1XGPB

Structure for antibody hyhel-63 y33a mutant complexed with hen egg lysozyme
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
210
structure length
210
Chain Sequence
b'EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDAWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgpB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgpB02
4TUOA 4MXWH 4Y5XB 1OTTD 4J6RH 2Z31B 4NRYB 1KPVB 4NJ9L 4KPHL 4CADB 5TF1L 2C3VB 4P48A 4TUKH 5C0AE 4L3CA 4PRPB 3QO0B 3BWUC 5I8KL 2VITB 5BCAA 3L9RB 1JF6A 2PUQT 3FONA 3N50A 4LLWB 4PBXA 3GBNH 3J7HA 4RGNE 3TBVB 1RJLB 4BQBA 1Q72H 5KBNC 1PDKA 2WAHA 4XHJD 5I8EA 3ZSTA 5KSAA 5H2BA 5GGQL 5IFHH 2MMXA 1PD6A 3WN5A 4Z0BL 4AT6A 1NH6A 1YC7A 5FECA 1G9NC 1AIFB 3I84A 2LAGB 3QCTH 4NSKA 3IFLH 4H26A 4NN7B 2HFEA 3FKUS 3TA3A 5EA0H 1PYWA 1VKXB 5MHSE 3QIWB 5ITFA 2R4RL 3CK0L 4MS8C 4P4KB 3WL9A 4U1HA 1FSKC 3ARGA 1E4XL 2XXCB 4M5ZH 2G60H 3V95A 1K8IA 4TULL 2OK0L 5DR5L 3SE9H 1EX0A 5I73B 4JO1L 4F2MB 4LPWA 5DJYA 1YECH 3X3GL 4NPYB 3U0WH 1NGZA 3R06A 1SYSB 2X4NA 5BMFL 4EUPB 5F6HI 4GQ9L 4MD5B 4GMTL 3OJ2C 1G6RL 3ARDB 2OTPA 4P3WA 3HC0A 4QYOA 5DWUH 1HH9B 4ZPTA 4LMQI 2BK8A 1LNUB 4NQVB 3C2AL 3KYKH 3FJTA 3SQBA 3ZKMD 4JZNA 1CFTA 3LKNA 4MB4A 5DHVH 1EHAA 5B39B 1IC4H 1JGLL 5HYJA 3A6OA 4J3XA 3P4MB 1EAJA 3EYQC 4JZOB 3RVXD 3GMOB 4UBDC 1IFHL 2DQFA 4K3DH 1U93B 2IQAB 3WXWH 4PB0L 1VEOA 4PGCA 3ECBB 1W2KT 3NCYP 2G2RA 3CD4A 1HYSD 1U9KA 1YY9C 4ODXA 1UB5B 2QSQA 3N1PC 4QLRA 3SE3A 2ADIB 1OGAA 1HHKA 4G9DA 2X1XR 1CE1L 2DQUH 1EEZB 4U0QB 3K8KA 1M7XA 2E8ZA 1KYOK 2ITCB 1KCSH 4R4FL 3OBAA 1S5HB 3AAZA 5EZLA 3C6LA 3QDGA 1K4CB 5L0QB 3FQRA 3QNZA 3RVWD 2CH8A 4X6FA 3MV8D 4XCCH 1MRCL 5F44A 1UZ8A 2MKLC 1FVDA 1FAIL 3REVB 3WE6A 3AREB 3MRRB 4YHOL 3G5VA 2I27N 4JPVH 2EECA 4FTVD 4ZUWA 4DTGL 3OR6A 5GHWL 5FYLH 3X11A 4W6YB 4QHMA 5T3ZL 5E9DE 3MLZH 1SVZA 2EDRA 2JB5L 4GG8A 5BZWB 2OTWA 3GSWB 3QWOA 4JFFA 5KN5A 3S4SA 3T2NL 1X5HA 4YC2C 5LGKA 3T8XA 3FMGL 1UACL 4O5LL 1B2WH 5IB1A 5ADOH 1N0XL 1V05A 4HIJB 4OLWH 4PJXA 3QFJE 4L3AA 2BCKA 1ZSDA 4XCYA 1EFQA 3PL6A 4EDXA 3BYYA 1SEBA 4ONHA 5D7LE 4K3EH 4N9GA 5GS1C 4QRPE 2WIMA 3FB6B 1TMCB 1OB1B 3GHBH 3EW3B 4MB3A 3G5YB 2RB8A 4OQTH 3DV6A 5D5MA 4Z5RB 3V6BR 3CDFA 3VXUD 1G7MA 3S3SA 1RJYA 3JV6B 1JZ6A 2ADGB 1PKQE 1IAMA 1N2RB 1QRNB 4NQDA 4S1DC 1ZT4A 5ELIA 2BNQB 4YPJA 3T4AA 1CG9B 4YDLB 1ZT1B 4UT7H 5T1LB 2P48B 3TZVA 2B1AL 1Q9KB 3OAUL 3LRGA 5CD3A 4GH7B 4HWNA 2BOBA 3EYVB 3MA9L 3TPUB 4L8BB 5F9WB 5SWSB 3IF1A 3BEWB 2JTDA 3IU3B 3KYMB 3B9EA 3O4LE 1U2CA 4EVNA 4M7ZB 4ZUVB 5LAXA 1AC6A 1W72L 3S88H 3QCUL 3C8HA 3T1FA 4FTVB 3FAXA 2BSSA 1SBSH 5TDPB 3KLHC 3O9WA 3PQYD 5IWLC 1HHJB 3ZTJG 3VXTB 1QLEH 2JJVA 2VH5L 3DX6A 1FFQA 4APQB 4Y2DC 3U4BH 5F7HA 5K9QI 4S0SD 1ED3B 1A4JB 1CI5A 3QIUB 2DRUA 3MV9E 1S7WA 3HRPA 2WW8A 4YHIB 4R26H 3D87B 3CFKA 4IJ3B 2CRYA 3OKLA 4OGAD 5TPWH 5I66A 1IGML 2EDHA 2NLJB 3O6KH 3ZYJA 2WM0A 1SMOA 4TNVF 1QPPA 3FQXB 1LD9B 3GBML 2DQGL 3F7VB 1U8HA 3LQAH 2BERA 3P0YL 4ODTL 3STLA 2E7HA 5E2TH 2AGJL 2VABB 2B2XL 4Z7UF 3PP3K 5E2UH 1NFKA 5HHOD 5DVLA 3U82B 2MSPA 4OIIH 4ZSOA 2OMBA 5E2JA 2QJDA 4IRSC 5B38B 2FH8A 4PIRF 2AXGB 4XPAH 3B43A 1A9BA 4GW4B 3RKDD 2DAVA 2Y06L 3SDYH 3VXUB 3BP6A 1LO4H 2X4RB 5ECJE 4KH2A 3THML 4PRIE 4Q6IA 4HGKC 5HGDA 1AE6H 4KJWD 3MRNA 4RAUA 2JB6A 4OZFH 1XT5A 3WSQH 3NIDF 1NUGA 2IGFH 1AGEB 1HNGA 1F3JB 3DGCR 4LLMA 3V52H 5B3NA 1CGYA 5H94B 1RU9H 2BXYA 3K8LA 4O9HH 4YHLH 5AZEL 1PY9A 5JDSA 4JANA 5C08B 5E5MA 1C7TA 2D7MA 3UYRL 2MQCA 4RMUA 3MXWH 4PV9B 4J8RB 5DVKA 3EUUA 3C9NB 3BKJH 5DC9B 5TQ2L 2Q76A 3M8OL 3NACH 5JHLL 4L1HA 1RJZA 4NZRL 1B0RB 5LG1A 1YEEL 1JYXA 4K94L 3GSNA 1CDGA 4R0LB 1IGCH 1KJ2A 3LD8C 1RMFH 3HMXL 4I0PC 4WEUD 3UXFA 5HI5C 1FDLH 2A83B 2AP2A 3I75B 4U1JB 5FOBB 2EO9A 4KQ4H 3UP1A 3WIFA 1LGVA 1KB5A 1Y18A 1FLRH 2R39A 4Z7VB 5EU7C 2C5DC 2QLVB 1FZMA 1GGCL 4Y5YB 4JGMA 5IHZA 1BX2A 4HX1A 4LVEA 2R8SH 3JZ7A 1BWWA 1TJIL 1HKLL 4PGEA 3T3PE 5B3JF 4P5TC 1LEIB 4G8GB 2FX7H 4BH7A 1OP5K 5A2LH 2XWJA 3H9SE 3CUPA 5DC4B 4HULB 3KWWA 4X6CF 4XH2A 3QEUA 5HYJD 3ZT6A 1TJHH 2XZAL 5MEQA 1I8IA 2EXYC 3SDAA 3OZ9L 1UVQB 4HH8A 1P53A 5SV4A 3QPXH 1WV7T 4N1EA 2DD8L 3PGCA 4MVBC 4TUOB 3CGTA 5HYSA 4OT1L 4PJ5E 1MCIA 1IGTA 5DD1L 2ZJSL 1GC1H 4Q9QL 4M6OL 4PB9L 2HTKD 1DBAL 4J3OC 2O93L 3QUYD 5C0JA 3BYTA 3H6JA 4LSUH 2O5ZH 1QFWL 1UH3A 2D3VA 1PVHA 5KSBF 3M1BA 1TNMA 1TCMA 4U05A 3FONB 4M3KB 2GJZA 5I8EB 4HF5L 5ICYA 4Z9KB 2D4DA 3QDGD 4FQIH 5IBLC 3ZSSA 3X3FH 3VXQA 5KSAB 5H2BB 4HC1H 4HV8A 1SMAA 3BP4B 3WN5B 4AT6B 3NFPA 4NSKB 5FGSA 1P9MC 2EIDA 1TETL 4H26B 3AMKA 1TIUA 2HFEB 3TA3B 4F57L 1PYWB 4WUKH 3VU2A 1NBVH 4LF3A 5ITFB 1A7OL 1LQSR 1WIPA 2BJMH 1F4XH 3QA3A 1MREH 4FXGA 3DPBA 4U1HB 4PGDA 1UADC 3ARGB 4JO2H 4KRLB 3VFMA 2CRMA 1K8IB 3LKPA 3QEQE 1R5VA 1OOAA 5DJXA 1XIWC 2IANE 2UUDK 3F58L 1WUNT 5DJYB 2V9QA 3K3QA 1NEZG 5C92A 1NGZB 4MXQC 1C5BH 1QSEE 1KXTB 5ICZA 2X4NB 4JKWA 4HG4J 1QHPA 2OZ4H 3PL6D 5T3ZD 1QR1A 1TVDA 4QYOB 1IEHA 4FQCH 5CILL 2HAZA 3TJHC 4ZPTB 3HE6C 4P57A 3SCMC 5D2LE 1IAIL 2J12B 2MCPL 2X4TA 1CFTB 2EDFA 3HE7C 3LKNB 2QHRL 3A6BH 1IT9L 3GSOB 4JKLA 5IBTH 1WIUA 3LKQA 4NO5A 1RZJH 5CJBA 2DQFB 2FGWH 1YMMB 4XB7A 3O2DA 5I19H 1NAML 4HAGA 1XGQA 4JRYD 2VDRH 5BQ7A 4UILL 2HT2D 3MC0A 4ZOBA 4ODXB 5IEKA 2J6EH 4GBXC 4WTZG 4LCCB 1OGAB 1CZ8L 1VFBA 3LV3A 3P30L 1HHKB 1J86A 3N1MC 1WBYA 1UGNA 3S36X 5JMRA 1NEUA 2CUMA 2WWMC 2XKSA 4OCSL 3UJTL 2YD7A 15C8L 3DX8A 3AAZB 5DVNA 2WNGA 5EZLB 3C6LB 1TFHA 4YX2L 3QDGB 3FQRB 3QNZB 3EYUH 5GRZA 4X6FB 1UZ8B 3PWJA 1H8OA 3WE6B 3CMGA 1UXSB 2R1WA 3G5VB 3QRGL 4ZUWB 5BVJA 3OR6B 2FCBA 2Y25A 5CKAA 2IALA 4Y89A 1C5DA 5LXGH 3SBWC 3X11B 4QHMB 3TV3H 5J12B 4OLUL 3VA2C 1C1EH 5DJ2A 4GG8B 5K9QG 2CDGA 2ARJQ 3OR7A 1FL5B 2IH3A 3O4LA 2OTWB 3QWOB 3KPLA 1WEJL 4JFFB 5KN5B 3EGSA 3WNPA 2WWKO 3S4SB 2F53D 3T8XB 1YYLH 1CR9H 2F5BL 4ACPA 5IB1B 4XPHH 4Q7DA 2CJUL 1KENL 4Z8FH 3JWOL 4PJXB 5FHBH 3VFSB 2BCKB 1T66D 4M1CC 1CDCA 3PL6B 1GL4B 5D70L 1QKZL 5KZCD 2VYRE 1SEBB 1AGBA 4MLIA 1QSFA 1JGDA 1JUFB 3CVHL 4N9GB 1AFVL 2Q86A 1H5BA 3FHAA 3QQNA 5SX5K 1UWXH 4KK8D 1A64A 2HYMA 4JVPA 2H1PL 1XGTA 3IB4A 4XCFL 3GK8H 3DV6B 4Y8AA 5D5MB 4KRPC 4MA7L 4XGZA 3FN3A 4H8WH 4YQXH 3CCHA 1G7MB 4HLJA 3EFDH 5EIIB 2A0LD 3RKPA 4EN3D 4YFEA 2WWKT 3DVIA 2PXYC 4AEIL 4DQOH 4FFYH 4NQDB 5KAQG 3KPSA 1G9ML 1ZT4B 4ZO6A 1QO3A 2PO6D 3RHWF 3T4AB 5C0AD 4NN5C 1L7TL 4UUJA 2J4WH 3TZVB 3BPLC 3QHFL 4ELKA 4RGND 1BFOA 3LKSA 4XX1E 3RA7H 3SDDC 3TT3L 4W4NA 1PJ9A 1CGSH 5CD3B 2R0WH 1FRGH 2BOBB 1GJIA 3RVVC 2B4CH 3IF1B 1OAXH 5GRXG 3HLAA 1TZGL 1KCRH 2QKIA 2OI9B 3MYJA 3CLEH 3W39A 5F70A 4Z7QF 3U30C 4EVNB 3EYSH 5F7FA 5LAXB 4KKLC 4HJ0D 3E6FA 3TYGH 5MHSD 3T1FB 2CLZA 4RA3A 2BSSB 4LEXH 1OAYH 4OCYL 3BIKA 3O9WB 4YDKH 4WI9A 3O41A 2FWOA 5GS0L 5T3XL 3QULA 3BGFB 4J1UA 3DX6B 1ZEAL 4XAKE 3AS3A 4PJHB 3TFKC 4OF7A 1G9EA 3FTGA 1ITCA 2LU3A 2X09A 3RDTA 1AXTH 1H3VA 25C8L 3FHQA 5F3BA 5D2NC 4WI7A 1S7WB 2SEBA 5IJKA 3K7UA 1KLUA 4V2BA 1PBYA 5FUOL 3CFKB 3MODL 4LLYA 5HD8D 4OZIF 3OKLB 3VRLE 4D9RE 5I66B 4QRRA 4X7SH 1N5YL 3OTTA 1F58H 1TJGH 2JIXA 2W0LA 3SDAD 4PJIF 4EUPG 1YY8A 4X80L 5DRXB 4XXDA 5CGYD 1U8HB 1OWWA 1E6OH 2DF3A 3STLB 1A6WH 3WFHA 4WHYG 1AQKH 2NW3B 4BUGA 5EORH 4ZSOB 5CAYB 3EBAA 4ZAKA 4X5LA 2R15A 1WT5C 1ZWIA 5B39G 3LMJL 2W0PA 2X1OA 2P5WE 4M7KH 3BP6B 3ELAT 5F1KC 1SJEA 4Q6IB 4FFVC 4NQXA 4F58H 5HGDB 2W59A 4RAUB 5JOFA 3MRNB 1U8OA 1MAML 4CJ1A 2I60L 1P7QD 5C6WH 5I0DA 3VDCA 4OGZA 3SKMA 4LLMB 2VDMH 2DM4A 2HFGH 1KTDA 2CR3A 3GKZA 5JDSB 4JANB 5E5MB 3ARTA 4P46B 5IB3A 4OLYH 5F7KC 3VG0H 4ZXBB 1DVFA 1L6XA 2XFXB 4OLZL 3NVQA 3RNQA 4TNWF 4AQOA 2Q76B 4N90E 2DM2A 2NY4D 4LCYA 2X9YA 3P4OB 3L5IA 1RJZB 1YPZE 1KIPA 2V17H 4J4PC 3GSNB 3AM8A 1INEH 3IDYC 4L9LA 1KJ2B 2DTML 1FL3B 1MCFA 3CFEA 3WIFB 1BECA 1KB5B 1Y18B 5C07A 3ULUF 5HYIA 4NWUH 1FZMB 4KROC 5IHZB 2D0GA 3BMVA 1BX2B 1RZ7L 4KMTH 4HX1B 4LSTH 4PGEB 4ODVH 4V1DE 2CUIA 4DGIL 5KW9H 4BH7B 3BN3B 4POZD 2XWJB 3CUPB 3QFJD 2VDLH 1EO5A 4XH2B 5DYOA 3QEUB 4NUGL 2XZCH 5D7LD 4NHUA 3ZKNC 5MEQB 1I8IB 2AJYL 3NMEA 4QRPD 2C9AA 3NCCB 3SDAB 1KB9J 4M9PA 1LP9A 5IR1A 3RVTD 4JPWL 1WZ1H 5D2LA 1RZIA 3PGCB 5HYSB 1NUNB 3QXUA 4LRNL 1IGTB 1HEZB 4N5UA 1E4WH 3WUWG 1ZLWK 1ZMYA 3O11A 4X7TB 1EEUA 4UB0L 2WBJD 1A7NH 4OSUH 1HK6A 1R5WA 5IM7A 2EZ0C 3M1BB 1IM3A 1NL0H 3WNKA 1KCUH 2GJZB 4ONFH 1T1YA 3D3VE 4P23C 5IFAL 2C1PA 4PJFF 3ME0A 3VXQB 1Q9WA 4HV8B 1FPTL 2CRIA 5LGHH 2NQCA 5ALBH 3NFPB 3JWDL 2AQ3A 3MXVH 3FN9A 4N1HB 1YEGL 4JM2A 5I0ZA 2NY3C 3VMOA 1NCWL 4LF3B 3JVGC 2GKIA 3QA3B 4DFIA 4FXGB 3O4LD 4PGDB 2K7QA 2BY2A 3VFMB 3LKPB 4G8IA 2AEWA 1BFVL 1R5VB 3SGJA 4PG9B 5DJXB 2X05A 2QQNL 2W0FA 3GRWA 1NPUA 1OAKH 4WEBH 1KCVL 1GCFA 4XVUC 1LK2A 1BZ9A 2F19H 5ICZB 4RGOL 3E8UL 5CHNA 3GBNL 3O81A 1FBIH 5ILTH 4HW6A 5IBUB 4FP8H 3HC3L 4M00A 1QR1B 1JNJA 1X5KA 3HUJF 3MV9D 4OGYH 3G08B 5JW4M 5CEZE 1JNLH 5HDBF 2IPUG 2D7TL 2AK1L 1N8ZA 2X4TB 3QCTL 2BC4A 4YK4B 4S1RH 1FFPA 5EA0L 3TESA 5E99H 3NH7H 4TSBL 3BH9B 2N4IA 3C5ZC 4NO5B 5JW5A 1JYWA 2FYYA 4D3CH 3BJ91 3GMLA 1K4DA 3RVUC 2G60L 2OLDA 3NOIA 2QQLH 2BVYA 3SE9L 1XGQB 5FKAA 3AGVA 3GMNA 5BQ7B 2E6JA 3BISA 1YECL 5CSBA 4PJDE 4PJCF 3U0WL 5IEKB 3AY4C 2HJKB 4I4WA 1AD9A 2IPKA 2VLRB 3O2WH 3LV3B 1A6UL 4PRID 3Q6GH 1MEXL 5B38G 1WBYB 1IARB 4R4BA 1IL1A 1GH7A 2DDQH 1SVCP 1F45A 5GRJH 5DWUL 3DX8B 4F7TA 5EZOH 1YYMH 2DMBA 2NXZD 6FABH 3MNZA 4RSVA 5IROA 1IBGH 3NPSB 5D6DA 2R1WB 1TDQA 2CR6A 5D1XC 5BVJB 2YXMA 1XF4A 4IDJL 1QEWB 1C5DB 2GUOA 4LSQL 3FN0H 1WFTA 3ZT7A 2XA8H 1WWAX 3S3JA 5DJ2B 3K4DA 2CDGB 3WXWL 3OR7B 1AGCA 2IH3B 4U6HA 1L6ZA 3O4LB 4FNLH 2W9EH 3KPLB 3VA6A 3EGSB 1I1FA 3WO4C 2D9CA 1ZVHA 3TBWB 1N6QH 1MF2H 2B1HH 2H6PA 3TCLA 4AK1A 3OAYH 4XWOD 3F7PC 5C09E 5L8KB 3OJVC 2JIXD 5HTSA 5GS0D 1RUMH 5FV1L 1F2XK 2I5YH 1AGBB 1QSFB 1JGDB 3ULVE 5TE7H 2Q86B 1H5BB 4JKMA 3H9SD 2DBLL 5DD0H 1R0AH 3SDXE 1XMWA 4UV7H 5IHUH 1XGTB 3ESUF 7CGTA 3QXTA 1J87A 4ZAKD 5C0RL 4XGZB 5HVHB 4HFUH 4RBPK 2XQBL 3CCHB 43C9A 3N9GH 1UWXK 3QIBD 3MLZL 1KEGH 4PJ5D 5MEOA 2YA2A 4O51A 3VFPB 1JYVA 2WMPA 2EEAA 3DROA 5D1QB 3KPSB 1QO3B 4GO6B 5A2IH 2R1YB 3ZYOA 4UUJB 2AJVH 1B2WL 1TNNA 5J1AA 3RAJL 1JRHI 4ELKB 5EUOA 1UM5L 3LKSB 4YE4H 1T5WA 4OLWL 1F11A 1F5WA 3PGFH 5CZKA 5DVOA 5GS3A 5FYKH 3E6HB 2Z8RA 1DVFD 4M4PA 4Q2ZA 2P42B 2Z91A 4K3EL 2WBWB 2BVOA 3MR9A 3BP7A 2D2OA 1CGTA 2QKIB 3HLAB 5GJSL 2UY6A 4LVOC 3MYJB 1A6TA 5GS2D 1AR1D 3W39B 5I1CH 1DBML 35C8H 4OQTL 5DZLA 1XR8A 5I30L 3E6FB 3OJDA 4P2CG 2CLZB 4N9OB 5JNYA 3ARWA 2DICA 3BIKB 5D93C 3RWIA 2GT9A 1DBJH 2I26N 3O41B 2FWOB 3CX5K 3QEQD 3QULB 1U8QB 2UWEA 4J1UB 4OAWA 4XPTL 3MRJA 2AJ3A 2IAND 3FTGB 1HSAB 3LRHA 3F12B 3UAJD 3RDTB 2JLLA 1YPZA 1EZVX 5F88B 1QSED 4UT7L 5F3BB 1PLGL 2SEBB 4Y19B 1KLUB 4HUXB 1I3RA 4LLYB 1AH1A 4NKQB 4Z95L 4UIMA 1J5OL 4QRRB 1YEIH 3U79A 2JIXB 5EOTA 4ONGH 2HMID 1YY8B 1KV3A 2DYPD 4XXDB 1FNSL 1J0JA 2VNCA 4DN3H 3QHZH 1NMAH 3TN0C 2EH7H 4LGRB 3WFHB 1YEFL 2OP4H 1ORQA 4HBQA 4Z7WE 1U3HC 3OKOA 1KYOJ 2ZWLT 2NPLX 4ZAKB 5HHNA 3O6ML 1SBSL 2R9HC 2UZYB 3MV7E 4DEPB 5DDHA 3BQUD 5IGXH 5SX4I 3BT2L 3UTZA 1S9XA 2R56H 4D0DA 1SJEB 2GFBA 3LH2H 3DTXA 3U4BL 2IBZX 1IEAA 4GG6E 1U8OB 4OF3A 3ULUH 4PYGA 1NSNH 3RL2A 5KANI 2A6DB 1FE8L 3QXAA 2FATH 4LOUC 3BRFA 1Z0MA 4AMKH 1NLBL 1ULVA 1KTDB 4FFWC 4HUNB 4JM2D 2DMCA 4CVZB 5IB3B 5FM4A 4NIKB 1F8TH 2B0SH 4AEFA 3FB8A 1AO7A 1DVFB 1RK0A 2KZ1B 1MCSA 4NUJA 3PJSB 4JGUA 3NA4A 3RNQB 4JFDE 5EBGA 5GS1A 5E2TL 4A2MA 2HTLC 1TCRA 4OIIL 5I1IL 5EOCJ 3BN9D 1YNTB 1KIPB 2Q8AH 1QD0A 2DQIH 4L9LB 2OJEA 3SDYL 1NMBH 5ABDE 4GKOA 3CFEB 3AS0A 1ZHLB 5IFJA 4X5XA 3MOAL 3K2MC 1AE6L 4NRXA 5C07B 3T0WA 5CEZL 3NCFB 3TEUA 2ZUUA 1IKFL 2DBJA 4JREC 4M02A 3S4SG 4HJJH 1HCVA 4TYUA 1I9JL 4LPCA 1FG2A 3H3PH 1KPRA 3MXWL 1P4LA 4MJ6B 3X12A 3BKJL 2OL3H 4Z0XA 1A3LH 3MGTA 4PY8J 4M7LH 1KTRL 1MRFL 1U42A 1HDMA 5IR1B 1LP9B 2HVJA 5D2LB 1RZIB 4KK9D 5GPRA 4HWEH 3RX7A 5C3LD 2IEPA 3WNLA 3QI9C 1OGTA 1FORL 3TBSA 2X4UA 3O11B 4O2FA 1IGCL 2Q3AA 1R5WB 1FDLL 1EFXA 5IM7B 3VI3F 5IWLA 1LO0H 4KQ4L 4ZNCD 1IM3B 2C26A 4LBEA 3O6FD 3RIFF 1M71A 3DHJA 3PGDA 4MXVF 1F3RB 3CAFA 3IKCA 1T1YB 4Y2DA 1XF3A 2E6QA 1Q9WB 2HKHL 4JFEA 5ANMA 1J10A 2PTUA 1RHHA 3PWNA 5DFVC 3VFWA 1Z5LA 3IDXL 4JM2B 1T80A 5F7EH 5EUKA 4DJMA 3MRMA 1LDPL 2H2PC 3JXAA 4N5ED 3QPXL 4R3SA 1SJHA 4G8IB 2PYEE 1OAQH 1S3KH 2YK1H 3OPZH 4CN4A 4X6EA 2O5ZL 1Q0YL 4IRSA 5CZXC 1LK2B 4LP4A 1BZ9B 4XAKD 1CK0H 5GQBA 5C7XH 5CHNB 4P2OD 4BH8A 3ULVL 5FUZH 1DANU 2C7UA 5FYJU 3CJJA 1IC7H 5EZIL 3U2SA 5J11C 3X3FL 5FM5O 5EU6A 3H0TA 4ZOCA 3GNML 4D9RD 1N8ZB 1QG3A 2DN7A 2BC4B 4K7FA 2OM5A 2KBGA 1FFPB 2DWEA 4X8XA 2RIKA 3QUZC 2VQTA 2V5SA 4JFQA 3MBEC 4QRTA 5JW5B 1T2QH 5AG9A 2FYYB 4X6CE 2BJML 1F4XL 2MKWA 1MREL 3ARYA 3WIHH 3GMLB 1K4DB 4HPYH 3SDXA 4XPGL 5GGTA 1MI5E 3U4AA 3O3EA 5FKAB 5FUCC 4YXKH 1F02I 4TQEL 1DFBH 4IOFC 1NGYA 5CSZA 1AD9B 3T4YA 5FM5M 4JQIH 2IPKB 4H20H 1C5BL 3GI8H 3QQ9C 4JRXE 3KYAA 2XG5A 3LQAC 4I0PA 4R4BB 2OZ4L 3EHBD 2XT1B 1DE4A 4HGWA 4FQCL 5GGSY 5JLZA 4F7TB 3UBXA 2EH8H 1MFAH 3MNZB 2VQ1A 1FGVH 4UAOC 1JPSL 4P5TA 4IRZH 4OFVA 3CPLA 3A6BL 3L5HA 3VG9B 1XF4B 2GUOB 1VFAA 4GFTB 3EYQD 2FGWL 1MWAB 4N90D 3P77A 4NP4H 4UBDD 3E2HB 3RWEA 4F7EA 4KKNA 4JVWA 1RPQA 1S5IH 4FQPA 4L8SA 5DLMH 1AGCB 4U6HB 4I9WE 5I19L 2DOCA 2WINA 1I1FB 4KVNL 3WFBL 5C0IA 2J6EL 3HAEH 4F8TA 3S5LA 2NY5C 1FH5H 2H6PB 1YUHA 1D5XA 3TCLB 3MRKA 5GRVK 1J1OH 1NCUA 2EYSB 4F80A 1GAFL 3RNKA 3FQNA 4V1DD 2AJSL 4CMMA 4R4NC 4LHJB 4YHPA 3SKJH 2LVEA 3WDJA 4XVSL 1CD0A 1LDSA 2YD1A 1KFAH 3VRIA 3R4DA 5DJ6A 1E0OB 1P9MA 2MFNA 1CDIA 4PFEA 3KDMA 43C9B 4EBQH 1A2YA 4BZ1L 1C1EL 5HVFB 4A2LA 5MEOB 1A6AA 4O51B 2IJ0C 1FSKB 1DEDA 3BE1H 5D9SA 3DROB 2HKFL 5HYSG 5KJRH 1XIWA 2MQ3A 2B5IC 5J1AB 5EUOB 4P4RA 4F7CA 4Z8FL 1T5WB 2YN3A 5E5UB 5FHBL 1SEQH 3V4PH 4GG6A 3D3VD 5HJ3A 5DT1H 4C55A 1GC1C 2Z91B 4DK3A 2ZOLA 2YD8A 3MR9B 1QFWM 2XI9A 1X4XA 3BP5A 4XRCA 1A6TB 4TPRL 2QBWA 5ERWB 3HE6A 2N7AA 3SCMA 3GK8L 2X44D 1XR8B 1G7PA 3KVQA 3BKCH 4QHNA 3UO1H 4K3HA 3OJDB 1FAKT 4LLVA 3C60D 5HVGB 1V7NH 4H8WL 1ACZA 1GGBH 3RWIB 4C56A 2A9ML 2GT9B 5TF0A 5IMMA 5T1MB 3B2UD 2UWEB 4L4TA 4OAWB 2R2BA 3MRJB 2QTEA 1A1MA 4FFYL 4FFZL 5K9KA 3Q3GA 5IV2A 2AJ3B 4JFYA 1EGJL 3BKYH 5SWZA 5E8OA 4ZUSB 5TFSH 2J4WL 4KMLB 5F3HA 4GBXA 1HH6A 3RA7L 4OM1H 3MUY1 1LO3H 4U0RC 1I3RB 3TVMD 1LILA 1CGSL 2R0WL 1XEDA 5TDNA 3DETC 2B4CL 5D96C 4MNHB 4YXHH 2HT3C 1AI1H 5IBUG 3BDBA 3MRPA 5CEZD 4P9MH 1ORQB 1WAAE 4ZFOA 4PLJC 3ZE0F 4R2GC 3UZEA 3CDYA 2BRRH 3OKOB 1DSFH 3TYGL 3CVIH 1ZS8A 2ATKB 5HHNB 4LAQL 4G3YH 3ARVA 4HKJA 4LEXL 5DMGC 4BM7A 1MVUA 5DDHB 1ZKAA 5CIPH 3MFGB 1S9XB 4D0DB 3SBWA 1RUAH 2GFBB 1IAIM 2VXQH 3DTXB 3WFEH 1IEAB 1U8JA 1GGIH 1BD2E 2VRAA 3MCLH 4YBQC 4PG2C 3VWKC 2XN9A 3RL2B 2WUCL 3T3ME 1EV2E 3QXAB 4YC2B 5T1KA 4ZO8A 1RFDH 1I3GH 1RZJC 1JNHA 3SGEH 1RSFA 1D7FA 1F58L 1TJGL 4PRDA 5E95B 3FB8B 1AO7B 3BEVA 1MCJA 1RK0B 4NUJB 2X9WA 4TSAH 4TVSa 3KGRA 4ZS6D 3IKKA 1FZJA 4KXZI 5GS1B 1A6WL 1WLHA 2VKXA 4XNYH 4KKBC 3DRTA 1AQKL 1WICA 5EORL 5D7IF 3VD7A 4KY1H 1TCRB 1RIVH 2DWDA 3F65A 4D94A 3MPCA 4IRSD 4XP1L 2OJEB 3RWFA 3MACH 1R3IH 1Q8MA 4KGJA 1I1RA 5D7JA 5IFJB 4X5XB 2MWCA 2AABH 1YEHH 4NRXB 4Z7VF 4M1DL 4U31A 1I9IH 4M48H 4A6YH 2PXYA 2D31A 1BF2A 3UTSE 4JAMB 3T0XA 2HFGL 1AXIB 2Y6SD 5C09D 2VXVH 3MV11 4KJQC 1FG2B 5CBAA 3KS0J 4P3DA 1NCBH 1RZKL 3SDDA 1MNUL 1KPRB 3VG0L 1D5MA 1P4LB 4MA3A 3T0EC 2VL5A 3X12B 1U36A 4BYHA 3ULVD 2X4QA 4Z0XB 3MGTB 2FHBA 1HDMB 5C86A 3LEYH 1WZLA 3GSXB 3LAFA 2EIBA 1MCHA 2Y9RT 1T1WA 1OGTB 1BBJA 4JG1H 4P5MA 3OGCA 3TBSB 2X4UB 3WIIH 4O2FB 3CXDL 2V17L 2YPVL 3SKOA 1INEL 5ITBL 5FO9A 4HBCL 4MZ3A 1OW0A 1EFXB 3ARFC 4LBEB 2BNRA 4OIBA 1M71B 3WEXA 3PGDB 3VFRA 1HWGB 5LGJA 3IKCB 4UTAH 3S8WA 4Y2DB 4KMTL 2XY2A 4Z76A 2JJWA 3V5HA 4OCXH 1XF3B 3MUJA 4LKXA 4WHYH 5KW9L 3QUML 1CYGA 1JPTL 4JFEB 4H8WC 5ANMB 5D2NA 2AJZA 1RHHB 4L29A 2VDLL 3PWNB 4QRQA 3IVKA 2RCSL 2H45A 4QTIL 3VFWB 1Z5LB 4XPFH 3LZFL 3TO2A 3V6OE 5EUKB 4KU1A 4MNQE 4CN6A 3GM0A 3M17A 4R3SB 1WZ1L 4M7JH 2H32H 1CF8H 5INDA 1SJHB 1CXIA 5IB5A 1EVUA 2O61A 5JR1H 2VDPL 3IDUA 1CXEA 4OSUL 2CPCA 5E7BA 2B4CC 4IRSB 5F1NA 2Z4QA 2ESVA 5LCVH 3RI5K 4BH8B 5L88H 1U8NA 3IETA 1CWVA 1TXKA 4HEPG 5GRUH 3WLWD 5FGBC 2EC9U 2FX9L 1B6UA 4NJAL 3VWJC 3U2SB 4U33A 1NANH 4RMSA 3PHSA 2YA1A 3KHOA 1XGYH 1GGTA 5EU6B 4WWID 3H0TB 1MIEL 3GHEL 2IFGA 5J89A 5IT2H 4K7FB 5I1GL 4N0FA 2DWEB 4LASH 3OX8A 5FEBA 4P2YA 3TNNB 4JFQB 4OTXH 4QRTB 4YO0A 4G6FD 1TLKA 4OZ4A 2JCCA 5C0EA 1CT8A 5KS9E 2NTSP 4K2UL 5MENE 2DQCH 2HRPL 3O3EB 1B3JA 5JZ7D 3MV7D 1KIQA 2J8UE 2CDEA 1NGYB 5CSZB 3T4YB 4F15C 3RWJA 3MRCA 4XVTH 4J4PA 2NR6C 3G9VA 3LD8B 1JHKL 4I0PB 1ERNA 4WU7A 5ILTL 4FP8L 4I8DA 2VWEC 4MNGA 5HI4C 2HJFA 5BVPH 3ZHDA 1K6QL 1DE4B 2AS5M 4ETYA 4HGWB 1P84K 5CCKH 1HINL 1PG7H 3T0AA 5JLZB 3UBXB 4QOKA 1BEYH 2E6PA 3I6LE 3KLDA 2VQ1B 1A7QL 2DQEH 3MNVA 4P5TB 3CPLB 3MGOA 5L9DH 4OJFL 1VFAB 5E2VH 4C4KO 1XH3A 4JFDD 1MAJA 3P77B 4Q6YA 3RWEB 4F7EB 4PJAE 3F6IA 4ODUA 3GJEA 2BFVL 4QCIA 4BFEA 1OSPL 5MP6H 2YBRA 2WINB 4OZHF 1P6AB 3QNXA 1MY7A 5C0IB 3QZWA 4WFEE 3S5LB 3O8XC 3O2WL 1YUHB 2CUHA 5K93A 1D5XB 1K8DB 1IAOA 3WUZA 2RGSA 4PJXF 4XVJH 1KXQE 5GRJL 1JWSA 3RNKB 3FQNB 5DF0A 5EZOL 3SGDI 4KJPC 1UM6H 4QWWD 3C6SA 4GRWB 1N6VA 2NY0C 4P23A 4B7IA 5IVZA 4CMMB 3ARBD 2E5EA 4OF5A 3UYOD 2QQKL 3HUJE 4YHPB 1LWRA 1Q94A 2HP4A 3DXAE 4I1NB 5D5MF 4C4KT 3VRIB 4XXCA 1RULH 3TWCH 4UNTA 3QXDA 5HDBE 4WVRA 2XA8L 3ESVF 1A2YB 5D6CA 3WFZA 1R3HA 5IB4A 1A6AB 2YD6A 4FNLL 5GZNC 2W9EL 2W91A 4BFBD 3RBGA 2M8XA 5DJCA 1NC2D 5D9SB 5IF0A 4K7PH 2LE9A 2GTZA 1MF2L 2FEDC 1XIWB 5F96H 2IH1A 1AJ7L 3OB0K 4F7CB 1PG7W 5ACZA 3IYLW 4KKCC 5HJ3B 1JK8A 2I5YL 1RQ5A 4B7LA 2EXWC 2ZOLB 2HLAA 1QR4A 1SBBA 3B9DA 2F5AH 2R2EB 3BP5B 2XG4A 4XRCB 4Q9CA 1R0AL 2YPLA 4UV7L 3AVEA 5IHUL 3L95A 5AYUH 3HE6B 4N0UE 5F1OB 3SCMB 3HFML 5IW1A 2XTJC 3QEHA 2D7NA 4QHNB 1G7PB 3OKNB 3HE7B 4HWBH 4LLVB 4Z18A 1YQ2A 3CLFL 5J6GA 3G6JE 2W07A 4C56B 2RBLA 4HXAL 3C5ZA 3S97C 5D7JD 5IMMB 3QP3A 3L3GA 3DIFA 4L4TB 4PJ9C 4ZTPH 2PYED 4F8QA 1A1MB 1T21A 3QDME 4YGAB 5K9KB 2EYRA 3Q3GB 4OZGF 4JFYB 5IV2B 3BPCA 5J3HC 4ZOAA 3J8F7 5SWZB 5E8OB 3ZE1F 2AJVL 1QBBA 5F3HB 1UENA 2NY6D 2HLFC 3AY4A 1HH6B 3HB3C 4G6AC 4GBXB 3S37L 4IRJA 2CO7B 4NO0D 3GUTA 5TDNB 2PKDA 3WHE0 4RFNC 1B4RA 1CS6A 1I7RA 3RZCA 2H8PA 1S9VA 2PETA 1F4AA 35C8L 1S78C 4ZFOB 3UTTE 4XC3H 4YUEH 3VDBA 1JWMA 4I0CC 4MMZC 1MHPL 1ZS8B 4OFPA 1MAKA 1CGUA 5D1XA 3VFOA 2NXYC 4HKJB 2DB8A 1OP3H 3WFDH 2Q7YA 5GSVA 3JTSA 1JI1A 1HZHH 3IFOA 4NO3A 1MI5D 3EAKA 4XC1H 3MA7A 5JIHA 1U8JB 5JIIA 4Q9BA 2DI7A 2XN9B 4AQ1B 4HCRH 2WLYA 1WK0A 5T1KB 4JRXD 3FRPA 3O6LL 1EK3A 1JPFA 1YEIL 3JTTB 4PRDB 4ONGL 4LCUA 2YOCA 3BEVB 4TUJA 4X7EC 1DLHA 4DN3L 1O0VA 1FZJB 2DKUA 3FL7A 1I4FA 1B6DA 2EH7L 2VDOH 3I02A 1EERB 2NY1C 4WUUB 2XKNA 3OXRA 4MDJA 1YEJH 2DWDB 4OGXL 4RNRA 3FFDA 4MNQA 5IGXL 1E4KC 2YD4A 1CE6A 3RWFB 2R56L 1U8IA 5CINL 4I9WD 3FFCE 5D7JB 4GRLC 2Q8BL 1N7MH 5ESVA 3HZKA 2P7TA 4O00A 3D48R 2PXYB 3H9YA 5E2WH 2D31B 3ULUL 1S7RA 5F1IA 2FATL 3RX8A 2QADC 1QUNA 3TT1H 4MQXC 3O0RL 4AMKL 4NN5B 1N4XH 2CKBL 4NJ9H 3BPLB 5CBAB 5TF1H 4P3DB 1IQDA 1ND0B 3FO9A 3SDDB 2FBJH 4PGBA 3CSYA 4O2CB 1D5MB 4MA3B 2VL5B 3SE4A 2X4QB 2NW2B 3R8BB 5DMYA 4XTRC 1T1WB 4MZ2A 1BBJB 4P5MB 3U30B 3OGCB 1MPAL 5GGQH 3SKOB 3QFDA 4CU6A 5FO9B 1MCQA 3ZTNH 5F6IC 2FO4A 2MQ0A 2FX8H 2BNRB 3WEXB 4L4VE 4X4ME 3VFRB 2R4RH 5EBMB 4NZTH 3CK0H 3UROR 3RGHA 4Z76B 1NGQL 3V5HB 1E4XH 1G84A 4LKXB 4TULH 3ARSA 2OK0H 4FXLA 4HJJL 1U41A 5D2NB 2AJZB 2EKJA 4L29B 3CX5J 2VLLA 4C83A 3BUTA 4QRQB 3IVKB 4JO1H 5HHMB 5ISZA 3H3PL 3X3GH 3TO2B 4WRLA 4FRWA 3RFZC 5I8CA 4M7LL 1NAMB 3M17B 1NGWA 4GQ9H 4P3CH 3FB7A 4GMTH 2YUXA 1OCWL 1MCPL 5IB5B 1J0IA 4DVRH 4GAJH 3TN0A 1R24A 2O61B 2VQUA 1P4BL 5DGQA 1U3HA 3C2AH 4GUPA 4UU9B 2IBGA 4X7DC 1CQKA 1DBBL 5F1NB 4DOHB 2Z4QB 4P2QE 4PJAA 2FHCA 4UINL 2ESVB 2XTLA 1CCZA 1U8NB 3DJ9A 3PABA 4NQTA 4P2RA 3F6LA 3B8SA 1IFHH 3MUZ1 4KUCF 4P23D 3V6FA 4RGMC 1TQBB 5DHVA 3SO5A 1JGUL 3RWGA 1EMTL 3DUUA 1F6AA 3W82A 1B90A 3U7YL 1BQLL 1JF5A 4N0FB 5F7EL 3OX8B 2NY3D 2P5EA 1CE1H 4MAYA 3S98A 5E6ID 2DQHL 1QBML 4YO0B 3WV0A 4OZ4B 2JCCB 3MRIB 5C0EB 4U6VL 1CT8B 1LO2L 3O3DA 4RFEA 2E7MA 4PRHA 1S3KL 3OPZL 5JW4R 3DXAA 1KIQB 1ZLVK 2CDEB 1MRCH 4LL9A 2YS4A 3MRCB 1FAIH 3IDYB 2FL5A 1H0DA 4KK5D 4DTGH 4WU7B 5GHWH 3CVHB 4MNGB 2CLRA 3JSSA 4PRPE 3GSUA 1JZ4A 4M03A 5T3ZH 1VFOA 3D18A 4QOKB 2JB5H 5ID1A 5IUSA 4KROB 2OS7A 3S35L 3MNVB 3BD3A 1WSST 4WENB 4JQXC 3MGOB 2P46B 3FMGH 4S0TD 1UACH 3RIAF 5DD5L 4HUVA 3DSFL 4O5LH 5JOEA 1N0XH 1T2QL 1XH3B 3WIHL 4HPYL 4ODUB 1MUJA 3GJEB 4ZYKB 4QCIB 4N0UA 1VPOL 3QNXB 4YXKL 3QI9A 3TIEA 3QZWB 2W0KA 1JN6A 2BDNH 4JQIL 4H20L 4IRJD 5HGGS 4Y1AB 2AEIT 1IAOB 2A73A 2MNUA 2WP3O 4IBLT 1A0QL 3C8KA 3JV4A 3EKCA 3I9GL 4RMVA 1JWSB 3UTSD 3PE9A 3RZCD 5I75C 3C6SB 3RUGA 4P23B 5IVZB 1FGVL 5L2JB 3NABL 3RU8H 3VD4A 4IRZL 2ICEA 1BQHA 4XNXL 1Q94B 4FS0A 4M61A 4ZFGH 2ZUTA 4TRPH 1WFOA 1V3KA 3QXDB 1EIBA 2NY3B 4NWTL 3VGGA 2G9HA 2VZ1A 5D6CB 1R3HB 5IB4B 5IF0B 5DJCB 1ONQA 4MA8L 2GTZB 4YBHA 1SYVA 4RWYL 2IH1B 2WP3T 1JHTA 1WWWX 4M3JA 3S7GA 1W72H 5CZVL 3EJJX 3QCUH 4LLQA 4X6DA 2XWTA 1J1OL 3LN5B 1NFDA 5ACZB 4HS6B 2IAMD 2WQRA 2ZUVA 4MD0A 4ELMA 1JK8B 3BUYA 2UYLA 1KLFA 1YNLH 2O26U 2HLAB 2ICCA 2YPLB 5T5NG 1H15A 2HFFA 1MHHB 3L95B 5A3ID 1I1CA 5IW1B 3PXJA 4NYLA 1JRHH 2UV3A 4MNQD 4I3SH 3EOBA 4HD9A 5M95B 4KHTL 1MCDA 3AUVA 3C5ZB 3DO3A 3H3KA 3MBEA 1IGMH 2CGRL 3DIFB 3DMMC 3L3GB 1T21B 2EYRB 3ETBF 1BLNA 3BPCB 3OB8A 3GBMH 2DQGH 4MB5A 5J6HA 5KJRL 5AG8A 1WQVT 4ODTH 4QGTA 3BAEH 5HI3C 2AGJH 3TM6A 2NY2C 1MQ8A 3FFCA 3WD5H 3MYZA 3GUTB 1SEQL 2P8PA 3V4PL 4S1QL 4E42A 2Y06H 3UTOA 5D72H 2DMKA 3ZE2F 1I7RB 3RZCB 2H8PB 1S9VB 4Z7OE 1BVKA 4WI2A 3DBXA 1T20A 1F2QA 5C3TA 3BKCL 1JWMB 2X9XA 4U1NA 3VFOB 5D1XB 4K8RD 4WO4D 5AZEH 3R0MA 4OZFA 1CTOA 5GSVB 2Q7YB 3JTSB 4ZQKA 5MEND 1HWHB 3MA7B 5FOJA 4PJ7A 3MJGX 1Z9SA 5JHDA 4ENEC 4UV4H 1KB5H 5CBEA 1EUTA 3BKYL 5TQ2H 1FNFA 4HG4K 4Y5VC 1JTOA 1ZA3A 5GGUA 3QPQC 4YZFE 5TDOA 3T77A 3WO4B 3M8OH 5JHLH 1QRNE 4NZRH 1OQOA 4HIHA 1JPFB 3I6KA 2BNQE 2ZCHH 2P49B 4K94H 2JJTC 5GZOD 4L4VA 5JW3H 1T6WA 3KPOA 4MWFA 5CJOH 4YXHL 1A8JH 4LCUB 3I6LD 3HR6A 3UMTA 3MJ9A 4TUJB 1MJJA 1DLHB 1LE5A 1U3JA 5DQDL 4NDMA 1I4FB 3UBXG 3WNOA 1GGUA 5SWSE 3I02B 3OAZH 4YWGL 1L9MA 2BRRL 1HKLH 1DSFL 2XKNB 3CVIL 3OXRB 4MDJB 1M05B 4RNRB 3FFDB 2D7PA 3MX0A 4URTB 2H2SC 1I1AC 4MNQB 4LSRH 5BOPA 4HS3A 1SHMA 1CE6B 32C2A 1U8IB 4E0RA 3LEXA 2A74A 3F7QA 5EU4A 3WFEL 2XZAH 1GGIL 4NCDA 5ESVB 3HZKB 2PNDA 2P7TB 4DAGL 1JGEA 1S7RB 4WFED 5F1IB 4NZJA 1HOCA 4OT1H 5DSCA 1RFDL 5DD1H 2ZJSH 4Q9QH 1JPST 4M6OH 4P2QA 1DBAH 4JLRA 2A6IA 1J1PL 1D6VL 3FO9B 1QFWH 2D9QB 4Z7NE 4MAYD 4PGBB 3CSYB 5ETUA 1NDGA 5CKGA 1CD8A 4KDWA 3SKUD 3DURA 1EAPA 3LIZL 4TSAL 3K1DA 1LP9F 4LGPB 4RAVA 5D2LF 5EO1A 3HMWH 5C0CB 4JN1L 4XNYL 4LVOB 4HF5H 1Y0LA 3DXAD 1X5LA 4K23L 4KY1L 3KJ4C 1RIVL 1T0NA 1UB6B 3IAGC 5I18L 4NRZA 5DQ9A 4PTTA 5JIPA 1OTSD 1R3IL 4JPIA 3GB7B 1TETH 1IGYA 3B2VL 2FO4B 5D93B 4F57H 2ZKHH 3QWRA 4U6XA 4WWKC 3VFTA 4HC1A 2YD3A 4G9FB 4ZMAT 2VLKA 4WDIA 4FQ2L 1NUDA 5ALCL 2D7QA 2J88L 3BD5A 2VXVL 1WBXA 3SQOL 5D7KE 4C83B 3F58H 4CBPA 1T89C 1NCBL 2C3VA 3RZWA 5ISZB 1KSRA 3TCXA 4JM2F 1S7QA 1BZ7A 2DLEA 4IMKC 4FQXC 2RR3A 2VITA 5IVOA 4KTEH 5K33A 5C08E 5TE4H 1NGWB 3CZJA 1BJMA 1D9KC 3FB7B 5K59E 3U0PA 4H1LA 3L3OA 3L3DA 3IGAA 1BM3H 1J0YA 5CILH 3TN0B 1R24B 4KGLA 3WIIL 1ZLSL 4IS6A 1U3HB 4GUPB 2MCPH 2EIEA 4JKKA 2Z92A 1QYGH 2QHRH 3QDMD 3PABB 4M9OA 4UTAL 4P2RB 1B9ZA 3V6FB 4PG2A 5DHVB 3VWKA 4Z7VE 3RWGB 3DUUB 4UILH 5DURB 2D03L 5DFVD 1X5IA 4JB9H 4G8GE 1N59A 4FMKA 4JZJC 2P5EB 4QRSA 4M7JL 2APBA 3UJTH 4KKAD 5FYJE 15C8H 3O3DB 5I1KL 3UTTD 1HH9A 4PRHB 4J23A 1QPXA 4RMTA 4OFIA 1T0MA 3DXAB 4U2YA 4JQVC 3VFGH 1QLFA 1O5DT 4EXKA 1GIGL 4PY8I 2FL5B 3HI5H 1YMHA 3QRGH 1H0DB 3VGAC 12E8H 5LCVL 4NKDA 4WFHE 2CLRB 4NGHH 2VL4A 3GSUB 4HLZH 2YEZA 3D18B 2H9GA 4DUWA 5ID1B 5CFHA 3KPMA 1TQCC 1GOHA 1WCBB 2ZG2A 2X4OA 4JREB 1F4WL 3QDHA 1UEMA 4HUVB 3FO2A 2AEPL 2F5BH 3JV0A 4OD3H 2DL9A 3UC0H 1A6ZA 2CJUH 4U2ZA 1KENH 5IMKA 3MBED 3T0EA 2AI0L 3D25B 3JWOH 1YEDA 3L1OL 4FQQB 1MUJB 5D70H 1QKZH 4N0UB 2DQCL 2FR4A 4KI5E 4NHCL 3T0DA 1EHNA 3GJFH 5TH2A 1MFEH 1AFVH 5D1ZC 4GXVL 3SEPA 3QI9B 3CFDA 3TIEB 4ERSL 5DFTA 4I2XA 1JN6B 1H9VA 2H1PH 4XVTL 3FFCD 2FZ3A 2A73B 5E6ZA 4X7FC 5EULV 4Y4HC 3C8KB 5BVPL 3R1GH 4NZDA 3JV4B 4WW1A 1PG7L 4AIXA 4BSWA 3P4NA 5BZWA 1UYWL 3IFPA 2IPTL 5FCUH 3RUGB 4AEIH 4LPXA 2DQEL 1JJUA 1G9MH 1BQHB 2VLJB 3W2DL 3WJLC 5L9DL 4XMLH 2ITDB 3UJJL 5GJTH 2X4PA 5E2VL 2G9HB 3W9DB 1D5ZA 4NKOA 3QYCA 2EDNA 1EBPA 2X41A 4GQPH 5MP6L 4GLRI 3EOYG 1JFQL 2W9DH 1TZGH 3WJJC 3VXSA 3QB7C 1NUFA 3FT4A 1YMME 1RAMA 3H7LA 1SYVB 3AFLA 1I8KA 1JHTB 4R8WL 1EZVY 1LK3H 4MJIA 5ENWA 2AXFA 4LLQB 3QCVL 4X6DB 4L4VD 5BJTA 4Z5RA 3RGVC 1NFDB 4XVJL 1T7VA 4N8PA 4MD0B 2YPKA 4ELMB 1OGAE 3BUYB 3QUXD 2UYLB 5HHVL 5GS0H 1ZEAH 4Z7UA 5FGBA 2WK2A 3VWJA 5J11B 1H15B 4I18A 2HFFB 4BSJA 5C9JA 25C8H 2VZTA 1ZT1A 5EFIA 2H26A 4NYLB 1RULL 4G6KL 3EOBB 4MSWA 5FUOH 3MODH 3P0VH 3QUZB 2VXSL 4ZPVA 2OQJA 1N5YH 3MBEB 4EOWL 1KULA 4AL8L 1WZKA 2VR5A 2V7HB 1BLNB 4K7PL 4X80H 3VMNA 3MRFA 1YPZF 2IBZY 3BEWA 5J6HB 5MEPA 5GGSA 2XZQL 5F96L 1AXSA 1MCWM 4P2QD 1FFNA 3A67L 4JFFE 1DQQA 3QO1A 2YA0A 3OJMB 4X4ZA 3FFCB 2NX5A 3MTRA 2P8PB 4PJ8C 4E42B 3LMJH 3U9PL 3ALWA 4M6MH 1G7LA 4HIEA 1OTTC 1ZGLM 2F5AL 2GK0A 3I6GA 1MAMH 1ED3A 1KJMB 1N3NB 1YN6A 2I60H 2IC2A 2J3SA 3L7FA 3T08A 3TGXA 2Z8WC 3IRZA 3HZYA 4UAOB 1T20B 5GS2H 4Y4FC 1MJ7H 4LNRB 3SY0A 4HWBL 1WCQA 4U1NB 1P84J 3V0WL 4TOYH 4EI5D 4OZFB 1C08B 5D5ME 4ZQKB 2NLJA 4XHJC 4QXTA 4ZTPL 3C09C 4PJ7B 3DOSA 3G5ZA 5JHDB 4OLZH 1UJ3C 2VLKD 5CBEB 5KTEH 1ZLUK 1ZA3B 2QEJA 5GGUB 2Z31D 5TDOB 3T77B 4NQDE 4ZS7L 3O8XA 1KTLA 1TVHA 3HI6L 5TJWK 1BREA 4PRPD 4L4VB 3KPOB 3L5JA 2DTMH 1XCQA 1AP2A 1MJJB 1J9CT 1LE5B 4AEEA 2A38A 1UWEL 4NDMB 2OYPA 1RZ7H 4XC3L 1FNEA 3CC5A 3LN4A 4OCWL 4DGIH 4LQ1A 1ZE3C 5FA3A 3AMLA 5KSBA 2ZCKH 1FL6A 32C2B 5C08A 4E0RB 2A74B 4NUGH 1HZHL 1QTYT 3STBA 5EU4B 4ZFZB 3QIWD 4XC1L 4XNMB 3OAZK 4YNYA 4P4KD 4EIGB 1SM3H 1JGEB 4KXZH 4YBQD 4LPYA 4JPWH 1CFNB 3D6GA 3ZKMC 3CFCL 4PJHE 1HOCB 5IEHA 5DSCB 4LRNH 5HDQL 5E03A 3QZWG 4P2QB 2B5IB 4JLRB 5F9DC 2A6IB 3PXHA 1QSVA 3RVXC 3KYOA 5B4MD 2VXTL 5GRYA 3O3BB 2GW5A 1NDGB 3GGWA 4IOIA 4U1JA 3DURB 4DN4L 3ARDD 2C4XA 4PV8A 4RAVB 1K5NA 5EO1B 1FFOA 2VDOL 5HPOA 4EIZC 3WHXA 2YSSA 4GAGL 1T0NB 5IFAH 1C8PA 4NRZB 3GRWH 3PNWA 1U58A 5DQ9B 4JDTL 4PTTB 1RV6X 3JWDH 4LQFL 5DUML 1OTUD 3MFFB 4JPIB 4ZSOE 1IGYB 1YEGH 2M2DA 2VERN 1KEML 4U6XB 4JHAL 2EDBA 3VFTB 3GMMA 3PIQA 1L7IH 5DD3L 3RVWC 3L6FA 1UVQA 5T5NF 2VLKB 4WDIB 4O58H 5C70A 3TT1L 1JZ7A 1BFVH 1N4XL 1UJTA 2ADFL 1WBXB 2HWZH 1OVZA 1X3DA 5JQHC 2A1WL 2QQNH 5E8DH 3VMPA 2FBJL 1A1OA 1KCVH 1S7QB 1BZ7B 1ZAGA 2AXJA 2AV1A 2F74A 4RGOH 3E8UH 4H5SA 5D96B 3FQUB 4BUHA 3HC3H 3U0PB 4H1LB 3L3OB 3BPOC 3L3DB 3IGAB 4BSVA 2L7UA 3KLAA 1R6VA 1F00I 4QXWA 4G5ZL 4WTXA 5FIEA 4IS6B 3B9KC 4OFDA 5T1DL 4R2GB 3ARED 3BP4A 5JQ6H 5F9OL 3ZTNL 2D7TH 2AK1H 2Z92B 4PRBA 4OFKA 4D9QE 1MQKH 2E7CA 2FX8L 4B41A 3B6SA 4HKXA 4TSBH 5KOVC 4JFPA 4WIQA 4NZTL 1G7QA 3LY6A 4N0YL 5LKNA 1V7MH 2CIKA 2DKMA 2V2XB 3QNYA 2F58L 5GGVH 3VWKB 2VZVA 1IZKA 2RFXA 4HZAA 1EO8L 3SGKC 1N59B 1A6UH 2BSRA 1MEXH 4KK6D 3ULVF 1VEMA 4QRSB 4P3CL 2EC8A 3IAQA 4WV1C 3SDXF 5L2KB 1DN2A 1MHEA 1KGCE 4POUB 4DVRL 8FABA 4GAJL 3HC4L 1T0MB 3VXMA 4QHUA 1P5UA 3O4OB 2W60A 1QLFB 1IKNC 4YDVA 1NLDL 3VGBA 3VXOA 1DQMH 1PY4A 1YMHB 3GSOA 1E4KA 1ZXQA 4IDJH 3WFCL 4CMHC 3LRSB 1H3PL 3WNMA 4NKDB 4KI1A 2OJZH 4LSQH 7FABL 2DQTH 4GRLA 4P99A 3RX5A 1PEZA 1YMMA 2YEZB 2DQJL 2H9GB 4GSDL 3AB0C 3KPMB 2UZIL 1QRND 3L5WA 1MELA 2X4OB 4ODWA 3FOLA 2BNQD 4BZYA 4I0KA 1ES0A 5T1LD 1GGYA 4PGZA 3FRPG 1WF5A 4ODSL 3FO2B 1GSMA 4LCCA 5ID0A 2VSCA 2X5PA 5CP7A 1A6ZB 1BIHA 5IMKB 3T0EB 4LFHD 2I9TA 1YEDB 5SWSD 3F5WA 1OY3B 4X6BA 4LHUA 2FR4B 5TH2B 4PPTA 3TO4C 3CFDB 2A6JA 2DBLH 3RTQA 4I2XB 1ZVSB 3VD3A 4OGAC 1UXSA 1C5CL 2FZ3B 1Z9LA 5C0RH 5HBBA 3IT8D 3ALPA 1KLGA 2XQBH 3ARFB 4UDTA 4WW1B 3U1SL 4HK0A 4DGYH 1DL7L 1FZOA 4BSWB 4JE4B 2C4FU 3P4NB 4APQD 4PJGA 3IFPB 1FL5A 3IJHA 4ZUTA 1CGXA 4UOJA 5A2FA 3QIUD 4CAGA 4NC2B 2APVA 3QXWA 2J8OA 3PWPA 1MCOL 3RKDC 3RAJH 1RVFL 2X4PB 1UM5H 5FAAA 1EO7A 5IW3A 4KJWC 1VESA 3VFSA 1D5ZB 4LCIL 4NKOB 3SGDH 4CU7A 3VGHA 4Z7WF 3WDIA 1JUFA 4J12A 4F37K 3VXSB 5GJSH 3FT4B 5TGBB 1CXHA 1EDQA 2BDNL 5AZ2L 3T65A 4YFLI 1I8KB 1DBMH 4JDVB 4MJIB 5ENWB 2AXFB 5BJTB 5I30H 4J3UA 4GKZA 5C0DA 4GG6F 2VLRE 2YPKB 5EIIA 1ACYL 4WI3A 2ICWB 4XPTH 3SOBL 4LSSL 4LARH 4Z7UB 3VWJB 5D7KD 4I18B 3V0VB 3RU8L 1WTGT 5C9JB 4ZFGL 1JL8A 5EFIB 2H26B 5KVDL 4TRPL 1PLGH 2VSDA 5C08D 4MSWB 5DJ8A 4KDTA 1WC7B 1RZGA 5EOQL 1AR2A 4Z95H 3SPVA 4ZPVB 3FAWA 2OQJB 1J5OH 1FYTA 3V79C 5E8PA 5GZND 2J7LA 1OSZA 5SV3A 4HEME 3BZ4A 3MRFB 1FNSH 4S10A 5MEPB 1T03L 5GGSB 5FM8A 1AXSB 3JV5A 3I85A 1FFNB 1YEFH 1DQQB 3QO1B 4F15B 3H42L 2NX5B 3O6MH 4X5WA 5F8QC 1T7XA 4FN0A 3VI4F 3GSRA 1DCLA 3BT2H 4GW5A 2X7LA 2R29H 1YNLL 4M7LT 2EXWD 2WQ8A 1G7LB 5J9PA 4HIEB 4PJHA 1K85A 2GK0B 3I6GB 2HTKC 4NCC1 3QUYC 1FIEA 1YN6B 1FN4A 3L7FB 3SE3C 2X6MA 1QBAA 1QSFE 3TJEL 1DUZB 3HZYB 4LRIC 4G8GD 1JRHL 1FE8H 3SY0B 2O5XL 1KNOA 4I3SL 4WW2C 5FXCH 4JQXA 5DO2D 1ZVYA 1NLBH 4RX4A 2N7BA 4PP1D 5CUSL 5CJQH 5FYJD 3NN8A 4QXTB 4Y7MA 1JMZA 5DEGA 1J05A 1O7VA 2QR0B 3G5ZB 5DRXA 5E00A 1IC1A 1CLZL 2OMNA 1KG0B 4RDQG 2XRAL 1RIUH 2EEDA 4O4YL 4FG6C 5I1AA 3BAEL 2BHYA 3MLRH 2NW3A 3O8XB 1F6FB 1KTLB 1TVHB 3KPSE 4OLVL 4WFHD 3WD5L 5I1IH 1DBKL 2DM3A 1XCQB 4XWGL 1AP2B 3EJYD 3DUSA 5D72L 3MOAH 4B5EA 1G0YR 4AENA 1X44A 5INCB 2NY0B 5CEZH 1CXFA 5F21B 5KSAD 5LQBL 1IKFH 1FNEB 4EZMA 3VDAA 3CC5B 3LN4B 2WLZA 4CKVX 5FA3B 1J8HA 2CXGA 5KSBB 1FL6B 3GSNL 5E56A 1I9JH 3TA3D 3RY4A 1KJ2L 4P46A 1RUPH 4KI5D 4ZXBA 4YNYB 3RQ3A 2XFXA 4UV4L 1KB5L 1AC0A 1BQSA 1VHPA 3ARGD 1MRFH 4PJFA 2GJ6A 3KR3L 4Y4KC 1PKOA 4XB8A 5CJ8A 3VGDA 5IEHB 2D0FA 3P4OA 1FORH 4L3EA 5CD5D 2EO1A 3I50H 2OL3A 2ZCHL 2DLTA 5JW3L 3KYOB 2VTFA 1FL3A 5HYFA 5CJOL 1KUMA 4Y19E 4RMRA 5LVEA 5BZDA 3GGWB 4IOIB 1R3KB 3OL2A 2ZUXA 4UQ3A 3TF7C 1CGWA 4PV8B 4QRRE 3WKNA 1K5NB 1FFOB 5E6YA 2HT2C 4DCQB 4M62L 3WHXB 2EICA 2YSSB 5KVFL 2NY1D 8CGTA 3ZE2E 5I6XC 2QSCL 3MUHL 2HKHH 3LB6D 3PNWB 4I48A 1BQHG 1U58B 4LSRL 3C08L 3CFJA 1JYNA 1HCFX 1KBGL 3IDXH 2EDDA 4NC1C 1M6OA 2RAMA 3GMMB 1LDPH 3PIQB 1YMMD 3L6FB 3Q2CA 2K3TA 1F97A 4U7KA 1HEZA 1XF2B 1AKJB 2HT4D 2WIIB 3QQ4A 1MFCH 4X7TA 1OGAD 1Q0YH 1A1OB 1DQJA 1NCDL 3AROA 2AV1B 2F74B 1BJ1J 4H5SB 2BVPA 3CH1A 4LU5L 3HMWL 3ULVH 4RFNB 5E94A 3MRBA 3C6LD 4BSVB 3KLAB 4NNPH 1BJ8A 5FO8A 4PJCA 1A1NA 3MLWH 5EZIH 3RTQD 3UDWA 3GSQA 2AJXL 4XPBH 3GNMH 1BBDH 4Y16A 2NXYB 4PRBB 2ZKHL 3B6SB 4HKXB 4KZEH 3D39B 3ARRA 4NZUH 4JFPB 3SN6N 2VXUL 1G7QB 4Q74A 1ZHNA 1Q9OA 2CIKB 5JTWA 4JFFD 5HYQA 3QNYB 4GKNA 4DGVL 4XPGH 4Y5VA 5EG6C 5C07E 5C6TL 4PG9A 5MI0C 3ILQD 1I1YA 3E3QC 2RFXB 3ROLA 5DRWA 1A4KB 4NFDA 1J0HA 4TQEH 2GEEA 3KPNB 1VGEL 2A0LC 2G75A 2JJTA 4EN3C 5JXEA 5I1HL 2BSRB 2ZUQB 1EA9C 4KTEL 3HNTH 3MZGB 4S2SA 5TE4L 4X98A 1HSBA 3LOWA 5IMLA 1X5GA 2GIYA 3ISWA 1MHEB 4P49A 2PO6C 1BM3L 2DTSA 4LVNC 8FABB 3O2DL 3VXMB 1LP9E 3G08A 4QHUB 2ADJA 2NY1B 4RGNC 4JJ5A 5EDXA 2W60B 3P11L 2LV4A 1JPSH 4YDVB 4HK3N 3VXOB 2HFTA 1QYGL 3EYOA 1I1AA 4RMWA 4EI6A 3BH9A 4FABH 1RZ8A 4OZFG 4GRLB 4HIXL 5JO5A 1EJOL 4KDVA 4OIAA 3ARXA 4NQDD 3L5WB 4HJ0C 1FO0A 3FOLB 4ODWB 1DTUA 1KACB 2QADB 4KVNH 3WFBH 1ES0B 4V2CB 3IXAB 4NKMA 3TLRA 2HJKA 3TZVD 1XR9A 4C59B 4KZDH 1HE7A 4JB9L 1G7JA 2VLRA 5ID0B 4WU5A 5H35A 2CRZA 5CP7B 3QAZC 5AWNH 1UA6L 1A47A 2P47B 5I2IA 2I9TB 2GAZA 4JN2A 3IAPA 3HG1E 3F5WB 3MCKA 1EVTC 1INDL 2BSED 1GAFH 3E1F1 3HAEA 4X6BB 2YHGA 3SJVE 4RZCA 4LHUB 2AW2A 4K94C 5IMOA 3VFGL 1BFSA 2A6JB 2AJSH 3RTQB 5J4MA 4X9HA 3P2TA 3MLVL 3HI5L 4XVSH 4PBVC 2VUYA 12E8L 3D2UA 5F6IB 1QEWA 1MFBL 3O9WD 1IM9A 4C57C 1KLGB 4NGHL 4UDTB 5CGYC 1QLRA 4HK0B 1FZOB 4WWKA 4BZ1H 1X4ZA 4PJGB 2NY7H 4PJBA 4ZUTB 3IJHB 5E8EA 1JTTA 1NEZA 3S36L 1QVOA 5BV7B 3OXSB 2HKFH 3BOVA 4XAWL 3PWPB 3TBWA 5F7NC 2ZCLL 1T89A 2VDNH 4OBSA 4OD3L 4RX4D 5EU5A 3UC0L 5E70A 3SDCA 4ZNEE 4YPGA 4IMKA 4FQXA 5C0FA 1KN2H 3B83A 3KPRA 1WAAF 3EZ8A 4QXUH 1MFEL 3R8QA 3P9MA 3O3AA 2RHEA 2P8MA 4TPRH 3EDEA 3T65B 3UX9B 4OZIB 1KJ3L 2FLRT 1PZUB 4GKZB 5C0DB 2AAVA 3K81A 3R1GL 4PJIB 2IG2L 2A9MH 5IVXA 1S7XA 3DX7A 3T3MF 5CJ5A 4ZD3L 2NY4C 3VFPA 5FCUL 1S7SA 3DHMA 1OWRM 1WZMA 4FFZH 5FGCB 5D1QA 4RGMB 1EGJH 1JMXA 2R1YA 2FB4L 1PAMA 4G8EA 4XMLL 4YIQA 4PR5A 5SWQA 5GJTL 5DJ8B 1RZGB 4P46D 3SPVB 2MPAL 2KZWA 1OF2A 1UG9A 3E6HA 4ZXBD 4ZUUB 1A3RH 1FYTB 5E8PB 2FIKA 4UQ2A 4MQ7B 3FO0H 1OSZB 2W9DL 4LEOA 2OTUA 3BZ4B 4H1LG 1G1YA 1KCLA 4POZC 4IM8A 4OCRL 4JQVA 1LK3L 4D9QD 4PUBH 4LAQH 3NCYS 2VISB 4X5WB 1DP0A 2V9RA 3QBTB 3GSRB 2Z0BA 5EIQA 3RVTC 4GW5B 2X7LB 3STZA 5J9PB 1U8QA 3CFBA 3P3YA 1IQWL 5BS0A 3V4VL 1HSAA 3F12A 4JY4A 4TTDD 1U3YA 4OD1H 1FN4B 3LQMA 3EJZD 5F88A 2WBJC 3KPTA 2WUCH 3B3IB 5CIPA 1KNOB 3BJLA 4Y19A 4HUXA 1FHGA 3P0VL 1FIGL 1DQDL 3NN8B 4YHKH 1KGCD 5C71A 4KAQL 1BVLA 4N0RA 5DEGB 1J05B 4GW1A 2FHFA 5E00B 4KTDH 5FDWA 2FJFA 4I3GA 3OG4B 1VERA 1ZOXA 5D1ZA 5I1AB 1D5IH 3LN9A 3HR5A 1FVCA 1JZ5A 3W0WE 1I7UB 5FK9A 4EQ2A 1C16A 1IGIL 4CL7A 1ADQA 4XP1H 4Y4HA 4OV6F 4JKPL 5EUOE 2EDXA 4M6ML 3DUSB 4OLEA 3V6ZB 4AENB 4M4RA 4M1DH 5E5RB 3PP4L 1NAKH 3GSVA 2CXKA 5JIKA 1YJDL 1UC6A 2A6DA 1MJ7L 1OD9A 3WJLA 4Y16D 1J8HB 4GAYA 4TOYL 2VR4A 4AG4H 1SY6A 4A6YA 2AV7A 1RZKH 4CVZA 1CICC 1MNUH 2F54A 3KXFB 3ET9F 4NM4H 5IG7B 4ENED 3PJSA 5JA8B 4PJFB 2JELH 2GJ6B 2XA3A 5KTEL 5K9OA 2UWEE 2NMSA 3WJJA 3ZKXC 3MLPA 1DLFL 4L3EB 4D9LH 2VAJA 4PJEA 2MHAA 3JWOC 1MFDL 2OL3B 1YNTA 3BZFA 3CXDH 2YPVH 1EUUA 3V9FA 5ITBH 5JXED 3RGVA 5ICXA 4HBCH 3I3EA 3B5HA 5BZDB 4UQ3B 1ZHLA 2YD9A 4XBGA 4LP5A 4KUCD 3V7AG 1UWGH 3QUMH 4JO3L 1JPTH 1CFSB 3PF2A 5L8JB 4I48B 2ZCKL 1FZKA 1I1AD 5KVEH 3CFJB 3V4UL 2GJJA 2RCSH 4QTIH 2WV3A 1VFUA 3LZFH 4MJ6A 5KS9F 2Y5EA 1M6OB 1SM3L 2NXZC 3MRLA 5F71A 1G9MC 4QRUA 3V7MA 2G5BA 2J8UF 5EBLA 2EEBA 3HHRB 1BIIA 4PY7A 3W11D 1LEGA 4OUUA 2IFFH 4JM4H 1U91A 2AERT 3QQ4B 2W65A 2VDPH 2EDQA 2NY2B 2VLRD 1AY1H 1AGDA 4QY8A 3U0TA 2R4SH 4OBRA 1DQJB 3FT3A 3WXVL 2H32A 4KC3B 4NQCE 4PJ8A 4BFIA 4KHXL 2BVPB 4CUCA 3CH1B 4U1GC 3UPRB 5DEFA 5E94B 3MLYL 3MRBB 1AO7E 1PG7X 5FO8B 2FX9H 4NJAH 4PJCB 1A1NB 3V0AC 1PSKL 3LS4H 3GSQB 3GRWL 3B9VA 4XWOC 4Y4FA 5C0ND 1MIEH 3GHEH 3MJ8A 4Y16B 1U8PA 1JBJA 5GS0C 2ORBH 3D2UD 4PJAF 5I1GH 3HG1A 2ENSA 2YZ1A 2YD5A 1IGFH 3SJVA 1L7IL 1AHWC 3VFNA 1V5JA 2Y36L 4LFHG 2MCG1 1ZHNB 2R2CA 1Q9OB 1UJ3A 4O58L 4NM8L 3S34L 5HYQB 4W4OC 4GKNB 2WUBH 4K2UH 4Y5VB 1MCBA 4ZAKC 2HRPH 2HWZL 3FT2A 3ZO0A 1JTPA 3IDGA 2N56A 1I1YB 5E8DL 3X14A 3H9ZA 3ROLB 5DRWB 4LSVH 2G75B 3SDCD 3QIBC 5JDJA 1FC2D 1CLCA 1JHKH 4S2SB 3KPRD 4X98B 1HSBB 5IMLB 3NTCL 1QSFD 5EOCH 4PGJA 1K6QH 4RDQF 2E9WA 1HINH 5EIVA 1ROWA 3RWCA 2ADJB 2X2YA 4JJ5B 1A7QH 5JQ6L 5TE6L 1KELL 1WWBX 4ZNEA 1F42A 1LO5A 3EYOB 1DVFC 1I1AB 1MQKL 4EI6B 1GPOL 4OJFH 1JF1A 1RZ8B 4FQHA 3Q5YA 4JHBA 2ED8A 4CGTA 5DMJB 4ODBD 1XGRB 1H3UA 3WUWA 1V7ML 1FGNL 5JO5B 2H41A 1AR1C 4YXLL 1INQA 1LE9A 2BFVH 1TVBA 5D1QD 5GGVL 3KPSD 1FYHB 1OSPH 1FO0B 1P5VA 5A40E 5TQ0L 4K7PX 4MAUH 1I3VA 4NKMB 1XR9B 3MQIA 1A22B 1G7JB 3EDKA 3K8MA 2Y1VA 3X17A 4JFEE 4WU5B 5H35B 5ANME 3LEVL 5C8JB 5I2IB 4P0DA 2GAZB 4JN2B 3UAJC 3MCKB 2YC1A 3HAEB 4IIQC 3OKEA 4RZCB 2K1MA 2KPNA 1DR9A 5IMOB 3KJ4B 3CNKA 2BVUA 3CSPA 4FZEL 3G6JF 3WYRA 3HPLB 2QQKH 1DQML 4UT6H 4JRWA 3D2UB 5I1EL 2HMIC 1IM9B 4YAQA 2OJZL 3G5XA 3DVGA 2DQTL 2L4OA 1QLRB 1MWAA 4YDIH 4WWKB 4QO1A 4U3CA 3OKKA 4PJBB 3EO9L 3EOTH 3MV8A 1ZTXL 5E8EB 3RUGF 3ZYZA 1NEZB 3RDTD 2M26A 1OLZA 1QVOB 4F9PC 2DJUA 4Y19D 3BQUC 5EU5B 1OHQA 1AJ7H 1G9NL 5EU6E 3OKDA 3SDCB 1MJ8H 4QRRD 4YPGB 3S96A 2APFA 4FQXB 1IGJB 3UJIL 2EYSA 5C0FB 3KPRB 1S7VB 1NDMB 2EYTB 4JEGB 4XI5D 4PLNC 3P9MB 3O3AB 1ZV5A 4WI6A 2P8MB 4JM2C 3B9KA 3HFMH 4CVUA 3PP3H 4LGSB 1DN0B 3ARQA 3CLFH 3UTQA 4JY5L 4DGYL 1DANT 3W81A 4HXAH 4YHMH 5IVXB 1S7XB 2EE6A 3DX7B 2LU7A 5JPNA 1S7SB 1R3JA 4BJLA 3W0WA 3JWDC 3BN9C 4QEGA 5EU7E 2V2TA 4G8EB 4YIQB 4PR5B 5SWQB 2MTPA 3S37H 2EKSA 1QACA 1IC5H 1I9EA 2V6HA 4HWZA 3NIFE 3SGKA 4JHWL 3DNKA 4JZJB 1OF2B 4KUZH 2FIKB 2BSTB 4UQ2B 4WV1A 2A77L 3VXNA 4LEOB 5DUPL 2OTUB 5ERWA 1CFVH 3QG6B 5E4IA 2AKRA 2OCFD 4O02L 1IKNA 3NA9H 1MHPH 4DUVA 3EZJB 5EO0A 1FCGA 3PHQA 3VGAB 4TNVK 3BVNA 4HSQA 5T1MA 1BGXL 3STZB 4KK9C 5J0BA 1I9RL 3CFBB 5J57B 5C07D 5BS0B 2Y72A 2GY5A 4LARL 4YLQT 3A0OA 4LCWE 4Q58C 5F7LB 5D7IA 4F7MB 4B50A 4JY4B 4YFLF 1TQCB 2ZUWA 2C3GA 5JUEH 5CMAA 1FQ9C 4ZUSA 5CIPB 4GRWE 1RUQH 5AEAA 5ESAB 1ZA6A 3GIZH 3PQYA 1OP5H 3O6LH 1I7ZA 3O6FC 3WCYA 1J0ZA 3HKFA 1EJ6A 1H3XA 4MNHA 1BVLB 4HCRA 3PDGA 4GW1B 4R90H 5IROC 1BAFH 5FDWB 2FJFB 1N26A 5EBWA 3KPQA 5D1ZB 3TO4A 1CL7I 3HR5B 4WHTA 1FVCB 5KG9A 4MCYA 3VJ6A 3T04D 4CU8A 5FK9B 4XNQA 4OLXL 2YMXH 4OGXH 2ATKA 1FVEA 1C16B 1GYAA 4QHLA 4DKAA 4Y4HB 4N5EC 2R29L 3HRZB 5CINH 4W6XB 4PLKC 2Q8BH 1GZQA 3WBDA 2X70A 2GY7B 3HI1B 1U8KA 3GSVB 5HHOA 4R7NA 1NCCL 5C0BB 4Y4FD 4NQCA 3O0RH 4PBWD 3N06B 3IFNL 3VXRB 4GAYB 2CKBH 4P2OC 4ONOA 3RJQB 2R0KL 3HG1D 3NFSH 5CJQL 2AV7B 4A6YB 1DZBA 4K8RH 3SJVD 1KJVA 2FECL 3P73A 2F54B 4WNQA 2X1QA 2OR8A 1NGXA 3TBTA 2AQ1A 5CGMA 1QFUL 3MRQA 4C56E 2OR9H 4X99A 5DZOA 1RIUL 5K9OB 4L4TE 3MOQA 4LHUG 3MLRL 4EKXA 4PJEB 2MHAB 5SWZE 2UUDH 3BZFB 1MPAH 3ROOA 1E27A 3MCG1 2JKXA 3RGVB 5ICXB 4BK5A 1RHFA 5HYEA 4X9BA 4UOW1 5IJVA 4QT5A 3EIFA 1YNKL 1W0WA 2FEEI 4XBGB 2AJUL 5DZNA 3PG2A 3VI4E 2F8VA 2PTVA 1Z0NA 1U6AL 4JAMA 2YN5A 1NGQH 2DI8A 2Z8SA 1MOEA 1JGVL 3FZUD 4NKIL 3IS0X 5GSRA 2ZPKL 5DUBA 3NZ8A 2Y7QA 1FZKB 3EHBC 1RUPL 4MYWB 4JFXB 4UTBL 3ZTJH 1BP3B 3MRLB 4QRUB 3BZDA 2I24N 2KKQA 2G5BB 5KAQF 4G80A 5EBLB 2HVKA 5EWIH 1BIIB 3GSXA 4PY7B 4HKZA 1LEGB 1OCWH 1MCPH 3DI3B 4OUUB 1BFTA 4PRNA 1IMHC 1U91B 3I50L 1SQ2N 2W65B 3RY6C 1P4BH 2FGZA 2XN9E 4QY8B 3U0TB 1AGDB 3LKOA 3FT3B 1DBBH 2H32B 1E4JA 1CLOL 1G6RA 1QP1A 4PJ8B 3GMRA 4BFIB 9CGTA 1YEKL 2X1PA 4UINH 3QXVA 4WI4A 4QKXB 5DEFB 3U83A 1DEEA 3MRHA 3INUL 3QUYA 1I75A 3ARPA 5EO9A 5FA4B 4LRIA 1JGUH 4Y4FB 1EMTH 3KAAA 3WMSA 4WW2A 3MJ8B 1U8PB 1C12A 4WY7H 4WUUE 3U7YH 5BO1H 5EZJA 4U1SA 1BQLH 1UEYA 3HG1B 3O2VL 4G6ML 3FQWA 4DFHA 5I16B 3SJVB 3C09B 3VFNB 3BSZL 3EDJA 2DQHH 1QBMH 5KVMC 1UJ3B 2E9BA 1OAUL 1K3ZA 3MLSH 4U6VH 3ZHKA 1LO2H 5DRNA 1JE6A 4OCNC 3FT2B 3IDGB 5F9JA 1MFCL 3X14B 3BDYH 4IHOA 2EDLA 1KOAA 4I3RH 2UVFA 1QOKA 3U48A 4DZ8A 4OZHA 5L7XH 4NNPL 4NT6A 1PQZB 5I9QC 3U6RA 3MLWL 4FQ1H 5GGTL 2GTWA 3U7WL 1FFRA 3RWCB 4UIKL 5FHAL 5SX5H 3IDMA 1T22A 3S35H 3B9KD 1M4KA 1CFBA 4XPBL 2IBBA 1BBDL 5J1TC 5B22A 1LO5B 3FCTA 2DL2A 1W0YT 5DD5H 1OLLA 2Z35A 3DSFH 4PD4K 4UNVA 4KZEL 1JF1B 4NZUL 3TNNA 4FQHB 1H8SA 4MS8D 1Y6NR 1MRDH 3WUWB 1A14L 4XBEL 1INQB 1LE9B 1TVBB 3KS0H 2BNRE 3W0WD 4Y4KA 3ES6A 1VPOH 3QDJA 5E1HB 2E8YA 3C60C 4K3GA 3B2UC 4MJ5A 5D2NE 3HNTL 3CDGA 5I8OL 5HHME 1JNNL 1A0QH 2I9LA 2APTA 5A16B 5I71C 3I9GH 2YC1B 1MLCA 4JRYA 3OKEB 1T7ZA 1JV5A 2EDWA 1M7IA 1CDBA 2D7OA 3WS6C 1RURL 1NBQA 3K2UL 3PWLB 3PWUA 2V2WB 3NABH 3TVMC 3GKWH 4ORGA 4XNXH 2Y07L 5F7YC 1A9EA 3ZDYF 2CKNA 3VD9A 3V8CA 4Z78B 4FABL 5CEYA 4YAQB 3G5XB 3DVGB 4NWTH 4DOHE 4FMFA 3GMQA 3OKKB 2ESVE 3VE0B 3MV8B 5HHQA 1NCNA 2ARWA 3NIGF 5GISL 4MA8H 4MX7A 1YY9D 1CD1A 3F62A 5J1SC 4KZDL 4XP4H 1DQTA 2VO5A 4RWYH 5IW6A 5C2BL 2VMFA 1K8DA 3OKDB 4J3WA 5AWNL 5CZVH 1DDHB 4U7MA 3S96B 4LCWA 4XNUH 4OZGA 5B8CC 1VGKA 4Z7OF 4TN9A 1MCNA 3BPOB 3RHWK 4YHYC 2F53A 5I17A 4HMEA 5LWYL 1W72A 3TO4D 2BX5A 3OAYK 1XGUA 2JCCE 2YXFA 1B4JL 5HHXL 1RK1A 3NAAH 3B9KB 1JP5A 5EN2A 3CDCA 5L6YH 1NBYA 4HGMA 3HCVA 1NCAL 1J18A 5CEXA 1EPFA 2LTQC 3K74B 2EDEA 3UTQB 1TZIA 4ZS6C 4KHTH 2GYSA 2EC9T 3PDDA 2NY7L 4N0CC 2CGRH 1VADA 4RRPA 5JPNB 2DLFL 5HY9A 4YZFF 4MNGE 4J7RA 1R3JB 2YRPA 1BVZA 3W0WB 2ZNXA 2QQQA 4QOKE 1QFOA 2V2TB 2HH0H 2VC2H 4NQCD 3SGEI 2VDNL 2DLGA 2EKSB 1FP5A 2LFGA 3L3HA 4HWZB 1Z3GL 3WNNA 4EN3A 3K4AA 5DMKA 1KN2L 1AO7D 2VR9A 4S1QH 2DLHA 4WV1B 4QXUL 1FV1A 2VDQL 3VXNB 2PO6A 4QXGH 2Y6SC 4JPKL 5C0AA 2R2EA 3KYNA 3GO1L 3VGEA 4DKEL 4X4YA 5I74C 4NOBA 1OPGH 3FOMA 2AKRB 4GXUN 3ZKSD 3OKNA 2NY5H 3HE7A 4NC0B 3ULVC 2J5LC 5EO0B 4G7YL 3N85L 3PHQB 4CMHB 1KN4H 3LDBC 5IP4A 4Y1AE 3BVNB 5IQ7L 3MJ9H 1S7TA 5D7IB 3AB0B 4N8VA 3V5KA 4S1DD 5CMAB 4ZFOL 4Z7NF 1ZA6B 3PQYB 3U7AA 4R96B 1I7ZB 5FYKU 1HI6A 4LKCA 5H37G 3VFVB 1A3RL 1S7UA 2FH6A 5T3XE 3FRUA 3FO0L 1CTNA 1CBVL 2WBKA 1XGPA 5EBWB 5I1JH 3NPZB 2Z93A 5DQDH 4H88H 3KPQB 3TO4B 2P4AB 4YGVA 4WHTB 5D71H 5KG9B 4MCYB 4YWGH 4PUBL 3HMXA 5CP3H 3VJ6B 3NBNA 1I8LC 2I25N 4XNQB 1Q0XH 1ZLWH 1FVEB 2Q6WB 3L7EA 4LK4A 4L8SC 1EFXD 3KLHD 4QHLB 2XYCA 4E41E 3MZTA 2C3HA 4TNWK 4FZ8L 4IMLA 4Y2DD 1GZQB 1S9KC 2X70B 2YR3A 3NCMA 4DAGH 4OD1L 3QR2A 5JPMA 1U8KB 1X6LA 5T33L 5HHOB 4R7NB 5E1AA 5CGTA 4JFED 2QL1A 2QV2A 2XPGA 4L3CB 2B8OT 4NQCB 4U1IA 2YPLE 4K07A 4TTGA 5JXAL 4CNIA 4NN6C 4BZ2H 2X40A 1J1PH 1D6VH 5K59F 4YHKL 3JTTA 1KJVB 3WLWC 3P73B 4WNQB 4HT1H 1NGXB 3TBTB 1VEPA 1P7QA 2CQVA 3N0PB 2VKWA 4KTDL 3MRQB 3LIZH 1UM4L 4X99B 2N1KA 3HAEG 4JN1H 1D5IL 3FO1A 4FG6D 5FECB 4K23H 4WUUA 2KQMA 1HQ4A 4OKDA 1DQLL 5EH1A 5I18H 3ROOB 1E27B 4HXBH 4HDIA 3EO0A 5IJVB 5E4EC 1LEKA 2EDKA 3B2VH 4QT5B 4HUKB 3DVNA 1W0WB 1WGOA 1NANI 2KL6A 4U1MA 5JZ7C 1NAKL 5T5FL 4H1LH 3U36A 2VDKL 1ODAA 4FQ2H 1BHGA <