1XH8A

Crystal structures of protein kinase b selective inhibitors in complex with protein kinase a and mutants
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Design and crystal structures of protein kinase B-selective inhibitors in complex with protein kinase A and mutants
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 112
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xh8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xh8A02
5IQBA 1RW8A 4YPSA 5JRSA 4AW0A 5JGBA 4MD7E 3EQBA 5DGZA 2OXYA 3ROYA 3O8UA 4GS6A 4YZ9A 1QPJA 3GCUA 3BBTB 5ANIA 3VJOA 3BQRA 3C4EA 4KA3A 4XBUA 2ZJWA 2R7IA 4APPA 5CAVA 3MPMA 4M13A 4FR4A 4X7QA 5DWRA 4O7ZA 1WBVA 4I6QA 5EFQA 4IB1A 4KKHA 5HBHA 3H0ZA 4K11A 4C7TA 5BMMA 4Q9ZA 4FKVA 4FC0A 5AV1A 4ENYA 4XOYA 5I9XA 2B52A 3G2FA 5HHWA 2J4ZA 3CPCA 2XK8A 4OT6A 3A7IA 3AMAA 1APME 1SZMA 1L3RE 4IAYA 2J0MB 4IWDA 3AMBA 2R3RA 2X0GA 3OD6X 1JVPP 5EW3A 5A4LA 5AADA 2WMSA 3E64A 3QD0A 3GU8A 3JPVA 3FBVA 4PX6A 4DG0E 4NW6A 3CC6A 1Q8ZA 4BKJA 5FUTA 5FM2A 3K3JA 4O7WA 3H9FA 3G51A 1J1BA 4BIBA 3I79A 4Y95A 3MESA 2ZV9A 3R7VA 4IEBA 1O6LA 2QU6A 3PWYA 4BTKA 4F65A 3KMMA 4FTCA 4QYHA 3QLFA 4IFCA 3L8SA 4HZSA 5DNRA 3TUBA 3Q53A 1ND4A 1KE6A 3BCEA 3ZU7A 4RX9A 2XB7A 2W06A 3LCDA 1UV5A 4YJOA 1PRYA 4CSVA 4QO9A 3FQHA 5K5XA 4M7IA 2HZ0A 4XG2A 1H8FA 1REJA 3E3PA 5AUTA 5BPYA 1BMKA 4AT4A 1OIQA 3Q9XA 4G3EA 4PNKA 4UZHA 5DHJA 3VBQA 2WMBA 3DDQA 4EUTA 2WTIA 4Y85A 4YNOA 5I9YA 3AC4A 3IECA 4DH7A 3R8MA 3RAWA 4FK6A 2WMRA 2YCFA 3HMNA 3HMIA 3IQ7A 4HPUE 4RJ7A 4YC3A 2PVKA 3QX4A 5B0XA 3QAME 4HVIA 2IZTA 3SHEA 4GIHA 3I4BA 3BHVA 4F1OA 2JIVA 2EXEA 3FQSA 2VUWA 4YJTA 3RHKA 4APCA 2PZRA 3G0EA 5L2SA 2QR8A 1FVRA 4PDPA 3L9LA 1H4LA 4XG4A 3W32A 4AGUA 5CAQA 3GFWA 2IZUA 4O6LA 4DN5A 3RAIA 4FT3A 4RWKA 2ZV7A 5ANJA 5IKWA 3O7LB 4B7TA 4L44A 3SXSA 2XK6A 4V01A 4BYIA 1P4FA 1YKRA 2O2UA 3CJGA 2WD1A 4TW9A 5L3AA 3PY3A 4O96A 4YSJA 4GUBA 5EDQA 1R1WA 2WIPA 4L7SA 4QP4A 2WHBA 4AUAA 2C6TA 4PRJA 3BQCA 2PE0A 2YFXA 4BDGA 2PMOX 3BHUA 3VUKA 4ZSAA 5BVEA 3D7ZA 4IX4A 4FV7A 2F7ZE 4PV0A 4CVAA 2QO2A 5IMEA 1GOLA 3U4UA 2UW9A 5HG5A 2GU8A 4KIPA 1ZZ2A 2OJIA 2PWLA 4CMOA 5E91A 2WTWA 5EI8A 4CV8A 4QP8A 3KCKA 3N51A 4NZWB 4RIWA 1B38A 2JBPA 5E8TA 4DTKA 2DUVA 1CM8A 2X7OA 3DK7A 2BHEA 2W99B 1YDTE 5LMAA 3MDYA 4XYFA 3OT3A 4CT2A 4PP7A 5CANA 3RMFA 2IJMA 4QMVA 3R30A 4I23A 4TYEA 3C7QA 3NPCA 2ITYA 4LL5A 3ZS5A 2QVSE 3O50A 2OJFE 4C33A 4PF4A 4G5PA 4F0FA 2X8IA 1VR2A 2R3NA 3EYGA 5CVGA 5LMBA 3CQWA 2DQ7X 3OUNB 3G15A 4NM0A 2Y7JA 4AZWA 1VEBA 4FL1A 3CGOA 4K33A 3R7YA 2G01A 1TVOA 4L42A 3VJNA 3W18A 2V22A 3CCNA 4DFZE 4EC9A 4BCIA 4BB4A 4OTQA 4XRJA 4E20A 2X6EA 5EYDA 5GZ9A 4QMSA 5D10A 2GNHA 3JS2A 2CDZA 2XK7A 3CTHA 3MI9A 4FKSA 4KSQA 4B9DA 3KN5A 4FZAB 3MS9A 4WO5A 4NCTC 3GCPA 4ZAUA 2QLUA 3JVRA 2OK1A 3UE4A 2YJRA 3MB6A 4OTDA 3TT0A 4QTCA 5E90A 3HX4A 1W83A 4UN0C 3EFLA 3F3WA 3WZUA 3E8NA 4TT7A 2J5FA 3ORPA 2IWIA 2VV9A 3GC8A 2JAVA 4RJ6A 3RGFA 3MJ1A 4EK5A 2XJ1A 4YZMA 3ACJA 2VX1A 3PZHA 3QC9A 4FYOA 4PMTA 4FVQA 4DEIA 4MD9E 2PUPA 5FGKA 2XK3A 3R8UA 4D9UA 4UALA 2BILB 3W16A 1CSNA 2I0YA 3QKLA 5JZJA 5M4UA 3AD5A 3R1NA 4R7HA 4KABA 4PMSA 3MIYA 4M84A 3LQ3A 4MWHA 5GNKA 4EK4A 3FMEA 3SGCA 2BPMA 2JDOA 4JG6A 3LXLA 3WYYA 4ZTNA 1ZMVA 4ACHA 3KC3A 1VYZA 3FC2A 3WF5A 3NVKI 2FSTX 3E3BX 1W8CA 3QTRA 4XG7A 3WZKA 1OPJA 3LFBA 3EYHA 3F5XA 2UW8A 1VZOA 2PY3A 4FKUA 2W1FA 3E87A 3W33A 4ITIA 5J87A 4F09A 2PVHA 3DKFA 3TNIA 2H8HA 2CLXA 4X0MA 4ACCA 3PIZA 4Z55A 3UPZA 5DOSA 3KK8A 3W1FA 3KXNA 2EWAA 4G3GA 1Z9XA 3QTSA 3HV7A 3AD4A 4ZLYA 4BCGA 4O6EA 5B2LA 3F2NA 1OKVA 1PXIA 3LE6A 4OTPA 2QOQA 3QZIA 2QI8A 3KXGA 3ORLA 3QA8A 3MH3A 3LFDA 5AIKA 4XP2A 4JR7A 4M66A 2VO7A 2YM8A 4ZIMA 4E1ZA 3AGLA 1B39A 4LOQA 1ZZLA 5GZAA 1BI8A 2GTMA 3WE4A 2WTKC 3O2MA 4ZMFA 2OKRA 3FKOA 4O0WA 5AJQA 4LRMA 3MVMA 2OO8X 4U43A 4JX7A 1FVVA 5E8SA 3TNHA 1OGUA 3FAAA 3GGFA 3TTJA 3VBYA 4C3FA 1QPCA 4DBXA 5HIEA 3PIXA 5IMXA 4R3CA 4B8MA 3TDWA 5BVDA 1ZYJA 2C6LA 3OXTA 4FTTA 3RJCA 4AN9A 2XIRA 4RIWB 1ZRZA 2X9FA 1BX6A 5CZIA 3SXFA 4OBOA 4IANA 4I20A 3FLWA 4XX9A 4DFXE 3OZ6A 2PUUA 3IPHA 3M42A 5ETIA 4M69A 4DYMA 4F9BA 5A54A 3MGYA 2XIKA 2QR7A 2PUNA 4PUZA 4TYJA 5E7RA 2C5NA 1XR1A 3F3TA 3HV6A 4C36A 3EJ1A 1JKLA 3R00A 2GQSA 4L45A 5CWZA 2QOKA 3I81A 2IZSA 2QNJA 1GZ8A 3K2LA 4Z9LA 5CEKA 5DA3A 5L2TA 4USEA 3V51A 4F6SA 3UZTA 3POZA 2O64A 4XOZA 3P79A 5E8YA 2ITPA 4S30A 2CKOA 1T45A 3R8LA 2P33A 3HA8A 5T6KA 4KAOA 1EH4A 3MV5A 3U6JA 5IQHA 1WCCA 5CSVA 3DPKA 5HCXA 3LJ2A 4UXLA 5IZFA 3PYYA 2XK9A 5CY3A 2J0IA 3O0GA 4ITJA 3ZSGA 4XMOA 3WF7A 3DBQA 3H10A 2C6IA 3MVHA 3NR9A 2ZMCA 2ETKA 5F4NA 5CAUA 4GK4A 1SNUA 5L2QA 2BDJA 1V0OA 4BGQA 3OEZA 5GJGA 5AFVA 2VX3A 3NYXA 4B99A 2WKMA 4EWHA 3LPBA 4UBAA 4Z7HA 2E9OA 4FSNA 5CXHA 3Q6WA 1BKXA 4FG8A 2XKEA 5M4FA 4F64A 3ZFMA 3UODA 1OM1A 1R78A 2A1AB 2IN6A 2FYSA 3FKNA 3MFRA 4NYEA 3D83A 4EBWA 3C4FA 4KD1A 2QQ7A 3ZLWA 3V8SA 5DRDA 4C4JA 4D58A 5EYKA 4E8AA 1H1PA 4I0SA 2AUHA 3D7TA 1CKPA 2XM8A 3IGOA 4EH6A 4F1MA 4IAFA 4FSRA 4FTUA 3QTZA 5L6OA 4KINA 3AGMA 1PKDA 4ASDA 2BZIB 3WF9A 3CJFA 4FV3A 4FSWA 4EKLA 1NT2A 3RINA 4I24A 5CSWA 3ENHA 1OUYA 5GINE 3QBNA 4U45A 4FEVA 1KV2A 2OIQA 3K54A 2NPQA 5CU2A 2J2IB 4LGDA 5LARA 2V7AA 4ANNA 2BAKA 3EFWA 5KMKA 2ITOA 4PQNA 4WKQA 2C0IA 3DS6A 3H4JA 3HNGA 4CYJA 3CSVA 5AUXA 3H0YA 1O6KA 3ANQA 3W2OA 4WIHA 3UIBA 3NRMA 3GVUA 4WNKA 4U79A 4BDFA 4DFUA 4E4MA 3L8VA 3UOKA 4I22A 2GS2A 4MNEA 4DE4A 4JJRA 1DI8A 3RP9A 4QP3A 5AV4A 4O81A 5EW9A 4FIEA 4ZS4A 2B53A 4ZZMA 4E6CA 3GC7A 4FNYA 2HAKA 2UW4A 2XIXA 3ZXTA 2FGIA 3BBWA 4JLCA 4L67A 3FMHA 4PDSA 3D14A 2ZM1A 5CI7A 3TNQB 3PSDA 4EOSA 3C1XA 4TKSA 4BI0A 1H27A 2ITZA 3HMOA 3P7AA 3ENMA 5HG8A 4XNEA 2F49A 3HV4A 4IB5A 3V8TA 4D4SA 1ZYLA 3PJCA 3ZEWA 5IU2A 3QF9A 1GIIA 5CF8A 3Q32A 2OJ9A 4OAUC 2JDSA 4IVAA 5K0KA 4WUNA 3Q2MA 4KIQA 4EHVA 1PXNA 1H1WA 2CGWA 3PVWA 2QO7A 4JDJA 4GVAA 4AZFA 4UY9A 3D0EA 2R3OA 1ZOEA 3NNXA 3DOGA 4J99A 5HX6A 3KGAA 4FNWA 5AP1A 2X4FA 3SOCA 2C68A 2GHGA 2R64A 4CQEA 5J1WA 2YIXA 2ERZE 3DAKA 4O83A 3M1SA 2Z2WA 3CQEA 4R3RA 4RC4A 4DG3E 4DHFA 4NCTA 1SM2A 4C02A 4I93A 3C4XA 4I3ZA 3ZDIA 4F0IA 2GCDA 1P2AA 4FEWA 2BVAA 4QMXA 3Q5IA 5DPVA 4AN3A 1VJYA 3H9OA 5HO7A 4FTIA 3MFUA 5ANKA 2CPKE 2XIZA 4IZAA 2QHNA 2WEVA 2WPAA 2XH5A 3AC1A 3DQXA 4M69B 3ZSIA 4A4OA 5J5TA 3RZFA 4MXXA 3ZC5A 3ZUVA 4A07A 4C8BA 1GAGA 1MRYA 4O2PA 3ZUTA 2J6MA 4ZZNA 4CXAA 4LRKA 1XH6A 4AW5A 2F57A 4BCMA 4ERKA 3GEQA 5FXQA 5CEQA 2BALA 4YPDA 4H1JA 3LFNA 3QRUA 5HIBA 5K0XA 1R0PA 3K5UA 4GJ3A 1UVRA 2Y6MA 2PVLA 1RDQE 4A9TA 3EQCA 4A9RA 5KMOA 5KKRC 2Y9QA 2P4IA 4XJ0A 2YITA 3ETAA 3DK6A 4FKQA 4LV8A 4FK3A 1ZYSA 3FC1X 5DEYA 5AUWA 4PMMA 2J51A 3RM6A 5JFXA 2W1DA 3N4VA 2ZOQA 3VRZA 5IQDA 2JD5A 2BRGA 4L3LA 3DBCA 4MCVA 3RK9A 4EZ3A 5HCYA 3LM0A 4GG5A 3BU5A 3A7GA 1Q8UA 1QPDA 3Q3BA 3TZMA 2VD5A 3F61A 4J8NA 5FEQA 5KMMA 3U55A 3BE2A 4M0ZA 3LZBA 3D94A 4N70A 4XV9A 1YVJA 2ITVA 1DS5A 1WVWA 3D7TB 3QC4A 5EQPA 3A8XA 3CY2A 4DEBA 4HYSA 2A19B 1VYWA 4AA5A 1A48A 3MYGA 3PXRA 4QPAA 4XBRA 4X2JA 2J0JA 4C59A 3ORXA 2XJ0A 2WZJA 2JDVA 3VO3A 5CU6A 3DFCB 5CEOA 5GHVA 5EM5A 4DG2E 4JBPA 3VS3A 3Q96A 4YLLA 3KRJA 2JKOA 4XHKB 5EM8A 2J7TA 4EH7A 5M53A 3QX2A 4WSQA 3T9IA 5L2IA 3QKMA 5IA5A 3R7EA 1KE5A 4TZRA 2VNWA 3MPTA 4MXZA 1FQ1B 5JH6A 2BDWA 4TWOA 4AOJA 3DB8A 3VNTA 1ZYDA 2XKCA 5D12A 4MNEB 5G6VA 5ACKA 3II5A 4QQJA 1ZWSA 2A4LA 2BROA 3VRYA 5HI2A 3BU6A 2UZBA 4YTCA 1REKA 4LUDA 4NKSA 3RCJA 4DH5A 2UVZA 3BI6A 4FTJA 4GT3A 3H30A 3IW7A 1PHKA 5EG3A 2W1EA 3FSKA 3JUHA 3GU4A 5H2UA 4FEUA 5CXZA 4EHGA 3ZLYA 2GDOA 2ZM3A 1A9UA 4HGSA 3TV7A 4UMUA 5M08A 4RQKA 4M0YA 3UQCA 3BEGA 4Y46A 4EH9A 4IVCA 4FKRA 4DA5A 3PSBA 4RSSA 3HV3A 4DTAA 3FY0A 4QMWA 2DWBA 4KWPA 1Q97A 1JPAA 4FNZA 5I9ZA 4QMMA 4BR3A 4ENXA 4MXCA 4NWMA 4IBMA 1GZOA 2WTJA 3ZLXA 5IA2A 5L2WA 3DNEA 1XBCA 5L8KA 2QG7A 2X7FA 5BVNA 1UU8A 5JFSA 4Z16A 3C50A 5LWMA 4CCBA 5IA0A 3NIEA 3P9JA 3Q2JA 4ALVA 3IS5A 1XH5A 4FUYA 4J7BA 4TPTA 5HQ0A 5E4HA 3OBJA 4FT9A 1PXKA 4PMPA 2J50A 2F9GA 1H26A 2XJ2A 5LVMA 3MTLA 3DT1A 4BDEA 3D5VA 3DZQA 3Q9YA 2BRMA 2V5QA 4XS2A 4IM3A 3UOHA 3HZTA 2VWYA 3G9NA 4QD6A 2OZOA 4LUEA 2XRUA 3HP2A 3BWJA 1J7UA 3PXYA 4E4NA 3QTIA 1H0VA 4ANSA 4O2ZA 2PPQA 1U46A 3DXNA 4R1YA 4GYGA 3NS9A 4QMZA 2WO6A 2YEXA 3QUDA 4D0WA 3CGFA 2HWOA 3WZJA 1GZKA 3DFAA 3RKBA 3LAUA 1WFCA 4FYNA 2YWPA 4V0GA 4WD5A 1LEWA 1OL7A 3OCBA 5ANEA 3TUCA 4UMRA 2PMIA 5EHLA 2W4KA 1SVHA 4MQ2A 4Y83A 4I41A 4YC8A 4OBQA 3DXQA 2YCSA 3EB0A 5HE2A 3R71A 4IQ6A 4DFNA 3RPSA 4O1PA 3BWFA 3NUAA 3HV5A 4FODA 2HZNA 4K0YA 2R3PA 1ZARA 3E92A 3FUPA 5BQ0A 4A4LA 5EHOA 2WQBA 3DJ7A 4G34A 3LW0A 4LMUA 3WF8A 3ZRMA 4U81A 5K3YA 3KXMA 2XCHA 2HZIA 4BCPA 3P7BA 2E9PA 4D2VA 4TWCA 3FZ1A 3Q6UA 1G8SA 4AXAA 3PDTA 1PXPA 2W17A 4FBXA 4RC3A 4DFBA 3R63A 1KWPA 3ET7A 4BTMA 4RIXA 2WMWA 3DBFA 2GNJA 2W1IA 5FXRA 3UIUA 1J7IA 4FMQA 4AW2A 5FTQA 2UZDA 2GNIA 4RG0A 4X2FA 4ZSJA 2PUIA 3QHWA 5BUJA 4IAKA 2B9IA 4FTMA 4ZTSA 5F9EA 2GS6A 2ERKA 2JIIA 3MBLA 2WTKB 4FVPA 4GFMA 3SOAA 4RVKA 3TV4A 4J96A 1OBDA 2E9UA 4HGLA 4AN2A 2HYYA 3ZONA 3DY7A 1KE7A 4FE2A 5EI2A 3MPAA 3BYSA 4FKLA 2XNBA 4M8TA 5KBRA 2HXLA 3QQLA 3ZUUA 3SKCA 2LGCA 2BFXA 4PPCA 5FEDA 5HLNA 5HU9A 5KHWA 3AC5A 5AV3A 5TT7A 3V5PA 3EWHA 1H1RA 2HCKA 3D4QA 3QD3A 4OTGA 3ZRLA 4E4LA 4CZYB 4ORKA 4BDAA 2DYLA 3ZBFA 4AS0A 2EUFB 3BYVA 4D4RA 5DVRA 3QXPA 1PXLA 2R2PA 2WMXA 3TV6A 4IB0A 1MQ4A 2YA9A 3EN9A 5LJJA 4RRVA 4N4SA 4QP9A 3SW7A 3N4TA 1OB3A 2CGXA 3QQHA 2Q83A 1U5RA 5DLSA 1DI9A 1DAYA 4LQMA 2V7OA 5FBOA 1KV1A 1W84A 4O27B 4AZVA 3EIDA 2C0OA 4RFZA 5DI1A 1OZ1A 4EUUA 3TM0A 4HNIA 2VRXA 4YHTA 3EN4A 4ZSGA 5AWMA 4L6QA 2Z02A 2YM4A 2C5OA 3TCPA 1YHWA 5JQ8A 2C6DA 2QKRA 3G6GA 4QYGA 4MH7A 2R7BA 1PMNA 4YZCA 2PZYA 4LOOA 5CU0A 3EQPA 3G9LX 3KK9A 3RPRA 4HYHA 4JG8A 5FWKK 4K9YA 3QQJA 2XEZA 5HVJA 2OWBA 3PPJA 3QCQA 3QGWA 3BX5A 2I6LA 2X8EA 4H1MA 4NJ3A 2P55A 4AAAA 1URWA 4F99A 4F63A 2UZNA 4JIKA 4JRVA 5HLPA 4G17A 2XCKA 3PFQA 4F9CA 5ANOA 1PMVA 3BYMA 4F08A 5EYMA 4BCHA 5IH5A 2YIYA 3BKBA 1FINA 1GZNA 3KULA 2ZV8A 4DITA 2G9XA 2X1NA 5DR6A 3OS3A 2FVDA 4O0VA 2BTSA 4FTLA 4CQGA 3FI3A 2YAAA 3LJ1A 3CTJA 3MY1A 5KMJA 3ZTXA 2XYUA 4E5AX 4EC8A 2OG8A 3MIAA 4PL4A 5DEWA 2OI4X 3IONA 4ANQA 4JOAA 2ETRA 4NSTA 4QQCA 3SRVA 2F7EE 3DLZA 4ZLZA 1OPKA 5GJDA 4BL1A 1OL6A 3TZ8A 5EKNA 4KIOA 5HBEA 2CKEA 4GSBA 3F66A 4I6HA 1OKWA 4D9TA 1XJDA 3RM7A 1OECA 4QMQA 2JDRA 3TUDA 3BGPA 4AZEA 1JSUA 2WNTA 2C5YA 3QZGA 4F7JA 3UVRA 4FA2A 4DFLA 2YAKA 2C0TA 3FV8A 3U87A 2VO0A 4QPSA 3W8QA 1M14A 4L9IA 2W9ZB 4UMPA 5J8IA 4YTIA 3WYXA 5FM3A 2CGUA 3C9WA 4FG9A 5IA1A 3DTWA 3UIXA 3OBGA 4BY9E 3FMJA 2CN8A 3QUPA 4KRDA 4RIXB 2XS0A 4F6UA 4IX6A 3KXZA 1PXJA 2C47A 4JX3A 3EQIA 4EQCA 3R0TA 3F9NA 5DIAA 1H24A 2P3GX 2WQMA 3RPVA 1MRVA 4YNEA 4D1ZA 4I5HA 5K5NA 5ACBC 1W7HA 3V6RA 2Z8CA 4Q2AA 4S31A 5HD7A 3Q04A 3MW1A 1STCE 2BR1A 3BGZA 4EH5A 4F0GA 4NU1A 2CKPA 4D4YA 4EEVA 4RC2A 1UKIA 4NJDA 4CYIA 4O82A 3PXZA 2B0QA 4RMZA 2PMNX 5EK7A 3HGKA 5KZIA 5IDPA 5HE0A 3DQWA 1PKGA 2XEYA 1YOMA 5KBQA 2GHLA 3NLBA 3RCDA 1RE8A 4CMUA 2A27A 4CZUA 4EJ7A 1WZYA 4BI2A 1GIHA 1LUFA 1G3NA 2PULA 3AOXA 2WMQA 3QHRA 3F7WA 3FLQA 4PY1A 2XBAA 2ITXA 4J71A 3W2QA 4NT4A 5HD4A 1L8TA 4R78A 4GK3A 5M4IA 4O7LA 3KRWA 1OMWA 4AW1A 2R9SA 2Y0AA 3A4OX 5E1EA 4G3FA 4ZSLA 4KBCA 3UC4A 4C4IA 3UNKA 3UO5A 2WU6A 1XKKA 4RLKA 4FKIA 5CTPA 3EKNA 3QUEA 4FGRA 2YM6A 3QCSA 1URCA 4LGHA 4ZMEA 4GEOA 3VVHA 2CGVA 4NFNA 5KKRB 5IG1A 2W5BA 1W98A 5LWNA 5FP5A 3KMUA 4C2VA 3UG1A 4OGRA 2B9HA 4XV1A 4OT5A 4BCQA 3UP2A 5EM7A 4KRCA 4BDJA 4Z3VA 3HRBA 4R5YA 5HTBA 1RQQA 5DN3A 3RI1A 4O84A 3E88A 2W5HA 3C4ZA 2RG6A 1P4OA 2I7QA 1WBSA 2ZDUA 2HY81 2FH9A 2QKWB 1FMKA 3EQDA 4FOBA 2A0CX 5FBNC 3MFTA 4FV8A 3AT2A 4G6OA 5CYIA 4HCVA 3PA3A 1YI6A 3QWKA 5JN2A 1UU3A 3Q4UA 4IFGA 2R3KA 2AC5A 2ESMA 2CCHA 3KULB 2YHVA 3F2AA 3O8TA 3VS7A 5JGDA 2GNLA 4HW7A 4FUXA 5LVOA 3UG2A 4BTFA 4YBKA 5KO1A 3SW4A 1NVQA 1Q62A 5FRIA 2Z60A 5CALA 2PE2A 2RFDA 3ZO1A 1V0PA 2YDJA 4YZDA 2Z7QA 4GJ2A 4OAVB 4LGGA 1ZXEA 5LOHA 4D5HA 4AQCA 2BIKB 3SXRA 3EQHA 4RZWA 3JY9A 4JAJA 1SVEA 2BAJA 5CS6A 3SC1A 3SRVB 5J1VA 4MTAA 2XP2A 3P0MA 1H08A 2R0IA 4BGGA 2XBJA 4R1VA 5AUZA 3REPA 2BRHA 2ACXA 1SVGA 5IQEA 2ITNA 3I0QA 4WT6A 2Y4IC 4EORA 3TJCA 4V05A 2JLDA 2PSQA 2XRWA 4BN1A 4O21A 1GY3A 5LVLA 4QYFA 4DF3A 4RX7A 5A3XA 2OF2A 3QTQA 4KSPA 3R21A 4TWNA 4WBOA 4IWOA 4X2KA 2IW9A 3R7IA 3RHXA 3VS1A 1H28A 3FSFA 3PVBA 3E8DA 4X3FC 3OOMA 5H8EA 5TKDA 5J7HA 3MH2A 1KOBA 3HA6A 3VBXA 3VHEA 5L6PA 2CJMA 4FGBA 4U44A 4QMLA 4DH8A 3QCXA 4RLLA 4MNFA 1O6YA 3ZYAA 4DEHA 4FZFB 1XH8A 3KB7A 4L46A 4CFMA 3FI4A 2PK9A 2X9EA 3AC2A 5JT2A 4ACMA 3EOCA 2HWPA 3HUCA 3T3VA 3PXKA 3R2BA 3K5VA 4LYNA 4B8LA 3QTXA 1BL7A 3BIZA 4U0IA 3UOLA 4ASXA 5TE0A 4J97A 2IVSA 3UZRA 5E8UA 1E9HA 1QMZA 3O17A 4GUEA 3RK5A 2VTTA 3TIZA 4ITHA 2F2CB 3GBZA 4H58A 4J1RA 2UZOA 3EN6A 4DGMA 4L3JA 1IG1A 3V5LA 4WHZA 5AP0A 5L8LA 4E6DA 3RNIA 3FHIA 5A4EA 4NFMA 3H3CA 2ONLC 4BF2A 3LFSA 2QCSA 4EZ5A 5M44A 2GSFA 2XK4A 3KXXA 3EFJA 3QL8A 2OH0E 5I3RA 4HZRA 4RIYA 4J52A 3GU7A 2OXXA 3TKUA 3FLSA 4CFNA 1UKHA 3KQ7A 3PPZA 4C57A 2WTCA 3KRLA 3QKKA 5GIPE 1F5QA 1Q5KA 2EVAA 2GTNA 3EN7A 3FLZA 3GT8A 4FZ7A 4YJUA 5IQAA 3HEGA 1W82A 2GFCA 4XUFA 5EM6A 2O3PA 3FMMA 5A4QA 1WBNA 4PP9A 4BDHA 4YTFA 4EOLA 1QCFA 1NY3A 5B2MA 1OPLA 2ZB1A 1Q99A 3TN8A 2UW3A 2UZTA 3QYZA 3POOA 1OBGA 2YCRA 4NL0A 2NNWB 2AYPA 4WG4A 2PYWA 4K18A 3DDPA 3SV0A 3OHTA 4I6FA 4S32A 3PRIA 4C0TA 4X2GA 4OTWA 1FMOE 4E6QA 1XH9A 2VTOA 4EH2A 3GCVA 3N9XA 2VNYA 3ULZA 2ZB0A 2YERA 3LXPA 3F5GA 4FT5A 3HDNA 1Y6BA 3A7FA 4K2RA 3ZC6A 4HVHA 4OUCA 3D5XA 5IA4A 2VTSA 5C9CA 2R3IA 4GU9A 5FP6A 1IASA 4HNFA 3SX9A 3ZCLA 4MYGA 4YJNA 5IUGA 3BHYA 4YJVA 1J3HA 1RJBA 5KZ0A 4BIDA 3G90X 3HMPA 3VS4A 2E9VA 3BLHA 5HZNA 3FKLA 2GHMA 3OTVA 5ETAA 2QO9A 4C4HA 4F4PA 2ZAZA 3MA3A 4FSUA 4R7IA 2C1BA 3ZH8A 4R7BA 3CIKA 1U4DA 4U40A 4WA9A 3NNVA 3KRXA 3NGAA 1PXOA 3TG1A 2RFSA 4EL9A 3P1AA 4W8DA 1Q3WA 3UP7A 2OFUA 4RBLA 4TNBA 4TY1A 2XA4A 4J95A 4Q5HA 2C6KA 4RWJA 4KKEA 2HENA 1YHSA 1TQIA 3A7JA 1HCLA 3OWJA 5AUUA 5C4LA 2CCIA 2JKKA 2WTDA 4IJPA 3COIA 4M68A 5C1QB 5JKGA 4AT5A 1CMKE 3VIDA 3VUMA 3U51A 4YMJA 3C0GA 4AA0A 4S2ZA 3ROCA 1ZMUA 3QQKA 4HGTA 2X6DA 3BLQA 2XKDA 3HAMA 3KRRA 3NUSA 1YXTA 1ZOGA 5F1ZA 3OMVA 3FZRA 2B7AA 3G6HA 3PLSA 1U54A 3UJGA 3DBEA 5IH6A 4EOOA 3L1SA 2WU7A 2ZMDA 3HMMA 3PSCA 3QA0A 4I21A 3FDNA 4ZJVA 3ELJA 4NTSA 1PW2A 2CN5A 5D41A 3ORIA 4OW8A 2FSLX 5AR8A 5AM6A 4GKHA 4D2RA 2WMTA 3F69A 5H8BA 5E8XA 3OW3A 1FBNA 5DYJA 3CD8A 3QRIA 4PPAA 4QP7A 1JBPE 4AFEA 4NIFA 4JDIA 4E26A 2Q0BA 3OCGA 5DRBA 1FPUA 4C4FA 3ZM9A 3NMUF 3IK3A 2IVTA 2FB8A 2ITWA 1OIUA 3P7CA 3VUTA 4B6LA 5LMKC 1JSVA 1ATPE 1YOLA 4OTRA 5M07A 2OIBA 4W9WA 4PL5A 3IW6A 4BYJA 3PE1A 2J90A 3R9OA 4U42A 3C0IA 3EL8A 3RWQA 3GUBA 3O51A 4DEDA 2VWIA 4XH6A 3NVMB 4G2FA 1WBWA 3MWUA 2BCJA 3FPQA 5C4KA 4BWPA 3UNJA 4N6YA 4RVLA 1YI4A 4IAZA 2IVVA 2CKQA 1Y57A 3D5UA 2VZ6A 4IDTA 3NWWA 3PG1A 4EH4A 5CX9A 2PVYA 3KEXA 3GB2A 2KULA 5KHXA 4QTAA 3TI1A 4FL2A 4IM2A 5HVKA 5AP6A 2WB8A 3MY0A 4RJ3A 4BRXA 4K6ZA 1YWVA 3MB7A 3A7HA 3GU5A 4O0YA 5EW8A 5LVPA 5LCKA 2Y4PA 3LXKA 5CF5A 3N4UA 2YM5A 5AP5A 2QHMA 3FYKX 4EK8A 4YJQA 3G5DA 1YDSE 3DK3A 3FMDA 3NW6A 5AP3A 3EFKA 2QG5A 3LFQA 3LVPA 4MF0A 2OBJA 2VWZA 1BLXA 4MXOA 4YHFA 3TL8A 2WELA 1AD5A 1GJOA 2IW8A 3V5TA 4ANMA 1YXXA 3E7OA 3PWDA 5M55A 4FKPA 4JI9A 1ZMWA 2OH4A 3KCFA 4M3QA 4X3FA 5KX8A 3F3ZA 3CEKA 1M7NA 3F2RA 3V3VA 4MD8E 3VF8A 3QRTA 3ERKA 3COKA 3ODZX 4X21A 1H01A 2BFYA 3LHJA 5CT7A 3KF7A 5AUYA 4AZSA 5IQCA 5BYYA 4O7YA 2YZLA 1J91A 1OKZA 2BRBA 3KA0A 3LFAA 3R28A 3U4WA 3DJ5A 3FJQE 4FICA 4GFOA 3NUUA 3Q5ZA 4P2KA 1U59A 2X2LA 2UV2A 1OIRA 4RJ8A 3SG9A 4UYAA 5H8GA 4BTJA 1MUOA 5AAFA 3TJDA 5HX8A 2WQNA 5CSXA 2I1MA 3FZTA 5FTOA 3A99A 2F7XE 3U8WA 4K8AA 5I9UA 5JFVA 3JR1A 2C69A 1H07A 2RG5A 1LEZA 3AT4A 4AG8A 1H1SA 4GL9A 4DH1A 4V04A 5CAPA 3NUNA 5AR3A 4FOCA 4LFIA 1ZLTA 2ONLA 5AV2A 1O9UA 3HRFA 2LAVA 5J79A 4A4XA 3R1SA 2YJSA 4D0XA 4PTGA 4HJOA 5IPJA 5J7BA 2NRYA 1UA2A 4DINA 3ITZA 4GG7A 3R1QA 3GQIA 4QMTA 4ACGA 2QOHA 3PTGA 2C6EA 2X4ZA 4BI1A 4DEAA 3R04A 3MJ2A 4YJRA 3ZFYA 2PVMA 2JGZA 3QXOA 1U54B 3COHA 3EZVA 1TKIA 3AG9A 1OL1A 2I0HA 2OJJA 4FTKA 5DH3A 4EYMA 4HYUA 4M67A 5I4NA 2YZAA 5H3QA 4UZDA 4HPTE 3FXZA 1UNGA 3D15A 2Z7SA 4FV2A 3ORTA 4H3BA 4G5JA 3W2RA 4IHPA 4PPBA 1WVXA 2V55A 3NAXA 3NIZA 4LL0A 3BRBA 4FTNA 5HOAA 2E2BA 4B4LA 4ZY6A 5LVNA 1CKIA 5JRQA 4IDVA 3VC4A 1JQHA 4R6VA 4RA4A 4BCJA 4NIFB 2G2FA 2JKQA 4XP0A 2R3JA 5IQGA 3CPBA 4GRBA 1K9AA 2B55A 3VUIA 1JWHA 3PLAE 1KE9A 3HLLA 3OWKA 4EQUA 4QYEA 2GFSA 2XF0A 4IW0A 4QP1A 5FD2A 3R9DA 4E4XA 5E1SA 4FZ6A 4TN6A 4JIAA 3PRFA 4D2WA 5DG5A 4ASEA 1PJKA 2V62A 4UWBA 2J0LA 4IAAA 4F6WA 4O91A 3I0OA 3VQUA 2Z7RA 5LCJA 4L8MA 4EOIA 5HE3A 1M52A 2QOLA 5IUIA 3C51A 1F3MC 3DU8A 4YJSA 3UTOA 4CCUA 3OUKA 3OXIA 3VUHA 3IDBA 2C5XA 3R73A 4FV9A 4DCAA 4AT3A 2XNOA 4WNOA 5ICPA 3BGQA 3DLSA 5CVFA 2HW6A 3TXOA 1YW2A 3VBWA 4CGAA 1WBPA 4BHNA 4CZTA 4IJ9A 3FWQA 4C35A 2WEIA 2EB3A 2UVXA 3R01A 4I0RA 4AWIA 4CKJA 5DMZA 2VTQA 2ZDTA 4W4XA 3NCGA 1UWHA 4JG7A 4TRLA 3WILA 3QZHA 4AOIA 5BUEA 4O22A 1IA8A 4FKTA 3HDMA 3A4PA 4Q5EA 4G16A 3K3IA 2YDKA 4LRJA 1H00A 4IZ7A 3JYAA 3IO7A 4EOMA 4FSTA 5CI6A 4ZZOA 4Y5HA 4WUAA 4BZNA 4FG7A 1Q3DA 3PJ1A 4O7SA 2BRNA 2Y4IB 4JR3A 4QYYA 4WG5A 3OTUA 3DCVA 3ZMMA 3OY1A 1IRKA 4CFVA 4BDDA 4M97A 5KCVA 2R4BA 3S4QA 5HGIA 2OGVA 5I3OA 4KIKA 4X3FB 3ACKA 3I60A 3W2CA 2CSNA 2VTIA 1XO2B 1NXKA 4XV2A 5HCZA 4ZJJA 4C2WA 2GQGA 3CKXA 3S0OA 3R22A 2FSOX 4ZY5A 2VWWA 1IAHA 3R8VA 2H9VA 5ITAA 3LCOA 2VWVA 4YC6A 4AE9A 4EWQA 4H39A 4AOTA 1V1KA 4YU2A 2UW7A 3KXHA 4CKRA 3U9CA 3R8ZA 5D1JA 3LCTA 3EZRA 1XH4A 3AMYA 4X6QC 2VTRA 3KF4A 3BV2A 5IF1A 3KN6A 4J8MA 3TNPC 1YDRE 5D7VA 5EQYA 3TDVA 2BAQA 4NM5A 1WMKA 4O7RA 5I0BA 4O7VA 3JVSA 2FSMX 4J53A 2VWBA 3FMLA 3Q60A 5H9BA 5C01A 2H96A 4GMYA 3SDJA 4C3RA 2GNGA 5BNJA 3UYTA 3D2KA 1K3AA 3GOKA 4FT7A 2SRCA 4IZYA 4MBIA 4RFYA 3UZPA 2R3HA 4DT8A 2X7GA 1T46A 3CTQA 3IG7A 4BBFA 3L8PA 4Y72A 2VX0A 3DV3A 3QALE 4MEDA 4Z7GA 5LMKA 4QQTA 4RVTA 3EHAA 4BDKA 4UX9A 5HE1A 1ERKA 3VS5A 2VGPA 2W0JA 4HOKA 4ZXTA 4S33A 4L68A 3V6SA 2KTYA 1YWNA 3R9HA 3VS6A 4DGLC 2YISA 4GIIA 3KVXA 3I1AA 3P08A 5EH0A 3ZOSA 4O0UA 4DFYA 2OFVA 1PYEA 3CS9A 3IOKA 3IW5A 4H36A 4QTDA 3R9NA 2B54A 1XBAA 4L7FA 5BUIA 3R7GA 4E5BA 4MHAA 1WBOA 3QTWA 5M51A 4BCNA 3E93A 3HKOA 3BZ3A 3PY1A 4CG9A 1IA9A 3DKGA 5CASA 3DAJA 1FVTA 5HU3A 1Y91A 4YUQA 1IAJA 4RWIA 2WMAA 1S9JA 3B8RA 3BEAA 5AV0A 5AX3A 4CRSA 2RKUA 3I7CA 4JXFA 3IW4A 4ACDA 5CSPA 2WQOA 1YQJA 5EQEA 2DS1A 4ZP5A 2NRUA 4IZ5A 1M2PA 3EQFA 3JY0A 3A8WA 5C8KA 4ALWA 4FIGA 3QD4A 3EH9A 3R6XA 4D5KA 4TNDA 4EKKA 2GQRA 5IEYA 4WOVA 2P2IA 3VS2A 5L6WL 1TQPA 4D55A 4GT5A 3ORMA 3GOPA 4JDHA 3IGGA 2ZV2A 4QP6A 4U97A 2WQEA 5FLFA 5IEXA 3B2TA 1Q8WA 3QQFA 4IAIA 3UDBA 1BUHA 4RJ5A 3WF6A 4I5PA 2YM7A 3PVUA 4BDCA 5IISA 2E9NA 2W9FB 4YSMA 4CFFA 3LOKA 3EQRA 2XNGA 2C3IB 3MY5A 4XP3A 4Y8DA 3LMGA 2VTNA 5AAEA 4NTTA 3OC1A 3A2CA 3F6XA 1SYKA 2IZRA 4FTOA 4O0RA 3ZO4A 5M06A 2F2UA 3COMA 4D2TA 1OUKA 4U8ZA 4U3ZA 3P5KA 3R02A 3PA4A 3PUPA 4GT4A 4DAWA 5KMLA 2ITQA 4G1WA 5JK3A 3I5ZA 2I0VA 4PTCA 4P5ZA 5F95A 1Q24A 3ZZEA 3VULA 4EYJA 4XRLA 2YLFA 4NKAA 2PZ5A 5HIDA 3T8OA 3I6WA 4WRGA 3WI6A 4AGWA 5HORA 4V0GB 5A46A 3HVCA 5ETCA 2UZLA 3UPXA 3U6IA 3FL5A 4U3YA 3TZ9A 5HO6A 4DLJA 4DGNA 4FKWA 1JSTA 3FL4A 4RZVA 4NW5A 4KNBA 5C03A 4XV3A 5J9LA 4HVGA 3V8WA 1FGIA 2RSVA 3D5WA 3GU6A 2HXQA 4KBKA 4UWCA 2QOCA 3FY2A 4Y5QA 4BDBA 2XMYA 5KMNA 5L4QA 4RT7A 3F7ZA 3P86A 3OWPA 3BE9A 3R2YA 4NM3A 3CE3A 1J7LA 3PE2A 4AA4A 1UNLA 3NEWA 1JAMA 3QYWA 4GK2A 4D1XA 4EOKA 5A14A 4KIKB 1E1XA 1M17A 5HNGA 4CT1A 2BDFA 2YIRA 3FI2A 1NW1A 1MRUA 3ZRKA 2W7XA 3VS0A 2HK5A 4YO4A 3UIMA 4GCJA 3T3UA 3DB6A 4UMQA 3G0FA 4CLJA 4EHEA 3AD6A 4FSQA 4AE6A 5LXMA 5BVWA 3EL7A 4KKGA 1XQZA 4EOJA 5F20A 5T68A 5DE2A 3NZ0A 3RWPA 1QL6A 4FKOA 4N57A 4RVMA 3ZZWA 5AA8A 2EXMA 3KY2A 4C4EA 4EH3A 2OF4A 3ORNA 4BCKA 3HUBA 4TL0A 3OEFX 4UWYA 5IA3A 5EKOA 2XM9A 2WOTA 4FSMA 2CNVA 3D9VA 4DT9A 4F7NA 1R39A 4D28A 1WBTA 3LLTA 3GENA 1I44A 2WMUA 2VTHA 4ONAA 2UW5A 3MH0A 4JNWA 4RWLA 2C30A 4WRSA 5AX9A 2CMWA 4JDKA 5L8JA 3S3IA 5CU3A 3IDPA 4JQ7A 5CNOA 5BX0A 2PVJA 2O65A 5M56A 4HCTA 3OP5A 3HL7A 2ITTA 5CAOA 3L9PA 5ANDA 4PDYA 2VTAA 1PY5A 3WE8A 5CNNA 5JFWA 3ATTA 5M09A 4JQ8A 4FV1A 4DEEA 3ATSA 3S1HA 5HTCA 4A06A 3ZO2A 1KOAA 2CHLA 4WSYA 4KS8A 4HCUA 3PY0A 4FL3A 4OR5A 5GZ8A 4O38A 2WXVA 3WARA 3QTUA 4XG9A 5IH4A 5AR7A 1GNGA 1LPUA 1OVEA 4A9UA 2J9MA 3LQ5A 3LFCA 4IXPA 5FG8A 3Q4CA 5C8MA 4N6ZA 5CF4A 3UQFA 2YN8A 3W8LA 3FMKA 4O0TA 1PMUA 2HELA 4XG3A 5C27A 4ZTMA 3ZHPC 4NEUA 3ZXZA 3CD3A 3F3VA 4DGOA 2G1TA 3QWJA 2IW6A 3FYJX 1HCKA 3ORZA 5CEPA 2X2MA 2VAGA 3PZEA 4U6RA 3P23A 2OLCA 3PXQA 3UGCA 1JOWB 2UZVA 5HICA 2PMLX 4UYNA 4ZTHA 4MF1A 3GCSA 3RZBA 4O86A 1XBBA 5BMSA 4I4EA 5E92A 1FGKA 2UVYA 3D2IA 4E6AA 4AGCA 1FOTA 3CP9A 4L43A 4IH8A 4C58A 3ZDUA 3KL8A 5TO8A 4M14A 4RGJA 5GJFA 4CTCA 4YR8A 5A6OA 1YI3A 5DBXA 5AMNA 3OXZA 2R3LA 4HVDA 4LM5A 1ZOHA 4FV0A 2VO6A 3KFAA 4H3QA 4QNYA 4U7ZA 5BVOA 2AC3A 4A9SA 4IX5A 5AP2A 5KE0A 3QCYA 4OTHA 3DKCA 5K4IA 2UZUE 3W10A 2C6OA 4YO6A 2ETMA 4JBVA 3V5WA 3NYNA 3PPKA 2PVRA 4AZTA 3F5UA 3IKAA 3UMWA 3Q52A 4ZTRA 2FA2A 3TKIA 2RFEA 4DLIA 3E8CA 3LCKA 4ARKA 5CSHA 4AGDA 3A60A 3ZM4A 4R3PA 4FIJA 4MAOA 3BHTA 3Q4ZA 3FMNA 1PF8A 4IACA 2EXCX 4R8QA 3R7UA 3FPMA 4MX9A 3RAKA 4EI4A 1Q4LA 2BZKB 3O7LD 4LV5A 3NUPA 5TR6A 5IDNA 2F4JA 2BUJA 3QU0A 2REIA 2I40A 1QPEA 4P5QA 3Q4TA 2C3KA 3KU2A 4ZY4A 4BCOA 1MQBA 2UW0A 4IWQA 2JAMA 5EOLA 4B0GA 4QMNA 2BMCA 2OICA 4HYIA 4FI1A 4BWXA 1H1QA 4DGGA 4O7TA 2WIHA 4YBJA 2W4OA 3ID6C 1XHAA 2J0KA 2VTLA 5BVKA 3E8EA 4I5MA 3SA0A 3PJ8A 1CDKA 4QMUA 3PP0A 4TTHB 5C26A 3V04A 2OXDA 1ZAOA 3DNDA 3FZOA 3MTFA 5HNIX 4ASZA 3WBLA 5TOZA 4EOPA 4AP7A 1H25A 3MFSA 5IEVA 2H6DA 4OBPA 2YWVA 4TYIA 3SD0A 4C34A 3FI8A 3G33A 4TWPA 1LP4A 3F88A 5JZNA 3ODYX 3VBTA 4F9WA 5D7AA 5D11A 5KMIA 3C5UA 4MXYA 3AC8A 4U5JA 4BBMA 2OJGA 3ANRA 1UWJA 5AEPA 2QLQA 1YXVA 3UBDA 1K2PA 3O71A 4MQ1A 5EI6A 4AACA 3Q9ZA 5BYLA 3UO4A 1H0WA 4C3PA 1ZY4A 3CR0A 3L9MA 3FEGA 4QQ5A 2IPXA 4BCFA 2X39A 3MN3A 3LMHA 2JDTA 5AP4A 2C6MA 2XZSA 1KSWA 4PTEA 3SAYA 1KUTA 5FXSA 4IWPA 5E8VA 4R77A 2QU5A 4CMTA 2X8DA 2GPHA 2ITUA 2QC6A 3C4CA 3QFVA 2R3GA 3UMXA 1Y8YA 4FIIA 2CLQA 4ZEGA 3SVVA 3EQGA 3M11A 4S34A 3WOWA 2G2IA 5AAGA 5J9YA 4H05A 3BYOA 1MP8A 2WMVA 3IW8A 4JT3A 3UC3A 3DKOA 4L3PA 3DBDA 2JFLA 1Q8YA 5CEIA 4BKZA 4LMNA 4EBVA 5C8NA 4PL3A 3P4KA 3BELA 4X3JA 5HEZA 3DXPA 4NUSA 5DT0A 2RL5A 4R5SA 1Y6AA 3V5JA 2HW7A 4YLKA 3CBLA 3SLSA 3U54A 5DT3A 3I5NA 3PJ2A 5AR5A 2BKKA 3LMIA 3F82A 4ID7A 3GNIB 3FXWA 4BHZA 4MBLA 2ZM4A 3R1YA 4QNAA 4EH8A 4CD0A 4K77A 2XUUA 4JS8A 2OU7A 3RTPA 4OTFA 4MK0A 3GP0A 3MSSA 2JBOA 4FTAA 5HG9A 5IQIA 4GYIA 4PNIA 5CF6A 2OW3A 2JEDA 2XNPA 4IMYA 5CENA 4W4WA 4FIHA 3R8PA 2B9FA 4O7NA 3NCZA 5BYZA 1G5SA 1HOWA 4ERWA 5HLWA 4G31A 1JKKA 4XG8A 3T9TA 4X2NA 4FV6A 4I5CA 4L01A 4OTIA 5DR2A 2NO3A 2C3LA 3VUDA 4D2SA 1IR3A 2PVFA 3DA6A 1YXUA 4AU8A 2BZHB 2PL0A 3NSZA 3OF0A 2QOOA 3ZFXA 2B1PA 2RFNA 3NYVA 2XNNA 3AC3A 5CLPA 4BIEA 4O0SA 4RQVA 2B4SB 3LJ0A 4LG4A 2X2KA 4X6RA 3LCSA 1YRPA 2P0CA 4BFMA 3GCQA 3F3UA 4F7LA 4ZTQA 5B7VA 3FLNC 4QOXA 3NUYA 2PE1A 4U9AA 2UW6A 4G3DA 4L53A 4RX8A 3WIGA 4AF3A 4I0TA 4W4YA 5KNJA 4ZS0A 4CEGA 5M4CA 4GKIA 1OI9A 4IIRA 4OLIA 4ZSEA 1Q41A 4P4CA 5CU4A 4IX3A 4YZNA 4W9XA 5J9ZA 4EJNA 3PVGA 4PDOA 2FUMA 2JKMA 3C4WA 4WBBB 5ANGA 2OZAA 2GNFA 4L00A 5FQDC 3RNYA 5TF9A 2C3JA 4JAIA 4U41A 3W2SA 5HTIA 2JFMA 4C37A 3NYOA 3OWLA 3CLYA 3JXWA 4MKCA 5HBJA 3NDMA 1OL5A 4QPMA 2YM3A 3BLRA 3OROA 2YLEA 1R3CA 4YJPA 5AUVA 3SG8A 4E73A 3ORKA 4EQMA 2R5TA 3Q9WA 2VWXA 4JRNA 4QMPA 4P7EA 1V0BA 5J95A 3DTCA 1S9IA 4IVBA 2PU8A 5HG7A 5CT0A 5CZHA 3P78A 4FX3A 1W0XC 4IADA 4YGAA 4G3CA 3SQQA 4F9AA 2YIWA 1YOJA 4XLIA 3BV3A 3CY3A 3U6HA 1AGWA 3E62A 3ZEPA 4AFJA 4DC2A 1Y8GA 1BI7A 4IVDA 5JQ5A 4HGEA 5HNBA 2RIOA 5HESA 3S2PA 1P14A 4TYHA 4EK3A 4EHZA 2QOBA 4DTBA 3RK7A 4UMTA 4RIYB 4DCEA 5JGAA 3NAYA 5HVYA 1YXSA 3UVPA 1AQ1A 4FIFA 3A62A 2BTRA 3KKVA 2UZEA 1UU7A 5HKMA 4F7SA 4KB8A 1SMHA 3OFMA 4G9CA 1M7QA 4JVGA 3HP5A 2R0UA 1XWSA 5EDPA 4ANBA 4BWKA 2JC6A 5A4CA 3HYHA 3PP1A 2O63A 2QURA 4LI5A 5T3QA 3NNUA 2VTMA 2C5VA 4W8EA 1JKSA 5DR9A 3NNWA 4FT0A 4Y73A 5CVHA 3NW7A 4RIOA 5F94A 5M57A 2YDIA 3RAHA 4I6BA 4Q9SA 1CKJA 4I94A 4G9RA 5LQFA 4ANOA 4CRLA 2YCQA 2QODA 2EU9A 3OT8A 3R7OA 4BZDA 3BPRA 2WTVA 4WG3A 1R0EA 3LFEA 4I1ZA 3TNWA 2XNEA 5DT4A 5I5ZA 4BVUA 1IEPA 2ZYBA 4CFWA 4FKGA 3THBA 4K1BA 5J5SA 4F1TA 3FLYA 1GIJA 3LLAA 2O0UA 5D9HA 3HAVA 2PHKA 5K9IA 1TQMA 4ZTLA 2W1GA 4FF8A 4A7CA 1OKYA 3PG3A 1WAKA 3VWAA 3IOPA 2VN9A 2QOFA 1JNKA 3VW6A 4W4VA 3DJ6A 3I7BA 4C38A 1Q8TA 4FNXA 2WGJA 3EN5A 4U80A 4CFUA 2VWUA 3O96A 4E3CA 5A9UA 1E1VA 3VHKA 4BBEA 4YP8A 2CNUA 4FVRA 2W96B 2XYNA 5EDRA 2CNQA 4IM0A 3C5IA 3B8QA 3TKHA 1X8BA 5EYCA 2GS7A 5EHYA 5HO8A 3CQUA 2QOIA 4MBJA 4ZOGA 3QRJA 4RPVA 3TZ7A 3AQVA 3WZDA 4FV5A 3VN9A 4QMOA 2P2HA 4CV9A 3KMWA 4JQEA 3DGKA 3WZEA 3IDCA 3H9RA 3UNZA 4GV1A 3OG7A 1P5EA 4FSYA 3OVVA 4UV0A 4RFMA 1KE8A 4WNPA 4YHJA 3UQGA 2IG7A 2Y8OA 1BYGA 5A4TA 3VF9A 3VQHA 1M2RA 5B2KA 2J5EA 3E5AA 3AT3A 4XLVA 3CXWA 3V5QA 3PJ3A 5DFPA 5I9WA 4UEUA 3S95A 4BZOA 3QLGA 2W1CA 4USDA 3BU3A 1UU9A 3FZSA 5CQWA 3DAEA 1JLUE 2R3MA 2PVNA 4XG6A 4C4GA 2YIQA 3MH1A 4IC7A 4M12A 3BYUA 1YHVA 5FEEA 4C62A 4E7WA 3MA6A 1PXMA 5AIRA 5G1XA 3WIKA 5JMSA 2UUEA 2OZAB 2VU3A 4FV4A 3VAPA 1PMEA 3CKWA 2O8YA 1SNXA 4ANLA 2V0DA 3MVJA 5K4JA 1NA7A 4JL9A 3TWJA 4I4FA 2HIWA 4D1SA 4QTEA 1UNHA 4P90A 2O5KA 4QTBA 4GVJA 5A6NA 4JBQA 3TTIA 3RVGA 4KBAA 5AP7A 4CNHA 1ZY5A 3UYSA 3HECA 2W1HA 4H3PA 2JITA 4D2PA 4FSZA 2XIYA 3GXLA 1A06A 1OL2A 3HRCA 3I6UA 3LFFA 4QT1A 4FTRA 4FEXA 5AM7A 4A9YA 2PZIA 2XNMA 3KREA 2Z7LA 3DZOA 4GU6A 4PWNA 4E93A 3L9NA 3RPOA 3LM5A 3PA5A 1XH7A 3A61A 3QGYA 1M2QA 1NVRA 2HY0A 3C13A 3R83A 2BHHA 2OIDA 4CLIA 3GC9A 3QQGA 4YTHA 3V01A 3OY3A 2H34A 2JIUA 4FKJA 3ULIA 4TYHB 3OW4A 2PTKA 3E7VA 5AR2A 4L52A 3UO6A 3NW5A 3EKKA 2QONA 4NH1A 3FQEA 3AXWA 4IE9A 3LXNA 2R3QA 2OSCA 3EMGA 5BVFA 5JEBA 4YZBA 2I0EA 5EOBA 4JBOA 3NX8A 4KUJA 5AR4A 2IO6A 3M2WA 4EZ7A 4FTQA 4UB7A 1F0QA 2EB2A 5AA9A 4ZK5A 2C4GA 3LKMA 3ALOA 3E63A 4BKYA 3W55A 3FHRA 2W4JA 3B2WA 4IB3A 4NM7A 4WNMA 3VW8A 3R9RA 4FZDB 1I09A 3QQUA 5GIOE 3FZPA 2ZVAA 3GC0A 5E8WA 3RPYA 4BGHA 2W05A 3NUXA 4TYGA 2W5AA 4KS7A 4RX5A 1Z57A 4G6NA 4N0SA 4BICA 3TEIA 3GFEA 3F5PA 3W2PA 2BZJA 2QD9A 4YURA 3OOGA 4E5WA 5E8ZA 2YABA 2XVDA 4F70A 3TIYA 5ETFA 1CTPE 3PXFA 4QP2A 1ZYCA 2BKZA 3QRKA 4CFXA 3OCTA 4YLJA 4EOQA 2G2HA 2VTPA 4XCUA 3O8PA 4J98A 1G8AA 3FXXA 3ZSHA 2VGOA 1WVYA 4DBNA 5I9VA 3QD2B 4RJ4A 3QZFA 4AX8A 1PYXA 2PZPA 3C0HA 3GQLA 4IC8A 4DEGA 2IVUA 1B6CB 2Q0NA 4GFGA 4M15A 3U9NA 2R3FA 2NP8A 4LOPA 2Y6OA 4C61A 5CQUA 4O0XA 5FDXA 3LIJA 3TACA 3MVLA 3O23A 3LQ8A 3ZBXA 4QMYA 5E9EA 2YACA 1U5QA 2VO3A 3RBWA 4ALUA 2RGPA 2VTJA 1BL6A 4ZJIA 2A2AA 4CTBA 4GH2A 3GI3A 4CG8A 4DH3A 3VUGA 3ZO3A 1YWRA 3S00A 1Z5MA 4EONA 2X81A 3KVWA 2HOGA 4O1OA 4CKIA 2C1AA 4MWIA 4ZLOA 3L8XA 1Q61A 2WFYA 3OCSA 5KUPA 3PIYA 3ZLSA 5FTGA 1NVSA 3RALA 4FEQA 2FO0A 5CEMA 1DM2A 1OIYA 2RF9A 5FDPA 3UVQA 1LR4A 4BDIA 2WAJA 4GW8A 4MXAA 4I92A 5JSMA 3VBVA 4G6LA 4BC6A 2UZWE 2HZ4A 3UOJA 5IQFA 1DAWA 2G15A 4USFA 2WOUA 4F9YA 4HVSA 2W1ZA 4D4VA 4NK9A 4QRCA 4EK6A 2B9JA 3BHHA 5IUHA 1JKTA 3FE3A 4UXQA 2XKFA 4MVFA 4TXCA 1OITA 1J1CA 4II5A 2BIYA 4RA5A 2GMXA 4XEYA 3ALNA
chains in the Genus database with same CATH superfamily
5IQBA 1RW8A 4YPSA 5JRSA 4AW0A 5JGBA 4MD7E 3EQBA 5DGZA 2OXYA 3ROYA 3O8UA 4GS6A 4YZ9A 1QPJA 3GCUA 3BBTB 5ANIA 3VJOA 3BQRA 3C4EA 4KA3A 4XBUA 2ZJWA 2R7IA 4APPA 5CAVA 3MPMA 4M13A 4FR4A 4X7QA 5DWRA 4O7ZA 1WBVA 4I6QA 5EFQA 4IB1A 4KKHA 5HBHA 3H0ZA 4K11A 4C7TA 5BMMA 4Q9ZA 4FKVA 4FC0A 5AV1A 4ENYA 4XOYA 5I9XA 2B52A 3G2FA 5HHWA 2J4ZA 3CPCA 2XK8A 4OT6A 3A7IA 3AMAA 1APME 1SZMA 1L3RE 4IAYA 2J0MB 4IWDA 3AMBA 2R3RA 2X0GA 3OD6X 1JVPP 5EW3A 5A4LA 5AADA 2WMSA 3E64A 3QD0A 3GU8A 3JPVA 3FBVA 4PX6A 4DG0E 4NW6A 3CC6A 1Q8ZA 4BKJA 5FUTA 5FM2A 3K3JA 4O7WA 3H9FA 3G51A 1J1BA 4BIBA 3I79A 4Y95A 3MESA 2ZV9A 3W0OA 3R7VA 4IEBA 1O6LA 2QU6A 3PWYA 4BTKA 4F65A 3KMMA 4FTCA 4QYHA 3QLFA 4IFCA 3L8SA 4HZSA 5DNRA 4AXEA 3TUBA 4DHIB 3Q53A 1ND4A 1KE6A 3BCEA 3ZU7A 4RX9A 2XB7A 2W06A 3LCDA 1UV5A 4YJOA 1PRYA 4CSVA 4FRFA 4QO9A 3FQHA 5K5XA 4M7IA 2HZ0A 4XG2A 1H8FA 1REJA 3E3PA 5AUTA 5BPYA 1BMKA 4AT4A 1OIQA 3Q9XA 4G3EA 4PNKA 4UZHA 5DHJA 3VBQA 2WMBA 3DDQA 4EUTA 2WTIA 4Y85A 4YNOA 5I9YA 3AC4A 3IECA 4DH7A 3R8MA 3RAWA 4FK6A 4AXDA 2WMRA 2YCFA 3HMNA 3HMIA 3IQ7A 4HPUE 4RJ7A 4YC3A 2PVKA 3QX4A 5B0XA 3QAME 4HVIA 2IZTA 3SHEA 4GIHA 3I4BA 3BHVA 4F1OA 2JIVA 2EXEA 3FQSA 2VUWA 4YJTA 3RHKA 4APCA 2PZRA 3G0EA 5L2SA 2QR8A 1FVRA 4PDPA 3L9LA 1H4LA 4XG4A 3W32A 4AGUA 5CAQA 3GFWA 2IZUA 4O6LA 4DN5A 3RAIA 4FT3A 4RWKA 2ZV7A 5ANJA 5IKWA 3O7LB 4B7TA 4L44A 3SXSA 2XK6A 4V01A 4BYIA 1P4FA 1YKRA 2O2UA 3CJGA 2WD1A 4TW9A 5L3AA 3PY3A 4O96A 4YSJA 4GUBA 5EDQA 1R1WA 2WIPA 4L7SA 4QP4A 2WHBA 4AUAA 3VONA 2C6TA 4PRJA 3BQCA 2PE0A 2YFXA 4BDGA 2PMOX 2X0PA 3BHUA 3VUKA 4ZSAA 5BVEA 3D7ZA 4IX4A 4FV7A 2F7ZE 4PV0A 4CVAA 2QO2A 5IMEA 1GOLA 3U4UA 2UW9A 5HG5A 2GU8A 4KIPA 1ZZ2A 2OJIA 2PWLA 4CMOA 5E91A 2WTWA 5EI8A 4CV8A 4QP8A 3KCKA 3N51A 4NZWB 4RIWA 1B38A 2JBPA 5E8TA 4DTKA 2DUVA 1CM8A 2X7OA 3DK7A 2BHEA 2W99B 1YDTE 5LMAA 3MDYA 4XYFA 3OT3A 4CT2A 4PP7A 5CANA 3RMFA 2IJMA 4QMVA 3R30A 4I23A 4TYEA 3C7QA 3NPCA 2ITYA 4LL5A 3ZS5A 2QVSE 3O50A 2OJFE 4C33A 4PF4A 4G5PA 4F0FA 2X8IA 1VR2A 2R3NA 3EYGA 5CVGA 5LMBA 3CQWA 2DQ7X 3OUNB 3G15A 4NM0A 2Y7JA 4AZWA 1VEBA 4FL1A 3CGOA 4K33A 3R7YA 2G01A 1TVOA 4L42A 3VJNA 3W18A 2V22A 3CCNA 4DFZE 4EC9A 4BCIA 4BB4A 4OTQA 4XRJA 4E20A 2X6EA 5EYDA 5GZ9A 4QMSA 5D10A 2GNHA 3JS2A 2CDZA 2XK7A 3CTHA 3MI9A 4FKSA 4KSQA 4B9DA 3KN5A 4FZAB 3MS9A 4WO5A 4NCTC 3GCPA 4ZAUA 2QLUA 3JVRA 2OK1A 3UE4A 2YJRA 3MB6A 4OTDA 3TT0A 4QTCA 5E90A 3HX4A 1W83A 4UN0C 3EFLA 3F3WA 3WZUA 3E8NA 4TT7A 2J5FA 3ORPA 2IWIA 2VV9A 3GC8A 2JAVA 4RJ6A 3RGFA 3MJ1A 4EK5A 2XJ1A 4YZMA 3ACJA 2VX1A 3PZHA 3QC9A 4FYOA 4PMTA 4FVQA 4DEIA 4MD9E 2PUPA 5FGKA 2XK3A 3R8UA 4D9UA 4UALA 2BILB 3W16A 1CSNA 2I0YA 3QKLA 5JZJA 5M4UA 3AD5A 3R1NA 4R7HA 4KABA 4PMSA 3MIYA 4M84A 3LQ3A 1W2DA 4MWHA 5GNKA 4EK4A 3FMEA 3SGCA 2BPMA 2JDOA 4JG6A 3LXLA 3WYYA 4ZTNA 1ZMVA 4ACHA 3KC3A 1VYZA 3FC2A 3WF5A 3NVKI 2FSTX 3E3BX 1W8CA 3QTRA 4XG7A 3WZKA 1OPJA 3LFBA 3EYHA 3F5XA 2UW8A 1VZOA 2PY3A 4FKUA 2W1FA 3E87A 3W33A 4ITIA 5J87A 4F09A 2PVHA 3DKFA 3TNIA 2H8HA 2CLXA 4X0MA 4ACCA 4LDTA 3PIZA 4Z55A 3UPZA 5DOSA 3KK8A 3W1FA 3KXNA 2EWAA 4G3GA 1Z9XA 3QTSA 3HV7A 3AD4A 4ZLYA 4BCGA 4O6EA 5B2LA 3F2NA 1OKVA 1PXIA 3LE6A 4OTPA 2QOQA 3QZIA 2QI8A 3KXGA 3ORLA 3QA8A 3MH3A 3LFDA 5AIKA 4XP2A 4JR7A 4M66A 2VO7A 2YM8A 4ZIMA 4E1ZA 3AGLA 1B39A 4LOQA 1ZZLA 5GZAA 1BI8A 2GTMA 3WE4A 2WTKC 3O2MA 4ZMFA 2OKRA 3FKOA 4O0WA 5AJQA 4LRMA 3MVMA 2OO8X 4U43A 4JX7A 1FVVA 5E8SA 3TNHA 1OGUA 3FAAA 3GGFA 3TTJA 3VBYA 4C3FA 1QPCA 4DBXA 5HIEA 3PIXA 5IMXA 4R3CA 4B8MA 3TDWA 5BVDA 1ZYJA 2C6LA 3OXTA 4FTTA 3RJCA 4AN9A 2XIRA 4RIWB 1ZRZA 2X9FA 1BX6A 5CZIA 3SXFA 4OBOA 4IANA 4I20A 3FLWA 4XX9A 4DFXE 3OZ6A 2PUUA 3IPHA 3M42A 5ETIA 4M69A 4DYMA 4F9BA 5A54A 3MGYA 2XIKA 2QR7A 2PUNA 4PUZA 4TYJA 5E7RA 2C5NA 1XR1A 3F3TA 3HV6A 4C36A 3EJ1A 1JKLA 3R00A 2GQSA 4L45A 5CWZA 2QOKA 3I81A 2IZSA 2QNJA 1GZ8A 3K2LA 4Z9LA 5CEKA 5DA3A 5L2TA 4USEA 3V51A 4F6SA 3UZTA 3POZA 2O64A 4XOZA 3P79A 5E8YA 2ITPA 4S30A 2CKOA 1T45A 3R8LA 2P33A 3HA8A 5T6KA 4KAOA 1EH4A 3MV5A 3U6JA 5IQHA 1WCCA 5CSVA 3DPKA 5HCXA 3LJ2A 4UXLA 5IZFA 3PYYA 2XK9A 5CY3A 2J0IA 3O0GA 4ITJA 3ZSGA 4XMOA 3WF7A 3DBQA 3H10A 2C6IA 3MVHA 3NR9A 2ZMCA 2ETKA 5F4NA 5CAUA 4GK4A 1SNUA 5L2QA 2BDJA 1V0OA 4BGQA 3OEZA 5GJGA 5AFVA 2VX3A 3NYXA 4B99A 2WKMA 4EWHA 3LPBA 4UBAA 4Z7HA 2E9OA 4FSNA 5CXHA 3Q6WA 1BKXA 4FG8A 2XKEA 5M4FA 4F64A 3ZFMA 3UODA 1OM1A 1R78A 2A1AB 2IN6A 2FYSA 3FKNA 3MFRA 4NYEA 3D83A 4EBWA 3C4FA 4KD1A 2QQ7A 3ZLWA 3V8SA 5DRDA 4C4JA 4D58A 5EYKA 4E8AA 1H1PA 4I0SA 2AUHA 3D7TA 1CKPA 2XM8A 3IGOA 2ZFYA 4EH6A 4F1MA 4IAFA 4FSRA 4FTUA 3QTZA 5L6OA 4KINA 3AGMA 1PKDA 4ASDA 2BZIB 3WF9A 3CJFA 4FV3A 4FSWA 4EKLA 1NT2A 3RINA 4I24A 5CSWA 3ENHA 1OUYA 5GINE 3QBNA 4U45A 4FEVA 1KV2A 2OIQA 3K54A 2NPQA 5CU2A 2J2IB 4LGDA 5LARA 2V7AA 4ANNA 2BAKA 3EFWA 5KMKA 2ITOA 4PQNA 4WKQA 2C0IA 3DS6A 3H4JA 3HNGA 4CYJA 3CSVA 5AUXA 3H0YA 1O6KA 3ANQA 3W2OA 4WIHA 3UIBA 3NRMA 3GVUA 4WNKA 4U79A 4BDFA 4DFUA 4E4MA 3L8VA 3UOKA 4I22A 2GS2A 4MNEA 4DE4A 4JJRA 1DI8A 3RP9A 4QP3A 5AV4A 4O81A 5EW9A 4FIEA 4ZS4A 2B53A 4ZZMA 4E6CA 3GC7A 4FNYA 2HAKA 2UW4A 2XIXA 3ZXTA 2FGIA 3BBWA 4JLCA 4L67A 3FMHA 4PDSA 3D14A 2ZM1A 5CI7A 3TNQB 3PSDA 4EOSA 3C1XA 4TKSA 4BI0A 1H27A 2ITZA 3HMOA 3P7AA 3ENMA 5HG8A 4XNEA 2F49A 3HV4A 4IB5A 3V8TA 4D4SA 1ZYLA 3PJCA 3ZEWA 5IU2A 3QF9A 1GIIA 5CF8A 3Q32A 2OJ9A 4OAUC 2JDSA 4IVAA 5K0KA 4WUNA 3Q2MA 4KIQA 4EHVA 1PXNA 1H1WA 2CGWA 3PVWA 2QO7A 4JDJA 4GVAA 4AZFA 4UY9A 3D0EA 2R3OA 1ZOEA 3NNXA 3DOGA 4J99A 5HX6A 3KGAA 4FNWA 5AP1A 2X4FA 3SOCA 2C68A 2GHGA 2R64A 4CQEA 5J1WA 2YIXA 2ERZE 3DAKA 4O83A 3M1SA 2Z2WA 3CQEA 4R3RA 4RC4A 4DG3E 4DHFA 4NCTA 1SM2A 4C02A 4I93A 3C4XA 4I3ZA 3ZDIA 4F0IA 2GCDA 1P2AA 4FEWA 2BVAA 4QMXA 3Q5IA 5DPVA 4AN3A 3W0QA 1VJYA 3H9OA 5HO7A 4FTIA 3MFUA 5ANKA 2CPKE 2XIZA 4IZAA 2QHNA 2WEVA 2WPAA 2XH5A 3AC1A 3DQXA 4M69B 3ZSIA 4A4OA 5J5TA 3RZFA 4MXXA 3ZC5A 3ZUVA 4A07A 4C8BA 1GAGA 1MRYA 4O2PA 3ZUTA 2J6MA 4ZZNA 4CXAA 4LRKA 1XH6A 4AW5A 2F57A 4BCMA 4ERKA 3GEQA 5FXQA 5CEQA 2BALA 4YPDA 4H1JA 3LFNA 3QRUA 5HIBA 5K0XA 1R0PA 3K5UA 4GJ3A 1UVRA 2Y6MA 2PVLA 1RDQE 4A9TA 3EQCA 4A9RA 5KMOA 5KKRC 2Y9QA 2P4IA 4XJ0A 2YITA 3ETAA 3DK6A 4FKQA 4LV8A 4FK3A 1ZYSA 3FC1X 5DEYA 5AUWA 4PMMA 2J51A 3RM6A 5JFXA 2W1DA 3N4VA 2ZOQA 3VRZA 5IQDA 2JD5A 2BRGA 4L3LA 3DBCA 4MCVA 3RK9A 4EZ3A 5HCYA 3LM0A 4GG5A 3BU5A 3A7GA 1Q8UA 1QPDA 3Q3BA 3TZMA 2VD5A 3F61A 4J8NA 5FEQA 5KMMA 3U55A 3BE2A 4M0ZA 3LZBA 3D94A 4N70A 4XV9A 1YVJA 2ITVA 1DS5A 1WVWA 3D7TB 3QC4A 5EQPA 3A8XA 3CY2A 4DEBA 4HYSA 2A19B 1VYWA 4AA5A 1A48A 3MYGA 3PXRA 4QPAA 4XBRA 4X2JA 2J0JA 4C59A 3ORXA 2XJ0A 2WZJA 2JDVA 3VO3A 5CU6A 3DFCB 5CEOA 5GHVA 5EM5A 4DG2E 4JBPA 3VS3A 3Q96A 4YLLA 3KRJA 2JKOA 4XHKB 5EM8A 2J7TA 4I6LA 4EH7A 5M53A 3QX2A 4WSQA 3T9IA 5L2IA 3QKMA 5IA5A 3R7EA 1KE5A 4TZRA 2VNWA 3MPTA 4MXZA 1FQ1B 5JH6A 2BDWA 4TWOA 4AOJA 3DB8A 3VNTA 1ZYDA 2XKCA 5D12A 4MNEB 5G6VA 5ACKA 3II5A 4QQJA 1ZWSA 2A4LA 2BROA 3VRYA 5HI2A 3BU6A 2UZBA 4YTCA 1REKA 4LUDA 4NKSA 3RCJA 4DH5A 2UVZA 3BI6A 4FTJA 4GT3A 3H30A 3IW7A 1PHKA 5EG3A 2W1EA 3FSKA 3JUHA 3GU4A 5H2UA 4FEUA 5CXZA 4EHGA 3ZLYA 2GDOA 2ZM3A 1A9UA 4HGSA 3TV7A 4UMUA 5M08A 4RQKA 4M0YA 3UQCA 3BEGA 4Y46A 4EH9A 4IVCA 4FKRA 4DA5A 3PSBA 4RSSA 3HV3A 4DTAA 3FY0A 4QMWA 2DWBA 4KWPA 1Q97A 1JPAA 4FNZA 5I9ZA 4QMMA 4BR3A 4ENXA 4MXCA 4NWMA 4IBMA 1GZOA 2WTJA 3ZLXA 5IA2A 5L2WA 3DNEA 1XBCA 5L8KA 2QG7A 2X7FA 5BVNA 1UU8A 5JFSA 4Z16A 3C50A 5BV3A 5LWMA 4CCBA 5IA0A 3NIEA 3P9JA 3Q2JA 4ALVA 3IS5A 1XH5A 4FUYA 4J7BA 4TPTA 5HQ0A 5E4HA 3OBJA 4FT9A 1PXKA 4PMPA 2J50A 2F9GA 1H26A 2XJ2A 5LVMA 3MTLA 3DT1A 4BDEA 3D5VA 3DZQA 3Q9YA 2BRMA 2V5QA 4XS2A 4IM3A 3UOHA 3HZTA 2VWYA 3G9NA 4QD6A 2OZOA 4LUEA 2XRUA 3HP2A 3BWJA 1J7UA 3PXYA 4E4NA 3QTIA 1H0VA 4ANSA 4O2ZA 2PPQA 1U46A 3DXNA 4R1YA 4GYGA 3NS9A 4QMZA 2WO6A 2YEXA 3QUDA 4D0WA 3CGFA 2HWOA 3WZJA 1GZKA 3DFAA 3RKBA 3LAUA 1WFCA 4FYNA 2YWPA 4V0GA 4WD5A 1LEWA 1OL7A 3OCBA 5ANEA 3TUCA 4UMRA 2PMIA 5EHLA 2W4KA 1SVHA 4MQ2A 4Y83A 4I41A 4YC8A 4OBQA 3DXQA 2YCSA 3EB0A 5HE2A 3R71A 4IQ6A 4DFNA 3RPSA 4O1PA 3BWFA 3NUAA 3HV5A 4FODA 2HZNA 4K0YA 2R3PA 1ZARA 3E92A 3FUPA 5BQ0A 4A4LA 5EHOA 2WQBA 3DJ7A 4G34A 3LW0A 4LMUA 3WF8A 3ZRMA 4U81A 5K3YA 3KXMA 2XCHA 2HZIA 4BCPA 3P7BA 2E9PA 4D2VA 4TWCA 3FZ1A 3Q6UA 1TZDA 1G8SA 4AXAA 3PDTA 1PXPA 2W17A 4FBXA 4RC3A 4QEBA 4DFBA 3R63A 1KWPA 3ET7A 4BTMA 4RIXA 2WMWA 3DBFA 2GNJA 2W1IA 2X0QA 5FXRA 3UIUA 1J7IA 4FMQA 4AW2A 5FTQA 2UZDA 2GNIA 4RG0A 4X2FA 4ZSJA 2PUIA 3QHWA 5BUJA 4IAKA 2B9IA 4FTMA 4ZTSA 5F9EA 2GS6A 2ERKA 2JIIA 3MBLA 2WTKB 4FVPA 4GFMA 3SOAA 4RVKA 3TV4A 4J96A 1OBDA 2E9UA 4HGLA 4AN2A 2HYYA 3ZONA 3DY7A 1KE7A 4FE2A 5EI2A 3MPAA 3BYSA 4FKLA 2XNBA 4M8TA 5KBRA 2HXLA 3QQLA 3ZUUA 3SKCA 2LGCA 2BFXA 4PPCA 5FEDA 5HLNA 5HU9A 5KHWA 3AC5A 5AV3A 5TT7A 3V5PA 3EWHA 1H1RA 2HCKA 3D4QA 3QD3A 4OTGA 3ZRLA 4E4LA 4CZYB 4ORKA 4BDAA 2DYLA 3ZBFA 4AS0A 2EUFB 3BYVA 4D4RA 5DVRA 3QXPA 1PXLA 2R2PA 2WMXA 3TV6A 4IB0A 1MQ4A 2YA9A 3EN9A 2IF8A 5LJJA 4RRVA 4N4SA 4QP9A 3SW7A 3N4TA 1OB3A 2CGXA 3QQHA 2Q83A 1U5RA 5DLSA 1DI9A 1DAYA 4LQMA 2V7OA 5FBOA 1KV1A 1W84A 4O27B 4AZVA 3EIDA 2C0OA 4RFZA 5DI1A 1OZ1A 4EUUA 3TM0A 4HNIA 2VRXA 4YHTA 3EN4A 4ZSGA 5AWMA 4L6QA 2Z02A 2YM4A 2C5OA 3TCPA 1YHWA 5JQ8A 2C6DA 2QKRA 3G6GA 4QYGA 4MH7A 2R7BA 1PMNA 4YZCA 2PZYA 4LOOA 5CU0A 3EQPA 3G9LX 3KK9A 3RPRA 4HYHA 4JG8A 5FWKK 4K9YA 3QQJA 2XEZA 5HVJA 2OWBA 3PPJA 3QCQA 3QGWA 3BX5A 2I6LA 2X8EA 4H1MA 4NJ3A 2P55A 4AAAA 1URWA 4F99A 4F63A 2UZNA 4JIKA 4JRVA 5HLPA 4JMQA 4G17A 2XCKA 3PFQA 4F9CA 5ANOA 1PMVA 3BYMA 4F08A 5EYMA 4BCHA 5IH5A 2YIYA 3BKBA 1FINA 1GZNA 3KULA 2ZV8A 4DITA 2G9XA 2X1NA 5DR6A 3OS3A 2FVDA 4O0VA 2BTSA 4FTLA 4CQGA 3FI3A 2YAAA 3LJ1A 3CTJA 3MY1A 5KMJA 3ZTXA 2XYUA 4E5AX 4EC8A 2OG8A 4MUQA 3MIAA 4PL4A 5DEWA 2OI4X 3IONA 4ANQA 4JOAA 2ETRA 4NSTA 4QQCA 3SRVA 2AQXA 2F7EE 3DLZA 1OPKA 5GJDA 4BL1A 1OL6A 3TZ8A 4ZLZA 5EKNA 1ST4A 3UDTA 4KIOA 5HBEA 2CKEA 4GSBA 3F66A 4I6HA 1OKWA 4D9TA 1XJDA 3RM7A 1OECA 4QMQA 2JDRA 3TUDA 3BGPA 4AZEA 1JSUA 2WNTA 2C5YA 3QZGA 4F7JA 3UVRA 4FA2A 4DFLA 2YAKA 2C0TA 3FV8A 3U87A 2VO0A 4QPSA 3W8QA 1M14A 4L9IA 2W9ZB 4UMPA 5J8IA 1OGYA 4YTIA 3WYXA 5FM3A 2CGUA 3C9WA 4FG9A 5IA1A 3DTWA 3UIXA 3OBGA 4BY9E 3FMJA 2CN8A 3QUPA 3BLAA 4KRDA 4RIXB 2XS0A 4F6UA 4IX6A 3KXZA 1PXJA 2C47A 4JX3A 3EQIA 4EQCA 3R0TA 3F9NA 5DIAA 1H24A 2P3GX 2WQMA 3RPVA 1MRVA 4YNEA 4D1ZA 4I5HA 5K5NA 5ACBC 1W7HA 3V6RA 2Z8CA 4Q2AA 4S31A 5HD7A 3Q04A 3MW1A 1STCE 2BR1A 3BGZA 4EH5A 4F0GA 4NU1A 2CKPA 4DHJA 4D4YA 4EEVA 4RC2A 1UKIA 4NJDA 4CYIA 4O82A 3PXZA 2B0QA 4RMZA 2PMNX 5EK7A 3HGKA 5KZIA 5IDPA 5HE0A 3DQWA 1PKGA 2XEYA 1YOMA 5KBQA 2GHLA 3NLBA 3RCDA 1RE8A 4CMUA 2A27A 4CZUA 4EJ7A 1WZYA 4BI2A 1GIHA 1LUFA 1G3NA 2PULA 3AOXA 2WMQA 3QHRA 3F7WA 3FLQA 4PY1A 2XBAA 2ITXA 4J71A 3W2QA 4NT4A 5HD4A 1L8TA 4R78A 4GK3A 5M4IA 4O7LA 3KRWA 1OMWA 4AW1A 2R9SA 2Y0AA 3A4OX 5E1EA 4G3FA 4ZSLA 4KBCA 3UC4A 4C4IA 3UNKA 3UO5A 4AQKA 2WU6A 1XKKA 4RLKA 4FKIA 5CTPA 3EKNA 3QUEA 4FGRA 2YM6A 3QCSA 1URCA 4LGHA 4ZMEA 4GEOA 3VVHA 2CGVA 4NFNA 5KKRB 5IG1A 2W5BA 1W98A 5LWNA 5FP5A 3KMUA 4C2VA 3UG1A 4OGRA 2B9HA 4XV1A 4OT5A 4BCQA 3UP2A 5EM7A 4KRCA 4BDJA 4Z3VA 3HRBA 4R5YA 5HTBA 1RQQA 5DN3A 3RI1A 4O84A 3E88A 2W5HA 3C4ZA 2RG6A 1P4OA 2I7QA 1WBSA 2ZDUA 2HY81 2FH9A 2QKWB 1FMKA 3EQDA 4FOBA 2A0CX 5FBNC 3MFTA 4FV8A 3AT2A 4G6OA 5CYIA 4HCVA 3PA3A 1YI6A 3QWKA 5JN2A 1UU3A 3Q4UA 4IFGA 2R3KA 2AC5A 2ESMA 2CCHA 3KULB 2YHVA 3F2AA 3O8TA 3VS7A 5JGDA 2GNLA 4AAYA 4HW7A 4FUXA 5LVOA 3UG2A 4BTFA 4YBKA 5KO1A 3SW4A 1NVQA 1Q62A 5FRIA 2Z60A 5CALA 1G8KA 2PE2A 4O4BB 2RFDA 3ZO1A 1V0PA 2YDJA 4YZDA 2Z7QA 4GJ2A 4OAVB 4LGGA 1ZXEA 5LOHA 3TYKA 4D5HA 4AQCA 2BIKB 3SXRA 3EQHA 4RZWA 3JY9A 4JAJA 1SVEA 2BAJA 5CS6A 3SC1A 3SRVB 5J1VA 3UDZA 4MTAA 2XP2A 3P0MA 1H08A 2R0IA 4BGGA 2XBJA 4R1VA 5AUZA 3REPA 2BRHA 2ACXA 1SVGA 5IQEA 2ITNA 3I0QA 4WT6A 2Y4IC 4EORA 3TJCA 4V05A 2JLDA 2PSQA 2XRWA 4BN1A 4O21A 1GY3A 5LVLA 4QYFA 4DF3A 4RX7A 5A3XA 2OF2A 3QTQA 4KSPA 3R21A 4TWNA 4WBOA 4IWOA 4X2KA 2IW9A 3R7IA 3RHXA 3VS1A 1H28A 3FSFA 3PVBA 3E8DA 4X3FC 3OOMA 5H8EA 5TKDA 5J7HA 3MH2A 1KOBA 3HA6A 3VBXA 3VHEA 5L6PA 2CJMA 4FGBA 4U44A 4QMLA 4DH8A 3QCXA 2AEGA 4RLLA 4MNFA 1O6YA 3ZYAA 4DEHA 4FZFB 1XH8A 3KB7A 4L46A 4CFMA 3FI4A 2PK9A 2X9EA 3AC2A 5JT2A 4ACMA 3EOCA 2HWPA 3HUCA 3T3VA 3PXKA 3R2BA 3K5VA 4LYNA 4B8LA 3QTXA 1BL7A 3BIZA 4U0IA 3UOLA 4ASXA 5TE0A 4J97A 2IVSA 3UZRA 5E8UA 1E9HA 1QMZA 3O17A 4GUEA 3RK5A 2VTTA 3TIZA 4ITHA 2F2CB 3GBZA 4H58A 4J1RA 2UZOA 3EN6A 4DGMA 4L3JA 1IG1A 3V5LA 4WHZA 5AP0A 5L8LA 4E6DA 3RNIA 3FHIA 5A4EA 4NFMA 3H3CA 2ONLC 4BF2A 3LFSA 2QCSA 4EZ5A 5M44A 2GSFA 2XK4A 3KXXA 3EFJA 3QL8A 2OH0E 5I3RA 4HZRA 4RIYA 4J52A 3GU7A 2OXXA 3TKUA 3FLSA 4CFNA 1UKHA 3KQ7A 3PPZA 4C57A 2WTCA 3KRLA 3QKKA 1G8JA 5GIPE 1F5QA 1Q5KA 2EVAA 2GTNA 3EN7A 3FLZA 3GT8A 4FZ7A 4YJUA 5IQAA 3HEGA 1W82A 2GFCA 4XUFA 5EM6A 2O3PA 3FMMA 5A4QA 1WBNA 4PP9A 4BDHA 4YTFA 4EOLA 1QCFA 1NY3A 5B2MA 1OPLA 2ZB1A 1Q99A 3TN8A 2UW3A 2UZTA 3QYZA 3POOA 1OBGA 2YCRA 4NL0A 2NNWB 2AYPA 4WG4A 2PYWA 4K18A 3DDPA 3SV0A 3OHTA 4I6FA 4S32A 3PRIA 4C0TA 4X2GA 4OTWA 1FMOE 4E6QA 1XH9A 2VTOA 4EH2A 3GCVA 3N9XA 1W2FA 2VNYA 3W0NA 3ULZA 2ZB0A 2YERA 3LXPA 3F5GA 4FT5A 3HDNA 1Y6BA 3A7FA 4K2RA 3ZC6A 4HVHA 4OUCA 3D5XA 5IA4A 2VTSA 5C9CA 2R3IA 4GU9A 5FP6A 1IASA 4HNFA 3SX9A 3ZCLA 4MYGA 4YJNA 5IUGA 3BHYA 4YJVA 1J3HA 1RJBA 5KZ0A 4BIDA 3G90X 3HMPA 3VS4A 2E9VA 3BLHA 5HZNA 3FKLA 2GHMA 3OTVA 5ETAA 2QO9A 4C4HA 4F4PA 2ZAZA 3MA3A 4FSUA 4R7IA 2C1BA 3ZH8A 4R7BA 3CIKA 1U4DA 4U40A 4WA9A 3NNVA 3KRXA 3NGAA 1PXOA 3TG1A 2RFSA 4EL9A 3P1AA 4W8DA 1Q3WA 3UP7A 2OFUA 4RBLA 4TNBA 4TY1A 2XA4A 4J95A 4Q5HA 2C6KA 4RWJA 4KKEA 2HENA 1YHSA 1TQIA 3A7JA 1HCLA 3OWJA 5AUUA 5C4LA 2CCIA 2JKKA 2WTDA 4IJPA 3COIA 4M68A 5C1QB 5JKGA 4AT5A 1CMKE 3VIDA 3VUMA 3U51A 4YMJA 3C0GA 4AA0A 4S2ZA 3ROCA 1ZMUA 3QQKA 4HGTA 2X6DA 3BLQA 2XKDA 3HAMA 3KRRA 3NFGB 3NUSA 1YXTA 1ZOGA