1XH8A

Crystal structures of protein kinase b selective inhibitors in complex with protein kinase a and mutants
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Design and crystal structures of protein kinase B-selective inhibitors in complex with protein kinase A and mutants
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 112
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xh8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xh8A02
1Z57A 4C3PA 5A54A 3I0QA 4TN6A 4WG3A 5IPJA 3C0IA 3L1SA 2F49A 4WA9A 5E8UA 1TKIA 3KGAA 3WBLA 3IECA 3PZHA 5FEEA 3GCUA 5BYLA 1OBDA 2REIA 2W4JA 2CNUA 1BLXA 5J1VA 2NRUA 1GZOA 3DB8A 4MF0A 2WTCA 4BIEA 3CTQA 4EH7A 3EQIA 2AC5A 4R3PA 2XYNA 3KRJA 4IAIA 5DT0A 3LFCA 4YPDA 2QURA 5ANJA 2WMBA 2R64A 3TTJA 2VO6A 1G5SA 2W96B 3KEXA 4JAIA 3UNKA 3FMNA 3GU8A 3R00A 4IFCA 2PPQA 5FTQA 5AAGA 3JVRA 3S1HA 1SZMA 4RJ7A 3UG2A 5DGZA 1XH9A 2V0DA 5EI6A 2V55A 2CNVA 2C3KA 3QUPA 4UYAA 2G01A 5AR7A 4PMSA 5HU9A 4I5HA 4EWHA 4DG3E 5LOHA 4C02A 5IQBA 3GCPA 4GJ2A 4U5JA 4AS0A 2YM5A 3OOGA 2GPHA 1Z9XA 2XYUA 3QRJA 2OJ9A 3MA6A 3IDBA 3FY0A 2ERZE 2QLUA 2IG7A 3BYMA 4O21A 3OTVA 1QL6A 1Q5KA 2YM7A 4IB3A 4YO6A 5I4NA 1Q8YA 2IW9A 4AZFA 3EOCA 4EK4A 1XH6A 4QP9A 2GNLA 3JYAA 5HVJA 3IK3A 3CQWA 4J71A 4H05A 4GFMA 2R2PA 3D5WA 3DKGA 3MBLA 2BRHA 4RJ4A 4IJ9A 3ITZA 2AC3A 3BYVA 5AEPA 3IONA 3F69A 5D12A 5HIDA 4ITHA 2CHLA 4QQJA 1R0PA 3V5QA 4RA4A 3DAJA 3UPZA 4OTFA 4R5YA 4RMZA 3LFAA 5E8XA 1PXJA 2RF9A 4FL3A 4MWHA 3D7TB 5AUYA 5JFXA 3OCGA 1NVSA 2WIHA 4NTTA 2O2UA 4QP4A 4XV9A 2CKEA 2VRXA 4FSNA 4U79A 3WZEA 4ZS4A 3C4EA 3U55A 1CKIA 4BCGA 5FBOA 4CG8A 3NAYA 4JDJA 3LFEA 2I7QA 4BDEA 2QR8A 2HZ4A 2VNYA 3UC4A 3QXPA 4QNYA 1KE7A 4TYEA 3LLAA 4FKIA 3KK8A 2BKKA 4AGDA 1O9UA 3Q9WA 3OBJA 3AMYA 4JG8A 4MD9E 5TT7A 4AZVA 3IW6A 4PDYA 1CKJA 3FKNA 3NR9A 5DRBA 3UVPA 5C01A 4WIHA 3BKBA 4I6FA 2UVYA 3G5DA 2EUFB 2WMQA 1H1WA 2JKMA 3HRCA 5EM8A 3RK7A 4F63A 4DCAA 4FKPA 3RCDA 2A19B 4CKRA 4BCHA 4S32A 2JKOA 4G6LA 4YLKA 4AQCA 3P7CA 4L7SA 5AA9A 4UMUA 2YM4A 4QP2A 4YJRA 3VN9A 3CJGA 3D83A 1M14A 3OCTA 2FH9A 4EORA 3ZBFA 3UG1A 3FZRA 4M8TA 5KZIA 4FIIA 5AAFA 2CGVA 3PE1A 2BDWA 4X2JA 4GUBA 2PVHA 3R8ZA 3VF8A 3AD4A 3O7LB 4NM7A 4RWKA 2XNGA 3MW1A 3SHEA 3U4WA 3WZUA 5HLWA 5JGDA 1NY3A 4CRSA 4LM5A 2XNBA 3PTGA 3EQBA 4FF8A 3QXOA 3TUBA 4CMUA 1H28A 3FXWA 4I5MA 5EYMA 5GINE 1H4LA 4BCIA 5EQPA 4FL2A 2XNEA 3T9IA 3ORTA 3UIBA 3UVQA 3EFKA 3R6XA 3NYOA 4LL0A 2UUEA 2CLXA 4FTKA 2BFYA 2XVDA 2OJIA 2QU6A 3FQEA 1G8SA 3SLSA 5LMKA 3ZC5A 5FD2A 4AXAA 4Q9SA 4C62A 1G3NA 4EC8A 3WZDA 2VWIA 2J0IA 3FZ1A 3MH2A 4IZAA 3AG9A 4ZZOA 4ENXA 3LCDA 2W5HA 3DFAA 3PJ8A 3OUKA 4GKIA 2W05A 2WKMA 3OEZA 4WO5A 4O38A 3P78A 3SVVA 4LFIA 2YFXA 3VUKA 3LLTA 4MVFA 3KXZA 2C6MA 2PUIA 4XRLA 3NUAA 3ELJA 2UW6A 4IM3A 4E6CA 5L8JA 4QMVA 2PZRA 4G5PA 3OP5A 3Q60A 4F7NA 2FSOX 2XRWA 3A61A 2J4ZA 2JDOA 5M4IA 5BUIA 2VWXA 2Z02A 4M66A 4UXQA 4IM2A 3ROYA 3MY1A 5L4QA 4CMTA 4ITJA 3LQ8A 4FEQA 5LCJA 2QG7A 4FV2A 5FM3A 1REKA 2BZJA 2CGXA 2ITOA 2WEVA 3CIKA 3REPA 3NW5A 1XJDA 2RGPA 2BVAA 2IJMA 3PJ2A 3TTIA 3DDQA 3KXHA 4QMXA 3RAHA 4ZEGA 2O8YA 3ENMA 3HDMA 5CXZA 3R1QA 4L43A 1O6LA 4G34A 4MNEA 1R78A 4AGCA 1UKHA 4ASEA 2JIVA 1KOAA 4ZZNA 1FVVA 5E8YA 2OGVA 5ETFA 3NGAA 3KRLA 4G3DA 3BHYA 3EZRA 3ZC6A 4S30A 2JDTA 2BPMA 2VX1A 1NVQA 2QOBA 3TT0A 1V0OA 4WG5A 4BICA 4AFJA 4PNIA 3RBWA 4QTCA 5E9EA 2B54A 2ZB0A 1DAWA 2OF4A 2ITPA 3VULA 4BY9E 5JMSA 4EKKA 4OLIA 1ZYSA 2O64A 2GS6A 4CKJA 3ORIA 4O0VA 5CAUA 3QC9A 3DK7A 4JJRA 3V8TA 2BRBA 1ZY4A 4GIHA 3MY0A 5CEIA 5KMIA 3KXXA 3JR1A 2WTKC 4BI0A 5HLNA 1Q62A 3L9NA 4KSQA 4WD5A 3PRIA 4DE4A 1E9HA 1ND4A 3EJ1A 4HPTE 5L6WL 3ZXZA 2EU9A 2ETKA 2R3LA 3C51A 3MJ2A 4Y83A 4YLLA 4GL9A 1JNKA 4L3PA 4Q2AA 2YWPA 4YTIA 5IU2A 2ZV9A 3BU6A 3FBVA 1WVYA 3GC9A 2A0CX 4J97A 4KWPA 4RZWA 4C58A 4EI4A 1U54B 1YOMA 5HE0A 3OXZA 3QHWA 2ZM4A 4M97A 5E8WA 4Y8DA 4LUDA 3RPSA 4JRNA 4AP7A 3E87A 4CFXA 4DGMA 3K3JA 4X3FC 3QU0A 4EOPA 3VHEA 3WF6A 4BGHA 1ZOGA 2VTOA 3MB6A 3NUYA 2IZSA 1HCKA 3V8WA 3KRWA 2VTRA 3EHAA 4G3EA 4CFUA 5BVOA 1SNUA 3QCSA 5AR2A 3SW4A 4O0SA 4EL9A 3I79A 4GJ3A 4B8LA 3VUTA 3COHA 3QTQA 2JFLA 3H0YA 3QQHA 3R1NA 5CY3A 4DTKA 5KKRB 4MXZA 3TXOA 3LM5A 2HW7A 4YHJA 4NIFA 3Q6WA 4N6ZA 4R8QA 1K2PA 1NA7A 2E9PA 3DGKA 4KRCA 4GW8A 4AN3A 3GCSA 4LGGA 5BVNA 2IO6A 3CE3A 3JY0A 2B55A 2WOUA 3CLYA 4FNXA 4NUSA 4X3FA 5LMBA 5HZNA 3D0EA 5KCVA 4RA5A 5F4NA 4AT5A 2BHHA 1W82A 5HNGA 3BBTB 3P7AA 3UJGA 5KMKA 4CTBA 3JXWA 4ORKA 3S0OA 3QGWA 5IA4A 5AP7A 1T45A 4HVHA 4XBRA 4MWIA 3VUGA 5C26A 4I21A 2J0JA 4FZFB 4DGNA 2YABA 3DQWA 2VO3A 2R3NA 3EQHA 5EG3A 4FGRA 1B38A 2P3GX 4V01A 5H9BA 1K9AA 4AFEA 4EH2A 2WAJA 3O23A 3MIAA 4PUZA 4C7TA 3ET7A 2I0YA 5M4UA 1U46A 2JIIA 1WMKA 4ZTSA 4O27B 5IA5A 2VTHA 4J99A 2GU8A 3RINA 4AT4A 1JSVA 4YZBA 4U40A 3FYJX 4XG8A 5CENA 2PK9A 2ONLC 1MUOA 2R3GA 2EB3A 1ZZLA 4AW0A 1PJKA 3FI8A 3D5UA 2XBJA 4FKOA 1WBOA 5AUZA 2Z60A 4QMUA 3FEGA 5C27A 4EOQA 3FL4A 2W9ZB 4FUXA 4GRBA 5AIKA 5DPVA 1JKTA 3RPVA 3UDBA 4R1VA 4DFLA 3LVPA 2X1NA 3E64A 4G6OA 3PPKA 4S33A 3I6UA 4OUCA 3R9DA 4D1SA 3L9LA 4FK6A 2YZAA 4G9RA 1KSWA 2C6OA 1IR3A 2YITA 5HESA 4ZY6A 1Q8UA 2YACA 3F9NA 1UU3A 3MV5A 2B0QA 3GVUA 3CJFA 1VR2A 5M51A 3ZRMA 3HGKA 4JIKA 3DBEA 1PYEA 3AT4A 4AGWA 5A9UA 5I3RA 3DB6A 4L53A 4FV9A 3DXPA 4KIQA 3M42A 3EKKA 3OWPA 3F2AA 4O81A 2YCQA 2Y0AA 4XP0A 5DR2A 2C68A 2WIPA 3QX4A 1XH8A 3OEFX 4ANSA 4GKHA 1B6CB 1AQ1A 3CPCA 1GZ8A 4UBAA 5IEVA 2JAMA 5JZJA 4FEUA 2ZM3A 1H27A 1ZLTA 4I3ZA 4BCJA 3OT8A 4BN1A 2X0GA 2X8EA 1J91A 2PZIA 2V5QA 3V6SA 5K5NA 5HKMA 3ORKA 1GIHA 4EK3A 4L46A 3KVWA 4YC6A 4IX5A 4D4VA 4FTRA 3SKCA 1S9IA 3ZOSA 1NXKA 4FODA 3K54A 2J51A 2QO7A 4K33A 3DKCA 4TYIA 5T3QA 2Y6MA 3MVLA 2WTDA 5B2MA 2VZ6A 3MPTA 3ZM9A 2GNHA 5HBJA 3BEAA 1OBGA 4TYHB 4TPTA 5EDRA 3G6GA 2W06A 1BMKA 4JR3A 4QYEA 4BDBA 5GHVA 3JPVA 4GT3A 4LRMA 4ALUA 3BEGA 5TE0A 3FZSA 4UWYA 1SVGA 3VS6A 3WYYA 2J2IB 3AC8A 3P23A 1ZRZA 3WE4A 3QKMA 3QD3A 1UNLA 4XS2A 2JEDA 3MFUA 1LP4A 5FBNC 2CKQA 4Y5QA 1JOWB 5J1WA 2VTPA 2Z2WA 2C6DA 4IWPA 3TM0A 1OPJA 2RKUA 4DT9A 1OUKA 5DE2A 5AR5A 3ZSGA 2OIDA 2R9SA 3QKLA 3FKLA 5KBQA 3VC4A 4XG3A 4MBJA 4M67A 5BPYA 4FL1A 2F7XE 5H8GA 4G31A 4D2WA 5A4QA 2Y7JA 5HIBA 3ZYAA 1HCLA 5CTPA 2R3HA 4AACA 4EHGA 3QF9A 1PXOA 4DEAA 4U7ZA 2CGUA 3FMJA 4CYJA 3KFAA 3A4OX 4OTHA 3AMAA 3M1SA 4XV3A 5CSHA 4QPMA 2XBAA 4CGAA 2XIZA 4K6ZA 4KBCA 4BBFA 3CEKA 2X81A 3UNZA 4TXCA 4C61A 1KUTA 5DOSA 3TV4A 4B7TA 1I44A 4YZMA 2YIXA 3AC3A 3SX9A 1ZWSA 2YISA 3ANQA 3PA4A 4QD6A 2X4ZA 3FXZA 3R73A 3R7EA 4B9DA 4ZTLA 3ZTXA 5DFPA 2YJSA 4MHAA 1YWVA 2Q0BA 4FX3A 1JVPP 4R3CA 4U45A 3BGZA 5IH5A 3VUHA 5JFWA 3FSFA 3U9CA 4OTIA 1Q61A 4LOPA 4K77A 4O2ZA 4XLVA 5HTBA 4JAJA 4JQ8A 4GMYA 1ZYDA 2OJGA 4KB8A 3OBGA 5C03A 3R7VA 4LV5A 3ZO2A 4D0XA 5BVEA 4HZSA 3QYZA 2GHGA 5L3AA 2ZAZA 1JWHA 4L52A 4FICA 2B7AA 4D5HA 3TNIA 4UMTA 3ZM4A 3ORMA 4EBWA 2BILB 3UMWA 4BDHA 1M7NA 2ITNA 4FG7A 4GV1A 4NKSA 4KKGA 3TV6A 2B9JA 2WHBA 2ZOQA 4BGGA 3U6IA 1GAGA 5CSWA 4E7WA 3GU6A 3V04A 4NM0A 3DLSA 1JPAA 3QWJA 2UW3A 1CM8A 4H3BA 4MYGA 4E6QA 4P5QA 4DLIA 5E91A 5M53A 4LOQA 1PMEA 3EZVA 3PVUA 4RJ6A 3A7HA 4RLKA 3VIDA 3TEIA 4XG6A 2HXQA 1W0XC 1KV2A 4A7CA 3FUPA 4RWLA 2VTQA 4MK0A 3UYTA 3PG1A 5IA1A 3IQ7A 4BWKA 4USFA 5ITAA 5DLSA 4ASXA 4BKZA 4YHFA 3QQKA 2BIYA 1XBAA 1UNGA 4JDKA 4YPSA 2CPKE 2UZOA 1OITA 3C0GA 5ETCA 4UWBA 4X21A 4WKQA 4ALWA 2C1BA 4D4SA 2QG5A 3PSDA 3O8UA 3QTUA 4DAWA 4IADA 3FMMA 5G1XA 4Y46A 2O3PA 2HCKA 3DJ5A 1CKPA 2WU6A 4ZTNA 4O96A 3U51A 4OAUC 2OSCA 3R1YA 4EK8A 3FI4A 4ZSAA 4S2ZA 3FMDA 4GVAA 4O7TA 4WBOA 4DITA 3C4FA 5I9UA 1ATPE 3CXWA 4ZS0A 2WQOA 4JT3A 2FSMX 2WNTA 4GSBA 4RX8A 4WRSA 4QMPA 2QLQA 2R3KA 2FSLX 4NTSA 2Z8CA 2QQ7A 3G9LX 5EYDA 4C57A 3ENHA 4E5BA 3BYSA 3RHXA 5IA3A 3T3VA 4W9WA 4BCNA 2I40A 1ZOHA 2YERA 4AAAA 3EYHA 4APPA 3OT3A 5EHYA 4D4YA 2QODA 3O0GA 3TDVA 4M14A 3MA3A 3DOGA 3F7WA 4QMQA 2W4OA 4G5JA 4TRLA 3TKHA 3LQ3A 3E7OA 1F3MC 4YJTA 4A9RA 4F0GA 1PMUA 4XV1A 5KMNA 2VX3A 4HNIA 4O7ZA 4W4XA 5AIRA 4XP3A 3UIXA 3MPMA 4IAAA 3QCYA 5DWRA 5CZHA 5I9VA 3R2BA 3AD5A 4EK6A 3PJ3A 5KMOA 5C1QB 3RPOA 4BVUA 3COMA 3MVJA 4I20A 1OVEA 5D11A 4ZAUA 2OU7A 1W98A 3QTXA 5JZNA 1IAHA 1YOLA 2ZMCA 4CD0A 3GBZA 2BRGA 1E1VA 4L67A 4E4XA 4EZ3A 5BQ0A 4ZJIA 2OIBA 4IMYA 1PMNA 4BWPA 4M12A 4XRJA 4C34A 5HCYA 3LFQA 2WFYA 2Y4IC 3E3BX 3RAWA 3V5TA 2E2BA 5KUPA 3N4TA 3F88A 2ESMA 2R0UA 5FP6A 2KTYA 3EN5A 3LCOA 3QA0A 4ZSEA 4BCQA 3CGOA 2Z7RA 3POOA 5AM7A 4ZLOA 5A4CA 5AP5A 3RALA 2G2HA 1R3CA 3GFEA 4RJ3A 2NP8A 3EB0A 3D94A 3R71A 4GK2A 4LG4A 4RVLA 3SD0A 5HORA 3ZO1A 4ANMA 2X2LA 4KIKB 4U43A 2OLCA 3OXTA 3VUMA 1TQPA 5FXRA 3FZOA 2BUJA 1KE8A 2PMNX 2XM8A 3KF4A 1GNGA 4C0TA 5L2TA 4LRJA 2WZJA 2JLDA 4YJPA 4ZP5A 3TWJA 2J5EA 4OBOA 4QP1A 3DXQA 4EZ7A 1OL6A 2YIWA 2X7GA 4NWMA 5A3XA 1NT2A 3HX4A 2C30A 4EH5A 4HVDA 3BLHA 4DH5A 1URWA 4YZNA 3HMIA 4DH3A 4BBMA 4CT1A 4EWQA 5H3QA 3GC7A 4BYIA 1OIUA 3K5VA 3DZQA 3QD0A 2PVNA 4N0SA 2VV9A 4Y95A 4EH4A 3KRXA 4XOZA 3FV8A 3IW8A 3IG7A 3PIZA 4IB1A 3OY3A 4R7HA 3JUHA 2HIWA 3GNIB 3R2YA 4LGDA 4M84A 4NSTA 4QP3A 4QNAA 4RPVA 3U4UA 3W2RA 5E8SA 4N70A 1WAKA 2BAJA 2UZVA 4W9XA 4WRGA 2R0IA 5M56A 2UW4A 1IG1A 3KN6A 3MVHA 4XG2A 4JX3A 3R1SA 5K0KA 4CG9A 4DC2A 4UMRA 1JSTA 3S3IA 3DV3A 3JS2A 4USEA 4RFMA 4D9TA 2W0JA 1FVRA 1DAYA 3BWJA 1H00A 1GOLA 3NNUA 4LMUA 3LXKA 4RIXA 2CGWA 2OWBA 3OF0A 5L6PA 4FMQA 5HTCA 4FSTA 4I1ZA 3DJ7A 2I0EA 2VTSA 3LFFA 1V0PA 2OICA 2CN8A 2C5NA 2GHMA 3HV5A 4FC0A 3EIDA 3UP7A 1OKVA 4ERWA 4OT5A 4OW8A 4S31A 3UQCA 3R7IA 4MXCA 4O7RA 5A6OA 4ZK5A 5JRQA 4KINA 4W4WA 4H3PA 3TIZA 1QPDA 4DCEA 4JBPA 3IOPA 3NW7A 2XEZA 2E9VA 1BX6A 3MS9A 4LYNA 3RMFA 3FL5A 4XYFA 4TTHB 3EQGA 4M0YA 3RNYA 4D2SA 4KUJA 4FI1A 4XP2A 4YC8A 2BTRA 4IEBA 3W1FA 3KCKA 4AZTA 2I0HA 3N51A 5AMNA 4K11A 4XG7A 4YJUA 3PE2A 4CQEA 5IUGA 5CEQA 4FYNA 3TL8A 3BI6A 3VJOA 4CFFA 4FTLA 3NIZA 1SM2A 3MDYA 4Z7GA 2C3JA 4ZTHA 5GZ9A 2RFSA 3MIYA 4C35A 2GNGA 2O0UA 3A8WA 4FSUA 4CZTA 4NM5A 3MN3A 2P55A 4TYHA 1WBWA 3GT8A 4WUNA 4GIIA 4ZMFA 4AN2A 1CMKE 4JVGA 5TO8A 4MXAA 1ZZ2A 5CX9A 4O1OA 2OKRA 3QRTA 2GNFA 3ACJA 4RIYB 3WILA 4LL5A 4UX9A 2X2KA 3ACKA 2IWIA 4BRXA 3BLQA 4ZXTA 1M52A 4GT5A 5CI7A 2BROA 4ENYA 4LRKA 4AX8A 2QR7A 4JG6A 2JD5A 3WF8A 5L6OA 1H25A 3Q5ZA 3NYXA 2W4KA 1WCCA 4O82A 2X7FA 2FA2A 3W55A 3R8LA 2BRMA 3F3UA 4FSMA 2GS7A 1Q8TA 3PWDA 1JSUA 3UIUA 3DBQA 4UYNA 5ETAA 1DS5A 3KU2A 4GCJA 5BMSA 3G2FA 2VUWA 4XG9A 2VTTA 2GTNA 3VS7A 5D10A 2E9NA 4FVPA 5DIAA 5L8KA 4KS7A 5K4IA 4IC7A 3FMHA 4FOBA 3UZPA 5EI8A 4ZTMA 2XB7A 5HX8A 3U9NA 4YTCA 3MI9A 4AA5A 4WOVA 5AUWA 5AP0A 5DVRA 2ZJWA 3FE3A 5IKWA 5AP2A 4KAOA 3BHTA 3R8UA 4Q9ZA 2W7XA 1Q8WA 5IUIA 1H1SA 1UWHA 3T8OA 1YXSA 4X2NA 2HK5A 3OFMA 2I6LA 3P0MA 3DBCA 3IW7A 5HG7A 4KS8A 4C33A 3BU3A 3HMPA 2PMIA 3I5ZA 3OC1A 3IGGA 3F3ZA 2WQNA 5CNNA 2PUUA 4HGEA 5CF6A 4UZDA 4O7NA 4X7QA 4KBKA 2V62A 2YAAA 1FOTA 3A60A 2QOHA 3P08A 4JDIA 3RCJA 1OPKA 3PZEA 4DT8A 4CV9A 4IJPA 3WF5A 4JBOA 2BZIB 5EOBA 3NVMB 3QZIA 1ERKA 5KBRA 1YI6A 1YXVA 3F5PA 3W2PA 5E1EA 3QLFA 4FT3A 4BKJA 2IVVA 4IB0A 5CNOA 3N4VA 4HNFA 1MQ4A 5IQCA 5TKDA 2XIYA 4G16A 3L9MA 3NNWA 4G1WA 2QOLA 5TF9A 4C38A 2XK4A 5GJGA 5AUXA 3NZ0A 3QQJA 4YSJA 5IQDA 4RVMA 4E5AX 1YI3A 3C9WA 1U5QA 3OW4A 2YM8A 4F09A 1PXKA 5EW3A 3PIXA 3R63A 4HGLA 4P90A 2C1AA 4D1XA 4NJDA 4QP8A 4BYJA 4ZJVA 3UTOA 2OZAA 4ZY4A 3D2KA 3FI2A 2XMYA 4IDVA 4USDA 4B4LA 3H9FA 2DS1A 4MQ1A 4AZEA 5J7BA 5LMKC 5HLPA 1RE8A 3KK9A 3LFNA 4YZ9A 2ITYA 1IEPA 3TIYA 2FSTX 1YWNA 5T68A 2CNQA 5FEDA 3LHJA 2UZBA 2BRNA 4L3JA 3VBYA 5IA2A 4YGAA 1UU8A 4TWNA 5K9IA 2WQBA 4ACMA 4GK3A 3RVGA 4RWJA 3SRVB 3O50A 3ORZA 4NT4A 5HO8A 5BYZA 3PVWA 4CNHA 3DAKA 4EHVA 3SC1A 4FGBA 2FYSA 3QQGA 5BNJA 4U3YA 4CT2A 2PVMA 4XV2A 3UVRA 2OXXA 4F1MA 1UV5A 3MB7A 4ERKA 5BVDA 1J7LA 4BWXA 3FKOA 4IWDA 1Y8GA 1BKXA 5K4JA 2F7ZE 3N9XA 3KVXA 4IAFA 3ZXTA 2R7IA 5HE1A 5LVOA 1NVRA 4GYIA 2VTNA 2OXYA 4DH8A 3KB7A 4GEOA 3LM0A 4GS6A 1ZXEA 5EW8A 4F9AA 4D4RA 3SXRA 1PRYA 1KE9A 4M3QA 4MCVA 3KQ7A 5E8VA 4DH1A 2HWPA 3OXIA 5BYYA 2PE1A 3DTWA 4X6QC 5CSXA 4FT0A 5E92A 3VBQA 4A4LA 5K5XA 3CKXA 4IBMA 1YDTE 3QQLA 3O2MA 3P5KA 2X4FA 2PU8A 2FB8A 3FPMA 3GC0A 3V5WA 4NL0A 4R7BA 2PL0A 3F3VA 4IZ5A 2YA9A 4CVAA 3HVCA 5L2WA 3HNGA 4EZ5A 4KA3A 4FKLA 4WNPA 3RM6A 3HECA 3KY2A 3IO7A 4JQEA 2R3JA 5CEKA 3L8SA 3G9NA 5I0BA 4K18A 4XX9A 2X2MA 4L7FA 5CSVA 4PMPA 3Q32A 2PZPA 4TNDA 4PV0A 2YIYA 3UOHA 3V6RA 1E1XA 3E5AA 3F5UA 3W16A 4E20A 2Q83A 3TCPA 4ANNA 4E4LA 4NYEA 2BMCA 2XEYA 3UGCA 4DF3A 4LGHA 4EHZA 4ITIA 4CEGA 5EI2A 3ZBXA 5J9YA 5IQFA 2QD9A 4L3LA 3GOPA 2F4JA 4R78A 5HBHA 4QMZA 5J7HA 3MFTA 4D9UA 2QOKA 1BL6A 3L8XA 4IZ7A 1YKRA 4RQKA 4QTBA 4RIWA 2R3MA 3RZBA 2C5OA 4IVBA 5EM5A 3HMMA 5DHJA 3TZMA 2UW0A 4PNKA 4NCTC 1OPLA 4PDSA 3UYSA 4NW6A 5JFVA 2QKRA 1VYZA 2OF2A 1H07A 2CKOA 1IRKA 4F1OA 3AT2A 2PVRA 1DI8A 3E3PA 4M69B 5EOLA 4RX5A 1LEZA 5D1JA 3VJNA 1O6YA 2QOOA 5C9CA 2DQ7X 1FGKA 4MBLA 3S2PA 1JKSA 2XKCA 4L42A 2BDJA 4F1TA 2WO6A 4MQ2A 5FP5A 2QOCA 4FIGA 4C37A 1VJYA 1OIQA 1WBSA 3PPJA 2ERKA 3PFQA 5AV1A 3LKMA 5CSPA 2YZLA 3EFWA 4RG0A 1M7QA 3C0HA 3AC2A 3Q6UA 5DR9A 4NCTA 4PTEA 3RK5A 4FVRA 1RDQE 4BDKA 3A8XA 3FLSA 5I5ZA 2VX0A 3GU7A 4UB7A 2IPXA 4F6WA 4H36A 1Q41A 4KSPA 4XEYA 2RSVA 3ANRA 3ZFXA 3NUXA 4RQVA 4RT7A 5CANA 2CN5A 4XHKB 1ZOEA 3MH0A 5CVHA 1PHKA 3UBDA 4D2PA 4GFGA 3HA8A 4DEEA 1JLUE 2C6KA 3MTLA 3O71A 4BCFA 3VW8A 4Y85A 3EKNA 4TKSA 4YJVA 3NCGA 4D5KA 1U5RA 4B99A 5CU0A 4BR3A 2WEIA 2WTWA 5I9XA 3ZUUA 1GY3A 4E3CA 1R39A 2G15A 4W8EA 3VS1A 3FMLA 3TZ7A 2PZ5A 1OIRA 4E6AA 4ANOA 4E8AA 4F7SA 4E5WA 2PVFA 3MTFA 2VO7A 1MQBA 3DDPA 4LQMA 3PY1A 4K2RA 3DPKA 3ZEWA 2W1ZA 5I9YA 3NS9A 4UY9A 1YDRE 2ZM1A 2ZV2A 1YWRA 4I6BA 3HAVA 2P4IA 3WIGA 4QT1A 2UZEA 5EFQA 2OBJA 3IPHA 1J1CA 3DNDA 2A1AB 1FVTA 5L2QA 3KKVA 5IEXA 2YDIA 4QTEA 2VD5A 3BHUA 4GG7A 4MF1A 2F9GA 3UIMA 3ZEPA 4HGSA 4XH6A 5F20A 3BWFA 4I22A 2VTLA 4MTAA 4IWOA 5CEMA 4PPBA 2V7OA 3GUBA 4U41A 2J7TA 4J1RA 3ZU7A 4F6UA 4KABA 1H01A 2XM9A 3QQFA 4FVQA 3E92A 3L8PA 4V0GB 3R7OA 4B8MA 1PXNA 1IA8A 2PWLA 3KULB 2JC6A 3NLBA 4FKRA 4HCVA 4BTJA 1STCE 1UVRA 3UNJA 2Y4IB 3PSCA 3PJ1A 4G3GA 4G3CA 1ZMUA 4JNWA 5JN2A 3R8MA 5FGKA 3QRKA 4I23A 3CP9A 2PSQA 1TVOA 3GEQA 3UQGA 3LMGA 5HE3A 3C50A 2PVJA 5J5SA 5M08A 1AGWA 4QPAA 4U8ZA 3KF7A 4L9IA 5GNKA 3UO5A 3LPBA 4M68A 4HVIA 2BAQA 4QMMA 2BR1A 3BBWA 4GUEA 3R83A 4I5CA 2YCSA 4OGRA 5L2SA 4JDHA 5HG8A 3ODZX 2H6DA 3H3CA 4YZCA 4FTAA 3QGYA 4YJOA 4BB4A 4D1ZA 1XWSA 3QD2B 5CAVA 2V22A 4MEDA 3IDPA 3TKUA 3ZUTA 2Q0NA 4I4EA 1IASA 3ZLYA 4HCUA 4YTHA 1P5EA 3OWJA 2CMWA 2FO0A 4BCMA 3RHKA 3D7TA 5IF1A 2HZNA 3DZOA 2VTAA 4IVCA 3W10A 3DU8A 4IXPA 2VTMA 3PXKA 4OT6A 2JAVA 4OTWA 4PL5A 4DN5A 3QTWA 5FTOA 2YDJA 1MRVA 4PDOA 5FWKK 4EOKA 4O0XA 4AU8A 4QMLA 1IAJA 5DT4A 3VQUA 1UKIA 4FTUA 1UWJA 2YDKA 3WF9A 5DH3A 3AC1A 3SAYA 4FNWA 3SXFA 2QO9A 4ANBA 4RIOA 5CXHA 5J9LA 5E8ZA 2NPQA 2ZYBA 4ZY5A 4DEGA 3QZGA 5A14A 1ZAOA 1OECA 2YN8A 3C4ZA 4II5A 3FLYA 4JRVA 3QKKA 1YVJA 1LR4A 3PG3A 4GVJA 4NEUA 5DEWA 5EQEA 3NUSA 5EHLA 1GJOA 4BTFA 3QWKA 5D9HA 4C4EA 3TNWA 2JDSA 4PPCA 3VBXA 3A7JA 1W83A 3MFSA 3HZTA 3OY1A 4FZ7A 4RZVA 5AA8A 1H0WA 1SNXA 3QC4A 5DNRA 5GJFA 2C3LA 1UU7A 2WMVA 4FSQA 2C0IA 5A4LA 3FY2A 4ACCA 4FSWA 3ZRKA 1DI9A 3U6HA 2W1GA 4DH7A 3FLQA 5FQDC 1JQHA 3AXWA 4NK9A 4FTCA 3CC6A 5HCXA 2C6IA 2ZDUA 2ITWA 4NKAA 4ZSLA 2HZIA 3ZDUA 4YNOA 4FR4A 2IZRA 1LUFA 5AX9A 2DYLA 4WT6A 5HD4A 2ITTA 4YC3A 4C4JA 5AJQA 3FSKA 3BHVA 3GP0A 3W33A 2H34A 4C36A 4EEVA 1ZARA 4CLJA 4LV8A 2XF0A 3QTRA 1FBNA 2B1PA 3Q5IA 2RG5A 3DFCB 3B8RA 3I0OA 4RFYA 4WBBB 5HOAA 4IC8A 5GZ8A 3DXNA 2X7OA 2WMUA 2PUNA 3I7CA 3OCSA 3ZHPC 3GI3A 5KO1A 3VRZA 2XZSA 1XBBA 2JBPA 1BL7A 4RRVA 2XRUA 4FNYA 2QC6A 4DHFA 2GNIA 1QPJA 5ANEA 4FKTA 4CQGA 4PQNA 3OTUA 2OH4A 3CPBA 3QFVA 4KKHA 1PMVA 4LOOA 5K3YA 4BDGA 5HGIA 1BI8A 4DGOA 3DKFA 2C0OA 4FKUA 1U4DA 1OL5A 4WNOA 4BBEA 2PYWA 3QD4A 1J3HA 4JG7A 4EOJA 2F2UA 5A46A 1P4OA 4I94A 4MXYA 4NH1A 1YHSA 2ITQA 3PVGA 3R04A 2JIUA 1YI4A 2J0KA 4FTMA 4PP9A 1WBVA 4FA2A 5EW9A 4L68A 3HLLA 3EN7A 3R21A 3F5GA 4U3ZA 2R3IA 3WIKA 2NNWB 1VEBA 1F5QA 2PE2A 1M2RA 1GZNA 4U44A 5BUJA 4Y72A 4DEBA 2BZHB 5FXSA 3W2QA 4X3JA 4YUQA 3O17A 4FTOA 3I5NA 3EQDA 1EH4A 3BQCA 1MP8A 4FKSA 5D41A 3U87A 5BX0A 2OO8X 3DNEA 3P86A 4PL4A 3EMGA 3AC5A 4G6NA 1WBNA 3OZ6A 4PTGA 3FWQA 4K1BA 2ZV8A 2QNJA 4RJ8A 4XJ0A 5LMAA 1G8AA 5JQ8A 1XKKA 1DM2A 2EB2A 2R7BA 2YLEA 3GU5A 3LAUA 4UV0A 3WZKA 4YJSA 4UN0C 4YJNA 5E4HA 4RX9A 4ANLA 5HIEA 4O0TA 3PSBA 2PULA 3HV4A 5J5TA 3LCKA 3HL7A 1GZKA 2J5FA 3B2TA 2XS0A 4D55A 4DEHA 5H8EA 4R1YA 5AUVA 4PY1A 3TZ8A 2H8HA 3O51A 4IH8A 5KKRC 3VS3A 2FUMA 1YW2A 4B0GA 4ZZMA 2H96A 4EUTA 1H8FA 5JQ5A 2UZLA 4RSSA 4XMOA 3P7BA 3VS4A 3FAAA 4FOCA 1U54A 2C0TA 5DEYA 4S34A 4G17A 1RW8A 1FMKA 2ZVAA 3QL8A 3PVBA 4YBJA 2HXLA 3RPYA 3VS5A 4PDPA 5JH6A 4IX6A 5A4TA 4OBPA 4CSVA 3U8WA 2HENA 2X9EA 4U6RA 4ZTQA 3UZRA 1QCFA 4JXFA 3H9RA 3S00A 4R77A 5GJDA 1BUHA 4FBXA 4M0ZA 5AP4A 2IVTA 4C3FA 4JBVA 4QP7A 1OMWA 4IW0A 3SOCA 2W5AA 4U97A 1PXIA 3PY3A 1R0EA 3CBLA 3VF9A 2BHEA 2J6MA 4EH3A 3TUDA 4YHTA 2W1CA 2VGOA 4PRJA 2OG8A 3C4WA 3A2CA 3HV6A 3PDTA 1PF8A 2O65A 4PWNA 4QMSA 4EH9A 5CAQA 3DS6A 2OK1A 5E8TA 1GIIA 4MNEB 4BFMA 3QBNA 5LVPA 1OZ1A 4J96A 3RP9A 3AMBA 3ZZWA 2YIRA 2EXMA 3QLGA 3K2LA 4QYGA 1SVEA 5ANDA 3C1XA 4F6SA 4WSYA 3DKOA 4QYYA 1XQZA 4O91A 2WGJA 1JKKA 4P5ZA 4E4MA 3FMKA 4C4GA 3Q4TA 5AR8A 4F9CA 4H1MA 4AUAA 3ID6C 4FZ6A 2R5TA 5CZIA 4X6RA 5M4CA 4XLIA 4JOAA 1RQQA 2WMXA 5FDPA 4HCTA 4TYJA 4WSQA 5DA3A 3FQSA 3TV7A 4DFBA 4FSYA 2VN9A 4TNBA 4F0IA 5AX3A 3ZFMA 4DFZE 4YBKA 1J7IA 5DG5A 5ANGA 5C4LA 1PKGA 3LXNA 4HYSA 3PXYA 4CRLA 1OKZA 3FHIA 3CKWA 4P7EA 3UO4A 4C4FA 4CTCA 3LE6A 3RGFA 5HD7A 4F65A 5J95A 4R6VA 3NAXA 3UPXA 3IW5A 4NJ3A 3O8PA 3FQHA 2QO2A 4FSZA 1Y91A 5ACBC 2QOQA 4C4HA 3ORXA 4DG0E 4QYHA 3PRFA 5JK3A 3GGFA 5F94A 4J7BA 2XK8A 5G6VA 4U80A 3N4UA 3BV3A 2HAKA 3D5XA 1Y6BA 4PL3A 4UMQA 4FT7A 2GNJA 4F70A 4A9UA 2CSNA 4FT9A 2WD1A 1PYXA 2RG6A 2WOTA 3GCQA 3R30A 4RX7A 3SDJA 5CEOA 2WTKB 2J50A 5IQEA 3ORPA 4DG2E 3EFJA 4EJNA 2A2AA 1OM1A 3AGLA 4X2GA 4E73A 3VWAA 2WMAA 4GK4A 3IKAA 3UQFA 3TDWA 2R3OA 3HP2A 3NNVA 4ASZA 3DA6A 3OD6X 4Q5EA 1BI7A 2GTMA 4H3QA 1Q24A 5EYKA 2G2FA 4NIFB 4A9YA 5L2IA 2WTJA 1PKDA 3NIEA 4ID7A 1H1PA 5EK7A 3H4JA 4BDCA 5FUTA 2BIKB 4HYHA 5HTIA 2VTIA 5AV4A 2BFXA 5GIOE 4X3FB 1Y57A 4RVKA 3SQQA 3WI6A 4ZLZA 5KX8A 3R8PA 2YCRA 4IHPA 3P79A 3W8LA 3GENA 3CD3A 2XNOA 3NYVA 1W84A 2XNMA 3AC4A 2ZDTA 4XOYA 3MGYA 4GFOA 5CU6A 2XK7A 4GU9A 5BMMA 3PIYA 3C4XA 3DQXA 3ORNA 5JEBA 3A62A 3ERKA 1P14A 2IZUA 5LJJA 4JIAA 4FV5A 5CAPA 4FG9A 3RJCA 3NVKI 2VWYA 4L44A 3HAMA 3F3WA 1XHAA 4N4SA 3M2WA 4Y73A 4TYGA 4O7YA 4AZSA 4BIBA 3DLZA 1OI9A 5CVGA 2VWZA 4M13A 3I7BA 4EH6A 4L8MA 4P2KA 4TWOA 3PPZA 4QMYA 3UO6A 5J9ZA 4O22A 4O7VA 4RBLA 2JKKA 4CLIA 4NM3A 4R3RA 5M07A 3E93A 4I0RA 2B53A 1ZYJA 2UZTA 4CZUA 4YR8A 4DINA 1H24A 5GIPE 1OB3A 4C4IA 2UW9A 2QKWB 3R9NA 3E8DA 5K0XA 5J87A 1FMOE 2Y4PA 3ATSA 3LIJA 2C47A 2XCKA 3A7FA 4W8DA 3RAKA 4AW5A 4C2VA 2R3PA 4KNBA 4OTQA 4JX7A 4RWIA 3ULZA 3VRYA 5IDPA 3W32A 3OVVA 1BYGA 4F4PA 2ZV7A 5I9WA 5M4FA 3MSSA 2O5KA 4D58A 1OGUA 2B9IA 4E93A 5HG5A 1SMHA 1JBPE 5FM2A 4FV7A 3CQEA 1ZYLA 4DFXE 2HELA 3ZSHA 2WMRA 2W9FB 2C3IB 2XNPA 1KOBA 5C4KA 3ZZEA 4N6YA 3ATTA 5FDXA 1Q99A 3QCQA 3HUBA 3Q9YA 4CMOA 3COKA 4EK5A 4I0TA 4IANA 4YLJA 4L01A 5AV3A 3I60A 1VZOA 4I4FA 4QYFA 2FVDA 4BHNA 3PLAE 5CVFA 4U42A 4V05A 4DFNA 2XK6A 3D14A 4RC2A 3T3UA 4BKYA 2WTIA 4E26A 4HW7A 3EN4A 3TNQB 4CV8A 2GQRA 4HOKA 3FC2A 3Q9XA 3H10A 2E9UA 5BVFA 3QCXA 3COIA 3NMUF 4TZRA 3V8SA 2VWUA 2RL5A 1P2AA 1A9UA 4M7IA 3QRUA 4QMOA 3UC3A 3ZMMA 4WHZA 5CEPA 2RFNA 2NO3A 5HO7A 4F9WA 4AW1A 3EWHA 2C5YA 4O6LA 3GU4A 5IUHA 4DFYA 1OL1A 3ZSIA 1WZYA 3E63A 2RIOA 4AA0A 4ALVA 4E6DA 5IISA 3D7ZA 5JGBA 4EOIA 4YSMA 5JT2A 4ANQA 1TQIA 4HYUA 3R9HA 4DBXA 4MXOA 3R8VA 5CU2A 3KC3A 4XNEA 3MYGA 2WMSA 4FTTA 4NU1A 1JKLA 1Q4LA 3Q4UA 4FIJA 3R7UA 2BDFA 3BLRA 4J95A 4APCA 3Q2MA 4OAVB 3MVMA 4QTAA 3FMEA 4ZSGA 3HUCA 5KE0A 3VS2A 4AWIA 2VNWA 4W4VA 1Q8ZA 2XK9A 2AUHA 4OTRA 3BYOA 4JI9A 4ZLYA 2J0MB 2QCSA 5JSMA 5AWMA 3MFRA 4QTDA 3W18A 3PP0A 1M2PA 4BTKA 1P4FA 2CLQA 2OIQA 2PTKA 3E8EA 3PXFA 4IVAA 4MBIA 4PX6A 1X8BA 3GFWA 2IW8A 3UP2A 3CS9A 4Q5HA 1QPEA 3Q96A 5DRDA 2F7EE 2HW6A 4I41A 2HOGA 2I0VA 2XIRA 3PY0A 4GT4A 3F66A 1MRUA 4G9CA 5CF5A 5BUEA 3RM7A 5C8NA 5LQFA 4GYGA 5AUTA 2OH0E 3F2NA 5B0XA 4CKIA 2YJRA 5A4EA 1OKYA 3VUIA 4O7WA 4PPAA 4AOTA 3F7ZA 3GB2A 1KV1A 4X2FA 4EOSA 2C5VA 3CGFA 2JBOA 3LJ2A 3EQFA 2R4BA 4JLCA 3HV3A 2H9VA 3Q4CA 3R9OA 4DEIA 4CFVA 1URCA 4FV6A 5AP6A 5IG1A 2IW6A 2J0LA 3BGPA 3LCSA 2OI4X 4V04A 1VYWA 3LZBA 3DTCA 3ETAA 3TJCA 4BDIA 3C5UA 1XH7A 2B9FA 4P4CA 5AV0A 4A07A 3BGQA 5JGAA 3EH9A 4CZYB 2GCDA 4EBVA 2JDVA 1A48A 5C8MA 4WNMA 2XJ1A 3KXNA 3TUCA 4Z55A 2C6EA 4HVSA 3VAPA 3FYKX 3ZH8A 4RGJA 3KL8A 5C8KA 3O7LD 3QX2A 3Q04A 3SG9A 3HV7A 4FIHA 3ULIA 4RC4A 5IA0A 1ZMVA 2VWVA 3ZLSA 5IQIA 4QRCA 4DTBA 3WARA 2ETRA 2UZUE 4J8MA 4FV0A 5J8IA 5ACKA 3RTPA 1LEWA 5HNBA 2P33A 4IE9A 5HCZA 4MD7E 4UALA 5D7VA 4AE6A 3NEWA 4OTPA 4WNKA 4ZIMA 4IQ6A 2B4SB 5L8LA 1ZMWA 3V01A 5M06A 3NUPA 4UWCA 4FTQA 3TI1A 5HICA 5CASA 2PZYA 4IZYA 5LCKA 4DLJA 4RJ5A 3UOKA 3V5PA 3LXLA 2X8DA 2YAKA 3EQCA 4H1JA 5IZFA 1KE6A 3BRBA 4ZSJA 5KMJA 4D2VA 3OHTA 4FSRA 4WG4A 4KIKA 3VQHA 4F64A 1YHWA 1Q3DA 4GH2A 3VUDA 4FE2A 4NW5A 4PMMA 3R7GA 5ETIA 3S4QA 3E7VA 3QZFA 4B6LA 4O83A 4AG8A 4W4YA 1Q97A 3R01A 3QUEA 4FIFA 3LQ5A 4KKEA 4FTIA 1H08A 2WMTA 1XH5A 3CTJA 1PW2A 1YOJA 3C5IA 3NPCA 3OOMA 3GQIA 1OL7A 1SYKA 3SOAA 3BYUA 5CT7A 2C6LA 3VS0A 4DYMA 5CWZA 1WVXA 4ZJJA 3T9TA 3WE8A 2CCHA 5GZAA 1H0VA 3BE2A 2EWAA 5CLPA 3D9VA 3VHKA 4A9SA 4ACGA 3TKIA 3LJ1A 5EM6A 5EQYA 3R7YA 3GQLA 4BC6A 3FLWA 3F82A 3EQPA 4U0IA 3BHHA 4RLLA 4UEUA 2WU7A 3A7GA 5EM7A 2OZOA 2VWBA 3LOKA 3NSZA 3VBVA 4UXLA 3VBTA 3WYXA 1NW1A 3MPAA 3QQUA 2QOFA 4H39A 5HQ0A 2E9OA 5J79A 3DY7A 5D7AA 5DR6A 3E8CA 3W2OA 4MKCA 4MNFA 3ZRLA 2HYYA 3NX8A 1JAMA 4HYIA 3O8TA 2JGZA 2YEXA 3A7IA 3KXMA 5F1ZA 3U54A 5LVLA 4QQCA 4F7LA 4O2PA 1KE5A 3M11A 4XBUA 2X8IA 4OTGA 5FRIA 4R7IA 3CCNA 1WVWA 4FKJA 4OBQA 5ICPA 2B52A 2XIKA 4IAKA 4FV3A 2GDOA 4AF3A 3THBA 3TNHA 2NRYA 1A06A 4GU6A 5IQGA 1Q3WA 4FK3A 3G15A 3HA6A 4QMWA 4EC9A 3Q4ZA 4TL0A 3ZS5A 3SA0A 4RFZA 4YU2A 1FQ1B 2CDZA 4Z3VA 5AR4A 3MESA 2C5XA 2IVSA 3EL7A 2OFVA 3PWYA 1F0QA 4YP8A 4E1ZA 5IEYA 2W1EA 1WFCA 4A4OA 5FTGA 2IN6A 3LXPA 2ITZA 4IX3A 4KD1A 3A99A 5AP1A 4CFWA 4BDAA 3HMNA 3P4KA 2EVAA 4IVDA 5CI6A 4BTMA 3E8NA 5AUUA 3BIZA 2UW5A 5CQWA 4AW2A 1SVHA 2G9XA 1H26A 2SRCA 4YZDA 5M57A 2UVZA 4BCKA 4UZHA 4X0MA 1S9JA 2GSFA 2UZDA 3AT3A 4JQ7A 2GFSA 5HEZA 1PXPA 3OROA 3G6HA 4RIYA 2PMLX 2X6EA 5FEQA 4BCOA 4DBNA 2IZTA 2EXEA 4DGLC 2OJJA 2XUUA 1HOWA 1QMZA 2OFUA 3IS5A 3UE4A 1I09A 1YXTA 2ZMDA 3ZDIA 2YIQA 3UMXA 4QQ5A 3LCTA 3F3TA 2P2IA 3W2CA 2XKFA 3NCZA 4D2TA 3FPQA 4R5SA 1GIJA 2WQEA 3JVSA 4IB5A 4YNEA 2VTJA 5KMLA 3Q3BA 3PUPA 4EH8A 3ORLA 2R3RA 3R02A 5CS6A 3NDMA 2IVUA 2XH5A 5LVMA 3DBFA 3UZTA 3OW3A 5CQUA 2BAKA 5E7RA 3FHRA 3G90X 3FLZA 1K3AA 4C2WA 2EXCX 3H9OA 4RIXB 5LVNA 4EQMA 2X6DA 1YDSE 2PVLA 4ZTRA 5LXMA 2AYPA 2ACXA 3RZFA 4IAZA 3H0ZA 2Z7SA 2YCFA 5HBEA 5CT0A 2W1IA 2ONLA 4F7JA 1R1WA 3RAIA 4FEVA 4AOIA 3RWQA 2GQGA 3II5A 3KCFA 3LW0A 4I0SA 4FKQA 4IX4A 4EQUA 4EYJA 3MH3A 4TY1A 3VNTA 3QALE 5IH6A 5LWMA 3WZJA 4OR5A 4FYOA 3FLNC 3DK6A 4U9AA 2BZKB 5JKGA 4J52A 4BF2A 3PYYA 3R28A 1UNHA 5ANOA 4EOMA 1CTPE 3NRMA 5DMZA 1MRYA 3RNIA 3ZO3A 5HE2A 2XP2A 3LFBA 2XIXA 4NZWB 3V5JA 3KXGA 4AA4A 4I6HA 2Z7QA 4FEXA 2I1MA 4CYIA 4FKVA 2WQMA 4BL1A 5KZ0A 3KRRA 2JITA 2WMWA 5EKNA 4O1PA 2JKQA 4HJOA 3DT1A 3D15A 2O63A 2C4GA 1OKWA 5ANKA 4FZAB 4FEWA 3TNPC 1FPUA 3KA0A 3OG7A 4FT5A 2YLFA 3ZO4A 5B7VA 3FZPA 2BKZA 3QAME 4FV1A 1YQJA 4IWQA 4KIPA 4NFMA 1H1RA 5E1SA 5EKOA 4A4XA 4AGUA 4EOOA 1Z5MA 3OWLA 4TW9A 4BZOA 4O84A 5B2LA 3SRVA 3AQVA 1PXLA 1LPUA 4CCBA 5I9ZA 3BU5A 4H58A 4O0RA 1FGIA 1V0BA 3P9JA 5B2KA 5DBXA 3KMUA 4F9BA 1O6KA 2W1FA 1M17A 3R9RA 4FKWA 2QHNA 5EHOA 1W8CA 3EN9A 5AR3A 5I3OA 2W1HA 2Y9QA 4FIEA 5CAOA 3WOWA 5EDPA 1CDKA 1M2QA 1WBTA 1QPCA 5A6NA 4ZMEA 5M44A 5BVWA 2PY3A 4IDTA 4C59A 3B2WA 4EJ7A 4FV8A 2QVSE 3MY5A 4M15A 3HP5A 2GFCA 5EDQA 5F9EA 4IFGA 3PLSA 3GCVA 5HI2A 3SW7A 4HVGA 5HVKA 3K5UA 4QOXA 3KN5A 5AADA 2WB8A 4AE9A 3F6XA 4D2RA 2ITUA 3OWKA 2PVYA 3I6WA 4IAYA 3ROCA 2QHMA 3A4PA 3DK3A 3QTIA 4Z9LA 5ANIA 4YURA 3UOJA 3HRBA 4DFUA 4IIRA 3S95A 3F61A 5KHXA 3TN8A 3ZLXA 2W1DA 2P0CA 3RWPA 1WBPA 3F2RA 3H30A 3PXQA 5JRSA 3ALNA 3HEGA 2R3FA 2WTVA 3AOXA 3AD6A 3IGOA 2J9MA 4TT7A 3E88A 4YO4A 2X39A 3ODYX 3WF7A 4Z16A 4O7SA 4QMNA 2W99B 5CU4A 4BI1A 4I93A 2OXDA 4FG8A 4CXAA 5LARA 2R3QA 3BCEA 3CTHA 3QZHA 4HZRA 5AP3A 2B9HA 3VVHA 4J98A 3ZONA 2X9FA 4D0WA 5CF8A 5HU3A 3B8QA 4O7LA 4IM0A 3FZTA 2J90A 2UW8A 3I81A 3NW6A 5E90A 4E4NA 3VO3A 3FC1X 4J53A 2HWOA 2YWVA 4TWPA 3MH1A 3QA8A 4BZNA 4EUUA 3RK9A 2UW7A 4Z7HA 3BX5A 2P2HA 2VAGA 4CFMA 3CY3A 5EYCA 4ZOGA 3MWUA 4QP6A 3FXXA 4ACHA 4EKLA 4EHEA 1AD5A 2GS2A 3CD8A 2ZB1A 3FJQE 4L45A 2OZAB 4FTNA 1CSNA 4MH7A 2DWBA 2YM3A 2QONA 4K9YA 5CU3A 5FXQA 3Q9ZA 4AOJA 3V5LA 2XK3A 3Q53A 3CSVA 4QMTA 3HYHA 5KMMA 2XCHA 4FUYA 2UZNA 4QO9A 3POZA 5IH4A 3OS3A 5AM6A 4BGQA 3DBDA 2XKEA 3EYGA 5HG9A 3SXSA 4YJQA 2VO0A 5EH0A 2V7AA 2Y6OA 5CF4A 4QQTA 3IDCA 4QPSA 3TJDA 2QOIA 5FG8A 4BHZA 4CFNA 3OMVA 3NYNA 4I6QA 4MX9A 2JFMA 3CQUA 5HO6A 1YXUA 3I1AA 4O0WA 3GOKA 5H2UA 3Q52A 3BPRA 4FNZA 3JY9A 4M69A 5M55A 1XH4A 3VBWA 5DYJA 3OCBA 4JS8A 3O96A 3KMWA 5CYIA 4TWCA 2G2IA 2PUPA 3PA3A 2A4LA 4MAOA 5H8BA 2VU3A 3GC8A 1YRPA 4XCUA 3RI1A 2WPAA 3HKOA 4C3RA 3G51A 4FTJA 4PP7A 3DAEA 1OIYA 3IOKA 4BCPA 4BIDA 3EQRA 5HNIX 4I5PA 4BZDA 4G2FA 5DI1A 4U81A 5DN3A 4DGGA 2C6TA 2WELA 3F5XA 3G33A 3PXRA 3LFDA 4F99A 2BALA 3TZ9A 3W2SA 1YXXA 2XJ0A 4BDJA 3D2IA 3LJ0A 4G3FA 4O0YA 3CY2A 2HY81 4XUFA 3RKBA 4Y5HA 5IQHA 5CALA 3LMHA 3Q2JA 4MD8E 3R0TA 4O86A 3E62A 5BVKA 2F2CB 2XA4A 3U6JA 1J7UA 1TQMA 4O0UA 1APME 2XKDA 4X2KA 1B39A 5KNJA 1L8TA 2UZWE 2CJMA 3TACA 2VGPA 5F95A 3SV0A 2UVXA 2VWWA 3L8VA 3GXLA 4JL9A 4RC3A 5JFSA 3FI3A 3BE9A 2PMOX 3NNXA 4C8BA 2YM6A 5AV2A 2DUVA 3EFLA 1OL2A 3P1AA 4F9YA 2Y8OA 3DJ6A 2LGCA 3LFSA 5TOZA 4A06A 2F57A 2FGIA 2ITXA 4ARKA 5IMXA 2CCIA 1REJA 1RJBA 3UODA 3VW6A 3C7QA 3V3VA 3NUNA 4FV4A 5AFVA 3SG8A 4EONA 4CCUA 2JDRA 4AT3A 4IACA 4EOLA 3K3IA 2W5BA 2GMXA 2W17A 4F08A 4PTCA 3I4BA 2OW3A 4RIWB 2WXVA 4DTAA 1Y8YA 4OTDA 3MJ1A 3KREA 1KWPA 4F0FA 3OUNB 4KIOA 4ACDA 3EN6A 2LAVA 5M09A 3HDNA 2XNNA 1PY5A 3QTSA 3ZLWA 2C69A 3EL8A 3PA5A 4LMNA 2KULA 3UOLA 1U59A 3PP1A 3QHRA 4BDFA 3G0FA 4V0GA 4KBAA 4EYMA 3HRFA 3DCVA 2PHKA 4D28A 1YHVA 3KULA 4LUEA 3G0EA 5IQAA 2ETMA 4K8AA 4RVTA 4XG4A 3NUUA 1ZY5A 4KRDA 4ASDA 4NFNA 3LMIA 4LI5A 3C4CA 3CR0A 4JR7A 3TG1A 4AZWA 4DEDA 5IMEA 3SGCA 4A9TA 4ONAA 2QI8A 4PMTA 2PVKA 1XBCA 4L00A 2Z7LA 3QTZA 4K0YA 2OJFE 4PF4A 5DT3A 3RPRA 4EQCA 4I24A 1Y6AA 4J8NA 1UU9A 3QUDA 1PXMA 3C13A 5FLFA 4N57A 2RFDA 4HGTA 1ZYCA 3W8QA 3IW4A 2BTSA 2GHLA 3KMMA 4L6QA 1XR1A 3BZ3A 5HHWA 3NWWA 5T6KA 4DA5A 4O6EA 5KHWA 1OUYA 1T46A 1V1KA 2BCJA 2HY0A 3ZUVA 4YMJA 1H1QA 1UA2A 3AGMA 4AN9A 1L3RE 5AAEA 5LWNA 3QRIA 4BDDA 3HMOA 4YTFA 3BELA 2PE0A 2HZ0A 1W7HA 2XJ2A 4I92A 2RFEA 2CKPA 3QYWA 4GG5A 2GQSA 4FKGA 4FZDB 2G1TA 2QU5A 5TR6A 3V51A 3BQRA 3BV2A 3D4QA 4HPUE 2YHVA 3R22A 4BI2A 1J1BA 3ALOA 2ITVA 3ZCLA 3ZFYA 3PXZA 4WUAA 3FDNA 5HVYA 1IA9A 5HX6A 3L9PA 5IDNA 4JBQA 1XO2B 1FINA 3D5VA 3PJCA 4MXXA 2A27A 4UMPA 2UV2A
chains in the Genus database with same CATH superfamily
1Z57A 4C3PA 5A54A 3I0QA 4TN6A 4WG3A 5IPJA 3C0IA 3L1SA 2F49A 4WA9A 5E8UA 1TKIA 3KGAA 3WBLA 3IECA 3PZHA 5FEEA 3GCUA 5BYLA 1OBDA 2REIA 2W4JA 2CNUA 1BLXA 5J1VA 2NRUA 1GZOA 3DB8A 4MF0A 2WTCA 4BIEA 3CTQA 4EH7A 3EQIA 2AC5A 4R3PA 2XYNA 3KRJA 4IAIA 5DT0A 3LFCA 4YPDA 2QURA 5ANJA 2WMBA 2R64A 3TTJA 2VO6A 1G5SA 2W96B 3KEXA 4JAIA 3UNKA 3FMNA 3GU8A 3R00A 4IFCA 2PPQA 5FTQA 5AAGA 3JVRA 3S1HA 1SZMA 4RJ7A 3UG2A 5DGZA 1XH9A 2V0DA 5EI6A 2V55A 2CNVA 2C3KA 3QUPA 4UYAA 2G01A 5AR7A 4PMSA 5HU9A 4I5HA 4EWHA 4DG3E 5LOHA 4C02A 5IQBA 3GCPA 4GJ2A 4U5JA 4AS0A 2YM5A 3OOGA 2GPHA 1Z9XA 2XYUA 3QRJA 2OJ9A 3MA6A 3IDBA 3FY0A 2ERZE 2QLUA 2IG7A 3BYMA 4O21A 3OTVA 1QL6A 1Q5KA 2YM7A 4IB3A 4YO6A 5I4NA 1Q8YA 2IW9A 4AZFA 3EOCA 4EK4A 1XH6A 4QP9A 2GNLA 3JYAA 5HVJA 3IK3A 3CQWA 4J71A 4H05A 4GFMA 2R2PA 3D5WA 3DKGA 3MBLA 2BRHA 4RJ4A 4IJ9A 3ITZA 2AC3A 3BYVA 5AEPA 3IONA 3F69A 5D12A 5HIDA 4ITHA 2CHLA 4QQJA 1R0PA 3V5QA 4RA4A 3DAJA 3UPZA 4OTFA 4R5YA 4DHIB 4RMZA 3LFAA 5E8XA 1PXJA 2RF9A 4FL3A 4MWHA 3D7TB 5AUYA 5JFXA 3OCGA 4AXEA 1NVSA 2WIHA 4NTTA 2O2UA 4QP4A 4XV9A 2CKEA 2VRXA 4FSNA 4U79A 3WZEA 4ZS4A 3C4EA 3U55A 1CKIA 4BCGA 5FBOA 4CG8A 3NAYA 4O4BB 4JDJA 3LFEA 2I7QA 4BDEA 2QR8A 2HZ4A 2VNYA 3BL9A 3UC4A 3QXPA 4QNYA 1KE7A 4TYEA 3LLAA 4FKIA 3KK8A 2BKKA 4AGDA 1O9UA 3Q9WA 3OBJA 3AMYA 4JG8A 4MD9E 5TT7A 4AZVA 3IW6A 4PDYA 1CKJA 3FKNA 3NR9A 5DRBA 3UVPA 5C01A 4WIHA 3BKBA 4I6FA 2UVYA 3G5DA 2EUFB 2WMQA 1H1WA 2JKMA 3HRCA 5EM8A 3RK7A 4F63A 4DCAA 4FKPA 3RCDA 2A19B 4CKRA 4BCHA 4S32A 2JKOA 4G6LA 4YLKA 4AQCA 3P7CA 4L7SA 5AA9A 4UMUA 2YM4A 4QP2A 4YJRA 3VN9A 3CJGA 3D83A 1M14A 3OCTA 2FH9A 4EORA 3ZBFA 3UG1A 3FZRA 4M8TA 5KZIA 4FIIA 5AAFA 2CGVA 3PE1A 2BDWA 4X2JA 4GUBA 2PVHA 3R8ZA 3VF8A 3AD4A 3O7LB 4NM7A 4RWKA 2XNGA 3MW1A 3SHEA 3U4WA 3WZUA 5HLWA 5JGDA 1NY3A 4CRSA 4LM5A 2XNBA 3PTGA 3EQBA 4FF8A 3QXOA 3TUBA 4CMUA 1H28A 3FXWA 4I5MA 5EYMA 5GINE 1H4LA 4BCIA 5EQPA 4FL2A 2XNEA 3T9IA 3ORTA 3UIBA 3UVQA 3EFKA 3R6XA 3NYOA 4LL0A 2UUEA 2CLXA 4FTKA 2BFYA 2XVDA 2OJIA 2QU6A 3FQEA 1G8SA 3SLSA 5LMKA 3ZC5A 5FD2A 4AXAA 4Q9SA 4C62A 1G3NA 4EC8A 3WZDA 2VWIA 2J0IA 3FZ1A 3MH2A 4IZAA 3AG9A 4ZZOA 4ENXA 3LCDA 2W5HA 3DFAA 3PJ8A 3OUKA 4GKIA 2W05A 2WKMA 3OEZA 4WO5A 4O38A 3P78A 3SVVA 4LFIA 2YFXA 3VUKA 3LLTA 4MVFA 3KXZA 2C6MA 2PUIA 4XRLA 3NUAA 3ELJA 2UW6A 4IM3A 4E6CA 5L8JA 4QMVA 2PZRA 4G5PA 3OP5A 3Q60A 4F7NA 2FSOX 2XRWA 3A61A 2J4ZA 2JDOA 5M4IA 5BUIA 2VWXA 2Z02A 4M66A 4UXQA 4IM2A 3ROYA 3MY1A 5L4QA 4CMTA 4ITJA 3LQ8A 4FEQA 5LCJA 2QG7A 4FV2A 5FM3A 1REKA 2BZJA 2CGXA 2ITOA 2WEVA 3CIKA 3REPA 3NW5A 1XJDA 2RGPA 2BVAA 2IJMA 3PJ2A 3TTIA 1TZDA 3DDQA 3KXHA 4QMXA 3RAHA 4ZEGA 2O8YA 3ENMA 3HDMA 5CXZA 3R1QA 4L43A 1O6LA 4G34A 4MNEA 1R78A 4AGCA 1UKHA 4ASEA 2JIVA 1KOAA 4ZZNA 1FVVA 5E8YA 2OGVA 5ETFA 3NGAA 3KRLA 4G3DA 3BHYA 3EZRA 3ZC6A 4S30A 2JDTA 2BPMA 2VX1A 1NVQA 2QOBA 3TT0A 1V0OA 4WG5A 4BICA 4AFJA 4PNIA 3RBWA 4QTCA 5E9EA 2B54A 2ZB0A 1DAWA 2OF4A 2ITPA 3VULA 4BY9E 5JMSA 4EKKA 4OLIA 1ZYSA 2O64A 2GS6A 4CKJA 3ORIA 4O0VA 5CAUA 3QC9A 3DK7A 4JJRA 3V8TA 4O4CA 2BRBA 1ZY4A 4GIHA 3MY0A 5CEIA 5KMIA 3KXXA 3JR1A 3W0SA 2WTKC 4BI0A 5HLNA 1Q62A 3L9NA 4KSQA 4WD5A 3PRIA 4DE4A 1E9HA 1ND4A 3EJ1A 4HPTE 5L6WL 3ZXZA 2EU9A 2ETKA 2R3LA 3C51A 3MJ2A 4Y83A 4YLLA 4GL9A 1JNKA 4L3PA 4Q2AA 2YWPA 4YTIA 5IU2A 2ZV9A 3BU6A 3FBVA 1WVYA 3GC9A 2A0CX 4J97A 4KWPA 4RZWA 4C58A 4EI4A 1U54B 1YOMA 5HE0A 3OXZA 3QHWA 2ZM4A 4M97A 5E8WA 4Y8DA 4LUDA 3RPSA 4JRNA 4AP7A 3E87A 4CFXA 4DGMA 3K3JA 4X3FC 3QU0A 4EOPA 3VHEA 3WF6A 4BGHA 3TMOA 1ZOGA 2VTOA 3MB6A 3NUYA 2IZSA 1HCKA 3V8WA 3KRWA 2VTRA 3EHAA 4G3EA 4CFUA 5BVOA 1SNUA 3QCSA 5AR2A 3SW4A 4O0SA 4EL9A 3I79A 4GJ3A 4B8LA 3VUTA 3COHA 3QTQA 2JFLA 3H0YA 3QQHA 3R1NA 5CY3A 4DTKA 5KKRB 4MXZA 3TXOA 3LM5A 2HW7A 4YHJA 4NIFA 3Q6WA 4N6ZA 4R8QA 1K2PA 1NA7A 2E9PA 3DGKA 4KRCA 4GW8A 4AN3A 3GCSA 4LGGA 5BVNA 3NFGB 2IO6A 3CE3A 3JY0A 2B55A 2WOUA 3CLYA 4FNXA 4NUSA 4X3FA 5LMBA 5HZNA 3D0EA 5KCVA 4RA5A 5F4NA 4AT5A 2BHHA 1W82A 5HNGA 3BBTB 3P7AA 3UJGA 5KMKA 4CTBA 3JXWA 4ORKA 3S0OA 3QGWA 5IA4A 5AP7A 1T45A 4HVHA 4XBRA 4MWIA 3VUGA 5C26A 4I21A 2J0JA 4FZFB 4DGNA 2YABA 3DQWA 2VO3A 2R3NA 3EQHA 5EG3A 4FGRA 1B38A 2P3GX 4V01A 5H9BA 1K9AA 4FRFA 4AFEA 4EH2A 2WAJA 3O23A 3MIAA 4PUZA 4C7TA 3ET7A 2I0YA 5M4UA 1U46A 2JIIA 1WMKA 4ZTSA 4O27B 5IA5A 2VTHA 4J99A 2GU8A 3RINA 4AT4A 3PUFC 1JSVA 4AXFA 4YZBA 4U40A 3FYJX 4XG8A 5CENA 2PK9A 2ONLC 1MUOA 2R3GA 2EB3A 1ZZLA 4AW0A 1PJKA 3FI8A 3D5UA 2XBJA 4FKOA 1WBOA 5AUZA 2Z60A 4QMUA 3FEGA 5C27A 4EOQA 3FL4A 2W9ZB 4FUXA 4GRBA 5AIKA 5DPVA 1JKTA 3RPVA 3UDBA 4R1VA 4DFLA 3LVPA 2X1NA 3E64A 4G6OA 3PPKA 4S33A 3I6UA 4OUCA 3R9DA 4D1SA 3L9LA 4FK6A 2YZAA 4G9RA 1KSWA 2C6OA 1IR3A 2YITA 5HESA 4ZY6A 1Q8UA 2YACA 3F9NA 1UU3A 3MV5A 2B0QA 3GVUA 3CJFA 1VR2A 5M51A 3ZRMA 3HGKA 4JIKA 3DBEA 1PYEA 3AT4A 4AGWA 5A9UA 5I3RA 3DB6A 4L53A 4FV9A 3DXPA 4KIQA 3M42A 3EKKA 3OWPA 3F2AA 4O81A 2YCQA 2Y0AA 4XP0A 5DR2A 2C68A 2WIPA 4QDVA 3QX4A 1XH8A 3OEFX 4ANSA 4GKHA 1B6CB 1AQ1A 3CPCA 1GZ8A 4UBAA 5IEVA 2JAMA 5JZJA 4FEUA 2ZM3A 1H27A 1ZLTA 4I3ZA 4BCJA 3OT8A 4BN1A 2X0GA 2X8EA 1J91A 2PZIA 2V5QA 3V6SA 5K5NA 5HKMA 3ORKA 1GIHA 4EK3A 4L46A 3KVWA 4YC6A 4IX5A 4D4VA 4FTRA 3SKCA 1S9IA 3ZOSA 1NXKA 4FODA 3K54A 2J51A 2QO7A 4K33A 3DKCA 4QEBA 4TYIA 5T3QA 2Y6MA 3MVLA 2WTDA 5B2MA 2VZ6A 3MPTA 3ZM9A 2GNHA 5HBJA 3BEAA 1OBGA 4TYHB 4TPTA 5EDRA 3G6GA 2W06A 1BMKA 4JR3A 4QYEA 4BDBA 5GHVA 3JPVA 4GT3A 4LRMA 4ALUA 3BEGA 5TE0A 3FZSA 4UWYA 1SVGA 3VS6A 3WYYA 2J2IB 3AC8A 3P23A 1ZRZA 3WE4A 3QKMA 3QD3A 1UNLA 4XS2A 4LDTA 2JEDA 3MFUA 1LP4A 5FBNC 2CKQA 4Y5QA 1JOWB 5J1WA 2VTPA 2Z2WA 2C6DA 4IWPA 3TM0A 1OPJA 2RKUA 4DT9A 1OUKA 5DE2A 5AR5A 3ZSGA 2OIDA 2R9SA 3QKLA 3FKLA 5KBQA 3VC4A 4XG3A 4MBJA 4M67A 5BPYA 4FL1A 2F7XE 5H8GA 4G31A 4D2WA 5A4QA 2Y7JA 5HIBA 3ZYAA 1HCLA 5CTPA 2R3HA 4AACA 4EHGA 3QF9A 1PXOA 4DEAA 4U7ZA 2CGUA 3FMJA 4CYJA 3KFAA 3A4OX 4OTHA 3AMAA 3M1SA 4XV3A 5CSHA 4QPMA 2XBAA 4CGAA 2XIZA 4K6ZA 4KBCA 4BBFA 3CEKA 2X81A 3UNZA 4TXCA 4C61A 1KUTA 5DOSA 3TV4A 4B7TA 1I44A 4YZMA 2YIXA 3AC3A 3SX9A 1ZWSA 2YISA 3ANQA 3PA4A 4QD6A 2X4ZA 3FXZA 3R73A 3R7EA 4B9DA 4ZTLA 3ZTXA 5DFPA 2YJSA 4MHAA 1YWVA 2Q0BA 4FX3A 1JVPP 4R3CA 3PFYA 4U45A 3BGZA 5IH5A 3VUHA 5JFWA 3FSFA 3U9CA 4OTIA 1Q61A 4LOPA 4K77A 4O2ZA 4XLVA 5HTBA 4JAJA 4JQ8A 4GMYA 1ZYDA 2OJGA 4KB8A 3OBGA 5C03A 3R7VA 4LV5A 3ZO2A 4D0XA 5BVEA 4HZSA 3QYZA 2GHGA 5L3AA 2ZAZA 1JWHA 4L52A 4FICA 2B7AA 4D5HA 3TNIA 4UMTA 3ZM4A 3ORMA 4EBWA 2BILB 3UMWA 4BDHA 1M7NA 2ITNA 4FG7A 4GV1A 4NKSA 4KKGA 3TV6A 2B9JA 2WHBA 2ZOQA 4BGGA 3U6IA 1GAGA 5CSWA 4E7WA 3GU6A 4O4FA 3V04A 4NM0A 3DLSA 1JPAA 3QWJA 2UW3A 1CM8A 4H3BA 4MYGA 4E6QA 4P5QA 4DLIA 5E91A 5M53A 4LOQA 1PMEA 3EZVA 3PVUA 4RJ6A 3A7HA 4RLKA 3VIDA 3TEIA 4XG6A 2HXQA 1W0XC 1KV2A 4A7CA 3FUPA 4RWLA 2VTQA 4MK0A 3UYTA 3PG1A 5IA1A 3IQ7A 4BWKA 4USFA 5ITAA 5DLSA 4ASXA 4BKZA 4YHFA 3QQKA 2BIYA 1XBAA 1UNGA 4JDKA 4YPSA 2CPKE 2UZOA 1OITA 3C0GA 5ETCA 4UWBA 4X21A 4WKQA 4ALWA 2C1BA 4D4SA 2QG5A 3PSDA 3O8UA 3QTUA 4DAWA 4IADA 3FMMA 5G1XA 4Y46A 2O3PA 2HCKA 3DJ5A 1CKPA 2WU6A 4ZTNA 4O96A 3U51A 4OAUC 2OSCA 3R1YA 4EK8A 3FI4A 4ZSAA 4S2ZA 3FMDA 4GVAA 4O7TA 4WBOA 4DITA 3C4FA 5I9UA 1ATPE 3CXWA 4ZS0A 2WQOA 4JT3A 2FSMX 2WNTA 4GSBA 4RX8A 4WRSA 4QMPA 2QLQA 2R3KA 2FSLX 4NTSA 2Z8CA 2QQ7A 3G9LX 5EYDA 4C57A 3ENHA 4E5BA 3BYSA 3RHXA 5IA3A 3T3VA 4W9WA 4BCNA 2I40A 1ZOHA 2YERA 4AAAA 3EYHA 4APPA 3OT3A 5EHYA 4D4YA 2QODA 3O0GA 3TDVA 4M14A 3MA3A 3DOGA 3F7WA 4QMQA 2W4OA 4G5JA 4TRLA 3TKHA 3LQ3A 3E7OA 1F3MC 4YJTA 4A9RA 4F0GA 1PMUA 4XV1A 5KMNA 2VX3A 4HNIA 2X0QA 4W4XA 5AIRA 4XP3A 4O7ZA 3UIXA 3MPMA 4IAAA 3QCYA 5DWRA 5CZHA 5I9VA 3R2BA 3AD5A 4EK6A 3PJ3A 5KMOA 5C1QB 3RPOA 4BVUA 3COMA 3MVJA 4I20A 1OVEA 5D11A 4ZAUA 2OU7A 1W98A 3QTXA 5JZNA 1IAHA 1YOLA 2ZMCA 4CD0A 3GBZA 2BRGA 1E1VA 4L67A 4E4XA 4EZ3A 5BQ0A 4ZJIA 2OIBA 4IMYA 1PMNA 4BWPA 4M12A 4XRJA 4C34A 5HCYA 3LFQA 2WFYA 2Y4IC 3E3BX 3RAWA 3V5TA 2E2BA 5KUPA 3N4TA 3F88A 2ESMA 2R0UA 5FP6A 2KTYA 3EN5A 3LCOA 3QA0A 4ZSEA 4BCQA 3CGOA 2Z7RA 3POOA 5AM7A 4ZLOA 5A4CA 5AP5A 3RALA 2G2HA 1R3CA 3GFEA 4RJ3A 2NP8A 3EB0A 3D94A 3R71A 4GK2A 4LG4A 4RVLA 3SD0A 5HORA 3ZO1A 4ANMA 2X2LA 4KIKB 4U43A 2OLCA 3OXTA 3VUMA 1TQPA 5FXRA 3FZOA 2BUJA 1KE8A 2PMNX 2XM8A 3KF4A 1GNGA 4C0TA 5L2TA 4LRJA 4O4EA 2WZJA 2JLDA 4YJPA 4ZP5A 3TWJA 2J5EA 4OBOA 4QP1A 3DXQA 4EZ7A 1OL6A 2YIWA 2X7GA 4NWMA 5A3XA 1NT2A 3HX4A 2C30A 4EH5A 4HVDA 3BLHA 4DH5A 1URWA 4YZNA 3HMIA 4DH3A 4BBMA 4CT1A 4EWQA 5H3QA 3GC7A 4BYIA 1OIUA 3K5VA 3DZQA 3QD0A 2PVNA 4N0SA 2VV9A 4Y95A 4EH4A 3KRXA 4XOZA 3FV8A 3IW8A 3IG7A 3PIZA 4IB1A 3OY3A 4R7HA 3JUHA 2HIWA 3GNIB 3R2YA 4LGDA 4M84A 4NSTA 4QP3A 4QNAA 4RPVA 3U4UA 3W2RA 5E8SA 4N70A 1WAKA 2BAJA 2UZVA 4W9XA 4WRGA 2R0IA 3BL7A 5M56A 2UW4A 1IG1A 3KN6A 3MVHA 4XG2A 4JX3A 3R1SA 5K0KA 4CG9A 4DC2A 4UMRA 1JSTA 3S3IA 3DV3A 3JS2A 4USEA 4RFMA 4D9TA 2W0JA 1FVRA 1DAYA 3BWJA 1H00A 1GOLA 3NNUA 4LMUA 3LXKA 4RIXA 2CGWA 2OWBA 3OF0A 5L6PA 4FMQA 5HTCA 4FSTA 4I1ZA 3DJ7A 2I0EA 2VTSA 3LFFA 1V0PA 2OICA 2CN8A 2C5NA 2GHMA 3HV5A 4FC0A 3EIDA 3UP7A 1OKVA 4ERWA 4OT5A 4OW8A 4S31A 3UQCA 3R7IA 4MXCA 4O7RA 5A6OA 4ZK5A 5JRQA 4KINA 4W4WA 4H3PA 3TIZA 1QPDA 4DCEA 4JBPA 3IOPA 3NW7A 2XEZA 2E9VA 1BX6A 3MS9A 4LYNA 3RMFA 3FL5A 4XYFA 4TTHB 3EQGA 4M0YA 3RNYA 4D2SA 4KUJA 4FI1A 4XP2A 4YC8A 2BTRA 4IEBA 1OGYA 3W1FA 3KCKA 4AZTA 2I0HA 3N51A 5AMNA 4K11A 4XG7A 4YJUA 3PE2A 4CQEA 5IUGA 5CEQA 4FYNA 3TL8A 3BI6A 3VJOA 4CFFA 4FTLA 3NIZA 1SM2A 3MDYA 4Z7GA 2C3JA 4ZTHA 5GZ9A 2RFSA 3MIYA 4C35A 2GNGA 2O0UA 3A8WA 4FSUA 4CZTA 4NM5A 3MN3A 2P55A 4TYHA 1WBWA 3GT8A 4WUNA 4GIIA 4ZMFA 4AN2A 1CMKE 4JVGA 5TO8A 4MXAA 1ZZ2A 5CX9A 4O1OA 2OKRA 3QRTA 2GNFA 3ACJA 4RIYB 3WILA 4LL5A 4UX9A 2X2KA 3ACKA 2IWIA 4BRXA 3BLQA 4ZXTA 1M52A 4GT5A 5CI7A 2BROA 4ENYA 4LRKA 4AX8A 2QR7A 4JG6A 2JD5A 3WF8A 5L6OA 1H25A 3Q5ZA 3NYXA 2W4KA 1WCCA 4O82A 2X7FA 2FA2A 3W55A 3R8LA 2BRMA 3F3UA 4FSMA 2GS7A 1Q8TA 3PWDA 1JSUA 3UIUA 3DBQA 4UYNA 5ETAA 1DS5A 3KU2A 4GCJA 5BMSA 3G2FA 2VUWA 4XG9A 3AKJA 2VTTA 2GTNA 3VS7A 5D10A 2E9NA 4FVPA 5DIAA 5L8KA 4KS7A 5K4IA 2A98A 4IC7A 3FMHA 4FOBA 3UZPA 5EI8A 4ZTMA 2XB7A 5HX8A 3U9NA 4YTCA 3MI9A 4AA5A 4WOVA 5AUWA 5AP0A 5DVRA 2ZJWA 3FE3A 5IKWA 5AP2A 4KAOA 3BHTA 3R8UA 4Q9ZA 2W7XA 2XARA 1Q8WA 5IUIA 1H1SA 1UWHA 3T8OA 1YXSA 4X2NA 2HK5A 3OFMA 2I6LA 3P0MA 3DBCA 3IW7A 5HG7A 4KS8A 4C33A 3BU3A 3HMPA 2PMIA 3I5ZA 3OC1A 3IGGA 3F3ZA 2WQNA 4BJJA 5CNNA 2PUUA 4HGEA 5CF6A 4UZDA 4O7NA 4X7QA 4KBKA 1W2CA 2V62A 2YAAA 1FOTA 3A60A 2QOHA 3P08A 4JDIA 3RCJA 1OPKA 3PZEA 4DT8A 4CV9A 4IJPA 3WF5A 4JBOA 2BZIB 5EOBA 3NVMB 3QZIA 1ERKA 5KBRA 1YI6A 1YXVA 3F5PA 3W2PA 5E1EA 3QLFA 4FT3A 4BKJA 2IVVA 4IB0A 5CNOA 3N4VA 4HNFA 1MQ4A 5IQCA 5TKDA 2XIYA 4G16A 3L9MA 3NNWA 4G1WA 2QOLA 5TF9A 4C38A 2XK4A 5GJGA 5AUXA 3NZ0A 3QQJA 4YSJA 5IQDA 4RVMA 4E5AX 1YI3A 3C9WA 1U5QA 3OW4A 2YM8A 4F09A 1PXKA 5EW3A 3PIXA 3R63A 4HGLA 4P90A 2C1AA 4D1XA 4NJDA 4QP8A 4BYJA 4ZJVA 3UTOA 2OZAA 4ZY4A 3D2KA 3FI2A 2XMYA 4IDVA 4USDA 4B4LA 3H9FA 2DS1A 4MQ1A 4AZEA 5J7BA 5LMKC 5HLPA 1RE8A 3KK9A 3LFNA 4YZ9A 2ITYA 1IEPA 3TIYA 2FSTX 1YWNA 5T68A 2CNQA 5FEDA 3LHJA 2UZBA 2BRNA 4L3JA 3VBYA 5IA2A 4YGAA 1UU8A 4TWNA 5K9IA 2WQBA 4ACMA 4GK3A 3RVGA 4RWJA 3SRVB 3O50A 3ORZA 4NT4A 5HO8A 5BYZA 3PVWA 4CNHA 3DAKA 4EHVA 3SC1A 4FGBA 2FYSA 3QQGA 5BNJA 4U3YA 4CT2A 2PVMA 4XV2A 3UVRA 2OXXA 3UDSA 4F1MA 1UV5A 3MB7A 4ERKA 5BVDA 1J7LA 4BWXA 3FKOA 4IWDA 1Y8GA 1BKXA 5K4JA 2F7ZE 3W0OA 3N9XA 3KVXA 4IAFA 3ZXTA 2R7IA 5HE1A 5LVOA 1NVRA 4GYIA 2VTNA 2OXYA 4DH8A 3KB7A 4GEOA 3LM0A 4GS6A 1ZXEA 5EW8A 4F9AA 4D4RA 3SXRA 3O5AA 1PRYA 1KE9A 4M3QA 4MCVA 3KQ7A 5E8VA 4DH1A 2HWPA 3OXIA 5BYYA 2PE1A 3DTWA 4X6QC 5CSXA 4FT0A 5E92A 3VBQA 4A4LA 5K5XA 3CKXA 4IBMA 1YDTE 3QQLA 3O2MA 3P5KA 2X4FA 2PU8A 2FB8A 3FPMA 3GC0A 3V5WA 4NL0A 4R7BA 2PL0A 3F3VA 4IZ5A 2YA9A 4CVAA 3HVCA 5L2WA 3HNGA 4EZ5A 4KA3A 4FKLA 4WNPA 3RM6A 3HECA 3KY2A 3IO7A 4JQEA 2R3JA 5CEKA 3L8SA 3G9NA 5I0BA 4K18A 4XX9A 2X2MA 4L7FA 5CSVA 4PMPA 3Q32A 2PZPA 4TNDA 4PV0A 2YIYA 3UOHA 3V6RA 1E1XA 3E5AA 3F5UA 3W16A 4E20A 2Q83A 3TCPA 4ANNA 4E4LA 4NYEA 2BMCA 2XEYA 3UGCA 4DF3A 4LGHA 4EHZA 4ITIA 4CEGA 5EI2A 3ZBXA 5J9YA 5IQFA 2QD9A 4L3LA 3GOPA 2F4JA 4R78A 5HBHA 4QMZA 5J7HA 3MFTA 4D9UA 2QOKA 1BL6A 3L8XA 4IZ7A 1YKRA 4RQKA 4QTBA 4RIWA 2R3MA 3RZBA 2C5OA 4IVBA 5EM5A 3HMMA 5DHJA 3TZMA 2UW0A 4PNKA 4NCTC 1OPLA 4PDSA 3UYSA 4NW6A 5JFVA 2QKRA 1VYZA 2OF2A 1H07A 2CKOA 1IRKA 4F1OA 3AT2A 2PVRA 1DI8A 3E3PA 4M69B 5EOLA 4RX5A 1LEZA 5D1JA 3VJNA 1O6YA 2QOOA 5C9CA 2DQ7X 1FGKA 4MBLA 3S2PA 1JKSA 2XKCA 4L42A 2BDJA 4F1TA 2WO6A 4MQ2A 5FP5A 2QOCA 4FIGA 4C37A 1VJYA 1OIQA 1WBSA 3PPJA 2ERKA 3PFQA 5AV1A 3LKMA 5CSPA 2YZLA 3EFWA 4RG0A 1M7QA 3C0HA 3AC2A 3Q6UA 5DR9A 4NCTA 4PTEA 3RK5A 4FVRA 1RDQE 4BDKA 3A8XA 3FLSA 5I5ZA 2VX0A 3GU7A 4UB7A 2IPXA 4F6WA 4H36A 1Q41A 4KSPA 4XEYA 2RSVA 3ANRA 3ZFXA 3NUXA 4RQVA 4RT7A 5CANA 2CN5A 4XHKB 1ZOEA 3MH0A 5CVHA 1PHKA 3UBDA 4D2PA 4GFGA 3HA8A 4DEEA 1JLUE 2C6KA 3MTLA 3O71A 4BCFA 3VW8A 4Y85A 3EKNA 4TKSA 4YJVA 3NCGA 4D5KA 1U5RA 4B99A 5CU0A 4BR3A 2WEIA 2WTWA 5I9XA 3ZUUA 1GY3A 4E3CA 1R39A 2G15A 4W8EA 3VS1A 3FMLA 3TZ7A 2PZ5A 1OIRA 4E6AA 4ANOA 4E8AA 4F7SA 4E5WA 2PVFA 3MTFA 2VO7A 1MQBA 3DDPA 4LQMA 3PY1A 4K2RA 3DPKA 3ZEWA 2W1ZA 5I9YA 3NS9A 4UY9A 1YDRE 2ZM1A 2ZV2A 1YWRA 4I6BA 3HAVA 2P4IA 3WIGA 4QT1A 2UZEA 5EFQA 2OBJA 3IPHA 1J1CA 3DNDA 2A1AB 1FVTA 5L2QA 3KKVA 1W2FA 5IEXA 2YDIA 4QTEA 2VD5A 3BHUA 4GG7A 4MF1A 2F9GA 3UIMA 3ZEPA 4HGSA 4XH6A 4MUQA 5F20A 3BWFA 4I22A 2VTLA 4MTAA 4IWOA 5CEMA 4PPBA 2V7OA 3GUBA 4U41A 2J7TA 4J1RA 3ZU7A 4F6UA 4KABA 1H01A 2XM9A 3QQFA 4FVQA 3E92A 3L8PA 4V0GB 3R7OA 4B8MA 1PXNA 1IA8A 2PWLA 3KULB 2JC6A 3NLBA 4FKRA 4HCVA 4BTJA 1STCE 1UVRA 3UNJA 2Y4IB 3PSCA 3PJ1A 4G3GA 4G3CA 1ZMUA 4JNWA 5JN2A 3R8MA 5FGKA 3QRKA 4I23A 3CP9A 2PSQA 1TVOA 3GEQA 3UQGA 3LMGA 5HE3A 3C50A 2PVJA 5J5SA 5M08A 1AGWA 4QPAA 4U8ZA 3KF7A 4L9IA 5GNKA