE A;  2V1M A;  1O8W A;  1SYX A;  5IO2 A;  1T4Y A;  2LNS A;  1DE1 A;  4WKW A;  2C4J A;  3H1N A;  4QQ7 A;  1BYE A;  1YZX A;  3G7Y A;  3L4N A;  3KH9 A;  5D96 A;  3QMX A;  1R7H A;  2EIQ A;  1TK0 B;  1AW9 A;  2I81 A;  3TRQ A;  4O5R A;  3LXT A;  1R5A A;  1QGV A;  3DML A;  1TK8 B;  1M9A A;  6GSV A;  2VL2 A;  2X99 A;  3IC8 A;  4DVC A;  3R2Q A;  3KMO A;  3IK9 A;  3F9U A;  1SD8 A;  1QK8 A;  4OWY A;  4ZB6 A;  1RK4 A;  4ZB9 A;  5KN1 A;  4DSQ A;  4J2F A;  3V1W A;  1WRY A;  2CZ2 A;  4ACS A;  3KTL A;  2OAC A;  3DWV A;  4IVF A;  4IEL A;  1OKD A;  5DBQ A;  1M9B A;  4I2U A;  4CY6 A;  3TKS A;  4XS4 B;  1R26 A;  4XTS A;  3GMF A;  2J9H A;  2BJX A;  3KTB A;  3P7X A;  3IA1 A;  1SD9 A;  1GUH A;  1T4Z A;  2JL4 A;  3FKF A;  5GZZ B;  1SYR A;  17GS A;  2VLT A;  2OA7 A;  1EV4 A;  2A4V A;  4ZB8 A;  3U6V A;  2FLS A;  3IK7 A;  5J9C A;  4TVE A;  2VAF A;  4OCE A;  1AAZ A;  2IPA A;  4WET A;  1MDI A;  4O92 A;  5IMZ A;  1CQH A;  5F06 A;  3EC3 A;  4PNG A;  4MZC A;  3VWU A;  3HVS A;  3D5J A;  1THO A;  4O7H A;  1TU7 A;  3VWV A;  5E59 A;  1GUK A;  4RI6 A;  2L5O A;  3GL3 A;  3VI7 A;  2GT5 A;  2H76 A;  2WS2 A;  2C80 A;  4EL1 A;  5HFI A;  1JZD A;  2H0H A;  4BVY B;  3C8E A;  2V2G A;  3EYT A;  1IYH A;  2X8G A;  5IOW A;  2YNX A;  4KB3 A;  3CYN A;  1UA5 A;  1KBN A;  5JCG A;  3TJG A;  4KF9 A;  2TRC P;  2H1G A;  1I5G A;  4OO5 A;  4O5Q A;  1PN0 A;  1LJR A;  4K2D A;  2G2Q A;  3J7Y b;  2K8S A;  4ZBD A;  1SK1 A;  2YWN A;  1PL2 A;  3LYK A;  4PUA A;  3PGT A;  3KP9 A;  4MF7 A;  4E8H A;  3KP8 A;  4WF4 A;  3D0Z A;  5H5S A;  4KW6 A;  1A2L A;  2XPE A;  3RPN A;  1RQM A;  2C3T A;  4QL7 A;  1GWC A;  4ZBB A;  1EP8 A;  2C0G A;  2VCV A;  3DXB A;  2B6M A;  3P8W A;  1A0F A;  3ZMK A;  2CAQ A;  2OAD A;  3GUR A;  1GSS A;  2KP1 A;  1Z5Y E;  3TJF A;  5IMA A;  5D9W A;  4DSS B;  3UBK A;  2HI7 A;  5KEJ A;  1G6W A;  2P5Q A;  5KN3 A;  5IPG A;  3NOF A;  4POB A;  2FY6 A;  2OKA A;  2F51 A;  1JZO A;  2GSS A;  4MMM A;  4MCU A;  3LYP A;  2DIY A;  3TJJ A;  1OE7 A;  1B8X A;  1XXU A;  1VF4 A;  2DJ0 A;  1FW1 A;  2CVD A;  5HR3 A;  22GS A;  3ZRE A;  5EL8 A;  2B5E A;  4GWR A;  1CQG A;  2JSY A;  3L78 A;  1ZZY A;  1V9W A;  3U5R E;  2O89 A;  4FYU A;  1SK2 A;  4K5R A;  2XPD A;  3C1R A;  3GFK A;  2I9H A;  1V57 A;  1BG5 A;  4GSN A;  3IE3 A;  2IIY A;  2GQL A;  3DYR A;  2C0E A;  1THX A;  1GTA A;  2H6X A;  3A5W A;  4I2T A;  2CZ3 A;  5DCG A;  1XOA A;  3LOR A;  4D73 B;  2XHF A;  4ULX A;  2F8A A;  3CTG A;  5B8B A;  1ABA A;  2VLU A;  3ERG A;  5ECL B;  2JZT A;  5CNW A;  1H4O A;  4MA9 A;  2LJA A;  2KP2 A;  5CRE A;  2HRF A;  4I5Q A;  5GAN D;  4NXI A;  1JZW A;  4BA7 A;  2MZC A;  1JFU A;  1GSQ A;  1PKZ A;  3TB2 A;  3HJM A;  2LV3 A;  4G19 A;  4O32 A;  5B6N A;  1KNG A;  3D6I A;  1K3Y A;  2H1B A;  3F4R A;  2RUE A;  4JRR A;  4L5O A;  4IJI A;  18GS A;  3G7I A;  3VWX A;  2K8V A;  4ECJ A;  1URM A;  3UVH A;  2Z9S A;  4KA0 A;  1NHY A;  4G0I A;  1B9Y C;  1SJI A;  3HHV A;  2H0G A;  2GSR A;  1HYU A;  3HZ8 A;  5G2Z A;  3TKS E;  2R0G A;  3LQ7 A;  3ZIV A;  3QAW A;  6GSW A;  1A2J A;  2JAC A;  5EY6 A;  1Y25 A;  1IYI A;  2HRN A;  2H71 A;  4XHM A;  1N8J A;  1FOH A;  3VI5 A;  2ZUP A;  3HKR A;  2WUL A;  2HFD A;  1TRU A;  5ECK B;  1GL8 A;  1J9B A;  2DLX A;  1E2Y A;  1AXD A;  3IAS 2;  4XRD A;  2JZS A;  4BPY A;  2PMT A;  1GSD A;  5HFK A;  4FQU A;  4MDC A;  4IP1 A;  2IFQ A;  4MZB A;  3ZML A;  2E2M A;  2AJQ B;  2HLS A;  1ZYP A;  4BVX A;  3QAG A;  7GSS A;  1AIU A;  2C8U A;  2HXK A;  2E2G A;  5FHI A;  1U87 A;  1UVZ A;  3D22 A;  4BL7 A;  3MNG A;  4MJB A;  4AGS A;  4WBJ A;  4IP6 A;  2L6D A;  4JU5 A;  1HNC A;  2BMX A;  13GS A;  1TW9 A;  1M7T A;  2R5G A;  3APO A;  2R37 A;  3FY7 A;  4CHS A;  4WR4 A;  1GTB A;  3HCZ A;  4HZ4 A;  4MJA A;  1SJZ A;  1WMJ A;  3A2W A;  1MD4 A;  1OE8 A;  2MYG A;  4TR3 A;  1BAY A;  1XWB A;  1GTI A;  1NHO A;  3AY8 A;  4LMV A;  4TXO B;  1PX7 A;  2HZE B;  4KCE A;  11GS A;  4Z2T A;  3KEB A;  3HXS A;  5D8I A;  4XIH A;  1X5E A;  3I6A A;  2UZ8 A;  4WF5 A;  2PVQ A;  3FK8 A;  2O7K A;  2O8V B;  2O87 A;  5HR1 A;  1TRW A;  1ACV A;  1K0N A;  1XG8 A;  1PQN A;  5IPH A;  2VL3 A;  3M8N A;  1LU4 A;  2ES7 A;  3UL3 A;  3MWH A;  2MMZ A;  2NPB A;  3US3 A;  4K7I A;  1WE0 A;  1XFL A;  1DE2 A;  12GS A;  1BJX A;  3HVN A;  2VLV A;  1MTC A;  4KX4 A;  1F6M C;  1F37 A;  4KCA A;  4HUA A;  2NVL A;  3D4T A;  3FHK A;  4K0G A;  5G1K A;  2ZNM A;  3Q18 A;  3EWL A;  2REM A;  2C3Q A;  2H8L A;  3N5O A;  4N0V A;  5J4U A;  4N11 A;  4PQI A;  4ZXG A;  1PKW A;  2WGR A;  2DJ3 A;  3KD0 A;  4Q5N A;  2YZH A;  3ZYW A;  4G2E A;  2XBQ A;  4J56 E;  4BIK A;  1SKR B;  1J08 A;  2WDU A;  3QFB C;  1JHB A;  1AQX A;  3ZFB A;  1U3I A;  2H30 A;  4POM A;  1DUG A;  2JZR A;  1ERT A;  3ZTL A;  4ECC A;  4ECB A;  1T8E B;  3L9V A;  2GQM A;  5AIX A;  3GYK A;  3KIJ A;  4XS1 A;  1K0C A;  2ON7 A;  3MDK A;  3KMN A;  3VFI A;  1M2D A;  1XWC A;  2K6V A;  5GSS A;  5CP1 A;  3LSZ A; 
#chains in the Genus database with same CATH homology
 1XG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...