1XH8A

Crystal structures of protein kinase b selective inhibitors in complex with protein kinase a and mutants
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Design and crystal structures of protein kinase B-selective inhibitors in complex with protein kinase A and mutants
pubmed doi rcsb
source organism Bos taurus
total genus 112
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xh8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xh8A02
5DFPA 4BCMA 3NMUF 4D4SA 2IZUA 2GQSA 4I1ZA 3K5VA 4M15A 3ZOSA 1QPDA 4O91A 4E4LA 4F6SA 5JRQA 2JDOA 3DAJA 4O96A 5K0XA 2BDJA 5I3OA 3R7YA 2UZWE 3LZBA 3LM5A 4WG3A 1H1WA 2I0HA 3VW8A 2WQNA 4PMPA 5HVKA 4R1VA 2WTKC 3ALOA 4OBPA 4DN5A 1VZOA 3QGWA 3QRJA 2UW5A 3QZGA 2DUVA 4F4PA 4FR4A 4CT2A 1UNLA 5LWMA 5KKRB 4F0GA 2NNWB 4FTAA 4JDKA 2YWVA 1YI4A 3VBWA 4RIWA 3BLHA 2O63A 2G15A 2Q0BA 3BCEA 2IW6A 3FWQA 4QTAA 2IW9A 1GZKA 5HBHA 3C0IA 4EOJA 3NEWA 2FH9A 2E9PA 4FKIA 3ZC5A 3NAYA 3VF8A 5BUJA 2IVTA 5HOAA 3GFEA 1ZXEA 2XB7A 4GFOA 2SRCA 4A9RA 3CJFA 3P9JA 3QRUA 3UDBA 4GL9A 3TWJA 5F9EA 1WBSA 5IA3A 3GCQA 5L8LA 1FGKA 2OIDA 2VTOA 2XNBA 4AXAA 2J0IA 1JQHA 2YCSA 1KV1A 4FVRA 4X0MA 2UW6A 1V0PA 4UWCA 3UVRA 3V5PA 5CT7A 2NPQA 5L8KA 4FKSA 3QA0A 4NM7A 2H9VA 2XIKA 3OT3A 4ZTQA 5GZ9A 4XG9A 4ZSAA 3U6JA 5EM8A 2X8IA 3FHIA 5EM6A 2QR8A 5DH3A 2ITQA 2YDKA 2G2IA 4QP8A 3W18A 3H4JA 4KD1A 3R04A 1JSVA 2BTSA 3IGGA 3R73A 1LUFA 2VO3A 2Y6OA 3QTWA 4M14A 4M67A 4ENYA 5EI2A 3VUKA 5BVOA 4NL0A 3R8UA 1V0OA 2X6EA 2QNJA 3PXYA 5DWRA 5FBOA 3MFRA 1XH5A 5DEWA 4XG7A 5ITAA 5D1JA 4WBBB 5AM7A 5JFXA 3KXHA 3QD2B 2ZJWA 3HL7A 4ANSA 1SMHA 3L8XA 4FSNA 3PIZA 3QKLA 4QPMA 3I60A 2YAKA 3FMKA 5LMAA 4FV0A 2HXQA 4QO9A 2WU7A 4RX7A 4O0XA 4NM0A 4BWXA 2PSQA 4J8MA 4GS6A 4XLIA 5A6NA 1J7IA 5AUZA 4KNBA 5HNBA 3VNTA 3P86A 4ANMA 4BGGA 1GJOA 3C0GA 2VV9A 3HUBA 3PVBA 4O0TA 3TZ8A 2HAKA 3EN7A 4G3CA 2Q83A 4RJ8A 4BICA 3O8TA 3TXOA 2UW3A 4JR3A 4GJ2A 2VO7A 2I40A 2BAJA 4H1JA 4PDYA 3VBVA 5GNKA 1O6KA 4G5PA 1W0XC 4BI2A 3IGOA 5AUUA 2ZB1A 4FI1A 5LVPA 3LXLA 4DH5A 5ANEA 2ITYA 4EH4A 3PVUA 4W8EA 4FL1A 2C4GA 1ERKA 2J0LA 3KRWA 5IQHA 1RQQA 4MH7A 4ITHA 3MB6A 3ID6C 4I6HA 3ZZEA 4ZY6A 3N4VA 3AMAA 5E9EA 3HRFA 4F9BA 3R00A 4IHPA 3IK3A 4PTCA 5GIPE 1PKDA 1Q8YA 4I5HA 1W8CA 3UC4A 4Y83A 4GT4A 3G51A 5CY3A 5JRSA 1JAMA 3V8WA 3RNYA 4FSZA 2Y4IC 5I9VA 4AW2A 4BIDA 2ITPA 3OTUA 4PDPA 5HHWA 5IF1A 2ZMDA 3RWPA 3CJGA 3HRCA 3NDMA 4H58A 4C37A 5EQPA 5HVYA 3ANQA 2Y8OA 4DLIA 5L2SA 2OXXA 3RGFA 3HV6A 3EQFA 1JKSA 3KULB 3RZFA 4GEOA 1FMKA 5AX3A 4EH9A 1DS5A 4DBXA 2VWBA 3LCTA 3ORIA 5HTCA 4YZ9A 3PRIA 4YTIA 2YM3A 3BBTB 4NCTC 3ZRMA 4DH7A 3Q32A 4KIOA 4A9SA 3VBTA 1IR3A 1K2PA 2W1CA 3CEKA 3KN6A 2WTKB 3SD0A 3PP0A 3C13A 3LVPA 3BHTA 5DN3A 2CN5A 4RX8A 4F0FA 2LGCA 4F1MA 3F82A 3DKOA 4E6AA 3N9XA 3UNJA 3L9MA 4BKJA 4C61A 2AC5A 1OZ1A 4FV2A 2R7BA 1Q4LA 4NU1A 2XBAA 4UALA 4XLVA 5CX9A 4X2KA 1KOAA 3CC6A 3B8RA 3E87A 3QYWA 3WYYA 4A07A 4KAOA 1G8SA 4BHNA 3QALE 4FTKA 3R8LA 3SDJA 3V8SA 4DINA 3LFNA 4DITA 3KCFA 4EORA 5M4UA 3NUAA 3K3JA 3KVXA 3GXLA 5HE0A 5K9IA 3UO4A 4FG7A 2ZVAA 3DU8A 3IW8A 3ORKA 3I81A 4YBJA 2B9JA 1JLUE 1U4DA 3A7GA 2QVSE 2RKUA 3CD8A 4FTLA 4FTMA 4P5QA 5FQDC 3WYXA 4CFNA 2P2HA 2R5TA 4PQNA 3JY9A 3RMFA 5HLWA 4RA5A 5I9YA 4FSWA 3HVCA 1W83A 1OIQA 2HW6A 4GK4A 4FF8A 3Q4UA 4PL4A 4DBNA 4DFLA 4DFZE 4BCJA 4FKUA 3R0TA 4ZY4A 3CLYA 2PULA 1J91A 4FZ7A 5HKMA 1WAKA 2VU3A 1PMNA 3HP5A 1W7HA 4RC2A 2WXVA 4JG6A 4GKIA 3C4XA 3CBLA 2GHMA 4EZ5A 3TDVA 4JVGA 4WUAA 2XKCA 5AA9A 4IACA 3GCPA 4KSPA 2XIRA 1YI3A 4UWYA 3MPTA 3VN9A 3GEQA 4Z3VA 4K11A 4QYHA 5HVJA 2J7TA 2R3PA 4GG7A 5FBNC 4GVJA 3D15A 4EZ3A 5FTGA 2YISA 2WMQA 1PYEA 3RKBA 1JSTA 4H39A 3OMVA 2CKEA 3Q6WA 4FT7A 3PLAE 4FIGA 2OLCA 2OI4X 2XZSA 5JEBA 3PXQA 5AUVA 4JBVA 4FL3A 4IAYA 3DOGA 4QP2A 3QQKA 5LARA 2WQBA 1YWRA 3QTUA 3ZH8A 1QCFA 5J87A 1GNGA 2X1NA 4FKJA 5J1VA 4DH3A 3C4ZA 1YWNA 3Q60A 4G6LA 4GUBA 3E3BX 1HCKA 4GVAA 3C5IA 3D83A 5CAPA 1PRYA 1W82A 3DCVA 4RT7A 4UYNA 1TQPA 4Y95A 3TJCA 4DG0E 4EOLA 1JBPE 2WTCA 1Y8GA 5EYMA 3O0GA 4C38A 4ZJVA 5B2LA 5HD4A 4QPAA 4I6BA 2BROA 2VTQA 3VO3A 3VUGA 2GS6A 1XQZA 4RJ7A 1GIIA 2WZJA 4YSJA 1GZOA 3BV2A 2Z60A 3Q96A 4E1ZA 4IX5A 3FKNA 3LLTA 4J7BA 3DBDA 4IFGA 4EWHA 3BHUA 4S31A 3KXNA 2GNLA 1AQ1A 2E9VA 3ZO2A 2Z7QA 4OW8A 4W4VA 4DG3E 2UZEA 3A99A 3ZFYA 5AUXA 3RJCA 4BRXA 1MRUA 3ENHA 2EB2A 3LCDA 2G2HA 5ANKA 4UMUA 5IDNA 1Q62A 3POZA 5E8TA 5IQFA 3H9RA 1H1SA 1DI8A 3GOPA 3NX8A 1Q8WA 2HWPA 1PMVA 2UZTA 5JZNA 2JKOA 3HKOA 2YHVA 4MBLA 4C57A 5GZAA 2YFXA 3VS3A 2WB8A 5HLNA 2RG5A 3PE2A 3DLZA 3FDNA 4X2JA 1LEWA 4EZ7A 2X9EA 2ZM1A 3O7LB 3FAAA 2XVDA 3O50A 4KB8A 3V5TA 5BQ0A 3NVKI 4FUYA 2F7ZE 4WG5A 2ZV2A 3ZYAA 4O86A 3R8MA 1H1QA 1YRPA 5BYLA 2GSFA 3F5PA 4FIIA 3CP9A 1U5RA 4FSYA 3UYTA 3QZFA 2CSNA 5L2WA 3LFBA 3ZUTA 4AE6A 5IH6A 2JDRA 2XIZA 3O8PA 4F6UA 4OTDA 3R7UA 4O0SA 3G6GA 2HWOA 4L9IA 3ORMA 3TKHA 3BHYA 1BL7A 2R3IA 4BCPA 2WMUA 3HEGA 1H1PA 3FLSA 2W1EA 3KFAA 2EXMA 2R4BA 4XV9A 4O83A 4TPTA 4FTNA 4UV0A 2JEDA 4M69B 4EEVA 4U8ZA 4R5YA 4KINA 4WNMA 4C58A 2XKDA 1WMKA 1OPLA 1Y8YA 3DS6A 2QOBA 2J9MA 4XOYA 2PHKA 3PPZA 2Z2WA 1ZOHA 5CZIA 3SA0A 2QD9A 4GK3A 1TKIA 1OKZA 3BU6A 1FVRA 4NH1A 5M06A 3KEXA 1AGWA 1P2AA 4U45A 4BDFA 4FEQA 2YIRA 3LFAA 4CMTA 3TUBA 2XJ1A 4OUCA 5CEOA 3MH3A 5JGAA 4F7SA 2CCHA 5M55A 2BRGA 4D4VA 3D5WA 2YJSA 3LHJA 1H25A 3EQIA 2GQGA 3TZ9A 5BYYA 3BYSA 2G9XA 2BAKA 2ITTA 4C4HA 2XF0A 3EN5A 3O51A 2YACA 3JUHA 3MJ2A 5ANGA 4R8QA 1M52A 4DTKA 1ND4A 4I23A 4RMZA 3H9FA 5IEXA 2J50A 4G17A 4E4XA 4MXOA 4X3FC 4G31A 5LXMA 2ETRA 3PVGA 2GQRA 4IZAA 2WMBA 3A8XA 3U8WA 4DEIA 4UN0C 3LM0A 4APCA 4F09A 1Y6BA 3ZLYA 4FGRA 3KA0A 1OBGA 1OPJA 2I0EA 4MHAA 1NVRA 1BI8A 2VTJA 4FA2A 4BDCA 2XNPA 5HE3A 5FGKA 4RVKA 4FTQA 5HZNA 4NZWB 4N70A 1A9UA 2OICA 4CZYB 1IRKA 2YLFA 1OKWA 4HNIA 3KB7A 1M7NA 2IVVA 3GU4A 3PG1A 3D7TB 5I4NA 2CNVA 4IC7A 5ETAA 4QTEA 4NFMA 4R7BA 5EOLA 3HA8A 4M68A 5TO8A 2R3QA 2V0DA 4HVSA 4FEVA 4ANLA 2UZLA 5J1WA 4LQMA 4Z55A 1RJBA 5H8BA 4E20A 1JKKA 5JFWA 4C8BA 4Y72A 5HTIA 4XOZA 5K3YA 3L9PA 2YDJA 4DT9A 5M08A 5E4HA 3PXFA 3UO6A 2DQ7X 4QQJA 3BU5A 3EQRA 2J51A 3OBGA 2A19B 3UNZA 4FIJA 4G9RA 4JG8A 2B0QA 4F0IA 5HGIA 2OFVA 4IVCA 1UU3A 3QLGA 5KHXA 5D41A 2H96A 4FK6A 3SOAA 3ULZA 4TL0A 3Q2JA 4XG8A 5CEMA 3GNIB 4YO6A 3EZVA 1YHSA 1AD5A 4EK8A 4KRCA 1NY3A 4ASDA 3ULIA 3Q6UA 3BEGA 3NW7A 2PL0A 4I3ZA 4MNEA 5KMMA 4QOXA 2CKOA 4AFJA 3KK9A 3ZUUA 2P4IA 4YZBA 3PA3A 4ANBA 5IQGA 1BUHA 3A4OX 4AP7A 3ZDIA 2R0UA 5IH5A 4BF2A 3RWQA 3RALA 3MH0A 1ZLTA 4S33A 2W17A 4IFCA 4QMXA 1OKVA 5FRIA 5LVLA 3COKA 3G5DA 3KQ7A 4KIPA 3EYGA 1PMUA 3I0QA 2OZAA 4PRJA 3GFWA 5EI8A 4CRSA 1OMWA 4G3DA 2ZAZA 5AUYA 4D28A 3ORNA 5IA1A 3WOWA 3BX5A 4EHEA 4IZ5A 1H01A 1WBPA 1YDTE 3OG7A 4OTRA 4EHZA 5DMZA 3TV6A 3NNVA 3EQPA 4W9XA 3WZEA 5HESA 2WMSA 4KKEA 4IBMA 2W4OA 4X6RA 3O71A 2QONA 2VN9A 4XX9A 4DFXE 3QFVA 2HY0A 2PZIA 2AYPA 2PZRA 2B4SB 3I79A 2F2UA 1Q8ZA 4LL0A 5HCYA 3OWLA 4BDJA 2Y6MA 2YA9A 3TUCA 5M4CA 4YHFA 3VUTA 1OECA 3M1SA 2OJJA 4KS7A 4XRJA 1XH6A 2BIKB 3A7JA 4XYFA 3O96A 4ZEGA 4DFYA 3AD4A 4V0GB 2E9UA 3OW3A 1UNGA 4JRNA 3IQ7A 3CPCA 3NUXA 1M2RA 2JLDA 3BQRA 4QRCA 3W33A 3D7TA 3IKAA 5AEPA 4FG9A 4S32A 2OF2A 4K0YA 2ITVA 4IAKA 4O0UA 3MVLA 2O5KA 2UZOA 3GU5A 3ZMMA 4BIBA 1M2PA 2WNTA 2C3JA 3QBNA 2X2LA 5AP3A 3DBQA 3DAKA 5FDXA 4AA4A 4ZSJA 2WTDA 2ZV8A 2V7AA 1H08A 5D7VA 1PXPA 2FB8A 2B9FA 3HGKA 3PYYA 4TYHA 3V5WA 2NP8A 2HZ4A 4CLJA 4J52A 3DKFA 3RK5A 4BDKA 4EK3A 4DH8A 2C3KA 4O27B 4AQCA 3NRMA 3RZBA 4CFVA 4PNKA 5JMSA 1KUTA 4IB3A 3WBLA 3FLWA 3B2TA 5L6PA 2JIUA 5LQFA 3MYGA 4NTTA 2WHBA 3R9OA 2XK8A 4RQVA 2R3OA 4RVMA 1VYWA 4LRJA 3D5XA 2YWPA 4DTBA 2VWUA 1M14A 4TWNA 5AAGA 5CF4A 2QQ7A 4M97A 2X9FA 4HGLA 3Q5IA 2O0UA 4IVBA 2R2PA 5IKWA 5HU3A 3TNIA 3QA8A 2VX3A 1FQ1B 4YC6A 3ZHPC 4GFGA 3R63A 2PVLA 4O0WA 2ZB0A 4O6EA 1OL2A 3MFUA 3TCPA 3HUCA 3OXZA 2F7EE 3AXWA 4PF4A 4ZJIA 5IA5A 2RFNA 4JL9A 2FSOX 2P0CA 3EFLA 4FL2A 4NFNA 1QL6A 4ZTRA 4F65A 2OJIA 4E3CA 2VWXA 4AG8A 3MY5A 5FUTA 3R21A 3OD6X 1HCLA 4M7IA 1FPUA 4IH8A 3WF5A 1ZWSA 3Q4ZA 4HCVA 2C5YA 4NIFA 4TXCA 1H1RA 3LFDA 3VUIA 4DAWA 5CSVA 4AGWA 3FPMA 4V04A 5C03A 4EYJA 1BL6A 3T3VA 3MJ1A 4S34A 2R64A 3PPJA 4Q5EA 2B54A 3BHHA 3ODYX 2XNOA 4IX3A 4CQGA 4J8NA 4ZTHA 3MY1A 2ZM3A 4KA3A 4OTHA 3QX2A 4DEGA 5IA4A 4W8DA 4W9WA 2C6LA 4R5SA 4D55A 1DAWA 1BLXA 2C6DA 4CV9A 2YZAA 4AZEA 3MWUA 3COIA 4FV9A 4I0RA 3G9NA 4LV8A 3ATTA 2J0JA 2VTPA 4B7TA 2BZIB 4LFIA 4XS2A 3EKNA 1OB3A 3R1YA 4FV8A 5CF5A 5FEDA 1VR2A 3ZEPA 1WZYA 3AOXA 3PY1A 4MXZA 5HTBA 3KRRA 3M2WA 4RIWB 3RAHA 3NYXA 2GTMA 2BVAA 2C6IA 4QMLA 4J95A 4L42A 5D10A 4U6RA 2GFCA 3KU2A 3A61A 3ZRLA 3C5UA 3E92A 3E64A 4BDIA 3VJNA 4A4LA 4B99A 3QRIA 4R77A 4MXAA 3DK6A 3MA3A 4DCEA 3AC8A 4Q9ZA 4WT6A 4J99A 2JKKA 4M66A 5C26A 5IQAA 1PYXA 4OLIA 5DG5A 2UVXA 2WIPA 4FIFA 4Y8DA 4EHGA 1WBOA 2C5VA 2GNIA 4L00A 4B9DA 3ORZA 4TWOA 4ARKA 5DOSA 3QCQA 2XP2A 3HLLA 3H10A 1NXKA 4IDTA 2X0GA 3TM0A 4JBQA 4XG4A 4ENXA 3OY3A 3HMOA 3G2FA 5L2IA 1WBNA 4DGMA 1Q8TA 4F99A 3MPAA 1PW2A 3AC3A 3ZO4A 4E8AA 3LMIA 4AN9A 4RG0A 4Y85A 5KO1A 3NIZA 4I92A 2HW7A 3F5GA 3II5A 4BDDA 4E6QA 5CAUA 2CPKE 5CF6A 4X3JA 4P5ZA 4B8LA 4RWLA 4G6OA 3DK3A 3OXIA 4O7VA 1Z5MA 3DKGA 2PE1A 4MEDA 4IDVA 3ZTXA 3H30A 3RAKA 3QTIA 3OWJA 3AG9A 3FC1X 3KXXA 5EYCA 1BX6A 5A4TA 4MD9E 2VUWA 3QTSA 4QMUA 3WF9A 1YXVA 2ITOA 4NUSA 5HX8A 1F5QA 3ORXA 4DGOA 3AGLA 4DF3A 5AUTA 3HV3A 4AW0A 2PPQA 4CFFA 5AAEA 2PK9A 3ZSHA 1XJDA 3CS9A 3OOMA 2XNNA 3D5VA 2QURA 4OTQA 5HU9A 3Q04A 2XJ2A 4R6VA 2PWLA 5LJJA 3RAIA 5KNJA 3H0YA 3OWPA 3DNEA 5IQEA 3NUPA 4L68A 1YDRE 2YZLA 3F2RA 4RWIA 3QQFA 2PZYA 5E8WA 5J9LA 3EHAA 5AV1A 5IQIA 4AZVA 3RM7A 2Z7SA 4GT5A 3RPYA 3W2RA 5IQDA 4JDIA 4WHZA 4R1YA 2V55A 2PE2A 3NSZA 4ZOGA 1WBTA 5C9CA 1Y91A 3LOKA 5I9UA 4LM5A 4GU9A 2C0OA 4PNIA 4UMRA 3MTLA 3ITZA 4K8AA 1Z57A 5T6KA 5EHYA 4RIOA 3LJ1A 4G3GA 4HZSA 4QYYA 3Q9ZA 2P2IA 3LXNA 2FO0A 4RIXA 3W8LA 4MNFA 4AW5A 2C0IA 4AUAA 2JAVA 2EVAA 3FL4A 2PVNA 4BCKA 2PVRA 2BZKB 4O7RA 3FZSA 4I94A 5C4KA 1OUKA 4L7FA 3FXZA 3VUDA 3ANRA 3WF7A 3EL8A 2WAJA 2WU6A 2F7XE 5E1EA 3Q9YA 4O7NA 2W9FB 4MTAA 3PVWA 4BTFA 2VO6A 4ZSGA 3CPBA 1LEZA 4WNOA 1OL6A 4IAFA 4BCFA 1UKIA 3O23A 5EOBA 4GT3A 2GS2A 4NW5A 2A2AA 3IW5A 3FC2A 4NKAA 4AGDA 3E88A 5C8KA 4MQ2A 2PVFA 3MGYA 5L2QA 1T45A 2YM7A 4ZAUA 4YBKA 4GIHA 2GU8A 2W1FA 4CKJA 3KRLA 1OL1A 3QYZA 4EHVA 1PF8A 3IOPA 1NVSA 3HV4A 2VTAA 4JS8A 2W06A 4MK0A 4FT9A 4R78A 1CMKE 2C68A 4M0ZA 2XRWA 3E63A 3ZU7A 5EYKA 3RNIA 1UV5A 4L8MA 2KULA 2PVYA 4K33A 1LP4A 3MIYA 3Q4CA 4YUQA 2VTIA 2W0JA 3QCYA 3NZ0A 5HO6A 2JIVA 3LMGA 3PXZA 3T8OA 5EKNA 4X6QC 5LCJA 4FIHA 4I20A 3W2CA 4BC6A 4Q5HA 4MCVA 4NSTA 3UQFA 2PYWA 4FNZA 5CNNA 4MYGA 2XNMA 4MXYA 3A7IA 3RTPA 3SRVA 1ZYCA 4O7SA 3MV5A 4K2RA 5CQWA 5AV2A 4YLJA 2IW8A 3RPRA 4LGDA 3LPBA 5AP2A 5H8EA 3WE8A 3QF9A 5EQEA 1XHAA 3BBWA 2ZV9A 2JDTA 4OAVB 2Y4PA 4IC8A 5HLPA 2B7AA 1UU7A 2QHMA 4P2KA 4CRLA 3UC3A 2QOHA 3PA5A 3K54A 4IJ9A 3UQGA 5FTQA 3NGAA 3DT1A 4R3CA 1Q61A 3WIKA 4EJ7A 4DGLC 2W5BA 2XIXA 4U0IA 5DT0A 5JFSA 2UW0A 5J9YA 4IEBA 4NJDA 3SGCA 4R3PA 1UNHA 3QWJA 4BYJA 2BKZA 4UEUA 3LKMA 3AC5A 4IWQA 4HGEA 2BALA 3VBQA 3UOKA 3SW7A 4LGGA 4IWPA 4PPBA 4EBWA 3DAEA 2WMAA 2ONLC 3WE4A 4EQMA 5AP1A 2W7XA 2ZMCA 3HECA 3MVJA 4O0YA 5FTOA 4C33A 2VD5A 3FI4A 3BELA 3R02A 3ALNA 2Y0AA 2VTLA 3F2AA 3IECA 4U7ZA 3GU7A 2J0MB 5BVKA 2WIHA 3NCGA 3UQCA 4DH1A 1SM2A 3SKCA 3EIDA 5C01A 4XCUA 3O2MA 1WCCA 3TNHA 4YO4A 1KE6A 3UPZA 4KBCA 4OTGA 4IJPA 2FSLX 4ASEA 5ACKA 4MD8E 1L8TA 4AZFA 3SW4A 1E9HA 4FV4A 4ZTSA 4I24A 3W32A 2VX0A 3KL8A 3PSCA 4MWHA 3QCXA 5EDPA 2WPAA 1UU8A 1YXXA 3KCKA 4BTJA 4TZRA 4CT1A 4YJOA 1GZ8A 2C5NA 3G0EA 4FKOA 3W1FA 4AN2A 2WO6A 4FV6A 3V6RA 1O6LA 1SVHA 4CCBA 5DPVA 4EOQA 3L1SA 3EYHA 2XNGA 4IW0A 3DDPA 3LE6A 3FBVA 3JR1A 4RZWA 1ZRZA 2XMYA 2F57A 1ZMUA 5BVDA 2UW7A 3OCTA 4XJ0A 2C6OA 3W16A 2CHLA 3CY3A 4NEUA 2BHHA 5DVRA 2BFYA 2W4JA 3DV3A 4JAJA 5FP5A 3U6HA 4FMQA 4PUZA 3EQDA 3R8VA 2IO6A 2O3PA 5DIAA 5CSHA 4JDHA 4WNKA 4EOKA 3R28A 3ZCLA 4AU8A 2CCIA 5JK3A 5M57A 4QP7A 3LLAA 2JIIA 1P14A 4XBRA 3Q2MA 2X7GA 3P1AA 4UMQA 5DBXA 1G5SA 5JGDA 4APPA 2FGIA 4J1RA 4TNBA 3DB6A 5CU4A 2GMXA 4EH6A 4PPCA 2R0IA 5J7HA 1R0PA 5KMKA 3SHEA 1YOLA 4UWBA 4GCJA 2BRHA 1JPAA 3OROA 5E8VA 5A14A 4BR3A 1UKHA 2YABA 4RWKA 3N4UA 3PP1A 4XRLA 3V51A 3ZXZA 5IPJA 4TKSA 4Z7GA 2PZPA 3BWFA 4IAAA 3FLQA 1STCE 5CI7A 4L53A 4EK5A 1O9UA 4U97A 4YR8A 4KKGA 5KMOA 4YZDA 1NVQA 4HVIA 5ETIA 5E8ZA 4GYGA 4TYJA 3VJOA 4YLKA 4FKWA 3OZ6A 3CQEA 4L3PA 4BBFA 4ACCA 5B7VA 5LMKA 2VTRA 4U3YA 3RINA 2WQEA 3F3WA 4IM0A 2WELA 2C47A 2XCHA 3WIGA 4M3QA 4D1ZA 4DFBA 4QP1A 3ELJA 2X7FA 4IB0A 4QP4A 2BPMA 3TKUA 3KY2A 4GK2A 2XIYA 4KKHA 5E8XA 2ITUA 1R1WA 3AQVA 3DZQA 3LFFA 4A06A 2UV2A 3TL8A 3PJ3A 4FEUA 2O8YA 2BILB 1VJYA 3O7LD 4JXFA 3CR0A 5EQYA 3ZFMA 2HIWA 3KK8A 3NNXA 5A4QA 1H4LA 4JLCA 2QOOA 3UBDA 5HORA 5BMMA 3I7CA 1CM8A 5KMIA 3ACJA 3PRFA 2CMWA 5J79A 3QWKA 3OCBA 5CU3A 3OBJA 5HO8A 2Y7JA 4WG4A 2ITWA 4M84A 4C4GA 4MF1A 2FYSA 2OJGA 4ZLYA 3B2WA 5CAQA 3P08A 4OBOA 3W55A 3FSKA 3ATSA 3EL7A 4I0TA 4FTCA 5ANDA 5CSWA 5ANOA 4BCHA 4N4SA 4FT3A 3G6HA 3ZS5A 5TF9A 4CMOA 4EYMA 3HA6A 4JQ8A 2QG5A 1DI9A 5L4QA 3FMMA 3PXRA 4X2FA 4JR7A 3AD6A 2VGPA 3UVPA 1BYGA 5KHWA 5LVMA 3TTJA 3OCSA 3FLZA 5ETFA 1CTPE 3OT8A 3QLFA 3GU6A 4WRSA 3NCZA 4M0YA 4BZDA 3ZUVA 4DFUA 4XP2A 2YM8A 4C3FA 2OZOA 2X8EA 3EN6A 1REKA 4RZVA 3MN3A 1IA8A 1UWJA 4D2PA 3NS9A 3OVVA 4YURA 1ZMVA 1TQMA 3MTFA 3ZRKA 4FBXA 4MKCA 3U55A 5EK7A 4C02A 4F9AA 2OJFE 2J5EA 5CT0A 1I09A 1MP8A 4YHTA 1Y6AA 2VWVA 3LJ0A 3PJCA 5CASA 2X4ZA 3BHVA 3ZSIA 2X8DA 4AA5A 4B0GA 3UZTA 1OGUA 1KE9A 1TQIA 3MH2A 2CGXA 3P4KA 2WQOA 4IANA 4UY9A 2W96B 3S3IA 3QTXA 5JZJA 3FKOA 4MF0A 2YM5A 2ITZA 3Q9WA 4U44A 1RDQE 2WGJA 5CEQA 2BAQA 3R22A 3DFAA 2QOFA 1ZY4A 4ZMFA 2C69A 3V5QA 5E8UA 3R9HA 4FK3A 4EC9A 5DNRA 3DPKA 3LW0A 4MNEB 4TTHB 5E91A 4ACDA 3KREA 4JAIA 3P0MA 4UMTA 4IVAA 5KBRA 4ZMEA 3EFWA 2BUJA 4TNDA 4CKIA 3V04A 3WZUA 1KSWA 4KS8A 4L45A 2HK5A 4EOMA 3TZ7A 5AWMA 3GC8A 1U54A 3RCJA 2J90A 4U43A 1YHVA 4H3QA 4HGTA 5HG8A 3DXPA 3RHXA 4JOAA 4WBOA 2OZAB 3NNUA 3HNGA 3OEZA 3E3PA 4GFMA 1FBNA 4FEWA 3BE2A 3FE3A 4G6NA 5GIOE 3WZJA 3R8PA 1GIHA 2V5QA 3C0HA 2EXEA 1T46A 1ZYJA 3PZEA 4UYAA 2OU7A 4ERWA 3ZSGA 3ACKA 5FDPA 3JXWA 3V5LA 4K9YA 4BGHA 2VWYA 4G1WA 2BTRA 4GW8A 3LIJA 5IH4A 5FEQA 3NYNA 3T9IA 4E5WA 5AMNA 4A9YA 5K4IA 4LV5A 3IONA 1UWHA 4O22A 2PUPA 2XS0A 2QG7A 1SNXA 1U46A 3FEGA 2OJ9A 2GNHA 4AZSA 2PUUA 4IWOA 3F88A 2WEIA 5J5SA 4MD7E 5CU0A 4U42A 3PSBA 4FV3A 2JDVA 2BHEA 4AA0A 4BTKA 4YNOA 4D2TA 4FZDB 5F95A 1VYZA 3VULA 3HMMA 3PA4A 2W1ZA 2WFYA 1MUOA 4DHFA 2BIYA 1XBBA 4PP9A 1PXLA 3SOCA 5K4JA 5HEZA 2VTMA 4LRKA 1FMOE 3DY7A 4GIIA 5EFQA 4BB4A 2WKMA 3F9NA 3FZ1A 4NM5A 4TYHB 3NW6A 4W4WA 4OTWA 4EL9A 1TVOA 4D5KA 1B38A 2IVSA 4I41A 5EW8A 5HICA 2EXCX 3QQUA 3FXWA 4CZTA 4JT3A 3D2IA 1ZZ2A 4MXCA 1H28A 2GPHA 4G5JA 5CALA 1J1BA 2W05A 4GH2A 5KX8A 2A4LA 3MH1A 1PXKA 2XJ0A 3PG3A 5BUEA 3A62A 3DZOA 1FOTA 2EU9A 5FWKK 3HAMA 1FGIA 5EI6A 4O2ZA 4D58A 1PHKA 3W2OA 1H27A 4AT5A 1XBAA 5CF8A 2B1PA 4R7HA 5M53A 5HNGA 4D2WA 4XV2A 4CVAA 1YXUA 1YVJA 3OFMA 3VS4A 1MRYA 4TYEA 4AE9A 3HDMA 4XG3A 3GC9A 4FV5A 3FMDA 4D9TA 3R1SA 1OIUA 2IZSA 2WOTA 4IVDA 3H0ZA 3D2KA 2WMVA 5DLSA 4F9CA 2C1AA 4GG5A 4A4XA 2JGZA 4BY9E 1IG1A 4RVLA 4XV3A 3B8QA 5JKGA 3OCGA 4NIFB 2QCSA 2QO2A 4N6YA 4O7LA 1Q99A 4BIEA 3L8PA 3R1QA 4BBEA 2RGPA 3GC0A 4FC0A 5HE2A 3HP2A 3R2YA 4U81A 3TZMA 3F69A 4FTUA 2R7IA 4IMYA 4BKZA 2X2KA 4F70A 3EZRA 3ZEWA 1OL5A 2XKFA 3BEAA 4PDSA 3S95A 4KSQA 3NUNA 3VIDA 5CLPA 4PV0A 1ZZLA 2P55A 4L6QA 4LG4A 5CNOA 2C5OA 5AP0A 2VNYA 1K9AA 3AT3A 3KRXA 4FYNA 3F7WA 3GOKA 2VRXA 3VQUA 3LMHA 1GAGA 5M51A 3KMMA 4ZLZA 1EH4A 4AF3A 4BCGA 4S30A 2BZJA 4GU6A 4IM3A 3V01A 3CKXA 4C4IA 3DFCB 3CQUA 1NA7A 1OM1A 5IG1A 3FY2A 4BYIA 3LFSA 4IB5A 4AZWA 1E1VA 4JIKA 1QPJA 5AP6A 3JVRA 4EQCA 4RJ4A 2LAVA 2WTJA 4I21A 4L52A 3UG1A 4F1OA 5A4CA 2QC6A 5LOHA 5GJFA 4RQKA 3ZDUA 4LMUA 5HO7A 3QUDA 4N0SA 1KE5A 2JC6A 3F66A 4EUTA 4HPUE 3R7IA 3FZOA 5CSXA 3VUHA 4CZUA 5I0BA 5I9WA 5ANJA 5G1XA 4G34A 4BZOA 3K5UA 4ACGA 3VRZA 4QMMA 4CG9A 4YPSA 4DCAA 3NWWA 3S4QA 3QQLA 3DK7A 4JIAA 2R3LA 3FKLA 4L7SA 2XK7A 4AT4A 4N57A 3BYOA 2BRMA 3UO5A 4ZS4A 4N6ZA 3VQHA 4IZYA 4U79A 3MBLA 3PDTA 4AACA 3R9NA 3E62A 4CMUA 5HIEA 3QKMA 3P23A 5EDQA 5C8MA 3VHKA 5L6OA 2W9ZB 3OEFX 3LQ3A 3ZZWA 3A8WA 2W5AA 4ASXA 3NVMB 2XK6A 2IZTA 2QU5A 3CTJA 3UJGA 3VBYA 5IUHA 1P4FA 1B6CB 3DBFA 4FKTA 4USDA 5TOZA 4W4YA 4DEHA 5DHJA 1ZYDA 4CCUA 4XNEA 4ZTMA 3TNQB 3VWAA 2G01A 3TACA 1PXNA 4TW9A 5JT2A 4K77A 3R7VA 3UZPA 5HD7A 4G16A 5AP4A 2NO3A 4JBPA 5BMSA 3FLNC 3O17A 2OIQA 3R1NA 4G9CA 4FSMA 5CI6A 1XBCA 4ZSEA 3PIXA 4NK9A 3IPHA 1R78A 3DNDA 4HYSA 3EKKA 5T68A 3VW6A 4XH6A 2OXYA 4U41A 2QO7A 3UOJA 3SV0A 1J7LA 3VC4A 2CKPA 3Q4TA 5F4NA 3FMNA 4MWIA 3CTHA 4FKQA 2QOCA 3DXNA 1M2QA 3MVMA 5HE1A 3SQQA 3QKKA 1YOMA 4EBVA 3I5NA 2B9IA 3GQLA 4CKRA 4YJPA 3C1XA 4J96A 5K5NA 2UW9A 1IEPA 4P7EA 4QMYA 1SNUA 3OWKA 5AAFA 3F7ZA 3DQWA 3LCSA 4R7IA 4F63A 3PTGA 3CKWA 4ZLOA 1YDSE 1GOLA 3BI6A 2DWBA 4KWPA 2J4ZA 4ERKA 4F7NA 4YU2A 3VRYA 5ANIA 5CANA 3FZRA 4CNHA 3JPVA 1S9JA 2VO0A 3OUKA 3UVQA 3F3VA 2BMCA 4L01A 3MFSA 5BPYA 4OT5A 4BDGA 3HYHA 2J6MA 2WOUA 3I4BA 3K3IA 3NUYA 5CVFA 5I5ZA 4RIXB 3LCOA 2R3GA 4QTDA 3SVVA 3QXPA 2RSVA 4U80A 4UZHA 3W2QA 2EUFB 4CYIA 1OI9A 4E6CA 5C8NA 4QMWA 2FVDA 3R30A 3UOHA 3WZDA 3PXKA 4KIQA 2GHLA 4RFMA 4BBMA 4CGAA 1RE8A 4CLIA 1F3MC 2ACXA 5M56A 4YC3A 3F5UA 4I4FA 5EM7A 3QD0A 4HGSA 5AR5A 3MA6A 4EOSA 3MSSA 4QMVA 4YSMA 1JKLA 3FI3A 3PIYA 3OP5A 3SXSA 2GHGA 3KKVA 4RLLA 3ROCA 4EOOA 4YTCA 3N4TA 4I93A 5LMBA 2HOGA 1OIYA 3PY0A 1X8BA 2R3HA 4P90A 3DB8A 4Y46A 2AUHA 4MQ1A 4AWIA 4D0WA 3RM6A 3R71A 5AADA 4D2VA 5KMJA 4YJRA 3AMBA 3QD3A 5CAOA 3NAXA 5E1SA 4EUUA 2GNJA 4YTHA 5C1QB 2WEVA 4YJUA 1H0VA 2UZBA 1U5QA 2XYNA 3DGKA 4YJTA 4YZNA 4WSQA 2XUUA 3GT8A 1G3NA 4EKLA 3LQ8A 2GS7A 2ZDUA 5J5TA 2RFEA 2ETMA 1WBVA 3AC4A 3F61A 3R8ZA 3DKCA 4BI0A 4X21A 2PE0A 3UNKA 3QHWA 4RRVA 5LMKC 3BZ3A 4EQUA 2ZYBA 3JYAA 4PMMA 3MPMA 2O65A 4A9TA 1WBWA 4FEXA 3C7QA 3ETAA 4YJSA 5I3RA 3P79A 3T9TA 4FTRA 3LFEA 4UXLA 4O6LA 5JSMA 4FNWA 2Y9QA 3SRVB 3PWYA 3LXKA 4IZ7A 2QOKA 4BCQA 3EOCA 5L2TA 1NT2A 3UMXA 4RVTA 3FMEA 3U4UA 4CFMA 4EJNA 3SXRA 3KXMA 1MQBA 4MX9A 2BKKA 2VWWA 4ACMA 4MBJA 2PUNA 4QNYA 3COHA 1P5EA 3CQWA 4JI9A 4X2GA 4XHKB 4AOJA 2IN6A 2YIXA 2W4KA 4I6FA 3LCKA 4I0SA 3I5ZA 3ZXTA 1JKTA 3FQHA 4Y73A 3E7OA 3UMWA 4EH8A 5AP7A 4O0VA 3E8NA 3M11A 3ZO3A 2C6TA 3PJ8A 4YJNA 4O38A 2BZHB 3N51A 5FD2A 3S1HA 2VX1A 2PTKA 3TUDA 3QL8A 4MXXA 4YJVA 5DI1A 4D4RA 1JSUA 3KGAA 2C6MA 4HJOA 3REPA 4NTSA 3BGQA 4RX5A 2FSMX 3R7GA 3R7EA 5IA2A 3PE1A 1W84A 5BVFA 4OBQA 2UUEA 3ZBFA 2X2MA 3VS6A 2PUIA 3IDPA 4G3FA 4PX6A 2YJRA 3TEIA 1CKPA 3ORLA 4DEBA 3T3UA 2JBPA 5HG5A 2GNFA 3F3TA 5EG3A 4IE9A 4QMSA 4OTIA 2XYUA 4HOKA 3U51A 4CFWA 2Z02A 3QUPA 4C4FA 4ZIMA 3NYVA 3OY1A 2ZOQA 2GTNA 4RIYA 4RX9A 2IJMA 5ETCA 1DM2A 2OBJA 3HMPA 4Z16A 5E92A 3VVHA 4J53A 5HNIX 4QNAA 2ITXA 1YWVA 3Q53A 3IW7A 4CG8A 1WVXA 3G9LX 4ANNA 3C4CA 4J71A 5HQ0A 2QOQA 5H9BA 3I0OA 3VS1A 1PXMA 4LUDA 4QQ5A 4OTPA 3RBWA 4ALVA 2ZM4A 4Q9SA 4Y5QA 2XK4A 3ZM9A 3FZTA 2OFUA 4W4XA 5CEPA 3KVWA 4M12A 3QAME 2YCQA 1YOJA 2XH5A 2ITNA 2OXDA 4F08A 5AUWA 3RK9A 2IZRA 4C36A 3SXFA 5FP6A 1CKJA 2VWIA 2Z7LA 3NR9A 4CTBA 2PY3A 3OC1A 4R3RA 5IEYA 3AT4A 4FKGA 5FLFA 5KZIA 1FVTA 5FXRA 3BE9A 3BIZA 4RFZA 1G8AA 4GRBA 5CVHA 1H8FA 5JQ8A 4BDAA 3KN5A 3K2LA 4LL5A 3A7HA 4IWDA 5CWZA 5DT3A 5CS6A 5K0KA 5CTPA 3DXQA 4ZTLA 1JVPP 1QPEA 2FA2A 3HMNA 3OOGA 3OUNB 4KIKB 5CXHA 1Q97A 4FZ6A 3ROYA 3SLSA 4IADA 2DS1A 5T3QA 3TI1A 3QHRA 3ODZX 4E5AX 5LVNA 5DR2A 5HX6A 1ZYSA 2HENA 4HNFA 4FGBA 3CIKA 3QUEA 3TV7A 2QKWB 5KCVA 4EKKA 4RJ3A 4O81A 2W1IA 3R83A 1Q24A 3U6IA 4DEEA 2OH4A 3FXXA 4GSBA 3ZC6A 2PVMA 2PMOX 2R3KA 5EHLA 2PMLX 1GZNA 2WTVA 3GQIA 3U4WA 3GUBA 5A4LA 2QU6A 2ERZE 4QTBA 4XUFA 3BLRA 3PPKA 3BRBA 3MY0A 4BZNA 4LOPA 2V7OA 3EQBA 3DLSA 2O64A 3NIEA 2YM6A 5CXZA 4XEYA 3DQXA 1UA2A 4PMTA 2I0YA 3JS2A 4BCOA 3Q9XA 3QXOA 4TT7A 4HYHA 5HG9A 4GJ3A 4EH7A 4BCNA 2I6LA 4AW1A 4C34A 4I4EA 2UW8A 2R3NA 4EONA 2JD5A 3NYOA 4ZTNA 2C30A 3SC1A 4HCTA 4QQTA 1U59A 4FICA 3G15A 4GMYA 4QMZA 3C50A 2OW3A 1MRVA 5M4IA 4LOQA 1P4OA 4O7YA 2I0VA 5H3QA 5CU2A 4BDHA 3DA6A 5A4EA 1O6YA 4TYIA 4WIHA 4FKLA 2R3FA 3LQ5A 1UU9A 2ZV7A 5BX0A 5L6WL 2W1HA 5D7AA 4E4NA 2CLQA 3BKBA 1R3CA 3BGPA 4HW7A 1ZARA 1CSNA 2REIA 4JBOA 5TKDA 3BLQA 3U9CA 3HX4A 3PY3A 3FYJX 2JITA 4PPAA 2Q0NA 5LVOA 4S2ZA 3KF4A 3S0OA 4LRMA 3GVUA 4YGAA 2V62A 3I7BA 3AMYA 4TWCA 4RJ6A 4YZMA 3FPQA 3O8UA 1JOWB 5AR3A 5AA8A 4AT3A 4XG6A 3P78A 4O2PA 4ZZMA 4CXAA 4CEGA 3OHTA 3QC9A 5AM6A 5E8YA 3H3CA 3ZONA 3U54A 4Y5HA 4C59A 2RF9A 5BUIA 4BGQA 5KZ0A 3LXPA 3BWJA 3RAWA 3W2SA 4BDBA 4DLJA 3ZBXA 4FZAB 1PY5A 1Z9XA 5FG8A 3FUPA 4C3RA 3DBEA 4Q2AA 2QOLA 4EK6A 2Z7RA 3TV4A 2OK1A 5HCZA 5A46A 2WTWA 4E93A 3DTCA 2H8HA 3F6XA 2QOIA 4ZS0A 2RG6A 4KIKA 3FMLA 3ZFXA 2WMWA 5I9XA 2RFDA 4ALWA 2YIQA 2V22A 2F4JA 5DEYA 4H05A 5GJGA 3DBCA 3IS5A 4ACHA 3Q52A 4PP7A 2RL5A 2F2CB 5A54A 2BRNA 2EWAA 3C51A 4AOTA 2IWIA 5B2MA 5JH6A 1BKXA 4IX6A 4DFNA 2OO8X 2P33A 4IAIA 3D14A 3WILA 2UVYA 4A7CA 4I5CA 1SZMA 3V6SA 2B55A 4RLKA 2XEYA 4FSUA 5HBEA 4GYIA 4FUXA 5F1ZA 2NRUA 2UZVA 2GFSA 3MFTA 3WZKA 2B52A 3FMJA 4YNEA 3MB7A 4GUEA 5B0XA 4QYFA 2VTTA 4O7ZA 5IISA 3GENA 4AOIA 4RBLA 4RWJA 4BVUA 2IG7A 3GU8A 4RSSA 4K1BA 5C27A 1FVVA 4C7TA 4UXQA 4A9UA 3I1AA 1XH7A 5G6VA 5J7BA 3UZRA 4NWMA 3RPVA 5CZHA 4DTAA 4H3PA 3NLBA 3C4EA 3TIZA 3GBZA 3ZLWA 4WOVA 5JFVA 4FNYA 4GV1A 4JG7A 3CE3A 5E90A 5IQBA 2VWZA 3U9NA 4E73A 2JAMA 2CNQA 4DEAA 3RCDA 4D1SA 3D0EA 3EQHA 1U54B 5E8SA 2R9SA 3GC7A 5DRDA 4YZCA 5ACBC 4TYGA 4YPDA 1H26A 4EH2A 1OIRA 2CGWA 4C2VA 3H9OA 4J97A 4ASZA 3CD3A 4ZY5A 5IUIA 4FTTA 1B39A 2YLEA 5EYDA 2VTSA 3SX9A 4F1TA 5EDRA 3TJDA 4WSYA 4TWPA 5IU2A 3EN9A 2YIWA 2CGVA 3QCSA 3GCVA 4FOBA 5GJDA 2YCRA 5KE0A 3ZM4A 2QI8A 5ICPA 1XH4A 3OXTA 3Q3BA 4YC8A 5LCKA 4RA4A 3D5UA 5CQUA 5BVEA 3KULA 2OF4A 4QP9A 3M42A 5AR7A 1ZOEA 2WQMA 3V8TA 3FI8A 3BQCA 3CGOA 4QMNA 5B2KA 1R0EA 3IG7A 5IA0A 3EQGA 3KC3A 4LMNA 4QMQA 2G2FA 2KTYA 3D4QA 2X4FA 4LUEA 3OTVA 5AIRA 1PXIA 4KABA 4L43A 4YLLA 5A6OA 1WFCA 4UZDA 3CSVA 4PL3A 4ZZNA 4YP8A 3THBA 2CJMA 3F3UA 3LFCA 2RFSA 4LI5A 4O84A 4IM2A 4HZRA 4B6LA 2BRBA 2A0CX 4PTEA 4ITIA 5FXSA 3WARA 4QD6A 5CVGA 3MVHA 2I1MA 4RGJA 3GCUA 4G2FA 2A1AB 5E7RA 3EMGA 2E2BA 1CDKA 3VF9A 3Q5ZA 2FUMA 5CENA 3TN8A 3KMWA 4QYEA 2HZ0A 3IOKA 3EH9A 2Y4IB 5IMXA 2PVJA 1XH9A 5IEVA 3D7ZA 1M7QA 1GY3A 2JFMA 5CAVA 1H00A 3KRJA 4NM3A 4IB1A 3CCNA 1KV2A 4H3BA 4C35A 4CSVA 2PMIA 5AV4A 1IAJA 3FI2A 4HCUA 4ZXTA 4O82A 2P3GX 5EHOA 3QGYA 4D5HA 2JFLA 4TRLA 4HYUA 4ITJA 4QP3A 1J1CA 2YN8A 1Q5KA 3DDQA 4XP0A 3UGCA 4FYOA 4NKSA 4CYJA 3MS9A 2EB3A 4YJQA 4AGCA 4I5PA 3MESA 5DA3A 3W8QA 5KMNA 4GKHA 2CDZA 4BN1A 1APME 3QC4A 3GP0A 2QHNA 4M13A 2HZNA 5AJQA 3BYVA 5HIDA 1ZMWA 2WMRA 3TNPC 4USEA 4BHZA 5JN2A 4DA5A 2J0KA 3QRKA 4FKPA 5BNJA 3CY2A 1H07A 3FLYA 3L9LA 3QD4A 2XM8A 3V5JA 3MI9A 1Y57A 2DYLA 4HPTE 5AP5A 4EOPA 5M07A 3EWHA 4FTIA 4CD0A 3BV3A 2C3LA 3UP2A 4BI1A 1OL7A 5FM3A 4H36A 4OAUC 2CN8A 3L8SA 4ONAA 1KE7A 3IW4A 3ZLSA 1OBDA 2NRYA 2UZUE 4BKYA 4YHJA 2C3IB 1IASA 4OT6A 4DC2A 3HV7A 3JY0A 4O7TA 4IX4A 3AD5A 5A9UA 2XNEA 2O2UA 5L3AA 3VHEA 3EB0A 2OWBA 2XK3A 3KXZA 1ZYLA 4AZTA 4OR5A 4FV1A 4AS0A 2OKRA 3FV8A 2UVZA 4JQEA 4QP6A 4ZP5A 3TTIA 4AX8A 2F49A 5EH0A 4MBIA 4EOIA 4HVGA 5GZ8A 3E93A 4YTFA 3EFJA 4B4LA 3HZTA 2YERA 3SAYA 3CXWA 4QMTA 4FKVA 4ORKA 3KXGA 4FV7A 5TR6A 2F9GA 4TN6A 4U5JA 4EH5A 4Z7HA 3VS2A 4ZSLA 2QLUA 2ESMA 3C9WA 4U3ZA 3RPOA 1ZAOA 4D9UA 5HIBA 4U9AA 1URCA 2WTIA 4DT8A 3TNWA 2CNUA 3IW6A 3DJ5A 5L8JA 1ZY5A 3RI1A 3LAUA 2ONLA 4WD5A 4FE2A 5H2UA 4HVDA 4NJ3A 4XG2A 4ZK5A 4JDJA 5F20A 5GHVA 3UIXA 1F0QA 4ID7A 4JQ7A 5LWNA 3FYKX 2ETKA 5K5XA 3VS0A 1WVWA 5DGZA 3ENMA 5BVNA 3COMA 3GI3A 4O21A 5M44A 4NW6A 2Z8CA 3UOLA 2VTNA 3FQSA 1V0BA 4L67A 1JNKA 1JWHA 1LR4A 1W98A 3FY0A 3E8DA 4MAOA 4D1XA 1ZOGA 2WD1A 5HCXA 5AIKA 2XCKA 5D11A 4NCTA 4JRVA 1YKRA 5CSPA 3QRTA 3RK7A 3P7CA 4NYEA 2C1BA 3OF0A 3P7BA 5EW3A 5FM2A 4BFMA 4D4YA 4I5MA 2J2IB 4UX9A 3GB2A 1HOWA 2VAGA 3NUSA 4WNPA 4D0XA 1NW1A 4FZFB 4WRGA 4CFUA 4EWQA 4E4MA 3CGFA 4FTOA 4KRDA 1OUYA 2C6EA 3PUPA 4C3PA 4ANQA 1S9IA 1VEBA 3PFQA 4K18A 3UPXA 4RC3A 4FT5A 2I7QA 4RJ5A 4V01A 4DEDA 2YCFA 4M69A 1SVGA 3EFKA 3RPSA 3FMHA 1KE8A 5AV3A 4C0TA 4FODA 5HBJA 2YITA 4O0RA 3UTOA 2QO9A 2YEXA 3NNWA 4I6QA 4H1MA 4X7QA 5D12A 4L44A 2OH0E 4WA9A 4PWNA 1Q41A 5CEIA 5IZFA 4QTCA 1MQ4A 1J7UA 2ERKA 1IAHA 1BI7A 4D2SA 4FVQA 4UBAA 4CV8A 4AAAA 2UZDA 2HXLA 2W1DA 3EN4A 3LFQA 3MDYA 5FXQA 4DG2E 5JGBA 3P5KA 4F64A 2QLQA 2XRUA 3RP9A 2FSTX 1GIJA 2PVHA 3OS3A 5KBQA 4PY1A 2HYYA 3E8EA 4FSQA 2A27A 4NT4A 4II5A 3FZPA 3VS7A 4EC8A 2C0TA 1K3AA 2VNWA 4F9WA 5IQCA 3S00A 3UG2A 4F9YA 3TDWA 2HELA 4V05A 4QMPA 1Q3DA 4FNXA 4FSRA 4FSTA 5HG7A 1REJA 4CQEA 3AC2A 1OPKA 3P7AA 5CU6A 4JNWA 4ANOA 2E9NA 1YI6A 3EQCA 2WMXA 3FL5A 5AR2A 3G90X 2R3RA 2W5HA 3UE4A 1RW8A 3FSFA 3G33A 4M8TA 3AGMA 4AGUA 3ORPA 3HV5A 1PXOA 1R39A 1QMZA 3DJ7A 3BYMA 2B9HA 1KOBA 5C4LA 3RVGA 3MIAA 3E5AA 2CLXA 4QPSA 4I22A 4ALUA 3IDBA 4L46A 5AR8A 2B53A 3KF7A 5I9ZA 5KMLA 5IDPA 1A48A 2UW4A 3R7OA 2YM4A 3BU3A 1XWSA 3PJ1A 4QMOA 5CYIA 4FOCA 4FTJA 3BPRA 4O1OA 2WMTA 1ATPE 3R9RA 4WKQA 4FT0A 4C2WA 4K6ZA 3IDCA 4HYIA 5A3XA 4AN3A 1H0WA 4C62A 1XR1A 3FJQE 2QODA 5J9ZA 3FQEA 3EJ1A 3NPCA 3LJ2A 1YXTA 3KMUA 3NW5A 4DYMA 4PTGA 3R9DA 3VAPA 4FKRA 3VS5A 2H6DA 3WF6A 5TT7A 3A7FA 1PXJA 4L3LA 3L9NA 4O7WA 4FVPA 5GINE 2XA4A 4J98A 4X3FB 5DR9A 2C6KA 3QTZA 2JDSA 4LYNA 3OW4A 4UB7A 2IVUA 2R3JA 3F3ZA 2BFXA 3F2NA 3MW1A 4BDEA 4C4EA 1CKIA 3I6UA 3WF8A 3ZLXA 3GGFA 4D2RA 4E5BA 4KUJA 3DTWA 3L8VA 3QTRA 2HCKA 3AC1A 4TY1A 3S2PA 5KKRC 5DYJA 1QPCA 2R3MA 3CTQA 2OSCA 3UODA 2QR7A 3BGZA 2X6DA 3U87A 1M17A 3WI6A 2W99B 4E7WA 2VGOA 3ET7A 2PVKA 5BVWA 5AX9A 3QX4A 5CEKA 1XH8A 3JVSA 4EI4A 5JQ5A 2CKQA 2JKMA 2ZDTA 5AFVA 3A4PA 3DJ6A 4IQ6A 5IMEA 4L3JA 4IXPA 4CTCA 4LOOA 5HI2A 3UIMA 2HY81 4WO5A 2OIBA 4CFXA 4P4CA 2YDIA 3VBXA 5BYZA 4RFYA 4BWPA 3PWDA 2GCDA 3QZIA 4ZZOA 3GCSA 1E1XA 1OKYA 4OGRA 2BCJA 3RHKA 4FG8A 2BR1A 1DAYA 2UZNA 3QQJA 3E7VA 1Q8UA 2G1TA 1L3RE 4DGNA 4FX3A 1OITA 5AV0A 4OTFA 2PZ5A 2XKEA 3A60A 3QU0A 4Z9LA 4BCIA 5EM5A 4EH3A 3ORTA 4QT1A 5J95A 4EK4A 3V3VA 4C4JA 3PSDA 1YW2A 1PJKA 4BWKA 2X81A 2BDFA 3TKIA 5M09A 1YHWA 1FINA 3HDNA 3QQGA 4F6WA 3QQHA 4PMSA 5DR6A 4V0GA 4F7JA 3NUUA 5EW9A 4E6DA 4DE4A 3VUMA 4BL1A 1YQJA 1PMEA 2VTHA 4RIYB 1SYKA 4WUNA 3AT2A 4LGHA 4ZJJA 3E8CA 3ERKA 1OVEA 2XM9A 3FHRA 4FIEA 3UIBA 5J8IA 2W1GA 3SG8A 2YAAA 4XBUA 2X39A 3PJ2A 3C4FA 1LPUA 2XEZA 4A4OA 3IO7A 4XMOA 1KWPA 4KBKA 1PKGA 3UYSA 4JX3A 4USFA 2PU8A 5D9HA 3R6XA 5F94A 1XKKA 3TT0A 2QKRA 3R2BA 1WVYA 2VZ6A 2YIYA 1BMKA 2AC3A 3QZHA 4F7LA 2JBOA 4QYGA 1A06A 5DT4A 2GDOA 1V1KA 3I6WA 5IUGA 4XP3A 4BTMA 5H8GA 3BYUA 3UP7A 1Q3WA 2PMNX 3ZO1A 4X3FA 4X2NA 4IIRA 4O1PA 5DRBA 2IPXA 3TIYA 5TE0A 4XV1A 3TG1A 4YMJA 5M4FA 3D94A 3HAVA 5KUPA 3QTQA 3A2CA 3POOA 2XBJA 2XK9A 1URWA 4KBAA 4E26A 1XO2B 2J5FA 3UIUA 3W10A 1SVEA 4DGGA 1UVRA 2OG8A 2OGVA 3HMIA 1YXSA 2GNGA 1IA9A 4RC4A 2E9OA 5FEEA 2RIOA 4B8MA 1I44A 2X7OA 4AFEA 4UMPA 1H24A 3F5XA 5AR4A 3PZHA 4PL5A 4HVHA 2CGUA 4U40A 2C5XA 5DE2A 3SG9A 4JJRA 4MVFA 3HRBA 2HZIA 3D9VA 4G3EA 3C4WA 4RPVA 4JX7A 3G0FA 5EKOA 4IAZA 3R01A 4PDOA 1J3HA 4QQCA 2JKQA 3PLSA 2H34A 2BDWA 3W2PA
chains in the Genus database with same CATH superfamily
5DFPA 4BCMA 3NMUF 4D4SA 2IZUA 2GQSA 4I1ZA 3K5VA 4M15A 3ZOSA 1QPDA 4O91A 4E4LA 4F6SA 5JRQA 2JDOA 3DAJA 4O96A 5K0XA 2BDJA 5I3OA 3R7YA 2UZWE 3LZBA 3LM5A 4WG3A 1H1WA 2I0HA 3VW8A 2WQNA 4PMPA 5HVKA 3O5AA 4R1VA 2WTKC 3ALOA 4OBPA 4DN5A 1VZOA 3QGWA 3QRJA 2UW5A 3QZGA 2DUVA 4F4PA 4FR4A 4CT2A 1UNLA 5LWMA 5KKRB 4F0GA 2NNWB 4FTAA 4JDKA 2YWVA 1YI4A 3VBWA 4RIWA 3BLHA 2O63A 2G15A 2Q0BA 3BCEA 2IW6A 3FWQA 4QTAA 2IW9A 1GZKA 5HBHA 3C0IA 4EOJA 3NEWA 2FH9A 2E9PA 4FKIA 3ZC5A 3NAYA 3VF8A 5BUJA 2IVTA 5HOAA 3GFEA 1ZXEA 2XB7A 4GFOA 2SRCA 4A9RA 3UDSA 4AXEA 3CJFA 3P9JA 3QRUA 3UDBA 4GL9A 3TWJA 5F9EA 1WBSA 5IA3A 3GCQA 5L8LA 1FGKA 2OIDA 2VTOA 2XNBA 4AXAA 3BL9A 2J0IA 1JQHA 2YCSA 1KV1A 4FVRA 4X0MA 2UW6A 1V0PA 4UWCA 3UVRA 3V5PA 5CT7A 2NPQA 5L8KA 5BV3A 4FKSA 3QA0A 4NM7A 2H9VA 2XIKA 3OT3A 4ZTQA 5GZ9A 4XG9A 4ZSAA 3U6JA 5EM8A 2X8IA 3FHIA 5EM6A 2QR8A 5DH3A 2ITQA 2YDKA 2G2IA 4O4CA 4QP8A 3W18A 3H4JA 4KD1A 3R04A 1JSVA 2BTSA 3IGGA 3R73A 1LUFA 2VO3A 2Y6OA 3QTWA 4M14A 4M67A 4ENYA 5EI2A 3VUKA 5BVOA 4NL0A 3R8UA 1V0OA 2X6EA 2QNJA 3PXYA 5DWRA 5FBOA 3MFRA 1XH5A 5DEWA 4XG7A 5ITAA 5D1JA 4WBBB 5AM7A 5JFXA 3KXHA 3QD2B 2ZJWA 3HL7A 4ANSA 1SMHA 3L8XA 4FSNA 3PIZA 3QKLA 4QPMA 3I60A 2YAKA 3FMKA 5LMAA 4FV0A 2HXQA 4QO9A 2WU7A 4RX7A 3TMOA 4O0XA 4NM0A 4BWXA 2PSQA 4J8MA 4GS6A 4XLIA 5A6NA 1J7IA 3NFGB 5AUZA 4KNBA 5HNBA 3W0NA 3VNTA 3P86A 4ANMA 4BGGA 1GJOA 3C0GA 2VV9A 3HUBA 3PVBA 4O0TA 3TZ8A 2HAKA 3EN7A 4G3CA 2Q83A 4RJ8A 4BICA 3O8TA 3TXOA 2UW3A 4JR3A 4GJ2A 2VO7A 2I40A 2BAJA 4H1JA 4PDYA 3VBVA 5GNKA 1O6KA 4G5PA 1W0XC 4BI2A 3IGOA 5AUUA 2ZB1A 4FI1A 5LVPA 3LXLA 4DH5A 5ANEA 2ITYA 4EH4A 3PVUA 4W8EA 4FL1A 2C4GA 1ERKA 2J0LA 3KRWA 5IQHA 1RQQA 4MH7A 4ITHA 3MB6A 3ID6C 4I6HA 3ZZEA 4ZY6A 3N4VA 3AMAA 5E9EA 3HRFA 4F9BA 4AQKA 3R00A 4IHPA 3IK3A 4PTCA 5GIPE 1PKDA 1Q8YA 4I5HA 1W8CA 3UC4A 4Y83A 4GT4A 3G51A 5CY3A 5JRSA 1JAMA 3V8WA 3RNYA 4FSZA 2Y4IC 5I9VA 4AW2A 4BIDA 2ITPA 3OTUA 4PDPA 5HHWA 5IF1A 2ZMDA 3RWPA 3CJGA 3HRCA 3NDMA 4H58A 4C37A 5EQPA 5HVYA 3ANQA 2Y8OA 4DLIA 5L2SA 2OXXA 3RGFA 3HV6A 3EQFA 1JKSA 3KULB 3RZFA 4GEOA 1FMKA 5AX3A 4EH9A 1DS5A 4DBXA 2VWBA 3LCTA 3ORIA 5HTCA 4YZ9A 3PRIA 4YTIA 2YM3A 3BBTB 4NCTC 3ZRMA 4DH7A 3Q32A 4KIOA 4A9SA 3VBTA 1IR3A 1K2PA 2W1CA 3CEKA 3KN6A 2WTKB 3SD0A 3PP0A 3C13A 3LVPA 3BHTA 5DN3A 2CN5A 4RX8A 4F0FA 2LGCA 4F1MA 3F82A 3DKOA 4E6AA 3N9XA 3UNJA 3L9MA 4BKJA 4C61A 2AC5A 1OZ1A 4FV2A 2R7BA 1Q4LA 4NU1A 2XBAA 4UALA 4XLVA 5CX9A 4X2KA 1KOAA 3CC6A 3B8RA 3E87A 3QYWA 3WYYA 4A07A 4KAOA 1G8SA 4BHNA 3QALE 4FTKA 3R8LA 3SDJA 3V8SA 4DINA 3LFNA 4DITA 3KCFA 4EORA 5M4UA 1OGYA 3K3JA 3KVXA 3GXLA 5HE0A 5K9IA 3NUAA 3W0QA 3UO4A 4FG7A 2ZVAA 3DU8A 3IW8A 3ORKA 3I81A 4YBJA 2B9JA 1JLUE 1U4DA 3A7GA 2QVSE 2RKUA 3CD8A 4FTLA 4FTMA 4P5QA 5FQDC 3WYXA 4CFNA 2P2HA 2R5TA 4PQNA 3JY9A 3RMFA 5HLWA 4RA5A 5I9YA 4FSWA 3HVCA 1W83A 1OIQA 2HW6A 4GK4A 4FF8A 3Q4UA 4PL4A 4DBNA 4DFLA 4DFZE 4BCJA 4FKUA 3R0TA 4ZY4A 3CLYA 2PULA 1J91A 4FZ7A 5HKMA 1WAKA 2VU3A 1PMNA 3HP5A 1W7HA 4RC2A 2WXVA 4JG6A 4GKIA 3C4XA 3CBLA 2GHMA 4EZ5A 3TDVA 4JVGA 4WUAA 2XKCA 5AA9A 4IACA 3GCPA 4KSPA 2XIRA 1YI3A 4UWYA 3MPTA 3VN9A 3GEQA 4Z3VA 4K11A 4QYHA 5HVJA 2J7TA 2R3PA 4GG7A 5FBNC 4GVJA 3D15A 4EZ3A 5FTGA 2YISA 2WMQA 1PYEA 3RKBA 1JSTA 4H39A 3OMVA 2CKEA 3Q6WA 4FT7A 3PLAE 4FIGA 2OLCA 1ST4A 2OI4X 2XZSA 5JEBA 3PXQA 5AUVA 4JBVA 4FL3A 4IAYA 3DOGA 4QP2A 3QQKA 5LARA 2WQBA 1YWRA 3QTUA 3ZH8A 1QCFA 5J87A 1GNGA 2X1NA 4FKJA 5J1VA 4DH3A 3C4ZA 1YWNA 3Q60A 4G6LA 4GUBA 3E3BX 3AKJA 1HCKA 4GVAA 3C5IA 3D83A 5CAPA 1PRYA 4BJJB 1W82A 3DCVA 4RT7A 4UYNA 1TQPA 4Y95A 3TJCA 4DG0E 4EOLA 1JBPE 2WTCA 1Y8GA 5EYMA 3O0GA 4C38A 4ZJVA 5B2LA 5HD4A 4QPAA 4I6BA 2BROA 2VTQA 3VO3A 3VUGA 2GS6A 1XQZA 4RJ7A 1GIIA 2WZJA 4YSJA 1GZOA 3BV2A 2Z60A 3Q96A 4E1ZA 4IX5A 3FKNA 3LLTA 4J7BA 3DBDA 4IFGA 4EWHA 3BHUA 4S31A 3KXNA 2GNLA 1AQ1A 2E9VA 3ZO2A 2Z7QA 4OW8A 4W4VA 4DG3E 2UZEA 3A99A 3ZFYA 5AUXA 3RJCA 4BRXA 1MRUA 3ENHA 2EB2A 3LCDA 2G2HA 5ANKA 4UMUA 5IDNA 1Q62A 3POZA 5E8TA 5IQFA 3H9RA 1H1SA 1DI8A 3GOPA 3NX8A 1Q8WA 3AKKA 2HWPA 1PMVA 2UZTA 5JZNA 2JKOA 3HKOA 2YHVA 4MBLA 4C57A 5GZAA 2YFXA 3VS3A 2WB8A 5HLNA 2RG5A 3PE2A 3DLZA 3FDNA 4X2JA 1LEWA 4EZ7A 2X9EA 2ZM1A 3O7LB 3FAAA 2XVDA 3O50A 4KB8A 3V5TA 5BQ0A 3NVKI 4FUYA 2F7ZE 4WG5A 2ZV2A 3ZYAA 4O86A 3R8MA 1H1QA 1YRPA 5BYLA 2XAMA 2GSFA 3F5PA 4FIIA 2XAOA 3CP9A 1U5RA 4FSYA 3UYTA 3QZFA 2CSNA 5L2WA 3LFBA 3ZUTA 4AE6A 5IH6A 2JDRA 2XIZA 3O8PA 4F6UA 4OTDA 3R7UA 4O0SA 3G6GA 2HWOA 4L9IA 3ORMA 3TKHA 3BHYA 1BL7A 2R3IA 4BCPA 2WMUA 3HEGA 1H1PA 3FLSA 2W1EA 3KFAA 2EXMA 2R4BA 4XV9A 4O83A 4TPTA 4FTNA 4UV0A 2JEDA 4M69B 4EEVA 4U8ZA 4R5YA 4KINA 4WNMA 4C58A 3P5JC 2XKDA 1WMKA 1OPLA 1Y8YA 3DS6A 2QOBA 2J9MA 4XOYA 2PHKA 3PPZA 2Z2WA 1ZOHA 5CZIA 3PUFC 3SA0A 2QD9A 4GK3A 1TKIA 1OKZA 3BU6A 1FVRA 4NH1A 5M06A 3KEXA 1AGWA 1P2AA 4U45A 4BDFA 4FEQA 2YIRA 3LFAA 4CMTA 3TUBA 2XJ1A 4OUCA 5CEOA 3MH3A 5JGAA 4F7SA 2CCHA 5M55A 2BRGA 4D4VA 3D5WA 2YJSA 3LHJA 1H25A 3EQIA 2GQGA 3TZ9A 5BYYA 3BYSA 2G9XA 2BAKA 2ITTA 4C4HA 2XF0A 3EN5A 3O51A 2YACA 3JUHA 3MJ2A 5ANGA 4R8QA 1M52A 4DTKA 1ND4A 4I23A 4RMZA 3H9FA 5IEXA 2J50A 4G17A 4E4XA 4MXOA 4X3FC 4G31A 5LXMA 2ETRA 3PVGA 2GQRA 4IZAA 2WMBA 3A8XA 3U8WA 4DEIA 4UN0C 3LM0A 4APCA 4F09A 1Y6BA 3ZLYA 4FGRA 3KA0A 1OBGA 1OPJA 2I0EA 4MHAA 1NVRA 1BI8A 2VTJA 4FA2A 4BDCA 2XNPA 5HE3A 5FGKA 4RVKA 4FTQA 5HZNA 4NZWB 4N70A 1A9UA 2OICA 4CZYB 1IRKA 2YLFA 1OKWA 4HNIA 3KB7A 1M7NA 2IVVA 3GU4A 3PG1A 3D7TB 5I4NA 2CNVA 4IC7A 5ETAA 4QTEA 4NFMA 4R7BA 5EOLA 3HA8A 4M68A 5TO8A 2R3QA 2V0DA 4HVSA 4FEVA 4ANLA 2UZLA 5J1WA 4LQMA 4Z55A 1RJBA 5H8BA 4E20A 1JKKA 5JFWA 4C8BA 4Y72A 5HTIA 4XOZA 5K3YA 3L9PA 2YDJA 4DT9A 5M08A 5E4HA 3PXFA 3UO6A 2DQ7X 4QQJA 3BU5A 1W2FA 3EQRA 2J51A 3OBGA 2A19B 3UNZA 4FIJA 4G9RA 4JG8A 2B0QA 4F0IA 5HGIA 2X0PA 2OFVA 4IVCA 1UU3A 3QLGA 5KHXA 5D41A 2H96A 4FK6A 3SOAA 3ULZA 4TL0A 3Q2JA 4XG8A 5CEMA 3GNIB 4YO6A 3EZVA 1YHSA 1AD5A 4EK8A 4KRCA 1NY3A 4ASDA 3ULIA 3Q6UA 3BEGA 3NW7A 2PL0A 4I3ZA 4MNEA 5KMMA 4QOXA 2CKOA 4AFJA 3KK9A 3ZUUA 2P4IA 4YZBA 3PA3A 4ANBA 5IQGA 1BUHA 3A4OX 4AP7A 3ZDIA 2R0UA 5IH5A 4BF2A 3RWQA 3RALA 3MH0A 1ZLTA 4S33A 2W17A 4IFCA 4QMXA 1OKVA 5FRIA 5LVLA 3COKA 3G5DA 3KQ7A 4KIPA 3EYGA 1PMUA 3I0QA 2OZAA 4PRJA 3GFWA 5EI8A 4CRSA 1OMWA 4G3DA 2ZAZA 5AUYA 4D28A 3ORNA 5IA1A 3WOWA 3BX5A 4EHEA 4IZ5A 1H01A 1WBPA 1YDTE 3OG7A 4OTRA 4EHZA 5DMZA 3TV6A 3NNVA 3EQPA 4W9XA 3WZEA 5HESA 2WMSA 4KKEA 4IBMA 2W4OA 4X6RA 3O71A 2QONA 2VN9A 4XX9A 4DFXE 5CF4A 3QFVA 2HY0A 2PZIA 2AYPA 2PZRA 2B4SB 3I79A 2F2UA 1Q8ZA 4LL0A 5HCYA 3OWLA 4BDJA 2Y6MA 2YA9A 3TUCA 5M4CA 4YHFA 3VUTA 1OECA 3M1SA 2OJJA 4KS7A 4XRJA 1XH6A 2BIKB 3A7JA 4XYFA 3O96A 4ZEGA 4DFYA 3AD4A 4V0GB 2E9UA 3OW3A 1UNGA 4JRNA 3IQ7A 3CPCA 3NUXA 1M2RA 2JLDA 3BQRA 4QRCA 3W33A 3D7TA 3IKAA 5AEPA 4MUQA 3KIOC 4FG9A 4S32A 2OF2A 4K0YA 2ITVA 4IAKA 4O0UA 3VONA 3MVLA 2O5KA 2UZOA 3GU5A 3ZMMA 4BIBA 1M2PA 2WNTA 2C3JA 3QBNA 2X2LA 5AP3A 3DBQA 3DAKA 5FDXA 4AA4A 4ZSJA 2WTDA 2ZV8A 2V7AA 1H08A 5D7VA 1PXPA 2FB8A 2B9FA 3HGKA 3PYYA 4TYHA 3V5WA 2NP8A 2HZ4A 4CLJA 4J52A 3DKFA 3RK5A 4BDKA 4EK3A 4DH8A 2C3KA 4O27B 4AQCA 3NRMA 3RZBA 4CFVA 4PNKA 5JMSA 1KUTA 4IB3A 3WBLA 3FLWA 3B2TA 5L6PA 2JIUA 5LQFA 3MYGA 4NTTA 2WHBA 3R9OA 2XK8A 4RQVA 2R3OA 4RVMA 1VYWA 4LRJA 3D5XA 2YWPA 4DTBA 2VWUA 1M14A 4TWNA 5AAGA 1TZDA 2QQ7A 4M97A 2X9FA 4HGLA 3Q5IA 2O0UA 4IVBA 2R2PA 5IKWA 5HU3A 3TNIA 3QA8A 2VX3A 1FQ1B 4YC6A 3ZHPC 4GFGA 3R63A 2PVLA 4O0WA 2ZB0A 4O6EA 1OL2A 3MFUA 3TCPA 3HUCA 3OXZA 2F7EE 3AXWA 4PF4A 4ZJIA 5IA5A 2RFNA 4JL9A 2FSOX 2P0CA 3EFLA 4FL2A 4NFNA 1QL6A 4ZTRA 4F65A 2OJIA 4E3CA 2VWXA 4AG8A 3MY5A 5FUTA 3R21A 3OD6X 1HCLA 4M7IA 1FPUA 4IH8A 3WF5A 1ZWSA 3Q4ZA 4HCVA 2C5YA 4NIFA 4TXCA 1H1RA 3LFDA 3VUIA 4DAWA 5CSVA 4AGWA 3FPMA 4V04A 5C03A 4EYJA 1BL6A 3T3VA 3MJ1A 4S34A 2R64A 3PPJA 4Q5EA 2B54A 3BHHA 3ODYX 4QEBA 2XNOA 4IX3A 4CQGA 4J8NA 4ZTHA 3MY1A 2ZM3A 4KA3A 4OTHA 3QX2A 4DEGA 5IA4A 4W8DA 4W9WA 2C6LA 4R5SA 4D55A 1DAWA 1BLXA 2C6DA 4CV9A 2YZAA 4AZEA 3MWUA 3COIA 4FV9A 4I0RA 3G9NA 4LV8A 3ATTA 2J0JA 2VTPA 4B7TA 2BZIB 4LFIA 4XS2A 3EKNA 1OB3A 3R1YA 4FV8A 5CF5A 5FEDA 1VR2A 3ZEPA 1WZYA 3AOXA 3PY1A 4MXZA 5HTBA 3KRRA 3M2WA 4RIWB 3RAHA 3NYXA 2GTMA 2BVAA 2C6IA 4QMLA 4J95A 4L42A 5D10A 4U6RA 2GFCA 3KU2A 3A61A 3ZRLA 3C5UA 3E92A 3E64A 4BDIA 3VJNA 4A4LA 4B99A 3QRIA 4R77A 4MXAA 3DK6A 3MA3A 4DCEA 3AC8A 4Q9ZA 4WT6A 4J99A 2JKKA 4M66A 5C26A 5IQAA 1PYXA 4OLIA 5DG5A 2UVXA 2WIPA 4FIFA 4Y8DA 4EHGA 1WBOA 2C5VA 2GNIA 4L00A 4B9DA 3ORZA 4TWOA 4ARKA 5DOSA 3QCQA 2XP2A 3HLLA 3H10A 1NXKA 4IDTA 2X0GA 3TM0A 4JBQA 4XG4A 4ENXA 3OY3A 3HMOA 3G2FA 5L2IA 1WBNA 4DGMA 1Q8TA 4F99A 3MPAA 1PW2A 3AC3A 3ZO4A 4E8AA 3LMIA 4AN9A 4RG0A 4Y85A 5KO1A 3NIZA 4I92A 2HW7A 3F5GA 3II5A 4BDDA 4E6QA 5CAUA 2CPKE 5CF6A 4X3JA 4P5ZA 4B8LA 4RWLA 4G6OA 3DK3A 3OXIA 2NYAA 4O7VA 1Z5MA 3DKGA 2PE1A 4MEDA 4IDVA 3ZTXA 3H30A 3RAKA 3QTIA 3OWJA 3AG9A 3FC1X 3KXXA 5EYCA 1BX6A 5A4TA 4MD9E 2VUWA 3QTSA 4QMUA 3WF9A 1YXVA 2ITOA 4NUSA 5HX8A 1F5QA 3ORXA 4DGOA 3AGLA 4DF3A 5AUTA 3HV3A 4AW0A 2PPQA 4CFFA 5AAEA 2PK9A 3ZSHA 1XJDA 3CS9A 3OOMA 2XNNA 3D5VA 2QURA 4OTQA 5HU9A 3Q04A 2XJ2A 4R6VA 2PWLA 5LJJA 3RAIA 5KNJA 3H0YA 3OWPA 3DNEA 5IQEA 3NUPA 4L68A 1YDRE 2YZLA 3F2RA 4RWIA 3QQFA 2PZYA 5E8WA 5J9LA 3EHAA 5AV1A 5IQIA 4AZVA 3RM7A 2Z7SA 4GT5A 3RPYA 3W2RA 5IQDA 4JDIA 4WHZA 4R1YA 2V55A 2PE2A 3NSZA 4ZOGA 1WBTA 5C9CA 1Y91A 3LOKA 5I9UA 4LM5A 4GU9A 4AXDA 2C0OA 4PNIA 4UMRA 3MTLA 3ITZA 4K8AA 1Z57A 5T6KA 5EHYA 4RIOA 3LJ1A 4G3GA 4HZSA 4QYYA 3Q9ZA 2P2IA 3LXNA 2FO0A 4RIXA 3W8LA 4MNFA 4AW5A 2C0IA 4AUAA 2JAVA 2EVAA 3FL4A 2PVNA 4BCKA 2PVRA 2BZKB 4O7RA 3FZSA 4I94A 5C4KA 1OUKA 4L7FA 3FXZA 3VUDA 3ANRA 3WF7A 3EL8A 2WAJA 2WU6A 2F7XE 5E1EA 3Q9YA 4O7NA 2W9FB 4MTAA 3PVWA 4BTFA 4FJVA 2VO6A 4ZSGA 3CPBA 1LEZA 4WNOA 1OL6A 4IAFA 4BCFA 1UKIA 3O23A 5EOBA 4GT3A 2GS2A 4NW5A 2A2AA 3IW5A 3FC2A 4NKAA 4AGDA 3E88A 5C8KA 4MQ2A 2PVFA 3MGYA 5L2QA 1T45A 2YM7A 4ZAUA 4YBKA 4GIHA 2GU8A 2W1FA 4CKJA 3KRLA 1OL1A 3QYZA 4EHVA 1PF8A 3IOPA 1NVSA 3HV4A 2VTAA 4JS8A 2W06A 4MK0A 4FT9A 4R78A 4DHJA 1CMKE 2C68A 4M0ZA 2XRWA 3E63A 3ZU7A 5EYKA 3RNIA 1UV5A 4L8MA 2KULA 2PVYA 4K33A 1LP4A 3MIYA 3Q4CA 4YUQA 2VTIA 2W0JA 3QCYA 3NZ0A 5HO6A 2JIVA 3LMGA 3PXZA 3T8OA 5EKNA 4X6QC 5LCJA 4FIHA 4I20A 3W2CA 4BC6A 4Q5HA 4MCVA 4NSTA 3UQFA 2PYWA 4FNZA 5CNNA 4MYGA 2XNMA 4MXYA 3A7IA 3RTPA 3SRVA 1ZYCA 4O7SA 3MV5A 4K2RA 5CQWA 5AV2A 4YLJA 2IW8A 3RPRA 4LGDA 3LPBA 5AP2A 5H8EA 3WE8A 3QF9A 5EQEA 1XHAA 3BBWA 2ZV9A 3W0MA 2JDTA 4OAVB 1W2DA 2Y4PA 4IC8A 5HLPA 2B7AA 1UU7A 2QHMA 4P2KA 4CRLA 3UC3A 2QOHA 3PA5A 3K54A 4IJ9A 3UQGA 5FTQA 3NGAA 3DT1A 4R3CA 1Q61A 3WIKA 4EJ7A 4DGLC 2W5BA 2XIXA 4U0IA 5DT0A 5JFSA 2UW0A 5J9YA 4IEBA 4NJDA 3SGCA 4R3PA 1UNHA 3QWJA 2XARA 4BYJA 2BKZA 4UEUA 3LKMA 3AC5A 4IWQA 4HGEA 2BALA 3VBQA 3UOKA 3SW7A 4LGGA 4IWPA 4PPBA 4EBWA 3DAEA 2WMAA 2ONLC 3WE4A 4EQMA 5AP1A 2W7XA 2ZMCA 3HECA 3MVJA 4O0YA 5FTOA 4C33A 2VD5A 3FI4A 3BELA 3R02A 3ALNA 2Y0AA 2VTLA 3F2AA 3IECA 4U7ZA 3GU7A 2J0MB 5BVKA 2WIHA 3NCGA 3UQCA 4DH1A 1SM2A 3SKCA 3EIDA 5C01A 4XCUA 3O2MA 1WCCA 3TNHA 4YO4A 1KE6A 3UPZA 4KBCA 4OTGA 4IJPA 2FSLX 4ASEA 5ACKA 4MD8E 1L8TA 4AZFA 3SW4A 1E9HA 4FV4A 4ZTSA 4I24A 3W32A 2VX0A 3KL8A 3PSCA 4MWHA 3QCXA 5EDPA 2WPAA 1UU8A 1YXXA 3KCKA 4BTJA 4TZRA 4CT1A 4YJOA 1GZ8A 2C5NA 3G0EA 4FKOA 3W1FA 4AN2A 2WO6A 4FV6A 3V6RA 1O6LA 1SVHA 4CCBA 5DPVA 4EOQA 3L1SA 3EYHA 2XNGA 4IW0A 3DDPA 3LE6A 3FBVA 3JR1A 4RZWA 1ZRZA 2XMYA 2F57A 1ZMUA 5BVDA 2UW7A 3OCTA 4XJ0A 2C6OA 3W16A 2CHLA 3CY3A 4NEUA 2BHHA 5DVRA 2BFYA 2W4JA 3DV3A 4JAJA 5FP5A 3U6HA 4FMQA 4PUZA 3EQDA 3R8VA 2IO6A 2O3PA 5DIAA 5CSHA 4JDHA 4WNKA 4EOKA 3R28A 3ZCLA 4AU8A 2CCIA 5JK3A 5M57A 4QP7A 3LLAA 2JIIA 1P14A 4XBRA 3Q2MA 2X7GA 3P1AA 4UMQA 5DBXA 1G5SA 2IF8A 5JGDA 4APPA 2FGIA 4J1RA 4TNBA 3DB6A 5CU4A 2GMXA 4EH6A 4PPCA 2R0IA 5J7HA 1R0PA 5KMKA 3SHEA 1YOLA 4UWBA 4GCJA 2BRHA 1JPAA 3OROA 5E8VA 5A14A 4BR3A 1UKHA 2YABA 4RWKA 3N4UA 3PP1A 4XRLA 3V51A 3ZXZA 5IPJA 2AEGA 4TKSA 4Z7GA 2PZPA 3BWFA 4IAAA 3FLQA 1STCE 5CI7A 4L53A 4EK5A 1O9UA 4U97A 4YR8A 4KKGA 5KMOA 4QDVA 4YZDA 1NVQA 4HVIA 5ETIA 5E8ZA 4GYGA 4TYJA 3VJOA 4YLKA 4FKWA 3OZ6A 3CQEA 4L3PA 4BBFA 4ACCA 5B7VA 5LMKA 2VTRA 4U3YA 3RINA 2WQEA 3F3WA 4IM0A 2WELA 2C47A 2XCHA 3WIGA 4M3QA 4D1ZA 4DFBA 4QP1A 3ELJA 2X7FA 4IB0A 4QP4A 2BPMA 3TKUA 3KY2A 4GK2A 2XIYA 4KKHA 5E8XA 2ITUA 1R1WA 3AQVA 3DZQA 3LFFA 4A06A 2UV2A 3TL8A 3PJ3A 4FEUA 2O8YA 2BILB 1VJYA 3O7LD 4JXFA 3CR0A 5EQYA 3ZFMA 2HIWA 3KK8A 3NNXA 5A4QA 1H4LA 4JLCA 2QOOA 3UBDA 5HORA 5BMMA 3I7CA 1CM8A 5KMIA 3ACJA 3PRFA 2CMWA 5J79A 3QWKA 3OCBA 5CU3A 3OBJA 5HO8A 2Y7JA 4WG4A 2ITWA 4M84A 4C4GA 4MF1A 2FYSA 2OJGA 4ZLYA 3B2WA 5CAQA 3P08A 4OBOA 3W55A 3FSKA 3ATSA 3EL7A 4I0TA 4FTCA 5ANDA 5CSWA 5ANOA 4BCHA 4N4SA 4FT3A 3G6HA 3ZS5A 5TF9A 4CMOA 4EYMA 3HA6A 4JQ8A 2QG5A 1DI9A 5L4QA 3FMMA 3PXRA 4X2FA 4JR7A 3AD6A 2VGPA 3UVPA 1BYGA 5KHWA 5LVMA 3TTJA 3OCSA 3FLZA 5ETFA 1CTPE 3OT8A 3QLFA 3GU6A 4FRFA 4WRSA 3NCZA 4M0YA 4BZDA 3ZUVA 4DFUA 4XP2A 2YM8A 4C3FA 2OZOA 2X8EA 3EN6A 1REKA 4RZVA 3BLAA 3MN3A 1IA8A 1UWJA 4D2PA 3NS9A 3OVVA 4YURA 1ZMVA 1TQMA 3MTFA 3ZRKA 4FBXA 4MKCA 3U55A 5EK7A 4C02A 4F9AA 2OJFE 2J5EA 5CT0A 1I09A 1MP8A 4YHTA 1Y6AA 2VWVA 3LJ0A 3PJCA 5CASA 2X4ZA 3BHVA 3ZSIA 2X8DA 4AA5A 4B0GA 3UZTA 1OGUA 1KE9A 1TQIA 3MH2A 2CGXA 3P4KA 2WQOA 4IANA 4UY9A 2W96B 3S3IA 3QTXA 5JZJA 3FKOA 4MF0A 2YM5A 2ITZA 3Q9WA 4U44A 1RDQE 2WGJA 5CEQA 2BAQA 3R22A 3DFAA 2QOFA 1ZY4A 4ZMFA 2C69A 3V5QA 4AXFA 5E8UA 3R9HA 4FK3A 4EC9A 5DNRA 3DPKA 3LW0A 4MNEB 4TTHB 5E91A 4ACDA 3KREA 4JAIA 3P0MA 4UMTA 4IVAA 5KBRA 4ZMEA 3EFWA 2BUJA 4TNDA 4CKIA 3V04A 3WZUA 1KSWA 4KS8A 4L45A 2HK5A 4EOMA 3TZ7A 5AWMA 3GC8A 1U54A 3RCJA 2J90A 4U43A 1YHVA 4H3QA 4HGTA 5HG8A 3DXPA 3RHXA 4JOAA 4WBOA 2OZAB 3NNUA 3HNGA 3OEZA 3E3PA 4GFMA 1FBNA 4FEWA 3BE2A 3FE3A 4G6NA 5GIOE 3WZJA 3R8PA 1GIHA 2V5QA 3C0HA 2EXEA 1T46A