1XGTA

Structure for antibody hyhel-63 y33l mutant complexed with hen egg lysozyme
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
215
structure length
215
Chain Sequence
MDIVLTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtA01
5ADOL 3CFIC 1BEYH 1IT9L 5HI4C 5IFAH 1KELH 2QJDA 1HIML 2W0PA 3V4VH 3MNZA 2BY2A 2NY0B 2W65A 1P7QB 4H0GA 3BHBA 2C9AA 4W4NA 1KN4H 5LQBH 1QFWM 2CO6B 4AH2A 5FYJD 3UDWC 4L9LB 4TSCH 1X6NA 1G84A 4Y4HB 4HJJL 2IMMA 1BX2B 3E1F1 1PSKH 3X17A 5GGUB 5HVWA 1YNLH 3CVIH 3QUMH 4NFDA 2FX9H 4OF6A 3QG6B 3U48A 1G7QB 4QWWD 1FL6B 2BSSA 5CJOH 4JQIL 5F7HA 1JN6A 3EYOB 3OJDA 2HA1A 5DSCA 4KKLD 4LQFH 4HD9A 1MNUH 3OV6A 3EO0A 2IAMA 3JTTB 1QRNA 3O4OB 3P4MA 1JGUH 2Y07H 5BS0B 5IFAL 2CQVA 2FSEA 1KELL 3V4VL 1MVUB 4J8RB 4OLZH 3L5WB 1V3LA 4FQJH 4G8GD 1QLFB 3VFWA 4HIXL 3BPNB 5DMKA 3ARFD 2P7TB 1KN4L 3MQIA 2W38A 2R56L 4UIMB 1J5OH 5EPMB 4UNVA 4UV7L 4E41E 3ECBB 2X1QA 4DVRH 3IVKA 5ISZE 3G6DH 3LEVH 1PSKL 1YNLL 2R29L 3CVIL 2AXGA 3O4LD 4PLOB 2XWTB 1S7XA 5MEND 5BVJA 2QQKH 3QZWA 4LQFL 2JTDA 1A7RH 4OZHF 3SDAA 3IDIB 4WFHD 1MNUL 2IH3A 4U1LB 3T4YA 4CMHC 5D2LB 3GM0A 1J1PH 4J4PA 3SDDA 2WV3A 1R5WA 5KSAB 4U0RC 4WU5A 3G6JF 4PLKC 4E42B 1UXWA 4OLZL 1A7NH 5LGKA 5GRUH 5J3HC 4JFQA 4PJXE 1CT8B 1XH3B 5FECA 5DJ6A 3ULUH 1ADQA 5E9DB 2X4OB 1J5OL 1T2XA 1F58H 3NTCH 2CXKA 4ZUVB 4DVRL 3G6DL 3LEVL 3GB7B 4RX4A 3DVNA 1P7QA 3UTPE 3LMJH 1YDPB 3VRJB 2JB6B 3QUKB 4L9LA 4RGNC 4Y4HA 4PJIB 5L88H 1BX2A 3BUYB 2QQKL 5GGUA 4ELKB 2M26A 3F5WB 5DMYA 3QG6A 4YHNB 4JR9H 2FCBA 2Y06H 1G7QA 2ZUUA 1FL6A 2WM0A 4HEME 4JFFE 2C4FU 2Y5TB 1R0AL 3EYOA 1A7NL 5CZKA 4UDTB 3VXME 3W9EB 4OTXH 3JTTA 1RY7B 1L6ZA 3GSNH 3QIWD 1F58L 3NTCL 5BS0A 3VXRB 5E94B 1VKXB 1MVUA 4J8RA 2EE3A 3L5WA 1CBVH 3QEUB 1QLFA 2X40A 2HT3D 5KAQF 3IJYB 3LMJL 3RVUC 2P7TA 1T5WB 1MJJB 4UIMA 5EPMA 4PV8B 1F45A 5HI3C 3W0WD 3ECBA 1M6OB 5L88L 4MXWH 2OTWB 4NQDD 4DEPB 4F33B 4CNIB 3SGEH 1I7RB 2XWTA 1JTOA 2Y06L 1GGIL 5FB8B 1JV5B 4AK1A 1A6TB 2RB8A 1UJTA 4JHBA 4AJ0A 2EDEA 5ECJE 1JI2A 3ULVH 4NZDA 2FLBT 5T3XE 3IDIA 4U1LA 4XPGH 2XTJC 5D2LA 2NXZC 4OTXL 5F7DB 2XRAH 5EBMB 2E6JA 3ORJA 4O51B 3O6MH 4HUWB 5E8DL 5F21B 5KSAA 1Y0LB 1LP9E 5H94B 4E42A 1F97A 4LCCB 1CBVL 4XT1C 5CBAB 3S36L 1CT8A 4OFDA 4NM4H 2A2QT 4M7JH 4LSQL 2X4OA 4LRIC 2XQBH 4ZUVA 5DZNA 1KJ2H 3GB7A 3MODL 5I6XB 5EFIB 5EULV 3T77B 1YDPA 1MCRA 1WEJL 1N0LA 2JB6A 3QUKA 1UKSA 4PJIA 3BUYA 4ELKA 3ULVL 2X89D 5EOCL 1J8HB 2FR4B 4XP5L 2X1PA 3P77B 5IVXE 3F5WA 3TZVC 4XPGL 4YHNA 2BNQE 2XRAL 4NZUH 3UTTB 3O6ML 2CGRH 1MFCH 2BNUB 2Y5TA 5BOZG 4XPBH 1N2RA 4BZ1H 2VAJA 5HYJB 4UDTA 1JPSH 3QNZB 2F8VA 4X6CF 4M7JL 2VDNH 1A7PL 5E94A 3EBAA 2EIEA 3TO4D 1GGUA 3D48R 5DRWB 3WLBB 2WBKA 4S1DC 2XG5A 3IJYA 5J8OA 1VB9A 1T5WA 5CMAA 1MJJA 1RUPH 3EOTH 3DBXB 5C0CE 4PV8A 4NGHL 3UJJH 1M6OA 4J12A 1CXLA 2ID5A 2OTWA 4F33A 1K3ZA 2PXYB 3BPCA 1UB6B 4NWTH 2QADC 4CNIA 3U7AA 3VA6A 2H2PC 1I7RA 2VLME 2BJMH 3C6LC 4JRYD 4LMQI 3I6LD 2YKLH 2PUQT 2BX5A 1JV5A 1MFEH 4NZUL 3T2PA 1A6TA 5E6ZA 5FB8A 2CGRL 1MFCL 4GKOA 5C09B 2X09A 3IU3B 2R0WH 4XPBL 4B53A 4BZ1L 1OLLA 3BQUB 1ZLWK 1WZLA 3PWPD 1FN4B 3IFOB 4U6HB 1JPSL 5F7DA 4HXBH 5EBMA 4KKBC 4HUWA 2VIRA 3CFJB 2VB5A 4QRPE 2JE8A 4S0TD 3EKCA 1Y0LA 5H94A 3OAZH 4BK5A 4LCCA 3FB8B 5CBAA 3B9KB 4XP1H 1RUPL 3HE7D 4XWGH 3UJJL 4CVZB 1FLTX 1FHGA 4NWTL 1IGCH 2XY2A 3IDXH 2GSIB 1QZ1A 1U8IB 5GS0H 4QOKE 2F53B 4KHTH 2IWGA 3T77A 1JPST 3BZEB 2I27N 3DUHA 1JYVA 3T2OA 4M3KB 3UROR 1U42A 1U36A 2R0WL 4QWWC 1CL7I 2FR4A 3U4AA 3P77A 2IMNA 4M6ML 1JMZA 3ARUA 2WBJD 3L7FB 4KKLC 1H3XA 4H5SB 4LSUH 4HXBL 5FCSH 5HYFA 1NGWB 1MEXH 5H35B 2BNUA 1X4XA 4O4YH 2J5LB 3D85B 3QHZH 4LNVA 4BH7A 3LD8B 1K3IA 1J0KA 2HG5B 3T3PF 5HYJA 3QCUH 5DRZB 3FN0H 4JG0H 3QNZA 3AC0A 4XMPH 1X5HA 1CCZA 3SGKC 5C0GB 4MA8L 3T0BA 2IFGA 4I77H 5CHNA 3WE6B 3ARFC 4QYOB 1C5DB 1UM5L 1RIVH 3LN5A 5DRWA 3VXUB 3BUTA 3D5OF 4RAHA 3WLBA 5GS0L 3ARPA 4MLIA 4LVOC 1A6WL 2FWOB 3KYAA 3DBXA 3OR6B 5J11C 4G6FB 2PXYA 3MACL 1UB6A 3S5LB 3H42H 3DECA 4HUVB 1ZLWH 4KTDH 3UZQA 3Q5TA 5EUOB 4NQCB 1MEXL 3DYPA 4ZXBB 1T66D 4O4YL 3IU3A 4Y5YA 4J23A 3BQUA 2APVA 3RX8A 2ZUQC 1FN4A 4U6HA 3FN0L 4JG0L 4XMPL 1D5MB 4NN6B 3CFJA 4FFZH 2AJYH 4I77L 5E5RB 1H8SA 4LEXH 3BN9D 4B50A 1RIVL 3FB8A 1JJUA 3QPXH 1AKJA 5M7QA 2V9TA 1RK0B 4TSAL 1XGRB 1ZV5A 4GQPH 5INCB 4IBLT 1IZKA 1OP5H 3MLVH 2EYTA 2ZUSA 4CVZA 2GSIA 4OM0H 5D7IF 3QB7C 1U8IA 2EH7L 4GRMA 3LSOB 2DBJA 2BVUA 5J9PB 4R0LB 1TPXB 4WUUD 4KTDL 5C7XH 4PLJD 4WWID 3BZEA 5JA9A 2Q87A 4KDVA 1ADQL 3I9GH 4N9OB 3TFKD 3VWJD 3BN3B 1R3LB 3BIKB 4YEEA 1RUQH 1YA5A 3K8LA 5I16B 3T0WA 2YA0A 3L7FA 1A7QH 4QXUL 4H5SA 1MCCA 3T0EB 1EEQA 4JFDE 4XH2B 1NGWA 4XVUD 1SQ2N 2AJYL 4FFZL 3D85A 2B8OT 5I1HL 4LEXL 5GGRB 2HG5A 3QIWC 3TT1H 2DJSA 1BREA 3QPXL 5DRZA 1RUML 2FL5A 2AEIT 2AGJL 3H9SB 1I3UA 1BBDH 3UZEA 4ETQA 5C0GA 5HPMB 3MBEB 4HIIB 4EQ3A 3WE6A 4QYOA 1C5DA 4KWUA 3VXUA 2HT4D 3VFTB 4N1HB 1TJGL 3HI6H 3GRWL 4NBXB 1FH5H 2DQHL 5IVZB 4OAWA 2DQUL 4OF8A 2FWOA 1CICB 1RJLB 3I3DA 5C7XL 3OR6A 3GO1H 3I9GL 2M2DA 2XXMB 3S5LA 1NBZB 3CZJA 2VXQH 4ZSOB 1OM3L 5C2UB 2DMBA 3KPRB 2ZUWA 4HUVA 1RUQL 2UV3A 4QRQB 1UJ3B 1A7QL 1PKOA 2CDGB 5EUOA 4NQCA 4YDVB 1ITCA 2KZ1B 1T7WA 4MJ2A 3V0VB 4ZXBA 4ISVB 3B4NA 3TEUA 3TT1L 2I07B 1LP9F 3BDYH 4JLRB 4Z0XB 1BBDL 3MV9B 1D5MA 3EFDH 3HAEG 1MCFA 5ETUA 1UXSB 1HSAB 1FAIH 3LQAH 5DVKA 2D7NA 1RK0A 1TENA 4RCAA 1KOAA 1DJSA 1XGRA 1S9VB 5INCA 3S37L 1UKQA 3DPBA 5FM4A 4CW1B 1P84J 3GO1L 2X9YA 1E6JH 4XBGB 2YXMA 3FHQA 1UCBH 3LSOA 3ZHDA 3U9PL 5J9PA 3U36B 5IVXF 4R4ND 1R3LA 3DUUB 4JY4B 4M6OH 5I16A 3PWLB 3QO0B 2PTTB 3BDYL 3U6RA 3T0EA 1RVFH 4XH2A 1MF2H 3EFDL 1FFPB 1RULH 3GJFK 3V79C 2QEJA 4WY7H 3MV7D 5GGRA 5KANI 4N8VA 1T1XB 3LQAL 1FAIL 2Z8VC 1F13A 1A0QH 5EOQH 4PJFF 3WIIH 3TO4C 4H0HB 5HPMA 1T4KB 4YIQB 5JO5B 3MBEA 4MSWB 3RHWF 1INDH 4N8VG 3BMWA 5FM5O 1L7TH 5D9SA 1T1ZB 1E6JL 3ZHLA 1AQDB 2ZOLA 3VFTA 5IVZA 1RZIB 1WBYB 5CD3B 1TQBC 5DA4A 5D1ZA 1CICA 1RJLA 3JSSA 4NQED 4K8RD 3R8BB 1IGIH 1NBZA 4ZSOA 3KPQB 1WC7B 3ARQA 2VLRB 3O6FA 4QRQA 1UJ3A 1ZHBB 1F8TL 1I9RH 2CDGA 2EE2A 4KK5D 4NRXB 2V5MA 4CADA 1CGSL 1RULL 3VMNA 3V0VA 4NBYB 4WY7L 4ISVA 3MLUH 2NW3B 5CSBA 1TNMA 5F89B 2I07A 5HDQL 2NTFB 2HTLC 4LDOB 1A0QL 2Z91B 4JLRA 4Z0XA 3MV9A 5IEHB 2R15A 2APBA 1CD0A 2E7CA 2UZXB 5JIKA 1INDL 1BAFH 1L7TL 3HE7C 1UXSA 1HSAA 1K5NB 1BVLB 3WDIA 4I5BB 5KVGH 1LVEA 4TUKH 3FQTA 4CW1A 5EOCJ 3TC9A 1CD9B 4XBGA 1IGIL 4JKPH 3LZFL 2JCCA 1DQMH 5F7UA 3U36A 3QR2A 2WBJC 3KJ4C 1NAMB 3V2AR 2ZP0T 1JGLL 1WQVT 3MLUL 3DUUA 4WW1B 1CVRA 1V7NH 4JY4A 3PWLA 5JOPD 1ZA3A 2C4FT 2PTTA 3FFCB 2HH0L 4MCYB 1FFPA 2EIBA 2APXA 4RQQB 1OAYL 2BY0A 3IS1X 5SV4A 4N9GB 1BAFL 5HHOB 1O7SA 3MSPA 1N3NB 1T1XA 5C0AD 3FAWA 1ZS8A 1URLA 5AAWA 5KVGL 1T4KA 4YIQA 5JO5A 1I4FB 4M00A 4MSWA 4TUKL 2VKWA 4YFEA 1ZAGA 1T1ZA 3AB0B 4JKPL 5F1NB 1EHXA 3U0TB 1WBYA 4XTRD 5CD3A 3OGOE 3KS0J 3ARBD 3ZT7A 3KPQA 1WC7A 4LDLB 3IETB 2GTWB 1ZTXH 1V7NL 2VLRA 3QBTB 1T66C 5F7YC 5CEZL 2XZAL 1ZHBA 5T5NF 3PV6A 4NRXA 4MNQE 3V0AC 5L9DH 4QRUB 3S36X 5F89A 3BN9C 2NTFA 3GSRA 1PX4A 3VMOA 2EKSB 3V5DA 2P5WD 2Z91A 4JN1H 1K4CB 5IEHA 3INUL 4G7YH 2HRPL 3RUGE 4MJIE 3O8XA 2APWA 2CKNA 2F5AH 1JPGB 1K5NA 4JO3H 3ZLQC 5AUMB 4X6DB 4I5BA 3V4PH 5D96B 5J7CC 2DQTL 3B8YA 4JGJA 1J0YA 4WDIB 4PLJC 1H3VA 5T5FL 4PYGA 4JZNB 4RDQF 4LCYA 1ZTXL 4CMHB 4PJDA 3TFKC 3ALXA 3VWJC 2NY1B 4BQ8A 1HHIA 1DBBL 1NAMA 1X5XA 5GGQL 5L9DL 3EAKA 5SWZB 4WW1A 4XVUC 3BEVB 1ETZB 1VESA 1PQZB 3KHQA 1Y18B 3FFCA 4MCYA 3MXWH 4ODTL 4RQQA 3FB6A 2CKBB 1M7DB 3QYCA 1N3NA 2F5AL 5BV7B 1I1AD 1FGVL 1HI6B 4NKQB 3UDWA 1BIIB 2HT4C 2X42A 1I4FA 4RGNB 5HGGS 1YYMH 4UUJB 3IFNH 3WV0A 2FGWL 5F1NA 3HZVB 2OSLB 3HAEH 1MJUH 3U0TA 3PIQA 3UBXI 3O45B 1XT5A 3R1GH 5I75C 2Q7NA 3WDJA 4X80H 3HR6A 4G42A 5KTEL 4WI9A 1P69B 3IETA 2GTWA 3NA4A 3ARYA 2BVOB 1F11B 4PJ5E 2Y1VA 1EFXB 2NY5L 3HHRB 1E4JA 4MB3A 4PJBE 4NHCH 4QRUA 1JNHB 5SX5K 4YWGH 4JFYB 4JGUA 2DTSA 3VFGH 1Q9KB 1K4CA 1NCDL 3GUTA 1YYML 4L8SC 4ZNEE 2HLFD 1J10A 5GGTA 3IFNL 2W9EL 4G80B 1JPGA 2PN5A 4DKFL 1AY1H 1MJUL 5DD6B 3U2SB 5AUMA 4UTAH 4X6DA 2LQRA 1RZKH 3VDCA 3KPMB 4OFPA 5DEZA 4B7IA 4W6WB 4WDIA 2YRZA 3W11D 4RISH 1I85C 4R4NC 2XA8L 4JZNA 4PJ7B 4R96B 4Z7WE 4PB9H 4Y16D 1ZWIB 3UC0L 2A74B 5SWZA 1FAKT 1N6QH 3PP4H 3BEVA 4LPXA 5FYLD 4YWGL 1ETZA 1PQZA 1Y18A 3KXFE 5EA0L 1AXTH 4LLYA 5DFVD 4IRSD 4ELME 4P99A 2CKBA 1M7DA 4Y5XB 1CL7L 4PGJA 1WLHA 1B88A 2J8UE 3MRKB 2GHWB 3UTSD 1DQJB 1AY1L 2IPKB 4ZQKB 1A1OA 3VRIB 4UTAL 1HI6A 1BIIA 1RZKL 5DVOA 3I6GB 5FGBC 1HXYB 4UUJA 3L5JA 1MCLA 4D9QE 3IXTA 2HJFB 2C3GA 3HZVA 4K8RC 2OSLA 25C8L 3OAUL 1CTOA 3O45A 3H0TB 1EMTL 2BMKB 3X11B 4PB9L 3X12B 4Q7DA 5EU7E 4KK5C 3D3VE 4ONFH 2YPLE 3LV3B 5C0IB 4K94C 2AKRB 5SX5H 1BF8A 1F11A 1L0QA 1AXTL 5IV2A 1RU9H 4UZGA 5C08D 4G6JH 2ESVB 1EFXA 4DK3A 2VJXA 3ESUF 5JMOC 4PD4K 1JNHA 3VDAA 4F57H 4ACPA 4FZEH 2YPVH 5BRZE 4C56E 4NQVB 4JFYA 2Q3ZA 4P2QB 5T33H 1IAKB 1Q9KA 4MB5A 5I73C 1NDMB 3EHBD 2DQGH 5F44A 5ESVA 4RGMC 4D9RE 3O2WH 4G80A 5LAXB 5A43C 1OGAD 2FEDD 4KY1L 5DD6A 3U2SA 3VWKB 1FORL 3GBNH 3KPMA 1B0GB 1D5ZA 3KYOB 3D25B 4HMCA 4ONHA 3HMXA 1UH3A 4FQLH 1CR9H 4ONFL 1BZQK 1KCUH 1AP2B 3CDFA 4XNYH 1Q9OB 2OI9C 4Z78B 1RU9L 2VABB 3OR7B 2HYMA 5T3ZH 2ORBL 1ZWIA 3MRDB 1YQ2A 4EBQH 2AAVA 3T0VA 4F57L 3UPRB 2YPVL 1LEIB 1IC7H 1U91B 4M7LH 5EC1B 1J87A 4DUVA 5I2IA 4GRLB 1Q9LB 2DQGL 4L3AA 3KLDA 3MRKA 3HG1E 3GHEH 3Q0HA 2IADB 2IPKA 5C0BD 2V5SA 4ZQKA 4A6YB 3VRIA 2Q8BH 2OTPA 2Z31D 3DV6B 5HVHB 3I6GA 4XTRC 1HXYA 2MWCA 3LRSA 2VITB 4J3XA 2Q7YB 2HJFA 1MQKH 4E41B 2XKNB 1CR9L 3KAAA 1KCUL 3WHE1 4XNYL 1UADC 3ARBC 4JFOA 2DBLH 4K3GA 3U9UB 4HKJA 3H0TA 1BD2A 2BMKA 1C5BL 1SVZA 3BJ91 3CMOH 3X11A 4JCLA 4Q6IB 4NC1C 3X12A 4CN4A 2J4WH 3LV3A 3GSVB 4XP9H 3TN0D 4EBQL 4YHML 2AKRA 4XHJC 5GRJH 2A38A 2ZCHH 4M7LL 3WSQH 2ESVA 3ARFB 4OQTA 1INEL 3QCTH 5EO1B 4KJYB 2O26U 4NQVA 4P2QA 2WZPD 4KZEH 4FP8H 1IAKA 3QHFH 5F96H 1KEMH 3EZJB 3BT2H 1U3JA 2F8XC 2Q76A 1NDMA 3Q6FB 4PJXB 1J0IA 3NCJH 4NFBA 1EAPB 5LAXA 1NAMH 1MQKL 3CX5K 1AO7D 4N0UB 4IRJB 3X3FH 3VWKA 4CN1A 3O3AB 1SEBB 5ILTH 3RKDD 3KWWB 3D25A 1GHFH 1BVKA 3CMOL 4M7LT 5C8JB 1T03H 3GBMH 1FC1A 5L2KD 2ZUQB 1YEKH 2VL5B 1KJVB 2J4WL 3BKJH 3HPJB 3MRJB 1QPXA 1AP2A 4M61B 1Q9OA 4M9OA 3U1SH 4DTGH 5DRNB 4Z78A 5GRJL 5FHAH 4YK4C 1K8IB 3GSUB 5A2IH 3VXTB 2Z0BA 3WSQL 2VABA 3OR7A 1XR8B 4FQ2L 3MRDA 4R2GD 3QCTL 2FLRT 3VCLB 3UPRA 1LEIA 3SN6N 3BDXA 4KZEL 1U3YA 1U91A 4B7LA 3QHFL 4NRYB 5F96L 1KEML 1JHTB 1WZKA 3BT2L 1Q1JL 5I8OH 1I1AC 4KZDH 3EW3B 3HNVH 4PJGB 4GRLA 1Q9LA 4M03A 1J12A 3NCJL 2BNRE 4Y2OA 3LS5H 1NAML 4Y19E 1HCVA 2IADA 4BQCA 4A6YA 3X3FL 1G9MC 1JVKA 3DV6A 5GGRY 3N1GC 3UP1A 5ILTL 1GHFL 3VXPB 5D1QB 3IT8D 1T03L 3BRFA 4E41A 3BKJL 2XKNA 3CNKA 3RWFB 3B5HA 3DX8B 1U8HB 1W0YT 1WWCA 4Q6IA 2LAGB 2ICEA 3T8XB 1A64A 2EDBA 2P4AB 1R3JB 4QKXB 3GSVA 3JBG7 4P2CG 5GGTH 3SGKA 1OT1A 3CSGA 1FCGA 2J6EA 2R4RH 3QFJE 1JZ5A 1KENH 3ARFA 3HNVL 5DD3H 2DMCA 5EO1A 43CAB 5HXMA 3E6FB 4KJYA 2HLFC 3SO3B 3UPAA 5ABDE 4H0IA 4GAFB 4MZ2A 1JZ3A 3Q6FA 3QQ3B 4PJXA 4ONGH 2ICCA 5B8CB 1YC7A 1E4XI 2YS4A 4N0UA 4IRJA 4X98B 4O2EB 3W11C 3O3AA 1SEBA 4Z7VE 3IDNB 2BK8A 3KWWA 4QHMB 3D39E 3O3UN 4P49A 4Z7WF 1KJVA 3HPJA 3MRJA 5GGTL 3T08A 4M61A 3ARDD 4Y16C 3KPSD 1WFTA 1N8ZB 3FO1B 4HUNB 5DRNA 2DB8A 1GGBH 3STZB 2OMBA 3GSUA 1K8IA 3IKCB 3SJVD 3SPVA 3FQRB 3VXTA 4X7EC 1NCAH 3DRQB 5HDBE 2R4RL 1XR8A 5DFVC 4L4VD 4IRSC 5JXAH 4ELMF 4RMQA 3VCLA 1TVBB 2IAND 2ITDA 3CUPB 5GRVK 3PDOB 1JHTA 3TJEH 4PYHA 4PJGA 4AEHL 4XXCC 4ODXA 2CDEA 4IDJH 3HE6D 1D7FA 3BPLC 2OMNA 3MBXH 3PQYE 1A2YA 3W2DH 5D7LB 4C4KT 1T2QL 1H3GA 1HSBB 3VXPA 5D1QA 2D4FA 2CKBL 4LHUD 3L3JB 3RWFA 3DX8A 1GGBL 1U8HA 2G75A 5B38G 3GDBA 4CVWA 5EZIH 2VLJD 1NCAL 2P5EE 4FFVD 3C2SA 5F71A 4EN3B 3GMLB 3T8XA 2EDTA 1R3JA 1YPZA 3L3KB 3UMTA 4KJQD 2WQRA 3UYRL 2K9UA 2J3SA 1FNLA 3TO4B 4X99B 2E7BA 1CE1H 1H5BB 3HMXH 1WIOA 43CAA 3E6FA 2ZPKL 3EHBC 4LCWD 1TQBB 2F19H 1Z3GH 5HBBA 5AYQA 4PJEA 3MBXL 3OKOA 4ZS6D 1NGPH 2FEDC 3W2DL 5FYKE 3QQ3A 2NY4D 4P59H 1TVHA 3Q1SL 1CGWA 1P9MC 3N85H 4HZLB 5B8CA 3ZE2E 5GSRB 4X98A 2ADIB 4OF0A 1DZBA 3VDBA 1W8NA 3UJIH 5D93C 3IDNA 1MFBH 5EZIL 4QOKB 4QHMA 1NUFA 4P0DA 5DJAA 1YJDC 3KR3L 1P2CB 1YN7B 5HI5D 2VDKL 4Z5RB 1N8ZA 1J7VR 2NY6D 3STZA 3VXSD 4AIOA 3DRQA 1CE1L 3MRQB 4GKZB 3CIQA 3CFEB 4TNVK 3HMXL 4D9LL 5CUSL 4L3CB 1W0VB 2OCFD 1ACYL 4JFXB 2HT2D 3ZE0E 1TVBA 2F19L 3CUPA 4R26H 3PDOA 1NGPL 3QEGL 4XCNB 4OZGE 3H3PH 4XB8A 4F9PC 4JHWH 2Z31C 4HFUH 3N85L 1YEDB 4KXZI 1T80A 5MEOA 1D9KD 3VFRB 1I7UB 3VFUB 5D7LA 1JPTL 2WBJB 1HSBA 5E1AA 4ZAKB 3QWRD 2QR0A 4OQTH 15C8H 5KVMC 1W0WB 3IAPA 3L3JA 2HJKB 1VEMA 3TN0C 2HFGL 4EN3A 1FZKB 3GMLA 2Y23A 1UWEH 4DK6A 4DOHE 4OCRH 4GKSB 2GSGB 3L3KA 3JWOC 4UV4H 3TO4A 5HGHB 2C3VA 1IL1B 4R7DB 4IMLA 1F02I 3ELAT 4JHWL 5LWYH 4HFUL 1RAMA 1QEWB 4X6BB 4OF3A 2Q6WB 3W5NA 3BP6B 4OLXH 3CC5B 1CFTB 2WWMD 4Q9BA 3QIBB 2AW2A 2VDMH 3S97C 1T22B 1WUNT 4HZLA 3RKDC 3VJ6B 4OQTL 3OKEB 15C8L 2PO6D 5GSRA 2ADIA 1ZSDB 3RRQA 3PWPA 4ODHH 1CFVH 4KGLA 2FHCA 4GG6B 1UWEL 4FRWA 4ERSH 1P2CA 4OCRL 1YN7A 5FYJH 5MHSD 4PRIE 4WHYH 4UV4L 4NUJB 4OLVH 3FQWB 4HGWB 3K4ZA 3MRQA 4GKZA 3CFEA 3RJDA 2JJTA 4JFDB 4MNGE 5LWYL 4L3CA 1W0VA 3CCHA 1FJ1B 1NKOA 2VDQL 4MQ7B 4OLXL 2C1OB 5E99H 4XCNA 4EDWL 2VDML 4OV6F 1X6LA 3D2UB 4U0QB 1YEDA 1MRCH 5IVNA 3VFRA 4IJ3B 5JXEA 2HVKB 1I7UA 4J3SA 4FTVE 2OZ4A 1RZJC 2O5ZH 2WBJA 4ODHL 1CFVL 2BSED 4ZAKA 4ERSL 3E0GA 3PHQB 4JDZB 4RSVA 1UGNA 1LNUB 1W0WA 2X41A 4HUXB 3NPSB 1X5JA 4N90E 3P3YA 4MXQD 2AQ3A 3GI8H 2GFBB 2HJKA 1RIUL 2HRLA 4R9HA 1H8OA 4A6YL 1KPVB 1XIWB 2HN7B 1T89C 2FBJH 1OPGH 3TLRA 4GKSA 4DCQB 1JK8A 2GSGA 4KRLB 4JAMB 4PJCB 4EUPG 4JRXD 2WUCH 5HGHA 4ZFFA 2H3NA 5E99L 2DWDB 1DDHA 5ICXB 3QPQD 1UCTA 3MCKB 4HQQH 1QEWA 4X6BA 2W0FB 3OMZA 1BM3H 3FB5B 4GAYB 2Q6WA 1MRCL 2H6PB 4Z7QE 3SGJC 4FZ8L 2B2XH 5DC0A 1BQHA 5I75B 5JIPA 4NKDB 5J1TC 4GAJL 1CFTA 4TRPL 1PAMA 2O5ZL 1W72H 3QIBA 2J6EL 5IF0B 2VSCA 4GO6B 2VISB 3OKEA 1OSPL 4OCLC 1BQHG 1ZSDA 1AFVH 3AS3A 2D7TH 2D03H 4UOW0 3ARDC 3IF1B 2VMFA 5DC9B 3KYNB 4GG6A 5J6GB 1OPGL 3SDCD 3LPWA 4M7ZC 4MD0B 4AMKL 4JN2B 2VQUA 4NUJA 3FQWA 3ZDXE 4FQIH 2X4PB 2WUCL 4HGWA 5KG9B 1HNGA 4L8SB 2BHYA 1VFUA 4K07A 4HQQL 2LAAA 4XMKH 4RFEB 1BM3L 1WCBB 3UJTH 3HE6C 1IFHL 1K85A 4OI8A 2B5IC 3ULUE 4MQ7A 4BFIB 1NC4D 2C1OA 3N1QC 4PRPE 1MI5D 3SBWC 4GXUM 3OG4B 3D2UA 4HS3B 4PBWD 5DMJB 4R90L 3WFBH 3VWJA 4NJ9H 1AH1A 2HVKA 3RL1B 1J1OH 3WCYA 2W59A 1EERB 3EDEA 1BOYA 3RA7H 1NFDF 4X4XA 5JHDE 3MCLH 3PHQA 4JDZA 1TCMA 4FFVC 4HUXA 2DLGA 4LVHC 2YN5A 2GFBA 3IB4A 4FQIL 1NBVH 5E2WL 3X14A 4KJQC 1KPVA 1XIWA 2HN7A 4PJ9D 2MCG1 2I25N 3VI3E 4F15C 3A6BH 5DS8B 1JZ2A 4PGEB 4Y5VB 3C60C 4DCQA 4Z76B 4JAMA 4X5LA 4XMKL 5D7JB 4PJCA 3UJTL 4JZJC 2GY5A 1DFBH 2GJZB 2DWDA 1VGEH 4E5XB 5F93C 2FGZA 3ZL4L 4NQEB 1UM4H 4URTB 3MCKA 4ZS6C 2UWEB 2W0FA 3L3OA 4J7RA 2NY4C 5JQHC 3FB5A 4GAYA 3RIFF 2H6PA 4U3CA 3WFBL 1RK1B 4NKDA 2VC2H 1J1OL 1H3UA 3OZ9H 3Q48A 5T3XL 5B21A 4K71C 5IF0A 3VXQB 3TV3H 2VISA 3MCLL 1NLBH 1QBBA 1ZLSH 3E6HB 5IBUG 3WKMH 5DXWA 4MAUL 5HI5C 3IF1A 3KYNA 5AD0B 2NY6C 5J6GA 3A6BL 4MD0A 1I9EA 4HAFA 3RGVD 3EJJX 1I7ZB 1SY6L 3UO1H 5HHME 5KSBF 2X4PA 5JIHA 5E4EC 1VACB 1WCQA 2HT2C 4PPTA 5KG9A 3ZE0F 4L8SA 3MA9H 2XY1A 4PJAB 4AQOA 4JFHE 1UM4L 3V8CA 4H1LB 4RFEA 4OZGF 1WCBA 5DWUH 5I9QC 2R9HD 1AGEB 4KVNH 4BFIA 2VC2L 5C71A 4RMUA 4LLWB 1D9KC 3FAXA 4LHJB 1MPAH 1WT5C 1WVZA 2NX5D 3TV3L 3MRPB 3NVQA 1T6VN 1S5IL 3RL1A 3GKWH 3ZYIA 3CXHJ 2R0ZH 4I48B 3KHOA 3BDBA 2NTSP 1MCWW 4K3JH 3HS0B 1IC5H 2JIXD 4Z9KB 4BFBD 3UO1L 3VA2C 4X83A 4P4KD 4FMKA 5DJCB 4MQTB 1R3HA 4PGEA 2QTEA 4Y5VA 4MNQB 4OZFB 1E4XH 2FB4L 3ALPA 4QRTB 2OQJB 5CJXC 4Z7UB 2N7BA 1WIUA 1DBML 4P46D 3MREA 4NNXB 5A2JH 4KVNL 1XR9B 5FGBA 2GJZA 4E5XA 1RUKL 3NH7H 1IGFH 4NQEA 1MPAL 3C87A 3IDYB 1MREH 2UWEA 2WWMC 3PHSA 2F74A 3LPGA 3RUGB 4OQ1A 4MJIB 1RK1A 3BVNB 2PO6C 5E03A 1XCTB 4N0FB 4HWBA 3AVEA 5FHBH 4X9BA 3VXQA 1OTTD 2PYED 4K3JL 4P2RD 2ATKB 1IC5L 2BRQA 4LCUB 5TQ2H 3E6HA 3U30C 3BFOA 3IDJB 3U79A 5IGXH 5F72S 2EDQA 2P5WB 4PJHB 5AD0A 5DFWH 3HUJE 3F7YB 2YD6A 5E7FA 1C5CH 1E4XL 1I7ZA 2OL3A 1WWWX 2A6DA 2EDYA 5ACZB 4RFOH 5D8JH 1HCFX 2AK4D 4S1RL 4R6UA 5TF0A 5DO2D 2XWBB 5LVEA 1FVEB 4GQ9L 4PJAA 3MOQA 2OZ4H 1IGFL 4XP6L 1MJ8H 5CILH 3GZKA 4H1LA 1T7XA 4HLZG 1XF1A 4Y4KB 4M8VA 1B6DA 2BHUA 4LLWA 4A2LA 1WWBX 2NW2B 4EUPH 1T83C 1CXIA 2GY7B 2AJZA 4LGSB 1EHLH 4R8WH 4ZPTB 2XZQH 3MRPA 1FYHB 4MHHG 5IJKA 2XNAB 3VXOB 4I48A 3ETBF 4MXQC 2WNGA 1QRNE 4NO3A 3HS0A 1C5CL 4YHYB 4F58H 3AS0A 5IESH 5D8JL 3QI9B 5MP6H 5DJ8B 4RNRB 1CLCA 1I1AB 1WBZA 5GS1B 5DJCA 3RDTD 3SE4C 2WIMA 2OZ4L 2Y25A 1UA6H 4OZFA 5CILL 4NWUH 3CK0H 4QRTA 4XVSH 2OQJA 1F4HA 4PJBB 4Z7UA 3QPQC 4LCIL 4DW2H 3JWDL 3RI5K 1QLRB 3MZGB 4NDMB 4NNXA 3VGAC 3WO3B 4IDLA 4Z7QF 3EIFA 4OZFG 3RNQA 1DANU 1LD9B 3GMQB 4JO1L 4XAKD 3ARGD 2APTA 3UCRA 1KPRB 1EHLL 4R8WL 4UT9H 5AYUL 3RUGA 2XZQL 4MJIA 1NBYA 4MDIA 1EFQA 2H26A 1XCTA 1HQ4B 4LVNC 4N0FA 4OKDA 3FQNB 1HINH 4M93C 1FRGH 1RZGB 4I1NB 4IOIB 1UH2A 2ATKA 5IESL 3SDCC 5MP6L 1BJ1J 1S7TA 4AIZB 1NANH 5DA0B 5E7BA 3BH9B 2P5WA 4PJHA 2E3VA 4O2CB 2RBLA 3MFGB 2DLFH 3F7YA 4N1CA 1UA6L 1OL0A 4NWUL 4PJ8B 5ACZA 5CJ5A 4MQSB 1A9BB 1YYLH 3P9WB 4G7VH 3REWB 2XWBA 3OF6D 1FVEA 4JPWH 2I60H 2IG2H 4C4KO 2W60A 4IMKC 3ARWA 2V2XB 4UDUB 3ZT6A 4UT9L 4Y4KA 5A3ID 1U6AH 2MQCA 2J8UB 1KTRL 3QDMD 4D94A 2WSKA 2FHBA 2NW2A 35C8H 3W5MA 1WITA 3V7MA 3NIFF 3SKUD 5L7XH 4Y0GA 3MJ7B 5IFJB 2VTFA 3FCTB 5F9DC 2XNAA 3VXOA 2N4IA 3S35X 5FUZH 1OP3K 3OHXB 5CJQH 1HK6A 5IROA 2DLFL 4PJ9C 3U4BH 4MAYB 2LTQC 3D3VB 4RNRA 5DJ8A 1I1AA 5GS1A 4BZ2H 5KZCD 4JPWL 2I60L 2IG2L 4PP2B 3LPFA 2IBGA 4PBXA 2EXWD 3BPLB 1QLRA 1U6AL 4NDMA 4QHNB 4HG4J 4P5TD 1QSZA 1TITA 2FJFB 3MLSH 1LD9A 3GMQA 2N56A 5HHXH 35C8L 3QAZB 4Z77B 1A6ZA 2D2OA 1KPRA 4ODSH 4BUGA 4JQVC 5L7XL 1II4E 3BD4A 1IQDA 4HIJB 3DI2B 3SGDH 1YEIL 1Q94A 1TMCB 5D2LE 1B0RB 1HQ4A 2IFFH 3FQNA 4JVUA 4KI5F 3NBNA 2DQDH 4WJ5B 5C08B 1RZGA 5DUPL 4IOIA 2HTKD 2CRZA 3MRCB 3U4BL 3ULVF 3MYJB 3D0VB 4AIZA 3RGVC 1OWRM 3BH9A 3LKRB 4O2CA 2Z8WC 1TIUA 5EH1A 2BDNH 5FOBB 4PJ8A 3UTOA 2D7PA 4LBEB 1OGAB 1A9BA 5I1KH 5CIPA 3REWA 2R9HC 3E8UH 2I26N 3L3IB 2V2XA 4UDUA 4ZUWB 4ODSL 2R1WA 4KTYA 1X3DA 4WI8A 2J8UA 3HG1B 1ZEAL 3MRNB 4Z7NE 5FGRA 2IFFL 3WNNA 4O5LH 2D31B 2DQDL 1OP3H 5CSGA 2Z8RA 3EFFB 1UWXH 3MJ7A 4Y16A 3EDFA 5IFJA 32C2B 2KKQA 1C7SA 3FCTA 1IGML 2WWKT 2VUOA 3RIAK 2H45A 2OS7A 3OHXA 4Q2ZB 1B4RA 4P4KC 2BDNL 2KL6A 4MAYA 4K8RH 3D3VA 2NZ9D 1F90H 3UTSA 5I1KL 1F2XK 3QDGD 2FJGA 1GSMA 3FZUD 4P46C 4YE4L 1HQRB 3E8UL 3RBGA 4HWBH 4Y88A 4PP2A 4QRRB 2B7DT 4JG1L 1NGQH 1XCQB 4QHNA 3MX0A 1KYOJ 2FJFA 3FTGB 4X7TB 5H2BB 4O5LL 5DJXB 5JR1L 5KOMC 4HIJA 5IEKB 2OL3H 2X4TB 5KAQG 4GOSA 4GKNB 1B0RA 2ICWA 4L4TE 4WJ5A 5C08A 4BZYA 3E3QC 1Q9WB 1QKZL 3MRCA 3TVMD 3SY0B 1XF5B 4O00A 3MYJA 2KDGA 1ONQB 1NMBH 3DROB 5I30H 3LKRA 3RL2B 5J12C 1A7OH 5EU3B 4HWBL 1HHHB 5DO2C 5FOBA 3OKYA 1JGVL 2FIKB 3I6KB 1NGQL 1OGAA 1AO7B 5F7FA 5IQ9B 4TUJB 3L3IA 1QTYT 3QUYD 4ZUWA 1EPFA 3MUY1 1H3PH 1NL0L 2IQ9H 2BNRB 3EDKA 4JVWA 1NUNB 2OL3L 3HG1A 4GW4B 4Y19B 3VFOB 1DCLA 4AENB 4Q6YA 3O6KL 3WUZA 1PEZA 2X9WA 2XN9D 4M4RA 2D31A 3DHJA 5GZND 1ZMYA 3EFFA 1BJ8A 1KB9K 2UZYB 4R2GB 4OZFH 1ERNA 4DKAA 3O11B 5GGSY 4FFYH 5HYJE 1JTTA 5J6HB 4XNZC 1VFBB 5GGVH 1NMBL 5I30L 1LE5B 1P4BL 4Q2ZA 1A7OL 4WU7B 5C07D 2NMSA 3RDTC 1NPUA 3KLAA 3F7RA 1SYVB 2FBOJ 1JZ4A 4CU8A 4F9PA 4BQBA 5I0DA 1OVZA 1ZVYA 4TQEL 1HQRA 1T2JA 4X6CA 4QRRA 1FGNL 2YEZB 1A5FH 2CDFB 1N5YH 1H3PL 3QIUD 5IVOA 4V1DE 1XCQA 3N1PC 3ARGC 4FQXD 3BYYA 3ZTNH 3DRTB 3CH1B 4XX1G 1L4IA 4QNPE 5JDSB 4HH9B 4X7TA 5I76A 3K46A 4BELD 5H2BA 5IMOB 5DJXA 1I8IB 2WUBL 3QNYB 5IEKA 4FFYL 4RIRA 4GKNA 5CGMA 5GGVL 2X4RB 4YXKH 1DQLH 5ALCH 4Z7VB 4P3CH 1QSFD 3KLSA 1UZ6F 4BQ6A 1Q9WA 5K9KB 3D39B 1QR4A 1ONQA 3MXVL 3DROA 3KYKH 3RL2A 2CMRH 4BM7A 3RWDB 1HHHA 1A5FL 1BLNB 1NCWL 2FIKA 3I6KA 3WFHB 2ERJC 1AO7A 5IQ9A 4CRPA 1BHGA 5A3IC 2Y4SA 2EDKA 4BFGA 4K2UH 1A02N 3O2DA 1QFOA 4S10A 2BNRA 2E6QA 2ATPA 5I18H 4PIRF 2BY1A 3I2CH 4ZTOH 4GW4A 4HXAL 2PKDA 4Y19A 1ORSB 3VFOA 1HH9B 2XA3A 4AENA 2Q86A 3WKNA 1DQLL 2VZ1A 3SJVB 3PQYB 3QWQB 1AHWC 5FYKU 2ZUTA 4L4VB 2A9NL 3O11A 2VR4A 3PJSB 2A6IB 4NO0D 1AGDB 3CU7A 4HPYH 1JMXA 1VFBA 3QQ9D 2IANB 1FYTD 3KYKL 2JJSC 4KU1A 2CUHA 3B43A 3OKNB 2P5EB 4WHDA 1JRHH 3VXUE 4X4YA 2X4UB 1SYVA 4BK4A 3QXTA 3RGHA 2I9TB 2EXWC 2VO5A 5E70A 3LRGA 1CTNA 5CKGA 1HYSD 4H8WH 4P5TC 1DSFL 2YEZA 4K2UL 4LMQE 1BPVA 4XCYB 3P40A 4OB5H 5I18L 3DRTA 3I2CL 2D4DA 3CH1A 4ZTOL 5I19L 5EBLB 5JDSA 4HH9A 1MHEB 2YC1B 1S7SA 4NQCE 5EUOE 2PF6A 5IMOA 1BQUA 1BBJB 3OJVC 4ZFGH 1I8IA 3QNYA 1F00I 4HPYL 2UVFA 2HTKC 1T89A 3O0RH 1R3KB 2X4RA 4WI5A 5CIPH 4F8QA 4Z7VA 4EEEA 3N9GL 3WS6C 4ZG1A 4I0CC 5K9KA 5FKPA 4Z0BH 3JVGC 3FFDB 3P9MB 4I3GA 3N50A 1CQKA 1KBGH 2HFFB 3UYPA 1DLFH 1W2KT 3MGTB 4LCWB 2M8XA 5SWSE 3WO4C 3PABB 3O6LL 4HLJA 1EBAA 3CLEH 4H8WL 4F37K 1MWAB 4E0RB 4O9HL 2Y5EA 3RWDA 1J0ZA 2RJMA 1E0OB 1OB1B 3ROLB 1BLNA 2ENYA 4KRPD 3H9ZA 4HF5H 4PJIF 1A3RH 3WFHA 3MRBA 2ZG3A 1PG7W 4QY8B 5FYLH 4UQ2B 2Q3AA 5IIEA 2VZUA 4ZFGL 4Z7NF 4UU9B 4Z95L 4UMGA 3CFCL 4G9FD 4WGVB 3NIDE 2B1AH 1ORSA 3ARDA 1HH9A 1B4JL 3KPSA 5D7IA 4PRHE 2NY6B 4LLUB 3SJVA 1YEFH 3PQYA 4BH8B 2W1NA 4Z0BL 4L4VA 3PJSA 3QEQD 1BJMA 2A6IA 1AGDA 1KBGL 1DLFL 2IANA 3AUVA 4WEBL 1HDMB 2NZ9C 3CLEL 2P5EA 3TF7C 2WK2A 3FZUC 4KROD 5E2VL 3WBDA 4JFEE 4DOHB 4HF5L 3BZ4B 2QSTA 1A3RL 2X4UA 3OX8B 2I9TA 2HKFH 4F7EB 4MQXD 3SBWA 4PJFB 1LWRA 4RAVB 3IYLW 4K7PH 1NEZB 3NCEB 1DANT 2GI7A 4OZ4B 3H8NA 2X1XR 2B1AL 1MHEA 5D7SH 5L0QB 4HWUA 3VD5A 1SM3H 1BBJA 4K23H 4LHUG 3FMGH 1T7YA 5IBTH 3RWHB 4DQOH 4QTIH 4YBQD 3CU1A 3TVMC 1Q38A 1R3KA 1S7RB 1NCTA 3DURA 2X4NB 1TQCB 2Y7QB 5D71H 3P9MA 4IEFB 1MIEH 3DMMD 4YHZL 2HFFA 3MGTA 4LCWA 4PRIB 3PABA 3RY5A 2HKFL 5M95B 3PWUB 1MWAA 4E0RA 4F8TA 1O7VA 5AZEH 2R2CA 1YJDH 3RZCB 1OB1A 3ROLA 2YUVA 3SE8L 4LLMB 2AJUH 4MNGB 4DGYH 4BKLB 3QCVH 2JCCE 3RTQB 4LP4A 1NC2D 1X5IA 1DEEB 4JREC 4QY8A 4AY0A 2XOTA 4UQ2A 1S8DB 1JF5A 3P0YL 4LOUD 1SM3L 4K23L 4UU9A 2A9ML 3FMGL 1CXHA 2GT9A 5BZDB 5IBTL 2FO4B 4DQOL 4JM2B 2FYYB 5GZNC 1CLZL 1RUAH 4WV1B 3HFMH 4QTIL 1AQKH 1RZFH 3ZHKA 1FFQA 4FTVB 4WI2A 4BH8A 2DM7A 1BIHA 5D71L 5B39G 1MIEL 3TPUB 1QBAA 3QUMB 2AJ3B 1C08B 2V2WB 1CFQB 3UEZA 5T3ZE 1HDMA 3LY6A 1CDHA 4JHAH 3GM8A 4NYLA 1TXKA 4UILL 4WFFE 1SBBA 4WFED 4C57C 2AJUL 2R4SH 3QCVL 1RQ5A 2E8ZA 4KUCD 3QIUC 4GMTH 4M3JA 2VQTA 1YMME 3S4SA 4F7EA 1WT5A 4FQXC 3Q6GL 4PJFA 4RAVA 4OIIL 3TA3B 4TNWK 1NEZA 1YEJH 3JWOH 4OZ4A 3T0AA 3S4SG 3BYTA 4U1GC 3T2NH 5GIRB 4J6RH 3P11H 1RZFL 4R97B 3NMEA 1QFPA 5IG7B 2Z92B 4BA8A 5DD1H 4X6EB 4YBLB 1GC1C 4HX1B 1RPQA 4POZD 5C9JB 3CSPA 2JJVA 3BKCH 2X4NA 3I3BA 1N4XH 2PW2B 5CJXA 2Y7QA 3VGAB 2R4SL 1IZJA 3O2DH 4BYHA 1HH6A 5BCAA 2BVPB 3DVFA 5E8OB 3DARA 5A2FA 2G2RB 3RZCA 3NA9H 1XGQB 4P2OD 4LLMA 4MNGA 4LSPH 1YEJL 3JWOL 4BKLA 2PO6A 4PJDE 4QLRA 5CZXD 4FQPA 1DEEA 3T2NL 3C5JB 4NNPH 4B5EA 1S8DA 1EBPA 3BJLA 2GJJA 3MRLB 5BZDA 4PRPB 2FO4A 5DD5H 4JM2A 2FYYA 1WFUA 3DX9B 4WV1A 2EIZA 1KCRH 3WUWG 3TIEB 9CGTA 5K9QG 1QFHA 4XPHH 4HK3J 5E8EB 2IJ0C 1MCOH 2WLYA 2DTMH 2CH8A 4GW1B 3GIZH 3H9HA 5ALBL 3KLHD 3QQ9C 4FTVA 4K3HA 1N4XL 5IWLC 1MFDH 3ARVA 4UAOC 4KVCL 3PGFL 4TPRH 1P6FA 3TPUA 1F6AB 3QUMA 2AJ3A 2LE9A 1CFQA 2C4XA 3ZKSD 4DFIA 2FX7L 4MD5B 5BXFB 3NCYS 5GXBB 4I0KA 4RBPK 4WI3A 3NA9L 1HYSC 2EDHA 5TE4H 1F4XH 5ANMB 2R23B 4XI5D 1MRDH 4RAUB 2ADGB 4NQXB 4NNPL 3OGCB 2B20A 1T83A 4X5XB 3MRGB 4LPTA 4F9LC 3GSNB 4U1JB 5FGSA 3EGSB 4MJ5B 1RSFA 5EUOF 1FQ9C 2F58H 3S3PA 1ZT7B 5DD5L 4NKIH 3LKQB 3M17B 1U3HB 3MC0A 4AEIH 5GIRA 1KCRL 1V7ML 4AIXA 1MCOL 3CXDH 2DTML 4ZUUB 1I9JH 3GIZL 4PJ9B 1X5YA 5IG7A 5TDOB 4OT1H 3PWVB 3LKSB 4M43H 2Z92A 3T4AB 4TPRL 4X6EA 4YUEH 4HX1A 5C9JA 1DL7H 2ZUVA 2CRIA 2B39A 3LS4L 4V2BA 1BQLH 2PW2A 1A14L 1E4KA 1YY8A 3DXAD 5B3JF 2P47B 4HBQA 5TE4L 5J4MA 3O9WB 2OK0H 4M5YL 4K9EH 1MRDL 5T5NG 5FO9B 4FQCL 4GH7B 2VWEE 4KRPC 1LEKB 3IRZA 2BVPA 5EZJB 1ZHKB 3VFNB 3NFSH 4FQ1L 4UQ3B 3ILPB 2G2RA 1K6QH 3HI5H 1XGQA 5HGDB 5BMFH 1LEGB 1G0XA 5DJZB 4GBXD 1UVQB 2D9CA 4NKIL 2BHZA 4WW2C 4AEIL 1QYGH 3C5JA 4QHKI 2B0SH 4NO5A 3CXDL 1J1XH 3NIDF 1I9JL 2QSVA 4OT1L 3MRLA 4H88L 4M43L 5F9JB 1CDGA 1KJ2B 3DX9A 2YMXH 3WNKA 1LGVA 1MJ7H 2NY3D 4F7PB 3TIEA 2WBWB 1DL7L 1L7IH 5E8EA 4GW1A 1BQLL 4H26B 1U92A 4RDQG 4N0YH 4RBPH 3QA3B 4APQD 2OK0L 2AXHA 4K9EL 1IJ9A 4KROC 4QTHB 3G5YB 3SDXE 4MD5A 4WHCA 5BXFA 4RGNE 3NFSL 5KVFH 4PG2C 4YDLC 8CGTA 4ALAH 5IFHH 4XBEL 1KC5H 1K6QL 1UWGL 3HI5L 4MQXC 5BMFL 1T1YB 3IAGC 1TETL 2NX5B 1FFOB 4U6VH 4WI7A 1QSEE 5ANMA 2R23A 5I8KH 4RAUA 2ADGA 2C3WA 1QYGL 2AJSH 1EA9C 1O0VA 1KFAH 1TVDA 1IKFH 4X5XA 2B0SL 3MRGA 1S78D 1J1XL 3GSNA 4MJ5A 1DBKH 1XGYL 3TYFB 1ZT7A 5BVPH 2QBWA 3LKQA 2YMXL 1U3HA 1MJ7L 2P46B 4GMSL 3PL6B 2FJHB 1LO0H 2VNCA 2EH8L 4ZUUA 4PJ9A 4YBQC 4YGAB 5TDOA 4L9DA 3PWVA 4NJAL 3LKSA 3T4AA 1NGZB 1FBIH 4P46B 3DMMC 4KI5D 4XCCH 2V2TB 4I0PD 3STLB 1VADB 4ALAL 3CFKB 2LABA 3HUJB 3HNSL 4OCMC 5FYKL 3O9WA 4U6VL 1OARH 2FX8H 1NMAH 3ULVD 5FO9A 3K2UH 1I3VA 5KW9H 4L3ED 5CP7B 1LEKA 2AJSL 4HPOH 2VZTA 1KFAL 1RJZB 4GXVL 1ZHKA 5EZJA 3VFNA 3BH8B 4KDWA 4UQ3A 4JQVA 3ILPA 4NT6A 5HGDA 3G9VA 3IS0X 1LEGA 5DJZA 4EI5D 4NN7B 5F7NC 1UVQA 4LOUC 4P2RB 2XTJE 5DEFB 5J13C 1KLUB 1LO0L 3CSYA 4JKMA 4QRSB 1MHPH 1MWAL 2BSSB 1LO4H 1RJYB 3AFLA 3DO7B 3KJ6H 3HTLX 2QKIA 5J12B 1FBIL 1FZOB 2XYCA 5CJBA 1B90A 2ADJB 4XCCL 4D0CB 1EXUB 2K3TA 3K4AA 2DI9A 5C0DA 3WEXB 1JHKH 5LKNA 1Z2KA 5FDYA 1OARL 4JFPA 4Y1AE 2NYYD 2FX8L 1NMAL 1U8NA 5AWNH 3G5YA 2BVQB 5KW9L 4X4ME 3QDJD 3VFWB 4OCWL 4U6YB 1U9KA 1T1YA 1SJVA 2NX5A 3IVKB 4P9ML 1BD2E 5HGBB 1FDLL 3AREB 5CP3A 3WN5B 5DR5H 2NY7H 1IRAY 1MHPL 5I74B 3FO0H 3TYFA 1LO4L 2CR6A 1OCWH 4GAGH 4XNZB 3KJ6L 3BPOB 2BFVH 1IKNC 5EU6D 1RMFH 4WTZG 1OW0C 2FJHA 4XC3H 3SDAB 5EZLB 1VA9A 3T4YB 3HC3L 1UACH 4ZOBA 4POZC 1MOEA 2X10A 1IMHC 1R5WB 2YR3A 3DX7B 5F8RC 3KPLB 2P44B 4P46A 4JDTH 2V2TA 4HV8B 4JFQB 3STLA 5FECB 1VADA 4EI6B 3RVWD 5DFTA 3F58H 3HUJA 4NM8H 1JZ8A 2DI8A 2JK5B 1QUNA 4P2OC 1NGXB 3DVNB 5CP7A 1ZHLB 4KTEH 1RJZA 5GISH 5CZXC 3BH8A 5DR5L 2NY7L 4JPKH 4PRDB 3B6SB 3QUZB 1WSST 1X4ZA 1OCWL 1NSNH 4P2RA 4GAGL 2NQCA 5DEFA 3K4DA 2FH6A 5FUCC 2BFVL 1P6AB 5JW3H 4FXGB 1KLUA 3UTZB 3RAJH 4PS4H 4QRSA 1CDBA 4LSRH 1UACL 3NABL 1FE8H 2KQMA 3CFBB 1YEEH 1RJYA 4ETYA 3KLHC 2R39A 3DO7A 5F97E 5I1GH 5FDWB 4NUGH 2QL1A 2IBZY 5AG8A 1FZOA 3B2VH 2ADJA 2DDQL 4D0CA 1EXUA 5FYJE 2J88H 3F58L 5BQ7B 4NM8L 3WEXA 1CF8H 1RHHB 1U58A 3A6CH 3OSKA 5D2NC 1BEYL 1RD6A 1TZHB 3T3ME 4JPIB 2BVQA 3ALWA 1MCQA 2VXVH 4XI5C 3SQOH 4MD4B 2CLRB 4U6YA 5LQBL 4JPKL 3JUYA 2Y36H 3HNTH 3OAYK 4TSCL 3V9FA 1OLZA 2RR3A 1NSNL 3D6GA 1MCIA 5IOPB 3M1BA 3PUCA 3QDAA 3QUML 1G6RB 3V52H 5HGBA 5JW3L 3AREA 2FX9L 3WN5A 2L7UA 1J86A 1FE8L 2CJUH 1PKQA 1T1WB 4CVUA 5CJOL 3TCXA 5I1GL 2QLVB 4NUGL 4LFHG 4G8GE 3WXVH 1TZIB 3WFDH 2XWJA 5EZLA 4LDEB 4FXKB 5KZCB 4D2NA 5C6TH 1JGUL 2PTVA 2Y07L 3MUZ1 4J4PD 3DX7A 3KPLA 4FA8A 3JXAA 5B3NA 5I66B 4FHBD 4FQJL 3O4LE 2VXVL 3KNBB 3NN8B 5L6YH 4HV8A 4X6DF 4EI6A 5MENE 2Y36L 1IEHA 2XZCH 4GXUN 5IB4A 2XI9A 1XMWA 4N0UE 2JK5A 3BX7C 1NGXA 1ZHLA 4GBXC 3BD5A 4WFHE 4RX4D 3V52L 2NY0D 2D9QB 1P7QD 4HULB 4PRDA 2CJUL 3B6SA 1JFQH 3QUZA 4HMDA 3DO3A 4OLWH 4Q9CA 4OBRA 5L8JB 2A73B 2ZNXA 2J8HA 1A7RL 3WXVL 5F1IB 1TJIH 4FXGA 1AI1H 1FL3B 3CAFA 3A6OA 3SKNB 3UTZA 2NY3C 1FZMB 3CFBA 5DQJB 1H3WM 5C6TL 1J1PL 4N1EA 3PE9A 1AJ7H 5FDWA 1N2RB 3WO4B 3G5XA 1KV3A 3PXHA 3OB8A 3AS1A 5GRUL 4APQC 4PJGE 5L6YL 1CIUA 2IALB 3OF6A 4WO4B 3ULUL 4I3RH 5BQ7A 2PW1B 1RHHA 1TZHA 1PBYA 3HN3A 3OAYH 4JPIA 3ZKXC 1MHCA 3EJZD 5BS0D 5CFHA 1J11A 3I50H 1QFUH 3SO5A 3U7WH 2NY2D 1UM6H 4MD4A 2CLRA 5KOVC 5CMAB 4WWKD 4XC1H 3V6FB 1JFQL 3CDGB 1S78C 4OLWL 2GK0B 4MXVE 4NN5B 3BPCB 5I1CH 5IOPA 3WNOA 3E2HB 1G6RA 3N1FC 1TJIL 3ME0A 1AI1L 3OKKA 5K59E 1MCBA 4JR9L 1T1WA 1YPZE 4XNMB 4ZYKB 5HY9B 5L8LB 3QQNA 1MQ8A 3BESR 1QBMH 1T7VA 1TZIA 4ODVH 1WV7T 3QDGB 2WP3O 1BECA 4FXKA 4OUUB 4I3RL 3RX5A 4F3FB 3W0WE 2VIRB 3K7UA 3GSNL 4L4TB 5E4IA 4KI5C 4NQDE 3ZE1E 4I0PC 3SE3A 3DNKA 3BISA 3GNMH 4PJEE 4N0CD 3I50L 1QFUL 5I66A 3KNBA 3NN8A 3U7WL 1UM6L 3ULVC 3HR5B 4XC1L 4CVXA 5HPOA 5E9DD 3CDYA 4MXWL 3A67H 4C59B 1T21B 5I1CL 1WTLA 2AABH 4I3SH 4EI5C 4PJ7F 3H7LA 3BGFC 1G9EA 1KG0B 5F88B 4OD3H 2A73A 4OD2B 5F1IA 3TBTA 1FO0H 1FL3A 4XGZB 3SKNA 1FZMA 3QRGH 5DQJA 3JVGA 3F8UB 5GSVB 2CLVB 4HCRA 4BH7B 3GSOB 3GNML 5A2LH 4DGIH 2NYYC 3C8KA 2IALA 4WO4A 5CP3H 4NM4L 5D4QA 3TH2T 1KXTB 2PW1A 5CWSB 3AAZB 3QUYB 3GJFB 5CHNB 4TTGA 2XQBL 1DE4B 3A67L 4JREB 2MQ0A 1KJ2L 3LN5B 3AY4C 2AABL 1WAAE 3VXRD 4I3SL 1AD0B 1G0YR 2H9GB 5D7LE 3FL7A 3V6FA 1WIPA 2XN9B 3CDGA 3BD3A 2GK0A 3OQ3B 4V1DB 4LRNH 5FM5M 1FFRA 4KH2A 3QRGL 1I7TA 5C0FB 4XNMA 4ZYKA 5HY9A 4Y5YB 3V6OC 3NIGF 1N6UA 3HB3D 4DGIL 3QDGA 2ZCKH 1YNKH 3I02A 4OUUA 4F3FA 1BP3B 3BZDA 4L4TA 2VDNL 5F3BB 1DUZA 2HTLD 2NR6D 3RVWC 1QSVA 4UBDD 4JRYE 3RU8H 1AKJB 4AQ1B 1HHKB 4PY8I 3HR5A 4CBPA 3EOTL 1DQQB 1G7IB 2EYTB 4U1GB 2C7UB 1T21A 5J56B 4HDIB 3MJ9A 1FIGH 3PWPE 4GRMB 2BJML 4LKXB 1MLCB 1DBJH 2YKLL 1KG0A 1X5KA 1MFEL 4YHKH 5F88A 1M7XA 2CRMA 2EZ0D 1UEMA 4N8CH 1GVIA 1YMHB 4OD2A 5C9KA 1J8HD 4XGZA 2ZCKL 2IBZX 1YNKL 3RPKA 4M8QB 1GL4B 2X2YA 5IMMB 1MHHB 5GSVA 2CLVA 4UT6H 2BVEA 3UTTD 4K55A 2AVGA 2ZUXA 2VDPH 3GSOA 5D6CB 1DN2A 3RU8L 2FL5B 4XP1L 4XNUH 3KDMB 3UZVB 5FFLA 4ETQB 5FAAA 1KEGH 5CWSA 2DLHA 3ZYZA 3AAZA 3QUYA 3GJFA 1NCUA 4XWGL 1F3DH 1DE4A 1JNLH 1BGXH 1IGCL 3IDXL 1AD0A 2H9GA 5CEZD 2YRPA 5FV2A 1DBJL 4KHTL 4NNYB 2DJ4A 4OAWB 4OKVA 5K9JH 2XN9A 5BOPA 4YHKL 3LOWA 4M1GH 4XHQA 1U8KB 4V1DA 3M8OH 1UYWH 4NO0B 4ZD3H 5CD5C 1DN0B 4LU5H 4LSUL 4ZMAT 2EIDA 5C0FA 7FABH 2YHGA 5TPWH 2K1MA 3QHZL 5C09D 3HAEB 3LN9A 1MCSA 3R4DA 3BQUD 3QCUL 4J4PC 2K7QA 1FFNB 3CH8A 3MLWH 2FH8A 4XNUL 4OFVA 1EIBA 5C0JB 2AXJA 4YJZL 2YD8A 4PJXF 5F3BA 1PG7H 3BOVA 5ETUB 1X4YA 3UPCA 3QXUA 4O58H 1JNLL 1BGXL 3GMRA 4FQXA 2RCSH 1HHKA 3D87B 4X9HA 2YUWA 5ELIA 3B9KD 5SWSB 1DVFD 1SHMA 1DQQA 4FFWD 1HILB 1G7IA 2NY0C 2Q8AH 3EYUH 5D72H 3WJLA 4GT7A 2C7UA 1YUHA 1UT9A 4OJFH 3H42L 4HDIA 3M8OL 4ZD3L 4L9LC 4LKXA 1MLCA 3PP3K 4LU5L 1GZQA 4GG6E 2WINB 2F53D 1I8LA 4GS7B 5I71C 7FABL 5E2UH 4TSBH 2ADFH 1YMHA 1ZVHA 2VKXA 3BIAX 4NBZB 5EDXA 3K8KA 2Y6SD 4HH8A 5TH2B 3MLWL 2PR4H 4PRHB 3U6RB 4M8QA 5SX4H 5IMMA 1MHHA 4PJGF 3DHMA 2VLKD 1PG7L 2H1PH 2YD2A 4W4OA 3D85D 1NUDA 5D6CA 4N8VB 5LBSH 3O4OC 4JQXC 2RCSL 4J3UA 4M5ZH 5D1XB 1HYRC 3ZYJA 1G6RH 1QO3B 3EJZC 3KDMA 3LKNB 4WUUE 1YECH 3ARTA 2NY2C 2Q8AL 3MLVL 2MKLC 4WHTB 1CZ8H 5D72L 4WW2B 3P0VH 4WWKC 3BPNC 1QQDA 4OJFL 5D9SB 5I1EH 3T0DA 4JFEB 1PLGH 3WJJC 4OM0L 4G9FB 1KACB 2ZOLB 3HZKB 1IBGH 4NNYA 5D1ZB 4PFEA 3V4UH 4TSBL 4IIQB 1U8KA 2ADFL 3MZTA 4NO0A 3PWNA 3O6FB 3LKPB 1ZA6B 1DN0A 2PYFA 1MCEA 3PNWA 1FSKC 5IWLA 4CADB 1U0QA 2BVYA 4U1SB 4YZFE 4PY7B 4PJCE 3F6IA 2H1PL 3HAEA 4ZXBD 3O41B 3G9AB 1FFNA 3VH8G 1G6RL 4N0CC 1YECL 2HLAB 5C0JA 3ABZA 5HSFA 3TGXA 1CZ8L 3NCMA 3RY4A 3P0VL 4QXTB 4YHOH 5IHZB 3VD7A 5I1EL 4M62H 1PLGL 2AERT 2FATH 3HI6L 1FH5L 1EZVY 1S7QB 2UY7A 4X9IA 5SWSA 1IBGL 3SEPA 5JORB 1HILA 3PP3H 4NHUB 3FQTB 3V4UL 5CBEB 4M6NH 5JW4M 5L8KB 1NMCC 4HCRH 2VXQL 4ZOCA 5A1AA 4S0SD 5DTFB 2JCCB 1M71B 1MLBB 4F2MB 2WINA 1S9WB 1OAZH 2C3XA 4LASH 4WUKH 1N6VA 3SQBA 3DMMB 1H0DA 2AI0H 5TH2A 1ZA3B 2ZSVB 4PRHA 3S6CA 5JOFB 3T0ED 4G6MH 3OWEA 4G5ZH 3EUUA 1VEOA 4P9HC 5HDOA 5MI0B 5D1XA 1ZS8B 2FATL 1QO3A 3LKNA 1H3TA 3H9SD 3HA0A 4WHTA 4LPVA 3MBED 4WW2A 5E2TH 1FCCA 4M6NL 4NIKB 3AROA 5A16A 4MYWB 4HCRL 4JFEA 1PD6A 2L0DA 4G9FA 1G7MA 1CK0H 3MRFA 2HWZH 1OSZA 2GIYA 1UCBL 3HZKA 4DEPC 2D0HA 1YMMB 1MCPH 1IAIH 4M7KH 4LASL 4WUKL 2VXSH 4IIQA 3MV7E 3HI1B 3LKPA 1ZA6A 4M6OL 2AI0L 3KPRD 3FN3A 3HB3C 3PV6B 1RVFL 1P7HL 1MF2L 4U1SA 4PY7A 3I85A 4G5ZL 4HFWB 1X5AA 3C5ZD 4HHAA 3O41A 3O81A 4U3XA 1SJXA 3GSRB 2NR6C 2V6HA 3MJ9H 3V5DB 5EOQL 1F3RB 3THMH 4UBDC 3WIIL 4OV5B 4NQEE 4RWHA 2HLAA 2UWEE 3MV9D 4LCCC 4GW5B 3QISA 4DAGH 5IUSA 5E2TL 3O8XB 4QXTA 5FK9B 2P8MB 5IHZA 4IM8A 1JL8A 5EBWB 2V17H 4ODUB 1S7QA 3W39B 5J1SC 4OF5A 3WFEH 5TDNB 5JORA 4YNYA 4NHUA 4Z18A 4M7KL 2MTPA 5CBEA 3LIZH 2IH1B 2P43B 1L0XA 2ZKHH 1FNGB 4LCYB 5DTFA 2EZ0C 5F7MC 4PJDB 1M71A 3OKLB 3VG9B 1MLBA 4F2MA 1KGCD 3F7QA 3RNKB 1HHIB 1I9RL 1S9WA 4JPVH 1U2CA 5CJ8A 1KIUA 5ITBH 2E7MA 4XAWH 3GJFH 3C2AH 4R4BB 3R06B 1V5JA 3DMMA 3VI4E 2ZSVA 3R8QA 1RZ8B 3WHE0 3MJ9L 4PJAE 3THML 5BJTB 3S34H 5JOFA 3FB6B 4DAGL 4OFYD 5IMLB 5IB5B 1KUMA 4P2OB 5BW7C 1PGRB 1EK3A 3EDDA 2V17L 3FO2B 3K2MC 3CMGA 3C8DA 3L3DB 5HYSA 3WFEL 3NACH 1G9NC 4L8CB 4TVPD 3PG2A 5FA3B 4X8JB 3NZHH 2DQEH 4XB7A 2ZKHL 1F5WA 5JOPE 5HYSG 1BWMA 1WBXA 1DQML 2CIIA 3PIQB 5ID0B 4Z8FH 4B41A 1YMMA 1MVFA 1EUTA 4XAWL 4G42B 5DJYB 5C0AE 1G7JB 3HI1A 4PTTB 1RIHH 5H8DA 5EB9A 2VLRD 4POYA 5I8CB 5C70A 4XPTH 4CJ1A 3BQUC 3S34L 5D2NB 4ZPVA 4Z7UE 4HFWA 4XHJD 5IHUH 4RZCB 2R8SH 4U49A 2VOTA 1UQSB 4KKCD 3I75A 5F7WC 4OV5A 3MJ8B 1GRWA 4PRBB 3NACL 3GUTB 2DD8H 4GW5A 1V3JA 3B9KC 2DLEA 5FK9A 1DVFC 2P8MA 4FFWC 3NZHL 5EBWA 2DQEL 4YH6A 3V5HB 1GC1H 4ODUA 4NC1E 3W39A 1JI1A 3MGOB 5TDNA 3BP4A 4MA1C 2EDWA 2DIJA 1ODAA 5C1MB 2IH1A 4GG6F 3KPOA 3Q2CA 1IKNA 1G7PA 2V7HA 1FNGA 3P30H 5F7LB 3OKLA 2P5WE 4PJHE 2VZVA 3RNKA 1ND0A 4OGAD 4ZTPH 1HKLH 4R4FH 4XPTL 2Y6SC 4S2SB 4QHKJ 1BFVH 4U0RB 4LL9A 3K74B 4R4BA 5IHUL 2R8SL 3R06A 4NOFA 2W0LA 1RZ8A 5FKAB 5GHWH 5E95B 4LLYB 2DKUA 4JN1L 3FFCD 3LD8C 5BJTA 4K7FB 4G7YL 3JV5A 5IMLA 5IB5A 4P2OA 1M7IB 2YZ8A 1GGCH 5HHOD 2BSRB 4YAQB 3T04D 5TF1H 1CVSC 4U7SA 3FO2A 4JO3L 1A1OB 2FECL 2V5TA 3TNMB 4JFZH 4WFGD 4KJWD 3REVB 3L3DA 4UTBH 3SDXB 3V4PL 4C55A 3H3BC 1T3FB 5JUEH 2KUTA 4L8CA 1S7UB 3L5XH 4GLRI 1VFOA 5FA3A 4X8JA 1H15B 3H7BB 3IXTB 2NY5C 1QSEB 3P30L 2NY3B 5ID0A 5D7KD 4JO4H 1JYXA 43C9B 4ZTPL 1HKLL 3IJHB 4R4FL 5DJYA 4OF7A 4QF1B 1G7JA 4PTTA 4YZFF 5F9AC 4FOMA 2RGSA 4WI4A 4ZXBC 5GHWL 5IV2B 5I8CA 3RWGB 1CGXA 4BSWB 3MXWL 5D2NA 1OD7A 1KT2B 3SKOA 4RZCA 4JGMA 1GGCL 4WNQB 5TF1L 1UQSA 5F7EH 5DVMA 1PZUB 4JFZL 3RI5F 3MJ8A 4PRBA 1X7QB 4UTBL 3BKMH 5JUEL 3BMVA 5ESVB 1EJOH 1GAFH 3RIFK 3G04B 3DSNA 4G8EB 1QVOB 3V5HA 3GSQB 3I3EA 4PV9B 1V3KA 3DI3B 4JO4L 3MGOA 3R1GL 4GUPB 1LDPH 1D5ZB 1I1RA 4KDTC 4ONHB 1JWUB 2YRLA 3EZ8A 4I9WD 4X80L 1I1YB 4OGYH 4OFIA 2DM3A 4R0LC 1MFNA 4OZHE 2XTJB 5CKAA 2NXZB 3TBWB 3NZ8B 2NY1D 1ZHNB 4S2SA 5DI8B 4NHCL 2F54D 4HWNA 3T0EC 2CK0H 5SWZD 5DK2A 4UB0H 4OBSA 2DM2A 5F7EL 5FKAA 3VFGL 1CDCA 3DVIA 4K7FA 3BKML 5I2IB 3VW3H 2R0KH 4CU6A 1EJOL 1M7IA 1GAFL 4EI5B 5IR1B 2BSRA 4YAQA 3BGFB 3MBEC 4GJTB 2DIAA 4Y1AB 5FF6B 3TNMA 4QCIB 1IC1A 3SDXA 3REVA 2X4QB 3X13B 1LDPL 1T3FA 2DYPD 4HS8H 1S7UA 3LRSB 4OGYL 4NKMB 5FGCB 1JGDB 3B2UD 1H15A 3H7BA 1DR9A 4RISL 3MV8D 1ITBB 5FYLE 1QSEA 2OP4H 3TZVB 4JFOB 1RFDH 3TO2B 4HKJB 1E28B 1BD2B 2RHEA 43C9A 3IJHA 2AS5M 3FT3A 2DQCH 4Z7OE 2YPKA 1WF5A 4HUMB 5CSZB 1UJ3C 1N6QL 3PP4L 4QF1A 3UTSE 2CK0L 3P4NB 3C5ZC 4UB0L 3K3QA 4PTUB 4YXLH 3RWGA 4BSWA 1I8MB 3VW3L 1KT2A 2YA2A 3P4LA 5BO1H 1IAOA 4WNQA 5J06A 4IHOB 1TFHA 1X7QA 4QHLB 2IBBA 2Q76B 4HS8L 2GJ6B 2QADB 3IRPX 5FYJU 5JIIA 3LHPH 3G04A 3C6LB 1QVOA 4G8EA 3GSQA 4FABH 1TLKA 2OP4L 4PV9A 2ED9A 4MX7B 5EU6B 1HHGA 5C08E 4GUPA 4TUOB 4H20H 1BVKB 1JWUA 4J3TA 2DQCL 1I1YA 1F4YH 2YWYA 5DHXB 3TBWA 1B6UA 3NZ8A 4YXLL 1XZ0B 4XZUB 4FQQB 2R0LH 5KS9B 1ZHNA 4G6JL 4ZOAA 4PJAF 1DTUA 5DI8A 5FCUH 3MRMB 3QEHB 4HW6A 1OGAE 3TH4T 4ZNCD 4OIAA 4FZEL 1AR1D 5T33L 1XAUA 2R2HB 3EYSH 4LRIA 2OYPA 1QRKA 4IRZH 1GXEA 1KB5H 3G5VB 4EI5A 3O2WL 5IR1A 1E6OH 4AL8H 1DUYB 1KCSH 4FABL 4Y1AA 4LNRB 5FF6A 2GQHA 4QCIA 4X4MA 3GBNL 2X4QA 1FVDB 4HK3N 3X13A 5F6IC 5T1LD 1P1ZB 3PHOB 4MDJB 1JNNH 4NKMA 1JGDA 2VDRH 3TBVB 4FQLL 3BAEH 3TZVA 2DQFB 1K4DB 3TO2A 1E28A 4LSVH 3CJJA 4LKCB 2R0LL 2IC2A 3TP4A 3P9LB 2ZG1A 2ICEB 5T3ZL 1IGJB 3NAAH 4XNXH 5CSZA 5FCUL 4MCZA 2NLJA 5C0BE 1F4AA 2G5RA 3P4NA 4Z7UF 1ZANH 4PTUA 5EO0B 4XX1E 1IC7L 4G8GB 3QDJA 3PWJB 4X6CE 3EYSL 4QRRE 3WIFB 4KKCC 1I8MA 1CLOH 3OXSB 1XGPB 4IRZL 1K2DB 2ESVD 3MLRH 1E6OL 1MCDA 3S37X 4AL8L 3GHEL 3RUGF 1IT9H 4LVOB 4Y2DD 3C08H 4IHOA 1LILA 3JWNC 2Q8BL 5E2JA 5HHQB 4P2QD 5JPMB 4YBHA 4QHLA 3O4LB 3QDHA 5J11B 2E9WA 3AMKA 4JJ5B 4JEGB 2KBGA 2GJ6A 3DOSA 2W91A 1JNNL 3IKKA 2BSTB 5MENB 2VDRL 3C6LA 4HGKC 3BAEL 2EYRB 5D70H 2DBLL 4MX7A 5EU6A 4LSVL 2P45B 4YQXH 4TUOA 3D0LB 4PJHF 3OG6B 4XVTH 4CN6A 4OGAC 4WEMB 2XICA 2F15A 4XP9L 1P84K 5I1JH 5EIVA 1XZ0A 1W72B 4XZUA 4PRAB 4FQQA 2ZCHL 3SPVB 5KS9A 1CLOL 3MRMA 5HDLA 3QEHA 3MLRL 4HC1A 1AO7E 1B0WA 4PB0H 1X5ZA 2ITDB 2HJLB 3C08L 2CUIA 4FP8L 4P2YA 4ZOEA 1D6VH 1I1FB 2R2HA 2DRUA 1NDGB 2A77H 2O61B 4HJ0D 5J0BA 1T6WA 4HIXH 4ODXB 2CDEB 2OJZH 5L2KE 3G5VA 4KJWC 4GRLD 2CK2A 1UG9A 2R56H 4UV7H 1N64H 1DUYA 1JNJA 1NAKH 5D70L 4LNRA 2IQAB 4MLSA 1A2YB 5I71B 2R29H 1FVDA 2J12B 4YQXL 3AB0C 1P1ZA 3PHOA 4MDJA 5B38B 1BFOA 3VRLE 4XVTL 5ADPH 3GBML 2GK2A 5FXCH 1YEKL 4K3EH 2EDOA 3TBVA 2H41A 3LKOB 1UB5A 4E41D 2DQFA 1K4DA 3C8HA 3U1SL 3WFCH 1G0DA 3UYOD 4DTGL 5I1JL 2G75B 5FHAL 5IW3A 5ISZD 3FONB 4LKCA 4NC2B 1U41A 3P9LA 5ID1B 1IGJA 1KIPB 4OZIB 3FKUS 1YPZB 3QIWB 3WS3B 3T3PE 4PB0L 4PJBF 1UZ8B 5EO0A 2AQ2A 4G8GA 1D6VL 3PWJA 2NY2B 5HJ3B 5ACMA 2A77L 3WIFA 5I8OL 4KZDL 3OXSA 1XGPA 2COQA 3A0OA 4WWKB 1K2DA 2FD6H 2OJZL 3F12B 3W0WB 4QGYA 2R2BB 3BWUC 3LS5L 4NQDB 1N64L 3DYMA 1NAKL 1IVLA 4FS0A 1CDUA 3DWTA 4PJEB 5HHQA 5JPMA 3OKOB 3O4LA 5E5UB 4JJ5A 1PVHA 1TVHB 5DJ0B 1S3KH 1X5GA 2BSTA 5ADPL 5MENA 4F7TB 1ORQA 2VWEC 3BO8B 4K3EL 3IFLH 5D96C 5HHPB 4L29B 2EYRA 1Y6MR 1FSKB 1KCVH 2X05A 4IRJD 3WFCL 3D0LA 4ZO9A 1FG9C 1Y6NR 3UTPD 5DJAB 2NY1C 2OTUB 1A1NB 3QZWG 1OAKH 4ODBD 1R0AH 4U1HB 1W72A 4PRAA 5I15H 1D5IH 4U05A 2OLDA 1KENL 1GYAA 5DD3L 2FD6L 5IP4A 5JQ6H 2ZWLT 3BRGC 1WTGT 2HJLA 4JFFD 4BSVB 1I1FA 4S11A 2J8UF 2P8LB 1NDGA 4XBPB 1MY5A 2O61A 5BV7C 4JCMA 4ONGL 1F4WH 3VXMD 1NMCB 1S3KL 3IFLL 3KPSE 5D7IE 3ZZ1A 4BUHA 5MEOB 2CR3A 3IDUA 2IQAA 1KCVL 3B2UC 3SJVE 5C92A 4W6XB 2E9IA 5B38A 2CIKB 4L4VE 1HE7A 5E1AB 5D1QD 1GGIH 2QR0B 3HC0B 4YFLF 3VFSB 1LHZA 3LKOA 4Z7OF 2IANE 1OAKL 4KUZH 5JMRA 3HMWH 3GRWA 3FONA 5I15L 1D5IL 5ID1A 1KIPA 4OZIA 1KIRB 1CWVA 3NFPB 3QIWA 4JQXA 3WS3A 5JQ6L 5JXAL 2HKHH 4DVBB 5E6ID 2Z8SA 1VFMA 4QHUB 5CGYD 5E8DH 4NZJA 2ENSA 4ZO7A 1UZ8A 5M94B 3C60D 4N5ED 2C3VB 5HJ3A 3TJEL 5T3XD 3LDBC 5DJ2B 4WWKA 3S36H 5IB2B 4IMLB 4IDJL 1F4WL 3RWJB 3F12A 3W0WA 2R2BA 3WJJA 4LSQH 3FB7B 4NQDA 1VSCA 2DQJH 3MODH 2ILLA 2VLJE 4JRYB 1OQOA 1QG3A 5DJ0A 3ARSA 5ESAB 1WEJH 4F7TA 1DEDA 3BO8A 4PY8J 5HHPA 4P4RB 4L29A 5D5MB 5IK3B 4KUZL 3LEYH 5EOCH 1OD9A 3HMWL 3PWPB 3ESVF 1BZ9B 4XP5H 4AZ8A 2EEDA 2OTUA 1A1NA 2HKHL 3B5TA 4LCWE 3OB0K 1R5IB 3BRDA 1C12B 3U0PB 4U1HA 1IEBB 1Q0XH 3FHAA 1AR1C 2DQIH 4GLRH 1ZT1B 1XH3A 3HE7B 4F37F 2BNQD 2A1WH 2MHAB 5E9DA 1A7PH 3CCHB 3OAZK 1Z3GL 4BSVA 2GYSA 4Y5XC 2DQJL 2GUOB 2P8LA 4XBPA 1NANI 4P59L 5LXGH 5F1OB 1X5LA 5GRWA 3VRJA 1MRFH 3OBAA 4NGHH 4QEGA 5CAYB 1Y6KR 1REIA 2AV1B 4LSSH 4JE4B 2X89A 3VXSE 3UJIL 3LEYL 1WAAA 1MFBL 3EOAB 1MSPA 4CDGC 3DYOA 3KJ4B 2CIKA 5F70A 5D7LD 3HC0A 2YOCA 3VFSA 2P1YA 5C0CD 3LEXB 1CDIA 3KS0H 4U2ZA 2VLMD 1Q0XL 4EUPB 4L1DA 5GRVL 2DQIL 3WD5H 3W9EA 4EN3D 1KIRA 3NFPA 2A1WL 2GEEA 1JK8B 4G3YH 3WNPA 4DVBA 1V05A 4QHUA 1I3RB 4X9GA 3VXRA 4R26L 5DHYB 1VKXA 4PJFE 4ZFFB 2H3NB 4MB4A 3QEUA 2VL4A 4Y2DC 5DJ2A 3H3PL 1DDHB 5IB2A 5LXGL 3RWJA 3MROB 1MRFL 2VDOH 3FB7A 4LSSL 4QRPD 5DYOB 1BQHB 3P2TA 4JRYA 5CEXB 1UEYA 1S7WB 5ESAA 3HLAB 2VXTH 3VWKC 3ZDYE 4RA3A 4P4RA 5D5MA 5IK3A 3KG5A 4HC1H 3OB0H 1BZ9A 1MAMH 3GK8H 2GW5A 4WTWA 1NUGA 4M6MH 3WD5L 4QOKD 2X70B 3KYMB 4O51A 4G3YL 4MMZC 3OJ2C 4LLAA 1R5IA 1TCRB 1C12A 3U0PA 3SGDI 1IEBA 1DVFB 1ZT1A 2QSQA 5C3TA 3HE7A 2MHAA 3MOBH 4MA8H 2VDOL 1HNFA 4HJ0C 1RURH 5EU4B 4BSJA 2KZWA 4HK0B 4GRLC 1UM5H 4GRWB 4OI7A 2GUOA 4AG4H 4MA1B 5ITFB 5EFIA 1A6WH 2I5YH 4WUUB 1OP5K 4OCSH 5LG1A 2VXTL 5FEBA 5MHSE 5E24E 1KLGB 5HVHC 2AV1A 3VRLF 1OF2B 3LVEA 4HC1L 3MACH 5EZOH 4HJGB 4OGZA 3VWJB 3MCG1 1EO5A 1J8HA 5JXED 1LO5B 3EOAA 1MAML 3GK8L 3QH3B 2VE6B 1KJMB 1Z9OA 4KK9D 3BZFB 4X4XB 3BGAA 2LV4A 3L3HB 3UTTA 2VLKB 1UH4A 4ZAKD 3LEXA 5FYJL 5MERB 4OLVL 4Q6IC 1BQSA 3K80A 3X14B 1S9YB 4EUPA 3MJGX 3SOBH 5BW7A 5K33A 1KTKE 4E9LA 3MOBL 4NZTH 4LPYA 1RURL 1I3RA 5DHYA 4LP5A 5KBNC 3Q5OA 1U8QB 4AG4L 2W0KA 1U8MB 2DF3A 4TSAH 2I5YL 4OCSL 3MROA 3L3OB 4TNWF 2YD4A 3ZDZE 4GSDH 3K81A 1ZLUK 4P23D 5EZOL 5DYOA 2V5RA 5ESQB 1FZJB 2DOCA 4I8DA 2EH7H 5IBUB 5CEXA 4ESKA 1S7WA 4IRJC 3HLAA 3QIBD 4Z7VF 1ZGLP 4PD4J 1D5BB 1ADQH 1WK0A 5C09A 4JRXE 3GI8L 4KHXH 4MA3B 4YHPB 4KRNA 3IFOA 4QT5B 1EV2E 5F6HI 2FBJL 2X70A 4QXUH 3SOBL 4KK6D 3KYMA 3OL2A 4I2XE 5HDBF 4NZTL 3FRUB 4L4JA 4D8PB 1TCRA 2NCMA 3CPLB 3RVTD 5I1HH 1A21A 2A6JB 2ZJSH 4NKOB 1M1SA 4LPCA 1RUMH 3B9KA 2AGJH 4LVEA 1DVFA 3VFVB 2I9LB 5HHVH 3K8MA 4JFDD 5EU4A 4HK0A 4GSDL 2AV7B 2B2XL 5ITFA 4DGVH 1TJGH 3GRWH 1W72L 2DQHH 2F53A 4WUUA 4PLNC 2DQUH 4JANB 5JW5B 4MHHI 4XVJH 5GS2D 4C54A 1KLGA 3D2UD 1BWWA 1OF2A 1AFVL 4HJGA 5D1QC 1EO7A 2D7TL 4KHXL 1OM3H 2D03L 1LO5A 1L6XA 4EOWH 4LQ1A 3QH3A 2VE6A 1KJMA 1BMGA 3BZFA 3L3HA 5ICYB 2VLKA 5H35A 5MERA 3MV7B 4PGZA 1T0MB 2KH2B 1GPOH 2ZJSL 5E6IC 1S9YA 5CGYC 1R3HB 1XIWD 1MI5E 1L9MA 4N5EC 1UENA 5ANME 1ZT4B 4I18C 5HHVL 4KC3B 2HT3C 5BZWB 2X7LB 3MREB 1P53A