1XGQB

Structure for antibody hyhel-63 y33v mutant complexed with hen egg lysozyme
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
210
structure length
210
Chain Sequence
b'EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDVWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgqB02
2VYRE 3VDBA 5IFAH 5AZEL 4NC0B 5CEYA 5HVGB 4H8WH 3U9PH 4HWZA 4KRPB 2R4RL 4O00A 4XNZB 3JTSA 1KFAH 4JJ5A 3B6SB 3KYMB 5MEPA 2E27H 3BWUC 4HKXA 3VXRA 3S3PA 3VXUE 5T1KB 1T21B 2EICA 3Q3GB 4MDJB 5A16B 2MHAA 4D0BB 1FAKT 5CMAA 1OSPL 3ZDXE 3FHAA 1RZFH 3GSUA 4R97B 3JWDH 4ZTOH 2AJXL 5ACMA 1HXMB 3OF6D 2EXWD 4ORZC 3V7AG 3VI4F 5EFIA 4P2CG 1WCBB 1AQDA 2C3VB 3QEUA 4L4TB 1IJ9A 1JPSH 5FKPB 2LU3A 1N64H 5E4EC 3PNWB 2V2WB 4AEHH 4TSBL 3LKRA 1FVEA 3TVMC 3KG5A 3O3AA 5IW6B 3STLA 4RIRA 4L3ED 4TUJA 3EO0B 3BN9D 3AS2A 3MRGA 3EIFA 1U93B 2GKIA 3O11B 5ICXB 5E1AA 3TCLB 3B2VL 4ZUTB 3WFCL 4OF3A 3RWGA 1JZ5A 2V17H 4EN3C 3MRCB 1CLZL 3GHBL 2XI9A 3O2VL 4HS3B 2NYYD 5TH2B 3U7AA 5HYIA 2EYTA 5D1QD 4XNMB 4MDIB 3LN9A 1RZGB 5DEGA 3OKNA 5C70A 4F9PC 3GBLA 3KJ4C 1AGCA 5IM7B 2EEAA 3V95A 4YXKL 3WUWA 5C0JA 1AGDB 2A1WL 5ETUB 3NIFE 5CGYD 4IJ3B 5D93B 2O61B 4Y4KB 2L7UA 4P5TA 3RL1A 1TNMA 2NY0C 2WP3T 1RFDL 2FL5B 2PKDA 2A6DB 5IJVA 3PDGA 4JGMA 2XRAH 5SWSA 2FBOJ 1K4CB 3UTTA 3UO1H 3QJHA 3T77B 3TT1H 3I6LE 2X2YA 3PWPD 3VW3H 3RJDA 4WFED 5TFSH 4BJLA 4XP9H 4LLAA 4RGMC 1WAAE 4P2QA 3MA9L 5J11B 1LDPH 3U0TB 2CGRH 1HYSC 4LF3A 3GUTB 4YHPA 3MV7D 1BZ7B 1YMHB 5T3XL 1B4JH 4M1GL 3C2AH 1I9IH 2HMIC 2PCPA 4IRJB 4L9DA 1LE9B 1J1OL 2OJEA 2QQKL 5KN5B 1YDPA 3MGOB 4LAJH 4YE4H 4BZ1H 1IC5L 1WEJL 1OW0A 4NFDA 1JHKH 2H6PB 1FGNL 4ZO8A 3IDNB 5FGBC 5F7YC 4JN1H 2AABH 1IGTA 2DM3A 3WL9A 3FQXB 4KJQC 4C4KO 5I8OH 1TZHB 4NWUL 1YEEL 4QYOA 5JA8B 2QADB 3A6BH 2L4OA 3MXWH 4KHTH 5CJQL 4ELKB 1EX0A 4OZHA 3MLRH 4J4PC 3TN0A 4BSJA 5T3ZE 1A3QA 1TVHB 1CF8H 2VXUL 2B2XH 1MLCA 1R3LB 3FQRA 1U92B 4X4ZA 4OZFB 3HI1A 4XHQA 2CRMA 3MUZ1 3F7PC 4KZEH 1H5BB 3BHBB 3IFLH 3MYZA 1NGQH 3BYYA 1GGBH 3GSVB 3QZWA 4HJ0C 4NQXB 4KKBD 3WKMH 2VLLA 2EIBA 3VXOA 4H5SA 4HMCA 1F4WH 4AIOA 3HMWH 5DJCA 4R96B 1XR9B 3KPRA 1MQ8A 2H1PH 2F58H 2K7QA 2PYFA 3QI9C 5DA0B 4FRWA 4E5XB 5D7IA 5ABDE 2QSQA 5E5RB 5I18L 2B1HH 3NIDE 3V4PH 2I9TA 5CEXB 3WS6A 3X11A 4PJ5B 3ARUA 4LARH 7FABL 2F74A 5KSBE 4K3JL 5HD8D 1UA6L 5CKAA 1E6JH 1V3JA 3N9GL 4NZJA 3CK0L 1WWWX 2CDFB 1XCTA 5HHXL 2DMCA 4Z5RB 3HC0A 1V05A 3GBMH 2WUCH 3QT2A 3CU1A 1S3KL 1AGBB 3H9ZA 4A6YA 3DUSB 1YMMA 4TVSa 4N5EC 5FFLA 4HS8L 5EBLA 4R3SB 1R6VA 1JCKA 1LO3L 3CH1A 4XNYH 3FO2A 4L1DA 4LVOB 1YQVH 4X7DC 4LEOB 4LCCC 4OZHF 5F6IC 4AEIH 3CXDL 1L0XA 5HDBF 4DVBB 3Q0HA 3FO9B 2BNUB 5I8EA 1NDGB 1BVZA 5E2JA 2FHBA 3VWKB 4V2CB 4XP4L 4X6EA 3QCUL 1A6WH 1J0HA 2Z31D 1OAKL 5DD6B 2H3NB 4G6AD 1EDQA 1EO5A 4QY8B 3LDBC 4Y2DA 1OP3H 4P46D 2IALB 4ZNEE 5ADPH 5TF1H 1OTUD 1IM3A 4P2RE 4F15C 4XC1L 2MPAL 5DT1H 3ALPA 1WBZA 3KWWA 2J5LB 3U1SL 4YXHL 3DWTA 2A0LD 5D7IF 2CKBA 2R69H 3GKWH 3TYGL 4IOIB 2CR6A 3P73A 5GZNC 3KDMB 3AGVA 4DFHA 2VUOA 5IBUB 1P7QD 1ZEAL 1DBMH 4YDKL 3QG7L 5FUCC 3BP5B 3UP1A 5D1XA 2YBRA 4LPCA 3IDXH 3QIUC 5IOPA 3BEVB 5DTFB 1NEZG 4LLWB 3CFBA 3T0EE 5DJ8B 1MI5A 1JK8A 3UEZA 4NO2B 2VE6A 5JIIA 1RK1B 4Z6AT 4O9HH 4L8BA 3QNZA 4PJEE 3MRPA 4HC1H 4P2OC 2R0ZH 4Y4FD 5IMKA 4U49A 4FQHA 4DKDC 5IJKA 3D18A 1RU9H 5KS9B 5DRWB 1OF2B 4WV1C 5CBAA 5KW9H 1R3JA 3CDGA 1HXYA 1JNHB 1U3HB 4LCWB 2IGFL 3PJSA 2HTLC 5BV7C 5E08H 3VA6A 1IAOA 1BQHA 4PJ7B 3LEXA 4TRPH 3SKMB 4CW1A 4L3CA 3QUXA 3VGEA 5JXED 1EVUA 3O6FA 3GSRA 2F5AH 1TTFA 1A2YB 1WZ1H 1LO5B 3HHRB 3HE6D 4FN0A 2CK0L 1MHCA 4HKZB 2EXYD 5L2KD 4U1JB 4FQXC 4WWKC 5ICYA 2J8HA 3MXVH 2HT3C 2R1XB 3QJFB 5F1KC 1PG7H 2B1AL 3T2NH 2V9RA 3VWJB 4OCNC 1H3XA 5CZXD 1DN0B 4PGCA 1GH7A 1OGAD 3I3EA 4R90H 1KLGB 4XCEB 4MLSA 4JZNA 3EOAA 1JWMB 4LOUD 4JM2A 5JORA 4X4YA 3D2UB 1MWAA 3VXSB 2FRGP 4UNUA 3QIBA 2VDPH 3OHXA 4PJCA 2WUBH 5T1LD 1H3VA 5IG7A 4KHXL 1ND0A 4DN3H 5EO1A 5IUSA 1FBIH 1H3GA 1A7PL 3I02B 3OWEA 2VZ1A 2W91A 2CLVB 3GK8H 4JFFB 1S9KC 1QSFE 4PJHE 4NQCD 5I73C 1YNKH 1DVFD 1ZT4B 2Q3AA 2EE3A 1G7HA 3GSQB 4X7FC 2DBLL 5INCA 5I9QC 3ZLQC 2FGZA 4JQXA 4KTEH 3MLTB 2PYED 3QWRA 5ERWA 3NCYS 3BYTA 4KDVA 3B3IA 4TNWF 2IC2A 1I3GH 4W6WB 2Q76B 2Z4QA 1UM6L 1YEGL 4YHKH 1IM9D 4YQXH 3SGDI 2YPVH 4G6FD 3WLBB 4ZFFA 5FO9B 2QKIA 2R0KL 1FNSL 4JKPH 1I8KA 2X89A 2PF6A 3VFSB 4I0PC 3LKSA 4U6YA 3NA4A 4YXLL 3T65A 5KG9B 4PP1C 3LEYH 1YNTA 1MIEL 4O2FA 1ZS8A 1SMOA 3ARPA 4ZQKB 4XVUC 2DQUH 1S7RB 4LVEA 2JB6A 4RAHA 2EYSB 5CAYB 2VAJA 4EDWL 5IF0A 1YEDA 4POYA 2NY1D 2VZUA 1CK0L 4GJTB 3ZKQD 2LU7A 3KPLA 3K2MC 1LEGB 1Q94A 2HG5A 4N8CH 1SJEB 4MCZA 4JM2F 3LKPA 5JO5A 3CVHA 2Y5TB 3REWA 5GS1B 4RFNB 3QPQD 3S7GA 3KYKL 5B8CA 3IXTA 1BEYH 4P5KB 3MOBL 3FO1A 5F3HB 4CUCA 4FXGB 5K33A 3BPLB 1YJDC 1FP5A 4PJXA 3P9LB 1Y0LA 2ATKB 4Y16C 2HTKD 3MA7B 1UJ3C 4JPVH 4UDTA 1MFEL 4L4JA 5F89B 3PDDA 4R0LB 2YA1A 2YPLB 5TE4H 3WJJC 4I48A 3GMNB 3LN5B 4PFEA 4XCCH 4F8TA 5FO7A 4OV5A 4IRZH 4YIQB 4ODTL 3VGGA 4O2CB 5C0BD 3V0AC 5D2LA 2UZIH 5IB1A 4MNHB 1OD9A 4D0DA 4MA1B 4ELMA 4Z9KB 3PABB 1FC2D 5GRJH 3GI9H 2LE9A 1Y18A 5T3XD 1WWAX 1FH5L 3UMTA 4OUUB 3O9WB 5FEBA 3QXAB 5IK3B 4JPIA 4QT5A 1FG2A 5AEAA 4PGBA 2XXCB 5DWUH 2QTEA 3DV6B 2OM5A 1MRDL 3IGAB 1JZ8A 1XGUA 1AGEB 2KQNA 3PL6A 5HHOA 5IBLC 4DGIH 4LGRB 5FYKE 2BSSA 3PP4H 1A3LH 4TQEH 3TIEB 4LMQI 5L8JB 4J3XA 1BX2A 3FB6A 4JM4L 3SJVD 4H25B 1NAMA 3PV7A 3UC0L 1BGXH 2A9NL 43C9A 2JB5H 3MRIA 5MI0B 5KSAA 3G6JB 3QRFM 1FNGB 2H32A 3MV9A 1INDL 1DQJA 4MQ7B 4Q2ZB 3RKPA 3MLWL 5EC1A 1CE1H 4PJXF 1IEHA 2IMNA 2W07A 1MJ7H 2X09A 3RA7H 3WDIA 4P3CH 3MO1A 3JUYA 3MLYH 3RX5A 5I6XB 2GJ6D 3BJ91 4GRMA 4L8CA 1CIUA 4DOHE 1FGVL 1RZJC 2IFFL 2HT2D 1RUML 4X7SH 2XG5A 3GB7A 2PO6C 4Y5VA 4HBCH 3SDAD 3ARBD 5D7LA 4F57L 4Z76A 1NGXB 3MJ9H 4QNPF 4R8WL 1G7PB 1OY3B 2YMXH 5GIRB 1M7XA 2XN9E 3MRJA 4GLRI 1K8IB 1D9KC 3CZFB 4ELMF 3WXVH 5E94A 4JHWH 4R2GB 3IXAB 3U48A 4HH8A 3P0GB 1HHHB 3X3FH 1T5WA 1BFVH 2D7QA 5E5UB 3ZHLA 5DI8A 3NH7L 3TCXA 5D70L 4CL7A 5SV4A 5DEFB 2HFTA 5I1EL 1A6VH 5SWZE 2WWKO 3TV3L 3TBTB 1JPST 2XZQH 2RJMA 2ZUTA 3GHEL 3EJJX 5GGSY 3SKOB 3CFDA 4L4VA 1T5XB 3CFJA 5B3JE 1EAPB 1U8HB 5JMRA 2WBJC 1RZ8B 2Q3ZA 4HS6A 3S3JA 5IP4A 1B0GA 4URTB 4WUUB 1JPTH 3R06A 5ILTL 3SDDA 1QBML 3T0XA 1HEZA 5KS9E 1NL0L 5DRZB 3ZDZE 3ARDA 5GGQL 3MJ6A 1D5ZB 2NY4C 5EN2B 4X8XA 3KR3L 5HBBA 2VLRE 4LCWE 2EDWA 1UQSA 1C16A 4OBRA 1JYXA 1J8HE 1D5IH 2B4CL 2EO9A 4PJ7E 3ZE1F 1SYSA 4TUKH 3KPQA 5D2NE 2DYPB 1OHQA 4UV7H 3GM0A 1FORH 4OLVH 4NYLB 5CJBA 5HPMA 1HSAB 1N0XL 3VH8B 4OLXH 4PJIB 1G7MA 2BNQD 1AXIB 3FQWB 4NCC1 3THML 3DPBA 3BZFB 3IDGA 2DKSA 3T4YA 4PJDE 5F7HA 4WNQA 3NZHL 1HKLL 4MNQB 5E2VH 4A6YL 1S9YB 3H0TA 5BXFA 5IVXB 1L7IL 2H8PA 3VFUB 4YHNA 4N1CA 1X44A 2ED9A 2B7DT 5GHWH 1I9JH 2OI9B 1J86A 2MCG1 4DKAA 1DUYB 1ERNA 1V3MA 4JFFE 3O4LD 1MUJB 1NAKL 1QQDB 4JY4B 1JZ2A 5JW4N 2X9WA 3PDOB 1RUKH 2HLAA 1YEJL 4YHZL 4RQQB 3F7VB 2WSKA 4E41B 2B0SL 1FZJB 4IOSD 2QQLL 1IGJB 1U8QB 3SQBA 4NIKB 4EJ1C 1BBDL 3ZL4L 4OCSL 3IF1A 5D7JB 4LLMA 2NLJA 4MWFA 5DFTA 5C08A 5ISZD 2J8UE 3BW9B 2CKBL 1MJJA 4RGOH 5M7QA 4MXWH 4NN6B 3QXWA 5C0AD 3VXUA 4XTRD 2CLZA 3NABH 4AG4H 2A74B 3HA0A 1D7FA 1I7RB 3DVGA 5GGRA 4YAQA 1XIWD 3MYJA 1Q9LB 1GGCH 4OCRH 4HIJB 4LAQL 1DQQA 1UKTA 1NC2D 2OYPA 4Z7UE 1XGRB 4Y19D 1BJ8A 1N5AB 3O6ML 4M7LH 5DA4A 3QHTC 2EXWC 1DTUA 4NM4H 4X5XB 2BCKB 4EI5B 5E2WL 1FZKB 3V7MA 2HAZA 5F1IB 1MNUH 4PRHB 4HV8A 1FDLL 1TVBA 1YPZB 5JPNB 4K71B 3ES6B 3WUWG 3RBSA 4CVWA 3GO1H 3QDME 3BN9C 4ZXBD 1EHXA 1XF5B 3AXLB 5JOFA 4UTAH 1BQSA 2R0LH 3DMMA 4D9RD 1JF5A 4OIIL 4X8JB 2NY5L 2YPLE 4WO4B 4L4TD 3MCKB 4NCDA 1UEYA 2NYYC 5I30H 2Y7QA 3UJTH 5F9JA 4OFIA 4AT6B 1SJXA 5D1QC 5FCUH 2JTDA 4PIRF 1KLUA 4I1NB 4YEEA 4S1DD 4GW5B 1T1YB 1TLKA 2BY3A 3WKNA 3SGJC 1MHEA 4MD4B 3UCRA 2OK0L 4ZO6A 3C8KB 1YEIH 1NCDH 5I1GL 2WK2A 5LJYH 3VD9A 2DL2A 3RNKA 3TLRA 3W82A 3OB0K 3BVNA 3ZDXF 1ZVHA 1Q1JL 2RAMA 5F96L 1SM3L 3C5ZA 2FBJH 5C0CE 2KL6A 4YPGA 1KTKE 3HAEG 4IMLB 1NMAL 3MREA 5HYJE 4L8DA 3MLVH 5C0RL 1MWAL 2Y06H 1WAAA 2W0FB 1XF3B 2OBGA 2X10A 4LBEA 4LPWA 2RCSH 1J5OH 3MUJA 1OAZH 1X5KA 5HGAB 1JWUA 4JFDB 4RX4A 3FQTB 3CLFL 1J9CT 1EVTC 3SOBL 3P3YA 4R4FL 2VL5B 4NQUA 5E8NA 3GMLB 3QULA 3A6CL 1L6ZA 4D9LL 1NFDE 1GIGL 1KN4L 4NT6A 4G6MH 1D5MA 1DDHA 2BERA 4XBGA 4YO0A 3ARFB 4XHJD 4F8QA 3QZWG 5ITBH 4YHOH 3VFTB 4NDMB 2DQIH 5L7XH 1T4KB 4OT1H 4XPGH 5CD5D 3IS1X 3LN4B 1WBYB 2KZWA 5CILH 3N85L 1P4IL 3UPRA 4W4OC 3HI5H 4UT9L 3FTGB 4QO1A 1RV6X 5FA3A 1KEML 4JRXB 1ZK9A 1CVRA 3PIQB 3C6LA 1UXWB 4XXCC 2A9MH 1VEOA 1B9ZA 1CFSB 2VXVL 4P4RB 3QWQB 2IH3A 1W72H 3NIFF 3NCJL 5E1HB 3RY4A 1UWGL 3O6LH 4GAGL 2I5YH 4WY7H 1T89A 1YNLL 4X5WB 4ZG1A 5I76B 5IBTL 1X5GA 1I8MA 1JPGB 15C8H 4PUBL 4KKBC 4V1DD 3ULUH 5C6TH 2JCCB 4JGJA 4APQA 2BSTA 1EFXB 4I0KA 5I1HL 3RWFA 2OTWB 4HK3J 4NHUA 1X6NA 3GJFA 4U3XA 4ODUB 1WAAF 2DIBA 2P5EE 2G2RA 4I3GA 4AENA 4FFZL 1UZ6E 1YY9D 5I1IH 3QO1B 2XFXA 5AUMB 1SEBA 5DMYA 1RUQH 4XMKH 2CDGB 4KVCL 5HD8C 3WS3A 4P57A 4YGVB 5DJ6B 5F71A 1S7SB 2FHCA 1MSPA 1W0WA 1MAML 2CUHA 3OAYH 5FB8B 1F3DJ 2Q8AH 3K8LA 5SWSD 4FTVE 3OB8A 4RZCB 4H88H 4GBXA 1WK0A 1IT9H 1B0RA 4PY8I 3EGSA 2F54B 1FVDA 4RNRB 3QQ4A 4GW4A 3QXDB 3MRBA 2GITB 5DC0A 1MCNA 3T8XA 5F9DC 1KXTB 4K2UH 3MLZH 4TULH 2DQCL 1AHWC 2VXQH 2OZ4L 1A7QL 4UU9A 4HUWB 1CFNA 2J88L 5J89A 4NRZA 3MZGB 1NMCC 2I25N 4PJIE 1S7QA 4PJAE 1CICD 4CN1A 3SO5A 3TBWA 4ZFOL 2V2XA 4O2EA 3GMMA 4G6AC 3VXTB 3P0VH 4ZNEA 5JQHC 1F90H 4P46C 3NA9L 3HG1B 1RK0B 4X98A 3MCLL 4PD4J 2ITCA 3LMJH 1CXIA 4P2RA 3TT3H 1OTUC 1FZOB 5IGXL 4KVNH 4GAJH 1CFBA 2AW2A 1D5XB 2A0LC 3IETB 4HMEA 4ISVB 3VXPA 3MRQA 3KJ6L 3NIDF 4Z7VB 3TZVA 1B6DA 5E6IA 3T0AA 1QHPA 3VFGL 3VWKD 4N1EA 4BELD 4WW2B 3GSNH 3L3KB 4DCQA 8FABB 4QHNB 5KSBF 1A5FH 1P1ZB 5K9KB 1DLHA 5B3NA 2XWTB 3WXWH 4OM1H 2J6EA 4E41E 4OGYH 3L5IA 2LTQC 3T0EA 1R5WB 1KTDA 3SKUD 3ZSTA 2YKLL 3O2WH 1FYTB 4L8SB 3HZMA 3KLDA 2WBKA 3KPRD 4QRPD 3QHFL 1UWXH 1FE8H 5I2IB 2BVOA 2NCMA 2MKLC 4RMUA 4Y4FC 4P4KB 3B6SA 3KYMA 4MJ6B 2UUDK 1RZKH 1CXHA 3RI5K 1YN7B 5T1KA 2ZNWA 3PV6B 4HXAH 4WI3A 5DSCA 3OJDA 1BVLB 1BD2D 4PB9H 1R3KB 5J6HB 3AM8A 4HJGB 1VDGA 1XH3B 4HKJB 1HXMA 3V6OC 5TE6L 2YUXA 2EH8L 2C3VA 3RGVA 1R3HB 4BH8B 4OSUL 5FKPA 2FH6A 3PNWA 4HGMA 2V2WA 1G7QB 5DQDH 4HULB 1IAIM 5BS0D 2H2PD 3HNVL 1QNZL 4G43B 5IW6A 1TNNA 5JXEC 1F00I 3R0MA 4NZTL 2FR4B 1YPZE 4NC1E 3EO0A 1DFBL 3HE6C 1T2QH 2VAAB 3O11A 5ICXA 3MOAL 2EXYC 1HQRB 1J0JA 3N1FC 5IT2H 5C7XH 1AGFB 2EDLA 1QLFB 1GOGA 1RZIB 2EIZB 3LQZA 5AWNH 1TCRA 4GKOA 5CZXC 5KJRH 5TH2A 4N9GA 1N7ML 4QCIB 3F62A 3EW3B 2IPKB 2VSDA 4MDIA 5C07D 1MFCH 3PHQA 1RZGA 5GRVK 4ZFZB 2PR4H 5DD0L 4S1SH 4PJEF 1XGQB 5IM7A 4M93C 5ETUA 2FB4L 4Q6IB 5HHVH 2JELH 3BJLA 4Y4KA 2O61A 1MCQA 5GJSL 4OLWH 1DVFC 2NY2B 1QUNA 2H9GB 3KNBB 1DP0A 2XQYK 5JQ6L 2D2OA 3BUYB 1GL4B 2A6DA 4KAQL 2FO4B 4MJ5A 2AXHA 3QPXH 2EECA 1K4CA 5BJTB 3D2UD 2APXA 3WEXB 4JAMB 3F65A 3I50H 4HKBB 4TUOB 2ARWA 4YZFE 3U0TA 3NACL 3GUTA 2HVJB 1A21A 1BZ7A 3OZ9L 1ZHNB 1YMHA 1WIPA 2VQUA 4JFDE 1AH1A 3TH4T 1HINL 3LKQB 4G9FD 1SHMA 1OAQH 2QV2A 4NPYA 4GKSB 3I84A 4HIIA 4IRJA 3AROA 1LE9A 3BPOB 4I2XB 4NKMB 3MGOA 1J11A 5E4IA 4P9HL 2OMNA 4MA7H 4X99B 2KH2B 2IQ9L 2ZG3A 4HUVA 2H6PA 2W65B 5L8LB 3FFCB 4DUVA 3LIZH 4LKXB 2NY1C 4XC3H 3FQXA 3HI6H 1RURH 5E7FA 4NFCA 4ONFH 4RRPA 3KLAB 5CZKA 1GC1H 4ELKA 3MRRB 3T2QA 3F7RA 1WVZA 3QPQC 4O51A 3S4SG 2JJTC 1BAFL 2BHYA 5C86A 1TVHA 3O6FD 4PRDB 4WU7A 1KELL 4IRSB 1U92A 4OZFA 2IBZY 3L3OB 4J12A 4PJHF 4LSVL 3I6GB 2HTKC 4Z77A 3JWOL 1H5BA 5C71A 4P3DA 1AR1D 3GSVA 3S8WA 4NQXA 1S7TA 3IFNH 1EEZB 1DJSA 2IG2H 4NZUL 2JCCE 4LHUD 4JRYD 2I07B 2BVPA 1XR9A 1TQCB 5F9OL 4E5XA 1NCWL 2LVEA 2OTPA 3U7YH 1BQLL 5C8JB 3BFOA 2NXZD 4BUGA 4PJ5A 1AD0B 5CIPA 1WUNT 5DD1L 2VDQL 3UTSB 4LIQH 2AJZB 2C3HA 3U83A 1RHHA 1I7TB 3OKKB 2V9TA 1AY1L 2M1KA 3PGDB 1KOAA 2BFVL 4F9LA 4JRWA 4QHKI 5C9JB 3O2DA 1MH5B 3C09C 3VFMA 3DUSA 2M2DA 1BQUA 3BKMH 3HRZB 5HGBB 3HR6A 2F54E 5GGTL 3X13A 4R3SA 1AXTL 2GT9A 3O9WD 4WI2A 2JIXB 3BPNC 3OAUH 4LEOA 3MBXH 4KI5D 4RAVB 3UYPA 4Q74A 1QG3A 2ICWB 2D4DA 4CMMA 4DVBA 5BVJB 4G7YL 1DLFL 3EHBD 2BNUA 4MXQD 1NDGA 1XCQB 2HRPL 1P2CB 2CO6B 4UAOB 5E99H 4OLZL 3JVGA 5F7DB 4DKFH 4JGUA 1G9ML 3MLXL 4MJID 1K3IA 1FIEA 4QY8A 2HT2C 2WBWB 5EA0H 1NGPH 4I4WB 4MD5B 3SDAC 3ARBC 4PJGB 4QRTB 1A6TB 1PY9A 5HHMB 1CGVA 4NQEB 5DJ0B 5GSRA 2AK4D 3D3VB 4IOIA 3QQNA 2Y25A 1ACYL 5EC2B 2JE8A 2VDOH 4ZPVB 3SDCD 3QUKA 2DTSA 1XMWA 1U2HA 4KROD 5MHSD 4LASH 3DO7A 1F3JB 3U46A 5D4QA 5FK9A 2OR7A 1ZGLB 1JGLH 2VQTA 1C1EL 4UILL 3T1WA 4M7LT 5SWZA 1OPGL 5B38B 3HE7D 5IROC 5DJ8A 2ADGB 5TF0A 4QF1B 3VJ6B 4FNLH 4QRSB 4NO2A 1FYTE 1RK1A 2FLBT 2ZOLA 3V0VB 2E9WA 5KBNC 1P4LB 4PRIB 3UJIH 5HVWA 4LLDB 4U6XB 2EDBA 1AIFB 4JO3L 4B0MM 4R4BA 5T3ZL 4HXBL 5A3ID 4MD0B 5A2FA 5J1TC 1TQBB 2NW2A 4U1SB 1FO0L 2BSRB 2XA8H 1UC6A 5DQJA 1MJUH 5F6HI 2V5YA 4PGJA 1A6PA 1IGML 5KS9A 1FQ9C 1X5JA 5DRWA 4KKLD 5DK0B 2QL1A 2R8SH 2P44B 2HJLB 4NNPH 1T83A 1ZVSB 1MREL 1W8OA 3BKJL 3G5YA 4JG0L 3GMRB 2YPKB 4NWTL 1GJIA 1U3HA 3P40A 4LCWA 3O4OC 2EDQA 4ZOAA 1J8HA 1KG0A 3TIDB 4PJ7A 1C5CL 3VXQB 4JO2L 3WNMA 5F1NB 5D2NA 3SKMA 2E7MA 1DQMH 1FCGA 4KMQA 4DZ8A 2HN7B 5E4EB 1A2YA 4YWGH 5I1LB 2DIJA 2UYLB 3TJEH 1HQ4B 2VMFA 3TVMB 1P7KA 4WTZG 4HFWB 3MV9D 5IB5B 3RIAK 4HKZA 4LSUL 5GJTL 3WCYA 1S78D 3P30L 3SE9L 4U1JA 1T0NA 4NOFA 3IFOB 3HLAA 3S35L 4TVPL 2XY1A 3HZVB 4NUGL 2R1XA 3DXAB 3QJFA 2AXFB 2V5RA 2P8MB 3VWJA 4PJDA 3TNMB 1Z5LA 4Z0XB 1KLGA 1GZPA 4XCEA 1WT5A 5E6YA 2G5RA 3VGAB 1KEGH 1G6VK 1VGEL 4EN3B 1ZLSL 1T1ZB 3MCG1 3VXSA 4ZSOB 1CTNA 1J0YA 5DFWH 3RAJL 5I1DA 4LPVA 4C58B 3U7WH 3MC0A 5B3JF 2YN5A 1P84J 4M1DH 2N7AA 2CLVA 4JFFA 3AU1B 3W9EA 3DIFB 3KJ4B 2X1PA 1A0QH 4OIAA 3RRQA 1ZT4A 3CC5B 3HC3L 2ED7A 4P3WA 1FPTL 1NJ9B 1RIUL 3QFDB 3SGEI 5KS9F 3TYFB 5IQ7H 3MLTA 1KENL 3W9DA 2NTFB 3BGMB 3ZDZF 3EFFB 3V8CA 4NO3B 1R0AH 1ZLVH 2Q76A 1K8DB 3V7AE 1IAMA 1YYLH 5KTEH 3WLBA 5HGHB 1TPXC 2DQFA 3AVEA 5FO9A 1TZIB 4PJ7F 4L4VD 3NAAL 3C08L 3VFSA 4E9LA 4KJYB 2UWEE 4X7EC 4QRUB 4XTRC 5I66B 1UEMA 4FXKB 2A6IB 2NY3D 4BSWB 2LAAA 3MRFB 3EDKA 4LGSB 1NUDA 3OB0H 1XIWC 4ZQKA 4KXZI 2G9HB 5HYQB 3TPUB 5MEQA 1J18A 4Z7UA 3SGEH 2AKRB 3ARDD 3ZKXC 4OM0L 4BZ2H 3REVB 4C56B 1BJMA 2VDKL 4JFEE 3TO4B 4PJDF 3KVQA 1HZHH 4JO1H 3AY4A 3OBAA 1F8TL 1CG9B 5B4MD 1UM4H 5GS1A 5SV3A 1SY6A 5D8JL 3CU7A 4IMKC 4NQDE 4GMSL 2DICA 2IADB 4FXGA 4U0RC 4HAGA 2DQJL 1NGWB 3P9LA 3DVFA 4ZXBC 2ATKA 4OGXH 4WU5B 1OTSD 3MA7A 2ZPKL 5B22A 4OD1H 4O58H 4XT1C 5LGJB 3MRMB 1GPOL 4L3AA 5F89A 4JANB 4R0LA 4XVSH 12E8L 1X5HA 4UQ3B 5L9DH 1T04B 2YPLA 3W0WB 1DBJL 2R4SH 3WNLA 2DKMA 3GMNA 4NO5B 3LN5A 2OTUB 5EDXA 4K3DH 3CIQA 5FOBA 1XGPB 4UB0L 2A6JB 4O2CA 1JRHH 3P4LA 5L2JA 1BZ9B 5K9OA 4MNHA 5GGRY 3JV4B 3OKDB 1I9RL 4FQCH 2J8UF 3QI9B 4G3YL 4WFHD 4C59B 4S1DC 3MRNB 1NSNL 4ODWB 4OUUA 3UTSE 1SQ2N 4G8GD 4UT7L 3K0WA 2VC2H 4DFIA 4RWYL 2E8ZA 3DV6A 2UZYB 2DLIA 4OB5L 3UAJD 5C0CA 1T03H 2UY6A 4Z7UF 4EOWH 4R9HA 3O6KH 4K7FB 3TIEA 4JKWA 3MLUL 4H25A 2IBBA 5EU6B 2Y6SD 1T3FB 3VG0L 5D7KD 1IC7H 1O5DT 3CFCL 4XVTL 2Z0BA 5B39B 4U7MA 4XAKE 1M05B 3BAEH 3HFML 1FNGA 4NQTA 4Q2ZA 3VXUD 1EEYB 3PQYB 3CVHH 3FO0H 3TH3T 3SBWA 1QFUH 4JFZH 4S2SB 5GSVB 1U8JB 4GG6E 4LCCB 2Q8BH 5F7UA 3SE8L 5I15L 4XHJC 2C1OA 3SPVB 2X05A 5CD5C 4OKDA 5T33L 2VQ1B 1A14L 3L1OL 5DUPL 2D7NA 1BJ1H 5BO1H 1G7PA 1XR8B 1O0VA 4K94H 3FT3A 3L7EB 1LK3H 5GIRA 2GCYB 5IMOA 2GJZA 5C0IA 1K8IA 4OGAD 1LNUB 3CZFA 3QWOB 4OI9A 3P77B 4XPHL 3SQOL 1ZTXH 3F5WB 1OAXH 3IXAA 1QSEE 3VFPB 5C0GB 3IFPA 5CD3B 4YFDB 1EMTH 5I1JH 3EOTL 1QPXA 5DEFA 1LD9B 4BQCA 4LSQL 4JCMA 5FDYA 3TBTA 1L9NA 2VZ3A 1L7TL 3LV3B 3PXHA 3QIUB 3BX7C 4QHUB 4XPAH 4MJ4A 1U41A 1RI8A 1KN2H 3JWNC 4R26L 3LB6D 1T5XA 2BHUA 3TEUA 1U6AH 4J6RL 1U8HA 1VACB 5DYOB 2P5EA 1DSFH 1H0DB 2D3VA 1RZ8A 1YY9C 2BOCB 1PEWA 1CU4L 2J4WH 4P2OB 2DMBA 2X7LA 5D1ZA 5DS8B 1NAMH 1H3PL 2RIKA 2Z9TA 3B9AA 4WUUA 4FZEH 5EBWB 3VDCA 5KAQF 4JVUA 5LXGL 4YHLH 3L3DB 4QGTA 4TSAH 1NFDF 3S37L 2C3GA 3V4VL 3C5SB 1D5ZA 1ETZB 4F7CB 5JUEH 1B2WL 3OPZH 1QFOA 5BOPA 1BM3L 4PRPB 2IEPA 4WV1B 3ARGD 1CLOL 2DLFH 3GIZH 5FOJA 4P48A 1QFWL 3LRSB 3MNWA 3I6LD 2EC9T 1A9EB 2XQBH 4U1IB 1N59A 1A1NA 4JY6B 5BV7B 4M5ZH 3U4BH 2CXKA 1MIML 2OXHA 3EO1B 4ORGB 4OZGB 4EDXB 5LQBH 2UUDH 1PEZA 1HI6B 3W2DL 3IVKB 1EZVX 3VE0B 4Q9RH 5FXCH 4IOFD 4PJIA 4PJAA 2VISB 5I17B 4U05A 4TOYH 1CICC 3FQWA 3VI3E 1A4JB 3BZFA 2MCPH 4GKNB 3GEWB 4FQXB 4WWKB 4MNQA 1CDBA 4QRRE 3EJYD 3WD5H 5I16B 2VR5A 1CGYA 4X6FB 4NO0B 3W81A 5DUBA 2JK5A 1KV3A 3FQUB 2GTZB 2OL3L 4OD3L 3U6RA 3RBGA 5JLZB 3I2CL 3DYOA 4LVOC 3UROR 2AJUL 1QKZH 4X6DE 5DLML 3BO8B 5T3ZD 4HWEH 1AXSB 1MOEA 1CE6B 1UZ6F 1QQDA 3C8HA 4JY4A 2ZUWA 4BKLB 3RU8H 2P5WD 5HDLA 3PDOA 5DMJB 2P8LB 3K80A 4X9FA 2ID5A 3VWKC 4QXUH 1CBVL 3F7VA 2CDEA 4E41A 2IAMD 4WHTB 5I73B 3RQ3A 2YEZA 3OKEB 4F58H 1IGJA 4OZ4B 3HG1D 4U7KA 2FX9H 5I9QB 5F7MC 3K2UL 3KYOA 4RMSA 1IQWH 3DSFH 5D7JA 2B4CC 4OZIE 4FZ8L 3BW9A 3MODL 5SWQB 5F7EH 1NFIB 1A7OL 5ID1B 1FRGL 2F8XC 2YR3A 4IM8A 2ORBH 3RVUD 1Q72H 5HJ3A 4FFVD 1E28B 5J4MA 2A74A 1S7VA 3CPLB 1NGYB 5MEOA 3ZT7A 3QQ9D 4ETQB 3ECBA 1Q9LA 3D9AH 3ARTA 1FCCA 1PFCA 4XBPB 7CGTA 5ADOH 4M6AA 5F97E 3BDYL 4PJIF 2YD1A 4TVPD 3ROOB 1XGRA 4PJAF 3C60A 1N5AA 3BE1L 2KKQA 5JW3L 3E3QC 4X5XA 1ZLWK 3K4DA 4GQPH 1G7JB 5T5FH 4EI5A 3UJJL 4I13B 4MA8L 4P99A 5EUOB 1ZAGA 2L7JA 5CSGA 2H2PC 1N8ZB 5GGVL 1YPZA 5JPNA 2F19L 3ES6A 1AJ7H 1R5IB 4PPTA 35C8L 3GMPB 1VFBA 3E1F1 3AXLA 1F97A 1QEWB 5BQ7B 1GGIL 4OCMC 1E4WL 3A6OA 1KPUB 4CMHC 1YN6B 4HCRL 3LRHA 2D03H 3LH2L 2APVA 3S35X 1UJ3B 1WCQA 1OM3H 3TBSA 4G8FA 5CJXA 1WISA 4AT6A 4GXVH 5DR5L 3VDAA 1K5NA 5SX5H 1UXSB 4QOKB 2DB8A 4XWOD 4M62H 4PJBB 4GW5A 4CVXA 1T1YA 3MPCA 3QUML 3VXME 4MD4A 2SEBB 4MB3A 1TITA 3C8KA 3D25B 4TNVK 2QSVA 3VD4A 1X5AA 1AE6H 1KPVB 1A4KB 5I1KL 3QDJB 2F53B 5AG8A 4PY7B 4M4RA 4PS4L 4C83A 4X7TB 3LHPL 2B39A 4IMLA 2A1WH 4M7KL 1MFBH 4UBDD 3QR2A 1M7DA 1XZ0B 2W0FA 1XF2B 4DTGH 4RRPG 4O5LH 4HIEA 1E27B 1T7XA 2YXMA 3WFZA 1MFAH 2BY2A 4AM0B 4PLKD 5IHBA 4JFDA 3K4ZA 1RULH 1RZ7H 4Q9CA 1YPZF 1G9NH 3GMLA 1RIVH 4XP6L 4OZFG 5L6YL 2ZUVA 5TPWL 5EZOL 4WEUD 3KLHC 4K55A 4M6MH 2AJVH 4WCYL 3QCTL 3ULUE 5DGRA 3D85B 3UTZA 4ERSH 2EDDA 4QXTB 5E6ZA 2NY5C 3QO0B 1EBAA 4ONGL 5GISL 3LN4A 3NBNA 1INEH 1WBYA 4N1HB 1K85A 3RGVD 2BRRH 1F58H 1A6AB 3FTGA 3SCMA 2Y9RT 1WBXB 2PO6B 1KPRB 1ZANH 1WEJH 5DK3A 4GRWH 4JRXA 1QLRB 1UXWA 4JCLA 5E8EB 5ESVB 3AC0A 3EFDL 4P4RA 1UWEH 2DAVA 1U3YA 3CUPB 4DUXA 1D9KB 5CJOL 5D71H 1RAMA 1JNNH 1I7UB 5DDHA 1AR1C 3FN0L 3G9VA 4XPBL 1JPGA 3DX9A 4M48L 3NCFB 4KQ3H 1C5BH 4ZDHB 2JCCA 5FUCE 3QHZH 2A6KA 2P4AB 3MUGB 2BDNL 1EFXA 4LSPL 3WHXA 2AEPH 4X80H 4RFNC 2XZCH 2G60H 3PGFH 3KLSA 1A02N 1WZMA 1J87A 4YZFF 4HZLA 2NXZC 3K8MA 1RMFL 5BVPL 1IZKA 3LCYA 5AUMA 1QSFD 4MXVE 5IVZB 2CDGA 3EYOB 4KI1A 4YGVA 1PVHA 4X4XB 1S7SA 3N1MC 3BT2L 5CP3A 3P4NB 4ZUVB 2NZ9D 4P9ML 4L5FH 4OJFL 4JQXC 1UGNA 1LK2B 1A7NL 3UDWA 5FB8A 5JOPD 2OR9H 4PRPE 4S1RH 4K3HA 2WNGA 4RZCA 4D0CB 2NY4B 2EZ0D 2F54A 3R1GL 3QFJB 4RNRA 4ZUWB 5FGRA 2GITA 2CUIA 4DGVH 5MENE 4YHML 4WI4A 4YFEA 3O9WC 4XPTL 1OLZA 4YDIL 5MP6L 3K74B 4KI5C 5E9DE 4HUWA 1BBJB 2E3VA 5ELIA 3V6ZB 3INUH 5IBUG 2DJ4A 5EZIL 1BPVA 4Y1AB 3ARQA 1NANI 3CJJA 3EHBC 4MXQC 2X9YA 3LVEA 4XPFL 5CP7B 2EDXA 2CIIA 2VLKE 1Q0YL 1I7ZA 3VXTA 1CZ8L 4HC1A 3MRKB 1RK0A 5AAWA 2JCCF 2NX5B 1CTOA 1FZOA 2DLTA 1ZA3B 3O0RL 1NCBH 1IGFL 3L5XL 4ONHB 2Y5EA 3KYNB 1D5XA 2EDKA 2YSSB 5MI0C 4BA8A 5I8CB 3IETA 4ISVA 2ATPB 3NGBC 1CGSH 1A1MA 4I77H 5CCKL 2O5XH 3CSGA 4W81A 3SDCC 1HCVA 4KROC 1J05B 3GJFH 3QDGE 2ILLA 8FABA 4DQOL 1KJ2L 1P1ZA 1A3RL 1F4XH 2VXTH 5TQ0H 5BRZB 1HSBB 1F4YH 3ZMRA 1R5WA 3HE7C 2GSIB 1OB1A 4Z78B 5HSFA 2V2TB 1FYTA 3GZKA 1WITA 2XWJB 4K8RH 4NQED 4F7EB 1R5VB 5I2IA 3PF2A 1A7RL 1T22B 5A3IC 4P4KA 4NC2B 4KPHL 2VDNL 1UACL 1YN7A 4GS7B 1FLRL 2RGSA 4FFWD 1R3KA 1JZ3A 4KKLC 4JDTL 3Q1SH 4MAYA 3F12B 1OCWL 4MMXC 3IU4H 4HKJA 2BVQA 4LCUB 4GXUN 1FL6B 3S37X 3RNQB 4HQQH 1N6UA 5HHNB 4M61A 4PRID 3S96A 1TFHA 1R3HA 4NCC2 1Q9OA 2YUVA 2VABB 2J7LA 1G7QA 1JFQH 3G6DH 3VFVB 4E0RB 4G43A 1O7SA 1XAUA 2FR4A 3BRDA 2HT4D 2W9LA 3RDTA 4JFYA 5D9SB 5HI5D 5JPMB 1MCCA 3VXRE 1S78C 5DC9B 1HQRA 2BOBB 4L3EB 1KTLB 4UV4L 1AGFA 1RJLB 2GSGA 4Z0BH 2VRAA 4CGTA 2J8OA 1U0QA 2EIZA 2HKFH 5E00B 5GGVY 4WEBH 3LSOB 1HHKB 2YZ8A 2E6JA 1NKOA 3MGTA 4B41A 4Y5VC 4ZFZA 3H9YA 4MSWA 4U1MB 5DVLA 2MNUA 2RQ8A 3V5KA 2EYRB 1KCRL 1F3RB 1TJIH 1P9MA 1T0MB 2XN9D 4PJBE 5D1QB 3V6FB 5FYJL 5J1AA 1NCNA 5LBSL 4Q6IA 3ZHKA 2I60L 4HG4J 2W59A 1TZGH 3DI3B 2H9GA 4OAWB 1KB5B 4MNGB 3M8OH 3HTLX 2APTA 2FO4A 2PXYD 5BJTA 1MCIA 4I9WE 3EUUA 4J3UA 3NVQA 1ITBB 2AI0H 5IFAL 2FD6H 5ALBH 2E7LA 4H8WL 3U9PL 3C6SB 4HKBA 4TUOA 1KFAL 4MVBC 4HW6A 5JHDE 2E27L 4HIHA 2HVJA 4U1GC 1F5WA 4M43H 2OI9C 5ESQB 1ZHNA 1YYMH 2UWEA 3CMGA 1T2XA 6FABH 1RZFL 1UKSA 3JWDL 4GKSA 1IGYB 4YDJB 4ZTOL 2K7PA 3MV7B 5KANG 1QD0A 2XIDA 5ANMB 4H0GA 4KRLB 3RWIB 1HYRC 1SJHB 1F2XK 4AL8H 2W65A 3ARDC 3PGCA 1JPSL 1N64L 1DQDH 4LKXA 2VLRD 2AQ2A 3WLWD 2X4UB 4AEHL 5C6WH 4GG8B 4K3EH 4P23D 1J8HD 3MRDB 2WLYA 4I18A 3ROLA 4NJ9H 4I3RH 3HPLB 3B9KA 3KLAA 5E8DH 1N5YH 1I85A 1ZA6A 2MJWA 4GSDH 4NN6C 3T2OA 5B4MC 1PSKH 3QEGH 3WFEH 4NQDA 5EBGA 4LIQE 4KJWD 4PRDA 4R4ND 3DYMA 4IRSA 1GXEA 2BJMH 2V17L 4O4YH 4DKEH 3I6GA 1OTSC 3QA3B 4UINH 2NY7H 3KPNA 2F5BH 1EEZA 4C4KT 5A2JH 2GUOB 3SKNB 9CGTA 2I07A 1P7HL 2ZCLH 4O02L 5J9PA 1NCAH 4GUPA 2YUWA 3ILPB 1BREA 2VITB 1YEFH 3BP7B 4LFHD 1JTOA 5KAQG 3I75B 3UTSA 1MLBB 4K9EH 1HWHB 3U2SA 1QRND 2AJZA 3S88L 3NTCH 2UWEF 5HHQB 1JV5B 2XRAL 4QTHB 2VWEC 3GGWB 2ESVB 2K3TA 3MGAA 4NKQB 4HH9B 3UO1L 3TT1L 2FJHB 4K3GA 3PGDA 3VD7A 4P9HC 3VW3L 1QR4A 3UAJC 5TFSL 4XP9L 1MH5A 3P4OB 4DAGH 4XMLH 4ZTPH 3BP6B 5JNYB 4JB9H 1LDPL 2UVEA 1PYWB 2CGRL 3FONA 1DBKH 1IKNC 3VGFA 5HGBA 1B4JL 3C2AL 1I9IL 3FFDA 1NC4D 4N90E 3GSOA 4PLJD 3W11D 5CSBA 1QFWI 4OF8A 3BISA 1FL3B 1KIPB 4LQ1A 2JIXA 3D0LA 4JREC 4P59H 3SE3A 1VFUA 4YE4L 4UQ2B 4BZ1L 4KY1H 3HR5B 4CDHA 3O3DB 2ICWA 5C0DB 1C5DB 5BVJA 4JY5H 2NXYD 2XICA 1P2CA 4QHLB 4AIXA 1AHWB 2NNAA 3O8XA 3JWOC 4JN1L 2AABL 2ZOKB 4OZFH 1NMCB 4ZMAT 5I8OL 1HIMH 4AEEA 2Q6WA 4I4WA 5IV2B 2Z35A 4MD5A 4S0SD 3Q2CA 2YRPA 5DUMH 3MXWL 4GRLD 4KHTL 4JO4L 5GPRA 2WWMD 5FO8B 3MLRL 4PJGA 2Z31B 5FYJU 1A6TA 5EBMA 3V5DA 3H42H 1CF8L 2WZPD 2B2XL 4P46B 4HSQA 3V8OA 2P24B 1G6RB 3GMOA 5BZWB 3EYSH 5EC2A 4OGAC 4KZEL 1I8LA 5AAMA 2XG4A 3IFLL 3QDMD 1NGQL 1GGBL 5E2TH 3HMXA 3CFEB 2K1MA 3CH8A 3X17A 3WKML 1BIIB 1NLDH 1Z9MA 5DRNB 1K2DB 1VENA 5CIPH 1ZHKA 3HMWL 4PJ8D 1P7QB 2H1PL 2F58L 3KXFE 5B38A 2D31B 2ZUSA 2XKNB 5FM5O 2DI9A 4QF1A 1H3UA 1MCHA 2B1HL 3V4PL 3V0VA 2AJYH 2VIRB 4LLDA 4U6XA 5ECJE 3F58H 1V8HA 3LB6C 3M17B 4LARL 4PTUB 3RVWD 3O2DH 4MZ2A 4B53A 3QBTB 5FYKH 4MD0A 1S7WB 3BWAB 4KGLA 2BSRA 4U1SA 3VG9C 4WFGD 1E6JL 2IPUK 4KDWA 1A9BB 4E42A 2CKNA 3IDUA 1FFPB 4PP2B 3WFDH 3DLQR 5DK0A 2W38A 3GBML 3VH8G 2WUCL 2ZJSH 1ZVSA 3AMLA 4UIMB 3BD3A 4OLUH 2YPKA 1QFPA 4U6TA 4GG6F 5C0CD 4NP4H 3ARGC 1G9MC 4HJJH 2NZIA 5HYJD 2R29H 3TIDA 4XNYL 5ILTH 1MI5E 3QEQB 1YQVL 3GSWB 1VEMA 4AEIL 3H9HA 5F3BB 1U91B 1IAIH 3QB7C 2UYLA 3K81A 2KZ1B 2GEEA 3TVMA 3ABZA 5IB5A 1AO7D 3CMOH 4ZYKB 3V5HB 4YR6B 5I0ZA 5CBEB 1A6WL 4IOFC 4KK9D 5AYUH 3IFOA 1VADA 3HZVA 1VA9A 3BH8A 3DXAA 3HE6B 2AXFA 5ADPL 4ZUUB 5TF1L 4CADA 2C3XA 3TNNB 5ID0B 1ZLWH 3TNMA 5JXAH 2YHGA 5L2KB 4Z0XA 3K46A 2AV1B 3B5GA 2PTUA 4N68A 4W6YB 5DT1L 3T0WA 1NEZA 3KPMB 2X70B 5AZ2H 2R69L 3EJYC 3GKWL 4ZSOA 4JN2B 5LCVH 2O5YH 1OGAB 3BKYH 2C4FU 3HB3C 5J3HD 2VJXA 5GS3A 1DBML 3AU1A 4ESKA 1OT2A 4F9PA 3DIFA 3AFLA 2D0GA 3CC5A 1HKLH 3IDXL 2D9QB 3V9FA 1MVUA 4DWHA 4M93B 3SE4C 1X5IA 2NTFA 3BGMA 2IAMC 1UENA 1T89C 1DVFB 3CD4A 3EFFA 4O9HL 1W2KT 4NO3A 3GSXA 4HC1L 1MRCH 3STZB 2VO5A 1K8DA 3N06B 1CGXA 2R0ZL 1ADQH 1D6EB 2PYEB 3DGGB 5ALCH 1L6XA 5HGHA 3L3JB 1TZIA 2P7TB 4HFUH 1NBVH 1RU9L 3PWPE 4KJYA 4PJCE 2P5ED 2YC1B 3RVUC 2V7NB 1IM9B 4QRUA 5KW9L 4FFVC 4G6FB 2HFEA 5I66A 5HHPB 2A6IA 4BSWA 1U95B 3MROB 3QQ9C 1AR2A 1G0DA 3MACH 1X5XA 4WI7A 2G9HA 2DBJA 5HYQA 4RISH 3EOYG 3TPUA 4MA3B 2AKRA 3L3HB 4DEPB 5E08L 1P4BH 2VZOA 2F8VA 3FN9A 3VI3F 5EU4A 4TRPL 3V52H 3PWVA 1KB9J 4FTVD 3OKOA 3IDIB 1QFHA 4OI8A 2F5AL 2X4RA 1WZ1L 1CG9A 2NY1B 3AS1A 4LVHC 4PREA 1EGJA 3FAXA 1VFAB 4EVNA 1UB6B 2FCBA 3B8SA 4X6DF 1BF8A 1NGWA 5DJXB 5FYJD 3MXVL 3QRGH 3H9SD 4MQTB 2R1YB 1PG7L 4J4PA 3T2NL 1JVKA 5LGJA 3MRMA 1QA9B 2O26U 1CI5A 4MGXA 5HYFA 1LQSR 4R90L 1FDLH 1S9VB 1I3UA 3KPSB 4FQJL 2VDRH 4NO5A 2BSED 2OTUA 1V3KA 2VDPL 2WUBL 4RDQF 3ZT6A 3OG4B 2A6JA 2VKWA 1CQYA 4DN3L 4WI6A 1FBIL 2YS4A 3F6LA 3OKDA 3GK8L 1JP5A 1NBYB 4OZIF 3QI9A 2NY5H 1YNKL 4XWOC 4KK6D 3MRNA 5C0BB 1V7MH 1PBYA 1S7UB 5J0BA 4OFYA 1JZ7A 4KTEL 1AFVH 25C8H 1B0WA 4LLUB 3G5XA 3V4UH 4KMTH 1I3GL 5CUSH 3U9UA 5GS2H 4YHKL 3X3GH 1FLTX 4YQXL 2YPVL 1IGCH 3EDFA 4JKPL 1DCLA 1CLYH 4UBDC 3UTQB 5TDNB 3PWLA 2CSPA 1T3FA 1NUGA 5DZOA 1KCVL 5GS0H 1BF2A 5B39A 5I8KH 1T1XB 5EO0B 5KSUA 5IESH 3LEYL 4PLKC 5D2LE 1TJGH 1KCSH 3SJVB 2CMRH 1EEYA 2DQUL 3Q6GH 4C55A 3D48R 4HWUA 4CVZB 4AIZB 1SY6H 4PJFE 3BPNB 4S2SA 1U8JA 5F7FA 2F8OA 4LCCA 4HHAB 3NFSH 1AP2B 1AKJA 1CL7I 4N8CL 3C60D 4MAUH 4XNQB 1WTGT 1RIHH 2GJ6B 2QHRH 5DHVB 3SEPA 3RGVC 1BEYL 2X4OA 4Y5YC 1XR8A 3L7EA 3VA2C 3ARED 2GCYA 1UB5B 1T6VN 3ARBB 3LKNB 3QWOA 4YPJA 2OP4H 4JPVL 3PP3H 3BPOC 3DX7B 3KPTA 4NQSB 4ETYA 5TE4L 2FIKA 2WIIA 3L5HA 5C0GA 3WV0A 1HHGB 3OGOE 5CD3A 3SHSA 1IVLA 1IEBB 3L5WB 3MJ8B 4IRZL 1XF4A 2UZIL 1CL7H 3W5NA 5IHUH 1NCCH 3QNYA 3E8UH 5GRJL 3GI9L 1U8PB 1HILB 3MRLB 3HC4H 1VACA 2XY2A 5D7LE 4ZODA 3RTQD 4LNVA 1OGTA 1OSZA 5EO9A 1T0PB 3KGRA 2BOCA 3Q6FB 5H37G 4P2OA 5IVOA 5DWUL 4ZS6D 4CJ0A 2CLRB 2O5ZH 5DS8A 3R8QA 1K6QH 3U4AA 5EBWA 1H8OA 2V9QA 2FX8H 5GRUH 4U1LB 2Z8SA 4XZUB 3W39A 1ETZA 3PP4L 3L95B 2NZ9C 3ULUF 4KZDH 1A3LL 2LABA 4HUUB 4TQEL 5BW7C 4PRPA 4WV1A 4ZFGH 1LHZA 3MSPA 1TQCC 1BGXL 1PKQB 3TBYB 2EZ0C 4U1IA 3IJYB 3O4OB 3V6OE 2JB5L 4JY6A 4ORGA 4OZGA 2R2HB 1B3JA 1EK3A 1M6OA 4JE4B 1HI6A 3DI2B 1RVFH 3IVKA 1IAKB 1CE1L 2XYCA 2C7UA 2DOCA 5EB9A 3DBXB 1MJ7L 3RA7L 4P3CL 1CLCA 3MLYL 2MFNA 1TIUA 1U3JA 5HDQH 2VISA 4Q7DA 1C08A 3DX8B 4DN4H 3ULVH 4X7SL 3T09A 1A4JA 2C1PB 4GKNA 4HBCL 2VLKA 1V7NH 4FQXA 3MJ9L 2BNQB 5GGSB 3DRQB 1FJ1A 5I16A 2YMXL 1NUFA 4YBQD 4X6FA 3L9RA 3WO4C 3IKCB 2VNCA 2DWEA 4D94A 4U6HA 4BK5A 1LO2H 2W0KA 2GTZA 5IMLB 5A2LH 3WXVL 1J1PH 1X4YA 4JHWL 3BO8A 3VFRA 2R2EB 5CGMA 1AXSA 5IB2B 1CE6A 3X3FL 4BKLA 1BFVL 1WLHA 3NA9H 2R1WB 4MXVF 1A6VL 2R0WH 1TENA 1FNEB 2OJZH 3O4LB 2XZQL 4NQCE 3MOQA 3VU2A 1U8OA 2NX5D 4NNYB 1KACB 2E6QA 5SWQA 1NFIA 3VRLE 3BN3B 5ID1A 2DQTH 4H26B 3P11H 5K9JH 1JPTL 2EE9A 3VMNA 2G75A 4UZGA 1TPXB 3CPLA 5ISZB 1NGYA 5E24E 4J8RB 5H35B 4FFWC 4I0PA 4JKLA 4HK0A 3FB5A 3GSNB 4XBPA 4NRYB 5C0AB 4LSRH 4JQVC 4JR9H 1D5IL 1J0ZA 4HD9A 1XIWB 4PRNA 2H2SD 4TUKL 4PG2C 1QBAA 4HIXH 4KK8D 4UV7L 3ZKXB 1FORL 1NC2B 5IW3A 4GW1B 1G9EA 5E8OB 4OLVL 4Y19B 4M7ZC 3X14B 1TQBC 1N8ZA 1EJOH 5C08E 2GYSA 4JG1H 2IAND 1R5IA 4OLXL 2FIRT 1MHPH 3G5ZB 2V5SA 4IIQC 5HI5C 1QEWA 5BQ7A 3UZVB 4GO6B 1KPUA 3FT2B 4U0RB 1LE5B 1YN6A 2DTML 1BMGA 4J3OC 3LEVH 5E2VL 4ZXBB 4Y16A 1UJ3A 1UZ8B 1OP5K 3RP1A 4EBQH 3AMKA 4F3FB 3WJJA 2ZSWB 3UTOA 5IQ9B 2BZDA 2Y1VA 5C2UB 5GHWL 3UBXB 2ICEB 1I9JL 5FM4A 4QOKA 5T5NF 2FGWH 4PJBA 1T7VA 4AZ8A 2ZKHH 1RUKL 2JF1A 5JTWA 2WINB 4J1UB 3RL2B 1FAIH 2SEBA 3BPCA 1JGDA 4U4BA 1CQKA 1X5ZA 2ARJB 4XVJH 1A4KA 3QDJA 2F53A 5T3XE 5DD5H 1I1CA 2BC4B 4X7TA 4QHKJ 2PXYC 3V0WH 3VGAC 4D8PB 3RZCD 1S5HB 1NDMB 1EEQA 2DF3A 4RGOL 4MXWL 1XZ0A 4Y88A 4GRWE 5FECB 5JHDA 1XF2A 3NABL 4AG4L 4AM0A 3MNZB 1I1YA 2OX5A 2BMKB 4M7JH 5HYSB 1ORQB 5DJAB 3MV8E 2YRLA 4Y5XB 3UYRH 1GGCL 4OCRL 4Y8DC 4WEMB 1MCJA 2QHLA 4XP1L 3JTSB 4M7LL 3IB4A 3D85A 5MEPB 4MAYD 4NM4L 3NZ8B 1LEIA 4HKXB 2DQDH 1BOGB 1EEUA 2QJDA 4DUWA 1MNUL 4HMDA 3OKLB 5CMAB 1GCFA 3WLWC 2XXMB 3MRHB 3D0VA 4P23C 3V2AR 4M1CD 3GO1L 1WBXA 2PO6A 1KPRA 1PG7W 5EFIB 1FSKC 3BIBX 1AQDB 4KJWC 4UTAL 5E8EA 2R0LL 4R4NC 2YD2A 4PJBF 3RUGE 1GSMA 4JFHE 5DMGD 4NJAH 3RDTD 3CCHB 3GDBA 3CUPA 3CFKB 4OV6F 1D9KA 4UOW1 3SKJH 3STLB 1I7UA 2ED8A 4XP5H 4EI6A 1PG7X 4N0FA 4RIRB 5I30L 2AQ1A 4TUJB 3UJTL 2CJUH 3TO4C 3GRWA 1G7LB 4POZD 4ZDHA 5FCUL 1Q0XH 5E1AB 1GZQB 3HAEA 1WT5C 3WJLC 2XTJD 4V1DB 3G04A 4UMGA 1EAJA 1CDYA 4OLEA 2FO1A 2HWZH 1UCTA 3BZEA 2R23A 4RMTA 1YEIL 5F6HJ 1NCDL 4DK6A 2PW1B 1RJZB 1FIGH 1JBJA 5IVZA 2I24N 1JN6B 5GXBB 3EYOA 2WBJA 2FBJL 1I8IB 4X4XA 1QBLH 5C0JB 4QXGH 3P4NA 4M6NH 3SY0A 2P48B 4ZUVA 3SGKC 5ACZB 3MLVL 3UX9B 1LK2A 1SBBA 2Y06L 1QOKA 4PTTB 2LAGB 3PE9A 4F37K 3RHWF 2RCSL 4D0CA 1J5OL 1OAZL 1PKQE 4HWNA 4LPXA 3CXHJ 4ZUWA 1QRKA 2WAHA 2Z91A 3DX6B 2YRZA 5SWSB 4PLJC 3O41B 3QJHB 2MQCA 5JDSA 3MBED 4G6ML 4X6BB 3JUZA 1BBJA 2XOTA 2ESVD 1MCBA 2FZ3A 2XNAA 5FUOH 5ITBL 2NXYC 4YHOL 5E03A 2DQIL 5L7XL 1JWSA 4OT1L 4XPGL 4K07A 5CP7A 3CDCA 5CILL 2ICES 2PCPB 4X0KB 5B38G 3ULSA 3HI5L 5DO2D 4JFED 2OJEB 1YDPB 3MRKA 1CICB 5K9QI 1YC8A 4GRLC 3FAWA 5FCSH 1ZA3A 2WWMC 4PRBA 4LLVB 4LU5H 2A9ML 4ONHA 3KYNA 1BP3B 3B9KD 2BHZA 1JNLH 3P9WB 5KVFH 1KGCD 2YSSA 5EIVA 1TDQA 4N0UB 3QNXA 1W72L 2ATPA 1FFOB 3WO3B 1QP1A 4UI2A 3O6LL 3OXSB 2I5YL 4WY7L 4FQ2H 1J05A 2VLME 4CN6A 5EORH 15C8L 1VKXA 4KK5D 1FC1A 2VDLH 3ULUL 4OZHB 3TN0B 5C6TL 4PYHA 5BRZA 2I26N 1HSBA 3ZTNH 3KXFA 3EOBA 3QG6B 4PJ8C 2BVEA 3FQRB 1MHHA 3VFOB 2GSIA 4AYFA 2X4SB 3JV6A 4PR5B 2NR6D 5H8DA 4Z78A 1ACZA 4G5ZH 5CP3H 4F7EA 2OMBA 1R5VA 1IARB 2VLLB 5I1IL 3VXOB 3RVWC 1T22A 1RUQL 4XMKL 5MERA 1INQA 1RUAH 3KPRB 1HH9B 4QRPB 5D7IB 4M4PA 5ISZE 4XBEH 1BWWA 2GW5A 5DXWA 3Q5TA 3X11B 2Q8AL 5C0AE 3F12A 3LAFA 5H37H 1UJTA 4Z7OE 4H88L 1IT9L 4LCUA 4F7PB 4PV9A 1BD2B 1IBGH 3DTXA 4XB7A 1P84K 1EO8H 1WC7B 1FV1B 1JGVH 1S9XB 3MLZL 4K2UL 4TULL 3VFVA 4RGND 2VXQL 3JV0A 1F11A 1ZWIA 2X4NB 3BEWB 1E4JA 1A1OA 2ZCHH 3AS0A 4XAKD 4A6YB 5C1MB 4Y4HD 5BS0B 1T20B 3FB8A 5D9SA 4NSKB 4JPKH 4CU7A 4OI7A 5DZNA 2BOBA 1TVDA 3CH1B 4KK9C 4L3EA 4Y7MA 1KTLA 2YOCA 3FO2B 4HPOH 1RJLA 3U0PA 3P0VL 1F90L 2EIEA 4DVRH 3O8XD 5EUKB 2A77H 5E00A 2R15A 3TT3L 4RDQG 3LSOA 3RPIB 4KVNL 4GAJL 3ZDYE 4CMHB 5I8EB 1Q9WA 1ORSB 3QEQD 3WNPA 2VL4A 3SE9H 3KPPA 4L4TE 4U1MA 1KXQE 3EYVB 2EYRA 5J3HC 4LRIC 5D5MB 1T0MA 4Q9QL 5C07B 5T1MA 3GSNL 1WQVT 1A5FL 3QUYD 2P46B 4OAWA 2Y23A 4OM1L 3WXWL 3PXJA 4WJ5B 2CKBB 1H15B 1QSED 4OGYL 3SGJA 3P73B 5IIEA 1KB5A 4MNGA 2NY6B 3O2WL 4S11A 5IEHA 4PGEB 1Q38A 1I1AD 4AEFA 1FE8L 2CXGA 2MQ0A 4TN9A 1BJ1J 5J06A 4WW1A 2YBRB 4WUKH 5IOPB 1RZKL 5FF6A 2FWOB 4KUZH 3CFBB 4HXAL 3H7BB 3PWPA 3VGBA 3ZT5A 4PB9L 2VE6B 2P1YA 5CFHA 2ARJQ 1IGYA 4YDJA 3MRPB 3TWCH 4OQTA 5D7SL 1LGVA 4W70A 1N2RA 5I19H 3DO3A 4G9FB 3WBDA 1SJHA 5JR1H 5DQDL 4GG8A 4F33B 3MRDA 4L29B 5L88H 4L9LC 3R8BB 4PGDB 3HPLA 3BQUD 1FVCA 3QUZA 1T2QL 3WHE1 1HDMB 3PJSB 1HHIA 4W4OA 5J1SC 3STBA 4XRCA 1BQHB 1LO4H 3HNTH 2AVGA 5IT2L 4CW1B 3U30C 5EPMB 3QA3A 1MVFA 4XXCA 5AWNL 1K4DA 3O6FB 5ICZB 3GSRB 3VFNA 5KJRL 4HGWA 2GK2A 2GUOA 4X9BA 3ZKMD 1MFCL 2B20A 3SKNA 2PR4L 4S1SL 1CFTB 4K23H 4QRRD 5E0QA 4V1DE 1U42A 3EKCA 3CLEH 4H8WC 5HHVL 4LHUB 2JELL 5B39G 4JRYB 3BKCH 4JZNB 2ZUQC 4OLWL 1EUUA 4X4YB 5AD0B 3I75A 1MLBA 1MWAB 4PJCF 3OHXB 3LQAH 5HHQA 4RFOH 2NXZB 4QTHA 3WIHA 3JWDC 3GGWA 5DMIL 1Z3GH 4WGVB 3KPSD 5EO1B 3QPXL 4S1QH 5JMOC 2FJHA 1AQKH 4NOBA 1E4KC 2ZP0T 3I50L 2BXZA 3DETC 3BP6A 2WANA 1PYWA 2VLJD 2QQNH 2E9IA 4PJ9A 3ZKSD 1ES0A 1R3IH 3NFPA 1NBZA 1Z0MA 1OAQL 3B3IB 1FL3A 1KIPA 4BSVB 2VN7A 1F6AB 1VFOA 4HPYH 2FYYB 1CFQA 3S4SA 4FP8H 3HZYB 4UQ2A 3FMGH 3O3DA 4PJ5E 4XXDB 2VN4A 4PJFA 1I8KB 4N0CD 3LIZL 1AHWA 4OQ1A 5GZOD 4XC3L 2ZOKA 3ETBF 3HI6L 3T65B 1GHFH 1RURL 1YNTB 4ONFL 2I27N 2M26A 4O2FB 2JJSA 4JPWH 4KFZC 1GC1L 4RAUA 1ZKAA 5CJ5A 5CINL 4JEGB 1QSZA 3C8DA 1AI1H 4MJIB 5CLTA 1KCUH 2UY7A 5IF0B 2W0LA 3OKMB 3OR6B 1B88A 2NMSA 3AREC 1G6RA 3KPLB 2OCFD 3TO2A 2APWA 2HG5B 3QIWD 4OCLC 1ITCA 4G7VH 4LCIH 4MCZB 5HDOA 3S9DB 3CFEA 4ZAKD 2AK4B 2Q7YB 3REWB 1BIIA 3IFNL 3NGBB 2Z92B 1S5IH 1K2DA 2IG2L 4G6KH 4JHAH 2W92A 5EZJB 3SDCB 4UNTA 1X7QA 4KROB 1P7QA 3O45B 4NFBA 5DK2B 2D31A 2VH5H 3Q48A 2XTLA 2Z93B 5F9WC 3IAGC 3U7YL 1JPFB 2P45B 5BZDA 3MTRA 2X4TB 2VIRA 3HE7B 3MFFA 4PTUA 2A83B 4YDLC 3PUCA 4LIQL 3BWAA 4RSVA 3RTQC 4JFQB 4OV5B 1LDSA 4QRPE 5D2LF 2DWDB 1A9BA 3VXMD 5FHAH 1FFPA 4OF0A 4ZS6C 2AERT 2VR9A 4Y4FA 4ALAH 1T1WA 4ELMB 5IEKB 2EDYA 4UIMA 1Y18B 4PJFF 43CAA 2R39A 3BKML 1UVQB 1BD2E 4JPIB 4M5YH 3X12A 4QT5B 1FG2B 4PLOB 4OTXH 4PGBB 4Y89A 1ONQA 5C09D 3V6OA 4GQ9L 1XGUB 2X42A 5LXGH 3OAUL 3E3QE 1TJHH 3IJSB 3GSWA 4ZFOB 5HHOB 3MBXL 5F3BA 3NOIA 5DJZB 4Z7NE 3M45A 2YD4A 2BSSB 4RA3A 1GRWA 4PGZA 3U36B 5E99L 3V5HA 5JXEA 4YR6A 4DKFL 5TGBA 43C9B 3HE6A 5EA0L 3ULUD 1NGPL 2H32B 3MV9B 4ZUUA 3RWJA 3T08A 3T2PA 3TNNA 3HMXH 4HWBA 1AKJD 5EU3A 4ODHH 2AV1A 4Q97A 3WE6B 3ZYZA 3QYCA 5J6GA 4TTDD 1AD9A 3MO1B 3EDJA 3RGHA 3GIVA 2JLLA 4JN2A 4YBQC 5T5NG 1OGAA 2CPCA 2VDOL 1HH6A 2LV4A 5D5ME 4LASL 4Y5VB 1NBQA 1ROWA 1JTPA 2W9DH 3OR7A 5C07E 1CCZA 5T1DH 2DQEH 4CBPA 5T1LA 1DBBH 1JGLL 3O3BB 4G6JH 1YEKH 4N8VB 2CR3A 1X6LA 4XCFH 3U82B 3MRJB 4ZPTA 4NQCA 1OP5H 3U0WH 4FNLL 1NCTA 4FQIH 5E94B 3ARWA 3UJIL 1J0KA 3STZA 3ZHDA 5TDPA 1M1SA 2P8PB 1D6EA 2PYEA 3DGGA 5E2UH 2XKSA 2XA8L 2CRIA 4WIQA 4G9DB 1MJUL 2YK1H 3WFHA 3VXSE 1CS6A 3D39D 4JVPA 5BMFH 2YC1A 2V7NA 1IM9A 2R8SL 4NNPL 3VD3A 4U1GB 4L4VB 3CFJB 1U95A 3MROA 1VSCA 4WTZA 4QTIH 1PLGH 1E6OH 2VDMH 4G42A 4G9FE 3L3HA 1ED3A 2NY3B 2GK0B 1EH9A 3I6KA 1B0GB 3DGCR 1YUHA 3R06B 3SDDB 1I1FA 2H2SC 1KYOJ 2RR3A 2DKUA 4KK8C 4WVRA 3ARDB 1VGKB 4Z95H 1DQML 5DMKB 4YWGL 3TJEL 1T2JA 1VFAA 5MEND 1C16B 4GS7C 4C57C 5D72H 4WGWB 1PAMA 4DZBB 3B4NA 5DJXA 3U4EA 5E9DD 2R1YA 3MNVB 2JJTA 1S9VA 4ZO9A 1KEGL 3P0YH 3TA3A 5FKAB 5HPMB 4PB0H 4AQOA 5I1AB 1TTUA 1G7MB 1N4XH 1P6AB 1WZKA 4M9PA 3U7WL 2E6PA 1VHPA 4M1DL 2BNRD 5CZVH 5D6CA 4LLQA 2HJFA 4TPRH 3VRLF 1EV2E 5JW5B 5DFVD 5K59E 1X3DA 2H8PB 5IQ7L 4YHNB 5EOQH 4JZJA 3QDGD 4LLUA 1OAUH 4NKOB 1R0AL 4G8GB 1HKFA 1YYLL 5KTEL 1VPOH 4HAFA 3RZCC 2AS5M 3MR9A 3BIKA 1RPQA 2HLAB 3OSKA 3UTQA 5IMMA 1SBSH 4JZOB 1JNJA 3C9NB 3S36H 1T1XA 5EO0A 1YC7A 4XGZB 3MV8A 1JHLH 4N0RA 2P43B 3IF1B 4YNYA 5E56A 2XZAH 4AIZA 4BZ2L 1EGJH 1DQLH 4POUB 5CGYC 4LQFH 4I0PD 4JREB 2R2BA 3VXUB 2CLZB 4KI5E 1AP2A 4J3WA 4BFIA 2BVYA 1CGTA 3OQ3B 1HZHL 4JO1L 1A6UH 5A2KH 4NN5C 4XNQA 4YAQB 5GGRB 1NMBH 5IWLA 1DQQB 3DVNB 4D9QD 4M1CC 2A38A 2W60B 1SEQH 4WCYH 2LFGA 5IB3B 1UB5A 5C9KA 4OGXL 3SDAA 1IL1B 3ARBA 5DURD 3LKNA 4O58L 4D3CH 3D5OF 3RUGA 2ADJB 4LEXH 4YX2H 4HV8B 4NQSA 4XVSL 5F72S 5L9DL 3G6JE 5DMGC 2R4SL 1MCPH 2HH0H 5EOTB 3VXRD 5IW1B 4X9IA 1MY5A 2PN5A 4S0TD 1ZT7B 4K3DL 1IEBA 5FUZH 3L5WA 3WIFA 4NBXB 4GT7A 1S9WA 4ZD3H 2HFGH 4OIBA 5JOFB 1JRHL 2DI7A 4POZC 4Q6YA 5C2BH 4XCYA 2ERJC 1JMZA 1KC5H 1MRFH 2VTFA 4YK4C 2XTJC 1E0OB 4WHCA 3MRLA 5DD3H 4GRWF 4Z8FH 1PKOA 3F7YA 5D96B 4UT6H 1BZQK 4H20H 2VC2L 5GRYA 3ZKND 2CLRA 4YUEH 4FABH 1VFMA 1EO7A 3ULVE 3OX8B 3VG9B 1T03L 5SX4I 4EOWL 4U1LA 4XZUA 1MHEB 3FOMB 3O6KL 3P2TA 3L95A 4HUUA 5A2IH 4RCAA 4W6XB 1D6VH 3L6FA 1IC7L 3DARA 4EQ3A 1PKQA 3PHSA 3RNKB 3TBYA 3BVNB 1JYWA 4MX7A 3H8NA 3IJYA 3EYQD 3BAEL 3PHOB 3ARGB 3L3IA 2X40A 4YPGB 3FCTA 2R2HA 5DJ2B 3MREB 2CIKA 3CVHL 4QRQA 3FO0L 5DVKA 4L8DB 3E6FA 1IAKA 1QFUL 3MBEC 4JFZL 1J0IA 3DBXA 3TP4A 4LBEB 1PY4A 1CGUA 2Q8BL 3BGAA 3FOLA 4K7PH 3MUHL 1QO3B 3RUGF 5L0QC 3VRIB 1S8DA 4KUCF 1UCBH 1T6WA 4WUUE 4P5TD 5I1CH 5SX4H 2C1PA 5JW4Q 5E8NB 3QULB 4EEEA 3FKUS 2BNQA 3S34H 4NT6B 5DO2C 5CGTA 1DN2A 1DDHB 4K94L 4FQPA 4YDIH 5CSZB 1LK3L 3HZKB 5DRXA 4U1KB 1MCRA 4KKNA 3IKCA 3UTTD 4I18C 5FYLH 1MEXH 3DOSA 4LVNC 2ZCKH 1ZTXL 3B9KC 2C4XA 5IMLA 4MB4A 4G8IA 1OAXL 4CDGC 4P2QD 5E8PA 5IB2A 3BZ4A 4P5MB 1EMTL 3I9GH 5I1JL 4B5EA 4KK5C 5JA9A 5CJ8A 1FO0B 4Y0GA 3O4LA 3OXRA 4JQIH 2P5WB 5HGDA 1IFHH 4U6VH 5IKCB 4XPAL 2IH3B 4M8QA 4G80B 2N1KA 3L5JA 1KN2L 2KQMA 4NNYA 3HRPA 5LWYH 1U6AL 2Z31C 5LGKA 3RFZC 2IAMB 5FM8A 3LS5H 1DSFL 4HF5H 1UH3A 4MNQE 4QGYA 1PX3A 2J4WL 1FFNB 4IS6B 4YHIB 1NAML 5IVXE 4ZS7H 4FZEL 4APQB 4YHLL 5ISZA 2AV7B 2FECL 4TSAL 3TN0D 4J8RA 5BV7H 4NQVB 5JUEL 3WMSA 3OPZL 1XGYH 2WBJD 4NRYA 5C0AA 4AENB 4OFDA 2DLFL 3GIZL 4UTBH 3PWUB 2CH8A 1ZLUK 5KSBB 2XQBL 1XIWA 3WS3B 3WDHA 4P57B 3QISA 4HG4K 4M5ZL 3U4BL 4GW1A 5LQBL 4Y19A 3X14A 4N90D 4CNIA 3ISWA 3M1BB 4RGNC 3H6JA 4Q9RL 1RSFA 1Z9OA 3G5ZA 4MCYB 4Y4HC 4LVHB 4TOYL 1Q8MA 3SE3C 4IMKA 4NZRH 2MCPL 3T8XB 3FT2A 1LE5A 5KVDH 1T21A 3Q3GA 4MDJA 4D0BA 5A16A 1EHLH 3T3ME 2EEDA 3G6AB 5LGHH 4FXLA 4ZXBA 4A2MA 3KS0H 4M9OA 3O8XC 3UTPD 3WD5L 4UU9B 1MQKH 3TPKA 1NLBH 2LVCA 5C0EB 2CK2A 1KXVC 2ZNXA 4F3FA 2X1XR 5DGQA 2DDQH 5IQ9A 3WDJA 5CKGA 3SN6N 2KPNA 1QKZL 3UBXA 1MF2H 5DJYB 1WCBA 2ICEA 4L4TA 3TBWB 2DLHA 4HWEL 1OARH 4ZOCA 4PRHE 1YMMD 3NPZB 3RU8L 3UPCA 2WINA 4QXUL 4LDLB 2WQRA 3H3KA 3QUYC 1U93A 4F58L 3MV11 4R7DB 1X5YA 3TCLA 1WFUA 4ZUTA 4W68A 3CDYA 1IQWL 3BDXA 3DSFL 3KXFD 1I1AC 3Q5YA 4Z7OF 3MRCA 2VWEE 3H7LA 3T3PE 5D6DA 5F9AC 5EU5B 5F7EL 4HS3A 4QXWA 2ORBL 4Y2DD 1Q72L 4LOUC 3ET9F 1CIDA 4XNMA 4KGJA 3T0EB 2BMKA 1JYVA 4TSCL 5HYSA 1YECH 2X41A 5DJAA 1HCFX 1UM5H 3HZMB 1KT2B 4PJEB 3CSYB 5ADOL 1V5JA 5D7KE 1AGDA 5HTSA 2BVOB 4ACPA 2NY6D 4ZOEA 1J12A 3LZFH 1WFNA 3NZ8A 5T5FL 2Y07H 1BOGA 1IGIH 1QYGH 2FL5A 4GAYB 3FN3A 5DSCB 3OJDB 3OKLA 3GBNH 5D1XD 1CD0A 1EXUB 1JZ4A 3MRHA 3ME0A 1WV7T 3EO9H 4UIKH 1YJDH 3ZDYF 4OD2B 3T77A 3UPAA 1AJ7L 1EA9C 1MI5D 5IHZB 4OF5A 3BQUC 3BP4B 1GGUA 2HP4A 3RGVB 1YZZA 2V6HA 2GFBB 4Y5YB 2DRUA 3CCHA 2D03L 1MPAH 3CFKA 5AYQA 1OM3L 3IU3B 4DEPC 1TXKA 4EKXA 4U1HB 2FNBA 5KN5A 3IRZA 4WTWA 4KTDH 1LO0H 4I8DA 5J13C 4DK3A 1G7LA 2XWBB 4GXVL 3BXNB 3RKDD 1Q9KB 3ZKMC 1HHJB 1GZQA 2IFGA 3IDNA 1H8SA 4GKZB 1UYWH 4M62L 4V1DA 1Z9LA 3H3PH 3LQZB 3NN8B 4AK1A 5JIPA 1OT1A 1TCRB 4W4NA 1UH2A 1TZHA 4N9GB 1CR9H 4H1LB 2QSCL 2EEBA 5EWIH 3RVTD 2PW1A 3DECA 4ODXB 1CD9B 1RJZA 5CHNB 4JRXE 5FDWB 3QUXD 3PHQB 3F6IA 1AE6L 1JN6A 4O02H 1IKFH 1JI2A 4LK4A 1R3LA 1I8IA 3DUUB 4XI5D 4M6OH 1WIUA 1QSFB 4PJHB 5ACZA 5J7CC 3BHBA 1MFBL 2YXFA 1RD6A 2R56H 4PTTA 3TBVB 5E5MB 4DTGL 4ODSH 3S6CA 4O5LL 1MFAL 3S88H 1OP9A 4I3SH 2P47B 5CEZH 3OAZK 1RULL 4YC2C 1RZ7L 4KKAD 4R96A 4TYUA 1I3RB 3DX6A 4MJ5B 4JM2D 3O41A 3RY6C 5I74C 1G9NL 1RIVL 3BH9B 5JIHA 3QIBD 3LS4L 4X6BA 5I75C 4M6ML 1RZJH 2AJVL 5CEXA 4JKKA 4LL9A 4ERSL 3I85A 4KQ4H 3NCCB 5FA4B 3HPJB 1KIQB 3MLSH 1JGUH 4N0CC 3ARVA 4JFPB 5GZOC 1INEL 3WN5C 2CDFA 1WZLA 3QSKB 2Y36H 2BRRL 4NPYB 4X0KA 4HIIB 4Z5RA 1KIRB 1F58L 4NBZB 3BSZH 1CICA 3QWRD 1ZANL 1AGBA 4HUVB 4LLVA 3GRWH 2FSEB 4N0YH 1UWEL 4N0UA 3QUZD 3MUY1 1FFOA 3HAEH 3WO4B 2PETA 1II4E 5E95B 4WENB 2ENYA 5D71L 3QIWC 3OXSA 1JNNL 1DBAH 2X89D 1TETH 2IPTL 4G8EB 4LSTH 4LPTA 1LWRA 3ILQD 4ZAKC 5GQBA 1M71B 4JO4H 4KQ3L 1C5BL 4O51B 4IDJH 4HGKC 1MFDH 2ADFH 3QHZL 4OF7A 4WU7B 3FO9A 5JIKA 3QG6A 2P5WE 2E9JA 2AEPL 3VWKA 2Z8WC 4X80L 3VFOA 1RUPH 2X4SA 3A67H 2XZCL 4PR5A 2G60L 3PGFL 1MCWM 4Z77B 4P3DB 2H3NA 5DD6A 3TF7C 1KJMB 2IBGA 2IALA 5LAXB 1S7TB 4OCYH 3HG1E 3BD5A 2IBZX 3ARRA 1VERA 2BVPB 1HH9A 4QRPA 4J2XA 1X5LA 3ARYA 2W9EH 4UDUB 3KDMA 4DGYH 3MV01 4L5FL 1TTGA 4Z7VE 2OR9L 4S1RL 5CIPB 1QBBA 4LRNH 4YFLF 4MYWB 3BP5A 5HY9B 4UOJA 1HN1A 2Z8VC 4F7PA 1BD2A 3T0BA 1F02I 3BMVA 4XCNB 3BEVA 4OGZA 5DTFA 1RHHB 5EIQA 4DGVL 4LLWA 3BGFC 1OAYH 4TVPE 1WC7A 4KKCD 3B9VA 4ODBD 4PJ9D 1FV1A 1S9XA 3GI8H 2X4NA 1MCKA 3BEWA 3UXFA 3VFMB 5TE7H 3INUL 3FQNB 4M7ZB 5BS0A 2XQYG 3R4DA 1T20A 2EDRA 3DURB 4WI5A 4B50A 4NSKA 4KH2A 4XWGH 3X13B 2BY0A 4OCWH 2OL3B 2GT9B 1EHAA 4IIQB 1I3VA 1OF2A 2AEIT 3ULUC 3EDDA 5EUKA 5EZLB 3KHQA 1ADQA 3RPIA 1NCBL 1IC4H 4CMMB 1JNHA 3LY6A 1ZSDB 1ORSA 3PL6D 4TTDC 5HHOD 4DOHB 1CGSL 5F7WC 5F8RC 3EYVA 4I77L 2O5XL 5D5MA 4EUPB 4AQ1B 4IHOB 5C07A 2YD5A 1GAFH 4HUKB 3HCVB 1F4XL 2VXTL 5TQ0L 2H26B 1AC0A 1LO5A 3G08B 1KB9K 3B8YA 4OFPA 5GSRB 1F4YL 2IQAB 4WJ5A 3GNMH 1H15A 2XN9B 5KSAD 2X5PA 1A7BA 5JHLL 4ZO7A 4PGEA 3HNSH 3QUKB 4K8RL 3DO7B 4NM8H 3U46B 2GJJA 4LPUA 5FK9B 1FNFA 1DN0A 5DZLA 5IHLB 3C5JB 5F1SA 2PXYB 5JW4M 4AMKH 1JWMA 3IYLW 1HNGA 5SWZB 2FWOA 3D2UA 4ENED 1NCUA 3H7BA 4Y2OA 3OAYK 5D7LD 4IEFB 3DV4B 1OQXA 3QCVH 3O3UN 2ZOLB 3Q1SL 1KJ3H 4Z7NF 3NPSC 4OCXH 3I02A 3WNOA 3B83A 3IU4L 2AK1H 4R4BB 5IFJB 2NW2B 3BUTA 4G9FA 1CDJA 4HQQL 3GSQA 5DQJB 1MJ8H 1N6QH 2D7TH 4PG9B 1JFQL 3G6DL 1IMHC 4F33A 4L29A 5FHBH 5KVGH 4PGDA 3G5YB 4UOW0 2VLRB 3G5VB 4LSDA 3GJEB 1HDMA 4P23B 1J8HB 4GH7B 1BIHA 1KG0B 5D5MF 3KYAA 4TNVF 3IT8D 5D2NB 3S5LB 4Z0BL 2DQHH 1FSKB 5EPMA 5F21B 4NHCH 2HKFL 5KG9A 1PZUB 4WEBL 5ICZA 4DZ8B 2G5BB 3MLPA 3QUMB 1UKQA 4I2XE 3SDDD 1P7KB 1S7RA 4U3HA 3AB0B 2J6EL 2EYSA 1NH6A 2XZZA 1G1CA 5A1AA 3OTTA 1T0NB 3LKOB 3HLAB 1CFTA 3FFCE 1KB5H 1TJIL 1TCMA 1JF1B 1E4XI 1JRHI 1LEGA 2FATH 4PJDB 4DW2H 4LHUA 1PW3A 1Z5LB 1SJEA 4JRYA 1TZGL 3D1MC 1GZPB 1RZKC 1UH4A 2IMMA 2Y5TA 4FQJH 5AD0A 3RPKA 4NKDB 5ENWB 4P5KA 5F3HA 1KBGH 5DFVC 3CVIH 4XNXH 3M8OL 5I1DB 1UWXK 1BLNB 1SVZA 1QRNB 3V79C 2DJSA 2AI0L 1DEEB 2FLRT 2FD6L 5ALBL 3W9EB 1ZXQA 4OQTH 3VCLB 4MMZC 2EE6A 4M43L 3IKKA 4FFYH 2MWCA 5BCAA 1YYML 4Q0XH 4YIQA 5C0ND 3W9DB 5JOPE 1E4XH 6FABL 1N3NB 5TQ2H 4BSVA 1N6VA 1F6AA 2FYYA 3NCYP 2DQGH 3PABA 3HZYA 1NC4B 4XXDA 2J8UB 3JSSA 2DQFB 2F9BT 4AL8L 3O9WA 4HUXB 3QXAA 5IK3A 1A6ZB 1DQDL 1KCVH 4K3EL 3B9DA 2NXYB 4NJ9L 4I3RL 3IGAA 5E8DL 2ENSA 1AGEA 3DYPA 1OQOA 1N5YL 4GSDL 1R24B <