1XH8A

Crystal structures of protein kinase b selective inhibitors in complex with protein kinase a and mutants
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
339
structure length
337
Chain Sequence
b'QESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Design and crystal structures of protein kinase B-selective inhibitors in complex with protein kinase A and mutants
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 112
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xh8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xh8A02
2B54A 2JKKA 1Q41A 3QFVA 3MFRA 3MTLA 2W1ZA 2E9UA 1PXKA 3TUDA 3NYXA 3KXZA 2ETKA 1WAKA 4TNBA 2O65A 1P5EA 3F2AA 3RBWA 5L2QA 3TXOA 4JAIA 1JOWB 1UU3A 2YM3A 3PG3A 1UNLA 3QCXA 2FYSA 4O0SA 4TXCA 2IW8A 2BDWA 4L01A 3TDVA 4CMUA 4F7JA 3ZDUA 1R78A 3ORZA 5EDRA 4BYIA 2ITYA 5T6KA 3D5UA 5D12A 4FTUA 4F4PA 5HCZA 4IXPA 4LV8A 5AP3A 3B2TA 2GTNA 4JDKA 3NNWA 4X2GA 2GSFA 3M2WA 4FIHA 4RJ7A 4U80A 3HAMA 2BKKA 4L7FA 3UOHA 2R3OA 3MPMA 5IQBA 3WI6A 4QRCA 3WE8A 3ZUVA 4F6SA 3O0GA 5D10A 2J5EA 3RTPA 2QONA 4D4VA 2Y8OA 3QWJA 4OTIA 4E4XA 3ORMA 4ZJVA 4ZLYA 4K77A 2QG7A 1HOWA 3DLZA 4JAJA 5HG7A 1R0EA 2VWZA 4HGLA 3UZPA 5T3QA 2YLFA 2CGWA 4U7ZA 4BBEA 3Q4TA 4CV8A 4Y5QA 2WTKB 3R9OA 4QYHA 3L8VA 4O7VA 2XS0A 5LJJA 3BCEA 3FKLA 2RSVA 2BIYA 5FXQA 3BIZA 4CFUA 4JQEA 5CVHA 4ZEGA 3GCPA 5T68A 1KSWA 3WF9A 3MV5A 5EG3A 4AZTA 3LLAA 2C6TA 5F1ZA 1UA2A 5C8NA 3MN3A 1I09A 5TO8A 2W1HA 2V7AA 4FKIA 4ZZMA 4QYGA 2UW8A 3W2RA 2CKOA 3PIZA 3A4OX 2PWLA 4EJNA 3IDPA 3SKCA 2CJMA 3ZOSA 4WRGA 5HVKA 2JDSA 2Y9QA 5C9CA 5IEXA 2YFXA 3EQPA 3LXKA 4IM0A 3I60A 5F4NA 2OF2A 4I24A 2I7QA 4X2NA 2JKQA 4EQCA 5IKWA 4GU9A 4FKQA 3NIEA 4YR8A 4J7BA 1SMHA 2WMQA 2X81A 2HW6A 4BCFA 1H4LA 3PJCA 4QNYA 4AGDA 4BCJA 4BDDA 3C0HA 3TL8A 3DKOA 4TWOA 3W16A 3AD5A 3DZQA 4FEWA 4AUAA 5B0XA 5ACBC 5I3RA 5LXMA 3AGLA 3RPRA 2C5YA 3QTZA 2JGZA 4WBOA 4NFMA 5ETIA 3TKHA 2BZIB 3VRZA 4IW0A 3S00A 3BYVA 1VJYA 4M7IA 4R7IA 3VBQA 3LZBA 4ZTNA 3FLZA 1DAWA 2X7FA 3NVKI 2C47A 3GT8A 3GCSA 4HJOA 2PU8A 2C3KA 5DN3A 2EU9A 1IEPA 4LMNA 5H8EA 4S2ZA 4BDFA 1WBOA 4YJNA 4FV8A 2PMNX 1KE7A 2FO0A 4CLIA 3F5PA 4O84A 4L44A 1UWHA 4FVRA 4S34A 1CSNA 4FZ6A 3KXHA 4MD9E 1NA7A 4YLKA 2ZM4A 4E93A 5C4KA 3ZYAA 2J90A 4R7HA 3PXKA 2JDVA 1KOBA 4AGWA 4DEHA 1Q24A 2Z7SA 2BFYA 3ZBXA 5L6PA 4GJ2A 3V5PA 5A54A 4JBOA 3ZDIA 4IAIA 4LRMA 1G8AA 1ZLTA 4KKEA 2V22A 4I6FA 4TZRA 3OCGA 5AP4A 2OH4A 4O91A 4PDYA 3QQLA 1QPEA 5GZ9A 3DZOA 4KRDA 3CSVA 3RPYA 4D2WA 1OI9A 5KMOA 4DITA 2YIQA 4W4YA 4K1BA 3NVMB 4H05A 4EYJA 4ZIMA 4Z16A 2CCHA 2I40A 4GYGA 4N57A 1KUTA 5ANJA 5DWRA 3VWAA 3GOKA 3DS6A 3OXTA 4HVIA 1O9UA 3QC4A 5JFSA 1OKWA 3G6GA 5IQHA 4UMUA 2R0UA 5E8TA 1IAHA 3ORXA 4BI0A 4ZLZA 3PZEA 3N9XA 3E7OA 2GHMA 5EH0A 3NAXA 4CQEA 3TJCA 3D5VA 4I4EA 4FKPA 3VS7A 3UQCA 3G15A 2PPQA 1RJBA 2CMWA 3RPOA 2HY0A 2XKCA 5CSVA 3TIYA 4MTAA 3G0EA 5A3XA 4ACGA 3WARA 2PZPA 4V0GB 3R7IA 4QTBA 4NT4A 4U45A 2P4IA 3TZ8A 3I4BA 4FTTA 3QHRA 1H24A 3RAIA 2WMBA 5AP7A 4WG4A 4BDHA 3KXGA 4I0TA 4ZY5A 5CQUA 4K6ZA 3V5WA 2RG5A 4GKIA 3O8TA 3O51A 1WZYA 4FT5A 3ZLWA 2WEIA 3FHRA 4P5QA 4RWJA 2XK3A 4EUTA 4GYIA 5HX8A 2OFVA 4NM3A 4E6QA 2UZTA 3OCTA 3DXNA 4A4LA 4KIOA 4M69B 4DEGA 4IC7A 3GC9A 2ITUA 4YZCA 5BVDA 5CSXA 4RIXA 3COHA 3P7AA 3NPCA 3HYHA 4XNEA 4FZDB 1PMUA 4AXAA 3ZM9A 5CVFA 3R2BA 3N4TA 2X4ZA 3NNXA 2PZYA 3RI1A 2LAVA 2R7BA 5HHWA 4JRVA 2C6DA 1MRYA 4FV5A 5L2TA 4AN2A 1PXIA 2BRBA 4BY9E 1OBDA 3BYSA 4LUDA 2X9EA 3ANQA 3QL8A 1SNXA 4K2RA 4L67A 4XYFA 3ATSA 5EKOA 2NP8A 1H0WA 1Y91A 2I0YA 1YWRA 1AGWA 4FNYA 1WBNA 3GXLA 4IAAA 4JDIA 4O7ZA 4O7YA 2YIRA 5I9WA 1DM2A 4DG3E 1TVOA 4HCVA 3IG7A 3LQ8A 5B7VA 4NYEA 2IW9A 4L6QA 4FKTA 3BHUA 3FLYA 4FIGA 3EQDA 5HD4A 4AW1A 3NNUA 4RVMA 3OW4A 2VU3A 4BTKA 4ZMFA 4KRCA 3U87A 4O2PA 4RZVA 2VZ6A 5DYJA 1XH7A 2VWVA 3EWHA 1J3HA 3VHKA 4NWMA 1CKJA 3EQIA 2ZB0A 4EEVA 1IA9A 3EMGA 3MFUA 1W98A 2WTVA 3TT0A 4AA4A 1WVWA 3VS1A 3T3VA 1ZMVA 2BROA 4OGRA 4EOMA 5BYLA 5HGIA 4EK3A 1WBTA 2WQNA 4JQ8A 3DXQA 1OECA 1FVVA 3QD3A 4CG8A 5HBEA 5ANOA 2PE1A 2QO2A 3KRXA 1O6LA 2C0OA 2VTLA 3TNPC 3KB7A 2R4BA 3PWYA 3QC9A 2ZV2A 3SRVA 2C4GA 5JFXA 5CY3A 2PUPA 4R77A 3V5LA 2CLXA 5E90A 3GEQA 2XF0A 4XEYA 4IM2A 4F70A 3COMA 3CP9A 2XH5A 3PXYA 4FKUA 1MP8A 3MYGA 3F3WA 3OEZA 2XNPA 1LP4A 4QT1A 4BCMA 2WTWA 5HIEA 4XV2A 4E6CA 4BGQA 3DLSA 1OVEA 3ZCLA 2CKEA 3KXXA 3S1HA 2F2UA 2Q0NA 4FEXA 3CTJA 3E5AA 1SYKA 2ERKA 5DA3A 4U9AA 4TPTA 4AW2A 4H3PA 1Q8UA 3HECA 4BR3A 3FI4A 4WT6A 3UDBA 4YZDA 5J95A 3OP5A 3P7CA 4PMMA 3VQHA 3RAWA 4XLVA 3LFAA 3EQRA 3OC1A 3SAYA 3SOAA 4NCTC 3UNJA 3F3UA 3VIDA 3NAYA 3WYYA 3IGGA 4D2VA 3VQUA 2W9ZB 3QTSA 2XKEA 3VUDA 2CSNA 2GNGA 1RW8A 5CNOA 4M12A 5AR7A 2XEYA 3FSFA 3WF8A 5M4IA 4F9CA 5KKRB 5IQIA 3FXWA 3VO3A 4AZFA 3TKIA 2PE0A 3HRCA 4EK6A 4NTTA 1ZYCA 3WZDA 3PXFA 5FLFA 3UO6A 1V0BA 2E9VA 3C4WA 4ALVA 4M67A 4FV0A 5HTIA 3KCKA 2RF9A 2E9OA 4PNKA 2Y6OA 2HZIA 4OTPA 4YTFA 5BPYA 2W1GA 2PUUA 3QGWA 4HZRA 4E20A 2ZDUA 4G6NA 4U5JA 4AZWA 3JUHA 4Z55A 2Y4PA 3P9JA 4F65A 1UNHA 4ARKA 4D2TA 3BKBA 5JKGA 2PVHA 4FUYA 4D2RA 4FT3A 2XBJA 4HVSA 1WVYA 4QP8A 3LPBA 2CNQA 4FVQA 4HGSA 4BCKA 3UYSA 3A8WA 3R2YA 3LCTA 2XEZA 2XKFA 1FMOE 2F9GA 2QOLA 3MH1A 5HE2A 1OIYA 2PZIA 3CLYA 1E1VA 3ORTA 4FYOA 3D15A 2H34A 4JG7A 4PX6A 5EYMA 4O6LA 5AUZA 4XH6A 4RX5A 4MCVA 5AP5A 4NH1A 3QXOA 4XJ0A 2PVMA 4IEBA 3NZ0A 4N4SA 3AT4A 3NW5A 2QOCA 4CFXA 1Z5MA 5LVMA 4YBKA 4O1PA 2WTDA 2F49A 4PWNA 2BILB 4U8ZA 4DH5A 2R3LA 4FK6A 5CAPA 1J7LA 2J0MB 5EHOA 1J7IA 4D58A 5FM2A 4JQ7A 4DH1A 2UZNA 3GU4A 3TTJA 4UX9A 4LGHA 1FBNA 3G9NA 4EK8A 4E3CA 3WZJA 2XYNA 4H3QA 4FEVA 2WMVA 4JOAA 3CE3A 5I0BA 4AU8A 3BWJA 1YVJA 3PZHA 3PA3A 2B4SB 5K4IA 4CSVA 3RVGA 3CJGA 2R3JA 2OZOA 4F9WA 4WA9A 1X8BA 3KVWA 2UZLA 3R1YA 4KKHA 3DV3A 5AM7A 4OBQA 2PVYA 3H3CA 4LGGA 3FC2A 4QPMA 3KN5A 1Q5KA 4G31A 4R6VA 4UZHA 4CTCA 3HZTA 4BC6A 2QG5A 3F61A 2PZ5A 3VBYA 4FSRA 1XWSA 4YNOA 2QHMA 2WD1A 4O0XA 4PPAA 4WG3A 4F1OA 2JAMA 3HRFA 2YWVA 1YOMA 2GTMA 3P7BA 1SNUA 5ANIA 2BUJA 4JDJA 4WNOA 4BCHA 3A60A 2VTOA 1G3NA 3DB8A 3QWKA 5H8GA 2C1BA 4I5HA 3HMIA 4FOCA 2RFSA 4IDVA 1FOTA 4AACA 4C62A 3OWKA 3PVBA 2VTSA 4A9RA 3O7LB 4O81A 5HG5A 3QKLA 3THBA 1H01A 3PE2A 3L9MA 3MPTA 3ETAA 4J95A 5EQYA 5DGZA 2WOTA 4GVAA 4APPA 4AFJA 5CALA 3LFSA 4OUCA 3VNTA 5EDPA 4W4XA 4BZDA 1TKIA 1FVRA 1OPKA 2CGUA 4FSUA 2XUUA 3ZRMA 2XB7A 4A9SA 3ZTXA 4LV5A 4EH2A 2HELA 2WNTA 1U59A 3BHTA 3QTIA 4H36A 4J98A 4HYIA 3FHIA 4QQJA 4MBJA 2HOGA 2A1AB 3FUPA 2X8IA 4MXZA 3ZC6A 3DBCA 1YW2A 3QXPA 4P4CA 2WQOA 5LOHA 3PXZA 5J9ZA 4XG7A 1K2PA 2R5TA 4I6BA 3R1QA 4F63A 2Z2WA 3E8EA 3TNWA 4JVGA 3LM5A 4L43A 3H0ZA 3ROYA 5B2MA 3U8WA 3R83A 2GNIA 4LUEA 5TR6A 3ZEWA 4CEGA 5EYCA 4N6YA 3UQFA 4RBLA 3KGAA 4EHGA 4BDEA 4CKRA 4WHZA 4I0SA 5CU2A 1YXTA 3NYNA 1IG1A 4OW8A 2GFCA 2W4OA 2V55A 1W82A 4GKHA 3DK7A 2WEVA 4D28A 5IQEA 1JAMA 4FTRA 4V01A 1Y6AA 2C6KA 2IVTA 5FD2A 2PVLA 4IX5A 2QOOA 3DT1A 4WSYA 4AOJA 1CTPE 4FIJA 4HYSA 3E63A 3K5VA 4XUFA 3IDBA 5KBRA 4OBOA 1R0PA 3WF5A 3ODYX 5M53A 4FV1A 4ERWA 4I22A 4O86A 4FICA 2VAGA 2CNVA 3DGKA 3DKGA 1GY3A 4IWPA 3K2LA 4FIEA 4WUNA 5BVKA 3SXRA 4FGRA 3RK5A 4GEOA 4ID7A 3UIBA 2VTAA 3LCOA 3UMWA 4DN5A 4QP7A 4PTEA 3D2KA 4UY9A 3B8RA 5D9HA 4I0RA 4RSSA 4E73A 3ZZEA 4FKGA 1JKLA 4RLLA 4WIHA 3RM7A 1ZY5A 4RWKA 4PUZA 3WE4A 4BVUA 3BV3A 4NU1A 5K9IA 5AR5A 4KWPA 2C6MA 2RG6A 3BHHA 4H1MA 4ZXTA 3VW6A 1UWJA 3R71A 1V1KA 3O17A 2BALA 3UG2A 4E7WA 5I5ZA 3CIKA 1K3AA 4P90A 4B8LA 3NDMA 3FE3A 3SC1A 3C7QA 4IZ5A 4EWHA 2WFYA 2CKPA 4EH9A 4O6EA 4A06A 4NW6A 2OXDA 3S4QA 4NUSA 3OF0A 2R3PA 3M11A 3VUTA 4G5JA 4HVDA 3QRUA 2GNFA 3A8XA 4IE9A 1CMKE 3D2IA 4C34A 1RE8A 4UXQA 4FKVA 4G9CA 2VTHA 4MNEA 1KV1A 2EXMA 2QOHA 2XIYA 5HLPA 2VWUA 3VF8A 3CKXA 4G2FA 4B6LA 4EHVA 5CU0A 5JMSA 4BB4A 2W5BA 5BVEA 4FVPA 5EM5A 3F3VA 3JVSA 1PY5A 3VHEA 1Q8TA 2OJGA 3E64A 4S33A 3ZRKA 4BGHA 4QMNA 4OBPA 4FC0A 5M4UA 4FKJA 2XIKA 2B9IA 3I0QA 3KXNA 2QKRA 4RQKA 2JFMA 3OD6X 3OWPA 4FNZA 4Y85A 5DVRA 4D2SA 4DHFA 2XNMA 1H00A 3IW5A 4CYIA 2C30A 3O96A 5GIPE 1OGUA 2OJ9A 1NVSA 5D7AA 4EZ7A 1Q99A 4BWPA 5HU9A 4Z3VA 4MXXA 3V6SA 4DE4A 3EOCA 4FMQA 3Q9WA 4L68A 4DF3A 5ACKA 4FL1A 4YC6A 3LFDA 4BDBA 3QHWA 2WMAA 1IA8A 4FSWA 4JX3A 1L8TA 3PY1A 4IAFA 2OICA 2YABA 4RZWA 5A4QA 3N4UA 3FC1X 4J8MA 3C4FA 5HKMA 2ITVA 3KL8A 4KAOA 5CSHA 4QPAA 2BTRA 1S9JA 2CGVA 5M09A 5K5XA 5AR8A 4F7LA 2C6LA 2JLDA 4FYNA 2HYYA 3FDNA 5EW9A 3F5UA 5CU4A 4HCTA 2G1TA 3AT3A 4GT5A 3KRRA 4V04A 2ITQA 5CENA 2CKQA 3OBGA 4RMZA 1XH6A 3P86A 2VTTA 3TV7A 3WIGA 2XNEA 2JDTA 4OTWA 4CYJA 3NW7A 3PUPA 3PXRA 3ROCA 4GG7A 2ZMCA 3EH9A 2VWYA 3BI6A 3GB2A 5L8JA 5CANA 3KRWA 4EK4A 1JVPP 2ITNA 3Q9XA 1OL6A 5J8IA 4E4MA 3TJDA 3PIXA 4WKQA 4CTBA 3BQCA 4KIQA 5FTQA 3QGYA 5HLWA 2VO7A 5CEKA 2DWBA 2J9MA 1XHAA 2YIXA 4EHEA 3QQUA 4CLJA 1AD5A 3KQ7A 3QUPA 4O0TA 4J8NA 3CQEA 4U44A 5KX8A 4NJ3A 4X7QA 2GFSA 3ZEPA 4L9IA 4CZTA 3CGFA 4PMSA 3CBLA 3MGYA 2R3HA 3NX8A 4D4RA 4CNHA 2XNOA 3PY0A 5ANGA 5E91A 3UNZA 4A9TA 1YHWA 3MSSA 4KSQA 4PL5A 5DBXA 5BUIA 2FUMA 3EHAA 3GCVA 4I3ZA 4E4LA 3FI8A 3QCQA 4FK3A 4QMLA 4M97A 2JIIA 2PVFA 4DLIA 4OTGA 2QR7A 5CEQA 3DTWA 3PJ2A 4GUEA 3KY2A 4GV1A 4DH7A 4PL3A 3EN6A 4V05A 4QP4A 4Y95A 3ORLA 1CKIA 3CEKA 3G2FA 2WXVA 5DHJA 3HVCA 3RNYA 4F9AA 4YO4A 4QP2A 3TI1A 3C0IA 3E93A 3AC3A 4C38A 4F6WA 4IX4A 5E8VA 5A4TA 3OTUA 2G2IA 4D9UA 2Z8CA 3GBZA 1OKZA 1Q97A 2QLQA 4ZSEA 3VUMA 1VYZA 2Z7QA 3Q53A 3SHEA 1B6CB 3WZUA 5CAVA 1ZAOA 2ZJWA 3ZSIA 4UWCA 3WBLA 4ZZOA 2B0QA 4USDA 3AD6A 3VS0A 3PY3A 4JBPA 3R8LA 5JK3A 3DK3A 4EQMA 3NR9A 2X8DA 3UVRA 3P08A 1Y6BA 5EM6A 3SQQA 4FTNA 1SM2A 5E4HA 4FTAA 4X6RA 4NM5A 4QMXA 4CFMA 2VWWA 5IQFA 3AOXA 2WGJA 2C3JA 1H1PA 1WBSA 5HO7A 4QMVA 1RQQA 2WAJA 2WTJA 2P55A 4O0UA 4D1XA 3JR1A 3PIYA 4CQGA 3CQUA 4D0XA 3H9FA 4RJ4A 2ETRA 5HE3A 5L2WA 4C3RA 1WVXA 3O50A 4XG2A 4YHFA 4AGCA 1A48A 3A7GA 3OTVA 2R64A 4I20A 2W5HA 3AG9A 1TQPA 3D7ZA 3FZOA 1PYEA 3PPJA 3T8OA 1YXUA 3V5QA 3JS2A 4DLJA 4YZBA 5KKRC 4OTQA 4RPVA 2W4JA 4XG9A 3SD0A 3BU5A 4GK2A 4G3FA 3POOA 4IC8A 4V0GA 4C59A 3CY2A 1R3CA 3LCSA 4YO6A 5AAFA 1P4OA 3E8CA 3TWJA 3C4EA 4M68A 4QYYA 3MDYA 2J2IB 4J99A 4M84A 2HZ0A 3OFMA 3QTRA 5C8MA 4EOSA 1GIHA 3MPAA 4WSQA 3QRIA 4KS8A 4IVDA 1XJDA 3TG1A 2PSQA 4L3LA 4QP6A 5BUEA 5KMKA 4ANOA 3QZIA 4DTAA 2XJ0A 1P4FA 2FH9A 4EBWA 5AV4A 3U54A 2XJ1A 3P79A 4XV1A 1Q3WA 2XRWA 5EW3A 5A6NA 3QQGA 3PVGA 2ITPA 3GGFA 3MVMA 4G3EA 5EQEA 2XP2A 3VS4A 1ZARA 4QTAA 5ETFA 3FXXA 5IF1A 4CFNA 2YEXA 3MIYA 2UZDA 2XNGA 4JIKA 3VC4A 4Z7GA 2OJIA 1OIQA 2G9XA 4FV3A 2XA4A 2J50A 4BDGA 5FTGA 3UE4A 2IJMA 1U54B 2JKMA 3AGMA 3VULA 4W9WA 4YP8A 5IU2A 3ZSGA 4C61A 3NSZA 1L3RE 3FMDA 5BVFA 4O7NA 1YDRE 4QTEA 5DR2A 3HDMA 4OTHA 2E9PA 4LMUA 4C37A 1UKIA 1FVTA 3R7GA 3RAKA 4MF0A 2EXCX 2HXQA 2IVVA 1RDQE 4GUBA 4IX3A 4O22A 2ZB1A 3PSCA 4O96A 3GFEA 4K9YA 4WNMA 3R1NA 3RCDA 2VD5A 1H28A 3R9HA 3MY5A 5EOBA 1H8FA 5KE0A 4BZOA 4C4JA 5JGAA 3W2OA 2HK5A 2C6OA 3C50A 4J52A 4IADA 4MD7E 4G17A 3HEGA 4GFMA 3PDTA 2JFLA 3IDCA 4R5SA 2YM4A 3Q96A 3W55A 4LL5A 5EYDA 4L7SA 3FY2A 5FEDA 3TV6A 4APCA 4FTIA 3GCQA 3ULIA 4O0WA 5C8KA 2WQEA 3EFWA 1ATPE 2YM5A 4FG7A 4MQ1A 3DXPA 4FTOA 1ZOEA 2QOFA 4BHZA 1V0OA 3CKWA 3FZSA 3ZUTA 4RJ8A 1JSVA 3SG9A 5KHXA 5CAQA 2WMTA 4I21A 2BIKB 4YZMA 3EZRA 3AMYA 4DBXA 1H25A 3ZLSA 5E92A 5CT0A 3RGFA 4YJSA 4F64A 2VO0A 3BYOA 3EYHA 4EI4A 2ZV8A 4IIRA 5H8BA 4DC2A 3I1AA 2HZNA 4XG4A 5DMZA 2JKOA 4RC3A 4J53A 4TN6A 4IANA 4GSBA 4ZSJA 2YDJA 1ZY4A 4IB1A 4X3FC 4JX7A 4X2KA 3TACA 3I6UA 4L42A 4JT3A 4DEEA 3QTXA 1REJA 4MK0A 5LWMA 2HIWA 3FEGA 2VX1A 3PPZA 3ZXTA 3EL7A 2BRNA 5EM7A 4BDIA 4GFGA 3FPQA 4EZ3A 3ORPA 5IUIA 3TKUA 4PDSA 2W99B 1QMZA 3K3JA 1EH4A 3NUXA 4N6ZA 2ONLC 5ANEA 4E5BA 2F7XE 5M51A 2WOUA 4E1ZA 4GL9A 1ZWSA 4AOIA 4ZMEA 3IW8A 4P7EA 4L3JA 3JXWA 4IWQA 2JDRA 4XG3A 2YCFA 5DIAA 1XR1A 4G6OA 3MB7A 2NNWB 3GQLA 4O7SA 3Q52A 4F08A 3FAAA 2GMXA 4EBVA 3DDPA 3PJ8A 3MY1A 4F1MA 1LEWA 5HG8A 3NLBA 5G6VA 2BZJA 1OUKA 4O83A 2ETMA 1VYWA 2AYPA 2E9NA 3FMJA 4F7SA 4FOBA 4WG5A 2VTJA 4MAOA 3SV0A 4DGGA 1LR4A 4IQ6A 5A4CA 5GIOE 2W4KA 3M42A 5GJDA 3UOLA 3FZ1A 3EQCA 3PA5A 1J1BA 3R30A 4U6RA 4YJVA 5FBOA 2XK8A 3W32A 5IQGA 3CJFA 4RFYA 3Q2MA 2WU6A 3MI9A 1M2RA 2F7EE 4R3RA 3MTFA 4U40A 4XRLA 4EOJA 5IZFA 2YZLA 4YLLA 1OIRA 1YWNA 3MS9A 4G3DA 4MXCA 3KK9A 1CM8A 5E8UA 5FP5A 5JZNA 3OG7A 3PRFA 4BWXA 4ZAUA 1DAYA 3DY7A 1ZZ2A 3LXPA 4O1OA 3LXLA 5HO8A 4J97A 1ZXEA 4GT3A 2VO3A 1XBCA 4TYIA 3P0MA 2PVJA 3R6XA 2VTMA 5AWMA 2GPHA 5HCXA 3CCNA 3R8ZA 1KE8A 1UU7A 4RC4A 4AWIA 5J1VA 1OKYA 3TM0A 2H6DA 3UMXA 2XK7A 3DBQA 1PXOA 2ZOQA 3BGQA 4C58A 2C5VA 2V5QA 2X2LA 2YITA 3QZHA 5HE0A 5BYYA 4HZSA 2BZHB 5JQ5A 3RPVA 5L3AA 5KHWA 2YIYA 2JC6A 4JG6A 4R3CA 4RX7A 3HMPA 4QTDA 5HIDA 3U9CA 4ASXA 5JEBA 5AUTA 4FV2A 4R1YA 5FUTA 3TN8A 5DRBA 5J9YA 1IR3A 1ND4A 5GINE 3ENHA 4UWBA 4BDCA 5C4LA 3LFNA 4C36A 4CZUA 3OXIA 3KK8A 1U5QA 4AE6A 4HW7A 4BN1A 4C7TA 4X0MA 4G3CA 4O27B 5HNGA 3I6WA 3LW0A 4JLCA 3TZMA 1LEZA 3QBNA 3CXWA 4EH3A 4LYNA 5CU3A 5AP6A 2IO6A 5J79A 4CKIA 5IA0A 2IVSA 4M0YA 5CEOA 5BX0A 2CGXA 2BHEA 2O0UA 3LJ0A 4HPUE 4O0RA 3AMBA 4PV0A 5AM6A 3L9LA 4CCUA 1JSUA 4NFNA 4FA2A 2EXEA 4U41A 5CI6A 3V5JA 4GIHA 1YQJA 5DT0A 3ATTA 4BHNA 4OTFA 4H3BA 3BGZA 2HCKA 4EC9A 3QKMA 4PTGA 5CF5A 4XLIA 5LARA 2QQ7A 3HV6A 2YISA 4Z7HA 3HUBA 4QD6A 3PTGA 3D7TB 3GFWA 4IB3A 5HCYA 1U5RA 4PRJA 5AV0A 4IZ7A 1OPJA 3VAPA 5M56A 3OROA 3BPRA 4CRSA 2UW5A 2R3RA 3OOGA 4XP0A 5CAUA 5DPVA 2P33A 2BKZA 2VRXA 4K33A 3UGCA 1XBAA 3UOKA 5LMBA 3Q04A 4D9TA 2QODA 2OGVA 5LWNA 3AC4A 4Q5HA 5DT3A 1J1CA 5B2KA 4M14A 4XOZA 3FLWA 2J0KA 2R9SA 1IASA 2ZV7A 4U79A 1NVRA 3U51A 2ZVAA 3IS5A 4FKLA 2V7OA 4ZS4A 4OR5A 3F2RA 2FA2A 2OZAB 4O38A 4YHJA 4I5PA 4DAWA 3RHKA 4F0GA 1ZRZA 4ENYA 3BBTB 2IW6A 2YM6A 4LOQA 4B8MA 3E8NA 4BF2A 2YAAA 2R3KA 3LJ1A 4YZNA 3MH2A 5EM8A 1GZOA 4RIYB 4FSTA 4I6HA 4FZAB 4NIFA 4YTIA 1BI7A 2WMWA 4IJPA 1YI3A 3K5UA 2WIPA 4ZTSA 3PSDA 3TDWA 3SLSA 3VUIA 4DGOA 4P2KA 4DINA 4G3GA 4C8BA 3K3IA 4J71A 5IUGA 3SDJA 3QA0A 3A7FA 2B9JA 4AG8A 2EUFB 3W18A 1ZMUA 3QYZA 3FKNA 4UMPA 3TNIA 4AAAA 2CCIA 3HP2A 2W1CA 4JR7A 3TUCA 3LCDA 4EUUA 3KREA 2XNNA 2UW3A 4JRNA 4OLIA 4Y83A 4CMOA 5BYZA 3CD8A 1OL7A 2HY81 5AV1A 5KZ0A 3EN4A 5LVLA 4C2VA 3PA4A 2ITZA 3VUKA 4YBJA 3OCSA 2VX0A 2XCHA 3E87A 3D83A 3PFQA 4LQMA 3SVVA 3NUSA 3H4JA 4BTFA 3ULZA 1JLUE 3EQBA 3KMMA 1A9UA 5FG8A 5TE0A 5JSMA 2B1PA 2QKWB 2UZOA 4L46A 1YDSE 2HAKA 4TW9A 4TYHA 5HD7A 4FSNA 4TWCA 2J6MA 1K9AA 3I7CA 3BE2A 3OWJA 4GH2A 4KBKA 4BTJA 5HU3A 3S95A 2OFUA 4Q5EA 4FE2A 1JPAA 4GT4A 4TYJA 4BI2A 1Z57A 4D4SA 3NUUA 3CR0A 2PYWA 4ZJJA 3GU6A 1H26A 4BBFA 3DJ6A 5AIRA 2LGCA 2QR8A 2R3NA 4KABA 3EQGA 2X8EA 4XCUA 4K0YA 2GS7A 4FEQA 4KSPA 4AX8A 2W1EA 4IFCA 3UBDA 2W17A 4FTQA 2OU7A 3KVXA 4LL0A 1J91A 4Y73A 4YU2A 2BDJA 4IM3A 4W8DA 3M1SA 4NL0A 5JRQA 1YI6A 3QQFA 2OG8A 4AT5A 1HCLA 2R7IA 2C5XA 4EH8A 4F09A 1FGIA 2C5NA 4FV7A 3F82A 3DQXA 4FF8A 4USFA 5AIKA 4Q9ZA 3E88A 4L3PA 4DFXE 3KULB 1JSTA 1Y8GA 2YJRA 4FODA 4IB0A 3QQKA 3RZFA 2OJFE 2FSMX 4GS6A 4ZY6A 5CEMA 4DFBA 4UB7A 5AR2A 3P5KA 3FYKX 4R5YA 1KE6A 2C68A 4PMPA 3F9NA 3NYOA 3R28A 3RALA 3UP7A 3KRLA 4M3QA 5DI1A 3SXSA 2IZSA 1V0PA 1AQ1A 3I79A 3UO5A 3W8LA 5LMKC 2VTQA 2WQBA 2IWIA 4X2FA 3OUKA 3ZO2A 2A4LA 5E8XA 4C4FA 1WMKA 3HGKA 5L2SA 4FNXA 4BKJA 3Q6UA 1BYGA 2CPKE 1REKA 4X3FB 2C3IB 4EH6A 4ITHA 2OI4X 5HX6A 4DT9A 3UJGA 3Q32A 3I5ZA 1QCFA 4UXLA 4A9UA 5AX3A 4II5A 5CEIA 3SW7A 4FSQA 5EDQA 4QMTA 4I94A 5KMJA 4HNFA 5L6OA 3W2SA 2FSLX 4NCTA 4YTCA 4OT6A 3K54A 4EJ7A 3RHXA 3RPSA 3G6HA 4BGGA 1UKHA 3QLFA 2WMXA 2UZVA 5A6OA 3TEIA 5IA5A 3FYJX 3QCSA 3FY0A 4IH8A 3ZBFA 3PLAE 3ACKA 1NT2A 3QD4A 5E8WA 4OTDA 4RWLA 4DEDA 3R8PA 3MA3A 4RG0A 4TT7A 3ID6C 1SVEA 3FMEA 3QX2A 5L2IA 2HWOA 4C2WA 2UZBA 1Q8ZA 5JRSA 4AQCA 3HP5A 4DG2E 4RA4A 2QOQA 3HAVA 2QNJA 3AC2A 4PL4A 2WMSA 1E9HA 1Y57A 2C0IA 1G5SA 4UMTA 5DEYA 5I9YA 4FTCA 2J4ZA 2P2IA 1W7HA 3FZRA 3GNIB 3HMNA 3KKVA 3R63A 3LXNA 3QZGA 5ANDA 4P5ZA 3BLQA 3VBVA 1VR2A 2XM9A 3Q6WA 3F7WA 4FG9A 2BAQA 3I0OA 2XKDA 4W9XA 3TNQB 2RL5A 3DPKA 3S0OA 2E2BA 3AC5A 3FLQA 3BHVA 4FSZA 4IVAA 4O7WA 4CFWA 4BDKA 2JBOA 4JXFA 4IX6A 2WQMA 4FSMA 5BMMA 4CXAA 4MX9A 2VGPA 5FTOA 5A9UA 3L1SA 3LHJA 3R7YA 4RT7A 4I93A 4KKGA 3IW4A 4DCAA 4ANNA 2ITOA 1G8SA 1PXNA 4WO5A 5JZJA 2WIHA 4R3PA 4YTHA 2YA9A 4FKWA 5LMAA 5IISA 2EWAA 4S31A 5A4LA 4EKKA 3ZMMA 4TWNA 3Q4ZA 4UEUA 5IMXA 4WNPA 5C03A 3VW8A 2QD9A 2IG7A 3LQ3A 4H39A 3SX9A 4YJQA 3PSBA 2F57A 3NS9A 5HIBA 5M55A 3FMMA 2YCRA 4MNFA 3UC3A 3PP0A 2HZ4A 2WHBA 2QC6A 3MIAA 3Q5IA 4E26A 2XCKA 5FEQA 1UV5A 3KU2A 4XV3A 4IBMA 3GUBA 5CX9A 5FXRA 3FI3A 3P4KA 5LCKA 3QZFA 1OUYA 1XH5A 4NM7A 2Y6MA 3BX5A 5CXHA 5A4EA 2GNLA 4XS2A 4KBCA 4S32A 4U0IA 4XG8A 5FP6A 4Y72A 4DT8A 3GENA 3ORKA 4MF1A 3RINA 3KC3A 3ZS5A 4DGLC 2ITXA 1GNGA 5EI2A 5EI8A 4F9YA 3W8QA 4L45A 5KBQA 5HBJA 1GJOA 2VNWA 4QQ5A 4ZTHA 3ZSHA 2ITTA 3F7ZA 3FQSA 2WPAA 4EH4A 4DFNA 3UVPA 4XHKB 3BRBA 5AMNA 2EVAA 3HA6A 1R39A 4C4GA 3A99A 4FKOA 3OZ6A 5AP0A 1SVHA 3ZFXA 2GNJA 2R3FA 3E8DA 5HOAA 4A07A 2ZV9A 4U3ZA 4IVBA 2G2FA 3UPXA 4A4OA 5F20A 2VNYA 2GS2A 2UV2A 3FI2A 3E7VA 4GG5A 4NSTA 1UU9A 2QOBA 1YOLA 4PPCA 3R7OA 3UO4A 3V8SA 4HVGA 5I9VA 4B4LA 1PKDA 5CVGA 2C6IA 3OT8A 5FDXA 3N51A 1MRVA 4M0ZA 2BTSA 2OK1A 4FGBA 5LMKA 1OZ1A 4X3JA 5HG9A 2PTKA 3HUCA 5D7VA 3HDNA 2Q83A 3F69A 4I5CA 3Q4UA 4E4NA 5EK7A 2GS6A 3FMNA 2FGIA 5J1WA 5AA8A 2O8YA 2DQ7X 2XIRA 4AFEA 1LPUA 2ZM3A 4F1TA 1XBBA 3ORNA 4BZNA 4C4HA 5DR9A 3LOKA 2P3GX 4FV9A 2J0IA 4MEDA 4D2PA 4E5WA 4FL3A 3EZVA 3PLSA 5IQCA 3T9IA 4NTSA 5HVYA 1DI9A 5HTCA 3GOPA 5JGDA 3EKKA 3L9NA 4A9YA 4BICA 4D5KA 4F0FA 2QLUA 5LCJA 3G9LX 3H10A 4AZVA 4C57A 3OT3A 1KV2A 2WO6A 2YZAA 3D5WA 2NO3A 4FSYA 4JS8A 4I41A 3A61A 4UN0C 4H1JA 2OXYA 3U4WA 2YLEA 5IA2A 4K11A 2ESMA 4RWIA 4IAKA 1U54A 3RAHA 3WZEA 3DNEA 3QRKA 4CCBA 4BCNA 4KIKB 3DCVA 2BRMA 4BL1A 5A46A 4MXYA 2QU5A 2VTNA 3FL4A 3UZRA 4RVTA 2B9HA 3BZ3A 3FKOA 1VEBA 4YSMA 4LRKA 4RFMA 4FEUA 4YNEA 3BV2A 2GDOA 3I5NA 3LVPA 2R3QA 4FI1A 2JD5A 3KF4A 4ANLA 5IMEA 2WZJA 3C51A 3PYYA 3WZKA 2YJSA 3BGPA 4EC8A 4FTKA 5AP2A 2X6EA 3BYUA 3SG8A 2SRCA 1O6KA 1ZYLA 1R1WA 1DI8A 1Z9XA 1P2AA 3JVRA 1PHKA 4KB8A 4QMQA 3IO7A 1NY3A 4F99A 4AA0A 3L8SA 3VVHA 3EN9A 4DEBA 2KTYA 2O5KA 4HPTE 4EWQA 3U55A 3R7EA 4JR3A 1F3MC 2BZKB 4QYFA 4ACCA 4I6QA 5DNRA 3UC4A 3ODZX 5GJGA 5HLNA 4UWYA 2B53A 4RQVA 2ITWA 4RA5A 3R73A 4XX9A 1STCE 3Q9YA 1BX6A 2G15A 5CZIA 2WELA 1Q4LA 4AT3A 3IW7A 3Q3BA 2JBPA 5CF8A 3R9RA 3NW6A 3TZ9A 4G9RA 5BVNA 2ACXA 2OO8X 4BDAA 2RFEA 5BVOA 4DGMA 4ZSLA 5H3QA 3DK6A 3R7VA 3C0GA 1QPJA 3IW6A 3ZLXA 4DFLA 5JT2A 2GCDA 3ELJA 4QO9A 2UW7A 4QP3A 4YPSA 4DBNA 3AT2A 4JI9A 2W06A 5KO1A 2OXXA 3OHTA 3RK7A 5KMMA 4FT7A 2IZRA 3BQRA 4BIBA 5ITAA 4O21A 2XK4A 3KMWA 2G2HA 5CF4A 3V3VA 1W8CA 2JAVA 4K18A 1JKSA 3CQWA 1T45A 2O2UA 3AMAA 3C4CA 3FBVA 5AEPA 1J7UA 2VX3A 5L8LA 4NK9A 3QRJA 2R2PA 1GOLA 4ONAA 3C5UA 3OY3A 2PMOX 3Q4CA 4QMWA 1FMKA 1JBPE 4FX3A 5C27A 4AN9A 2XBAA 3VS5A 2W05A 4EOQA 3B2WA 2XIZA 3UG1A 4UYNA 5JN2A 2W0JA 3VJOA 4CFFA 2JIUA 3EFLA 3FSKA 5CTPA 4EYMA 5KMIA 2VWBA 4ACHA 2O64A 4FV6A 3WF6A 3GC7A 4I23A 4BIEA 2WMRA 4ASDA 2F2CB 4J1RA 4U43A 3QUEA 4WOVA 3O7LD 4YJPA 4FTJA 4OAVB 5J5SA 3VS2A 1YHVA 5F95A 2IVUA 3PJ1A 1O6YA 2OKRA 4EOKA 3MH0A 4EL9A 3BEAA 3L8XA 3OCBA 5GJFA 3RZBA 4BRXA 1M2PA 3OS3A 3SGCA 4KS7A 4M69A 2BAKA 4L8MA 4RVKA 3FMKA 2PULA 3DBEA 2VTIA 1ZYJA 3QQJA 3CD3A 2VGOA 3E3BX 3E62A 3QF9A 4HYHA 5FM3A 5I3OA 4U3YA 4LOOA 4BFMA 5AA9A 3R01A 4RJ3A 3KN6A 2BMCA 2Z7RA 5L6WL 1ZOHA 3VN9A 1YXXA 3CGOA 3FLSA 1SZMA 1ERKA 3R02A 4IVCA 1GIIA 1YHSA 3NIZA 2XK9A 4ASEA 2I0VA 2CHLA 3KA0A 4J96A 4EKLA 1BLXA 5IG1A 1OPLA 3V5TA 3OWLA 1KE9A 3QCYA 2YWPA 5AAGA 2ZDTA 2W96B 4KA3A 3RK9A 5AV2A 4S30A 5DLSA 4TL0A 5KCVA 4UALA 3CC6A 3V8TA 4YMJA 3IECA 2QOKA 3F3ZA 3FWQA 3DQWA 3EJ1A 4MWHA 5J7BA 3BE9A 3HA8A 4YJTA 4ITJA 4MKCA 4PPBA 3W2QA 3JY9A 2RFDA 3PVWA 2ZMDA 5G1XA 3GU8A 3LIJA 4NKSA 4HCUA 3RKBA 4JIAA 4QYEA 1Q62A 3FZPA 1MUOA 1PXMA 3G51A 3LM0A 4RIOA 3VF9A 1Q61A 5K5NA 4RIWB 4XRJA 5FEEA 2GQGA 3TCPA 2Y7JA 3BEGA 5FQDC 5B2LA 5E8YA 1ZYSA 3OY1A 4I4FA 4E8AA 3ZLYA 2UZEA 4JDHA 1LUFA 4EOPA 5M08A 5JFWA 4K8AA 3ZU7A 1WCCA 1UU8A 3BWFA 4F0IA 3F66A 4C02A 1H1QA 2GHGA 2X7OA 4XP3A 3BYMA 4JG8A 5L8KA 2X39A 4D0WA 4PQNA 4PY1A 5CWZA 1XKKA 4ANSA 3ZFYA 3MJ2A 4BCGA 2QI8A 3DA6A 3EKNA 3MB6A 5AUWA 3V6RA 3VS6A 4AZSA 4EK5A 3T3UA 4QMMA 3DB6A 3R7UA 2XMYA 4FKSA 4W4WA 2HENA 3POZA 3ZONA 4LGDA 1IRKA 4IB5A 4EQUA 4QMPA 2PUNA 2B9FA 3BLHA 3BLRA 3II5A 3LFEA 3UIMA 4NEUA 3RMFA 1GZ8A 4BDJA 5IA3A 3IOKA 3UPZA 2A19B 4KINA 2OH0E 2PY3A 5E1SA 3UYTA 3LE6A 4C3FA 1W83A 4R8QA 4DEAA 1FPUA 5AUYA 5CAOA 4B99A 2DYLA 2YCSA 3L9PA 5ANKA 5HICA 3ZUUA 4MVFA 3GC8A 3DU8A 2X0GA 3GU7A 3D7TA 4NW5A 4YGAA 1CDKA 1YKRA 4UYAA 4Y46A 4ZY4A 4KBAA 5CT7A 1XQZA 5BUJA 4KUJA 4L53A 4DCEA 3C5IA 4BYJA 2GNHA 1PRYA 2GU8A 2HWPA 4UV0A 4AGUA 4RGJA 4FT9A 5GZ8A 2CN8A 2PE2A 3EYGA 2AC3A 4N70A 5TKDA 2HXLA 3ZH8A 3LJ2A 4C3PA 4R7BA 4ZK5A 4BKYA 4UMQA 4ZTRA 3GC0A 3FLNC 4CKJA 3BHYA 5AR3A 3UVQA 2R3IA 1IAJA 1Q3DA 5EI6A 3WILA 3GU5A 3OW3A 4FL2A 2OZAA 3SOCA 4O82A 5EQPA 3LLTA 4GU6A 3O8PA 3FXZA 5M57A 5DG5A 5KUPA 4XBRA 2Q0BA 3QX4A 2NRUA 2WU7A 4QP1A 5D11A 3H9RA 1TQMA 4L00A 4DEIA 2I0HA 2W1IA 1T46A 3QA8A 2P2HA 3DAKA 4TTHB 4RIYA 5CI7A 3SXFA 1PMVA 1WFCA 3R0TA 4QMOA 2BRGA 4QOXA 4O0VA 4RFZA 5AUXA 1XO2B 4F9BA 3IQ7A 4KNBA 1FQ1B 3TZ7A 4GFOA 2W5AA 2I0EA 5DH3A 2C6EA 2ZM1A 4UBAA 1B38A 3DBDA 5FRIA 2Z7LA 4BKZA 5IPJA 5M4FA 1FINA 2YDKA 3A62A 3EQFA 1BI8A 2G01A 3NUPA 3O23A 5IH4A 3NMUF 3FQHA 3HV5A 5FXSA 3R8MA 1YI4A 1Q8YA 3GQIA 4QQTA 4G34A 5FGKA 4Y5HA 5BQ0A 3P23A 4QNAA 5AR4A 1F5QA 1H27A 2EB3A 2XRUA 4FG8A 5HVJA 5IDNA 2P0CA 2B52A 3W2CA 2UVYA 4MXOA 5C01A 3DKFA 3Q60A 3KXMA 3ZO3A 2QO7A 5BMSA 2CDZA 4E6DA 3L8PA 4M13A 3AD4A 5EYKA 2BVAA 3HLLA 4LM5A 2W9FB 3MWUA 3U6JA 2VWXA 4HYUA 4I1ZA 4YHTA 3ITZA 4I92A 5L4QA 2OF4A 1PJKA 1XH9A 2XM8A 1VZOA 3BU3A 3UOJA 2PVNA 3G90X 3O71A 3ENMA 3UIUA 5K4JA 2J5FA 4M8TA 4USEA 2W1FA 4YUQA 3CS9A 4FBXA 1QL6A 4EORA 3TNHA 3DJ5A 1WBVA 5K0XA 1NVQA 3QYWA 3F5XA 4AZEA 4YZ9A 1GIJA 4CRLA 4EOIA 2I1MA 2WMUA 2RFNA 2Y0AA 3HMOA 3WYXA 4X6QC 4DFZE 5KMLA 4PTCA 4RX8A 2BDFA 2VV9A 2W7XA 5K3YA 3KULA 5BVWA 2PK9A 1JQHA 4CVAA 2B55A 5LQFA 3SA0A 3MESA 2OJJA 4AS0A 1H1SA 1DS5A 5D41A 4YC8A 5ICPA 3PXQA 3FPMA 4ZOGA 3C4ZA 3A2CA 3ZC5A 3MW1A 3ET7A 1PXPA 2XZSA 3MFTA 4TRLA 5CZHA 1OITA 3DAJA 3RJCA 3ACJA 4EH7A 3ZHPC 1JKKA 4X21A 2BPMA 2YM8A 1H07A 2FSTX 4I5MA 4PDOA 1QPDA 4Q9SA 1YXVA 5HNBA 3F3TA 3QAME 5AJQA 2A0CX 4Q2AA 2UVXA 3R9NA 5C26A 1OL1A 2PL0A 2BCJA 1Y8YA 4X3FA 3VS3A 1ZYDA 5FBNC 4AW0A 4C4EA 4CMTA 4EZ5A 4UMRA 1TQIA 2UW6A 3G33A 2QVSE 4CFVA 4CG9A 2OIQA 2YCQA 4MWIA 4O0YA 3NGAA 2HW7A 4GK4A 3AXWA 1WBPA 1URWA 3OOMA 2OLCA 2X6DA 3SW4A 4LI5A 3VJNA 2ONLA 3VBTA 5IH6A 3MH3A 4QQCA 1OL2A 4FTMA 4IAYA 2JITA 2JDOA 3B8QA 1U4DA 1E1XA 1XH8A 2Y4IC 4EOLA 1GZKA 1W0XC 4FUXA 3KCFA 2R3MA 3GVUA 4TYEA 3D5XA 3D9VA 4AE9A 2OIBA 4BI1A 4E5AX 3LMHA 4MYGA 4O2ZA 4ACDA 3D4QA 3W33A 3WF7A 3MVJA 2UVZA 3KFAA 5GZAA 2XK6A 3KEXA 1YWVA 5KMNA 3MA6A 4DYMA 5LVOA 2IZUA 1F0QA 3GI3A 5E9EA 2OWBA 4F7NA 4C4IA 2PZRA 3VUGA 2ZAZA 2QCSA 5AX9A 4C35A 3DTCA 1FGKA 3ALNA 1OMWA 5EHLA 1BL6A 4ZJIA 3KRJA 3W10A 3ZZWA 2JEDA 3QTQA 4RIXB 3D14A 2BAJA 2CNUA 2YIWA 3NUAA 2VUWA 2B7AA 4CGAA 3LAUA 2IZTA 3U6HA 2WTIA 4FV4A 3DJ7A 4GMYA 5I9UA 2X9FA 5AP1A 4YLJA 1PMNA 3PPKA 2H96A 2PHKA 4WNKA 4AP7A 3BU6A 2FSOX 3CPCA 4BWKA 5I4NA 4IJ9A 2FB8A 1PYXA 4GK3A 3NCZA 3EN5A 4L52A 2X2MA 3EFJA 4MQ2A 3BBWA 3NUYA 3U9NA 2O63A 1BUHA 4ZP5A 4BCPA 4ORKA 4ACMA 2YN8A 3QQHA 4JJRA 3LFBA 4PF4A 4AW5A 4CZYB 4F6UA 3MJ1A 3R04A 4FNWA 4ZLOA 2QURA 3S2PA 4U42A 3R1SA 4LOPA 4RJ5A 1OIUA 2X4FA 3IGOA 4X2JA 3H0YA 3C13A 1MQBA 4OTRA 1H1WA 2VTRA 3OMVA 4RC2A 5JGBA 2UUEA 3NRMA 5IEYA 3EB0A 3MVHA 5J87A 3R00A 2UW4A 4XV9A 1Q8WA 4IACA 1ZOGA 2V0DA 1MQ4A 3FL5A 4GRBA 5F9EA 1NXKA 3C1XA 5J5TA 1KE5A 4YC3A 4ZTQA 4ZTLA 2OSCA 3F2NA 2X2KA 1NW1A 5EW8A 4DH8A 3H9OA 3LMIA 3E3PA 2RGPA 4GW8A 5ETAA 3ORIA 2DUVA 3QU0A 5CYIA 5H2UA 2JIVA 2YDIA 3PRIA 4MBLA 3SRVB 3TV4A 1YXSA 4YJUA 3EN7A 4DA5A 3P78A 2UZUE 4A4XA 3PE1A 5A14A 3U6IA 5JFVA 2NPQA 4W8EA 4GCJA 1OM1A 3R8UA 3PVUA 4XOYA 5CASA 5IDPA 4OT5A 5IH5A 4KIPA 3TIZA 4NKAA 5CNNA 3LCKA 4LRJA 4C33A 5M44A 1PXJA 2FVDA 1APME 3ERKA 2XJ2A 3QRTA 3REPA 3RNIA 3RWQA 2VO6A 3LFQA 3CPBA 4IZAA 3A7IA 2YAKA 4PNIA 4DFYA 4G1WA 4ITIA 4HNIA 3R8VA 1BL7A 4W4VA 1PKGA 3IPHA 2RKUA 3Q5ZA 1PMEA 4IHPA 3RCJA 4OAUC 3OXZA 1JWHA 1OKVA 3HV7A 2WTKC 4HOKA 4ZS0A 3OBJA 3FMHA 3PG1A 4D1SA 4RLKA 3V04A 4JBVA 4E6AA 4WBBB 2V62A 2H8HA 5JQ8A 1U46A 5DE2A 4MH7A 3EFKA 5E7RA 2BFXA 1PXLA 3H30A 4YPDA 5DFPA 3KF7A 2YM7A 2WB8A 4BCIA 2UZWE 4IDTA 4FZ7A 1BMKA 4YJRA 4ALWA 5M06A 4QMSA 3NWWA 3LFCA 1ZMWA 2XYUA 3RWPA 2IN6A 1HCKA 1SVGA 1YOJA 3JPVA 5HBHA 3ZO1A 4ASZA 3DAEA 3FMLA 3U4UA 2W1DA 4NIFB 3IONA 4GJ3A 3V51A 1YRPA 3IK3A 4WRSA 4KIKA 5GNKA 1PF8A 2UW0A 2O3PA 4H58A 4YJOA 4O7LA 4TYGA 4U97A 4XMOA 3WOWA 2Z02A 3VUHA 2BRHA 3V8WA 2VN9A 3QALE 3HL7A 3OUNB 3RM6A 4BCQA 3QKKA 2XVDA 5EKNA 1UNGA 1CKPA 3COKA 3GP0A 3JY0A 3OEFX 4ZSAA 5FDPA 4UZDA 5H9BA 2YERA 3HRBA 3MBLA 3G5DA 1ZZLA 5J7HA 3TUBA 2GQRA 4CT1A 1H0VA 3QD2B 2X7GA 5IA1A 5HEZA 4G6LA 1GZNA 3ZFMA 3LQ5A 4FZFB 4ANBA 3AQVA 4PP9A 4QP9A 3ZO4A 4RRVA 1H08A 4EHZA 3UNKA 5LVPA 4NZWB 4RX9A 4NJDA 5EOLA 5EFQA 1M52A 3F6XA 3IOPA 2ZYBA 3R9DA 3DFAA 2QU6A 2VWIA 4QTCA 2J51A 2J0LA 3HV4A 4TYHB 2F4JA 3UODA 3NCGA 3MVLA 4MXAA 2BR1A 3UQGA 1PW2A 3UP2A 3R22A 2XIXA 2NRYA 3DBFA 5DRDA 3QTWA 3KMUA 4IWOA 4ZSGA 4TKSA 3MY0A 1MRUA 5D1JA 2C0TA 5TT7A 4C0TA 5I9XA 4TNDA 3CTQA 1W84A 4R1VA 4ANMA 4Y8DA 3DOGA 4AOTA 2VTPA 2C3LA 2PMIA 5KNJA 5AV3A 4O7RA 1M7NA 2I6LA 3UIXA 3F88A 3NUNA 3QLGA 3FQEA 3QD0A 3IKAA 5HO6A 4JL9A 4M66A 4ALUA 3T9TA 1YDTE 2AC5A 3ALOA 4CV9A 4DGNA 5HI2A 4AA5A 2AUHA 5ETCA 2J0JA 5CEPA 4DG0E 4G5PA 5BNJA 5DOSA 2CLQA 3GCUA 2RIOA 5IUHA 2BHHA 5DT4A 1QPCA 3WIKA 2UW9A 4D4YA 2DS1A 4QMYA 5HTBA 4FKRA 3COIA 3S3IA 3N4VA 3G0FA 4BIDA 4WD5A 2EB2A 2QO9A 3A7HA 4JBQA 2YHVA 3VBXA 3DFCB 3AC8A 4D1ZA 3MFSA 3FJQE 4LG4A 3A4PA 4ENXA 5CF6A 5HNIX 4PMTA 5HQ0A 5AAEA 4DTKA 5FWKK 1GAGA 5JH6A 3CTHA 4QPSA 4B9DA 1I44A 4YSJA 3HX4A 5HORA 5HESA 5TOZA 2H9VA 4ERKA 4PP7A 4A7CA 1S9IA 1M7QA 4BCOA 5CU6A 5CLPA 3EIDA 2CN5A 2QHNA 3HKOA 5HZNA 2WTCA 4RVLA 3ZXZA 5LVNA 1M17A 5CS6A 5HE1A 3VRYA 2ERZE 5GHVA 2GHLA 3W2PA 2REIA 4FTLA 5E8SA 3W1FA 5TF9A 4AN3A 5E1EA 1B39A 5AFVA 5K0KA 3Q2JA 3DDQA 2A27A 2XNBA 4FT0A 4ZTMA 2C1AA 2QOIA 3ANRA 4HGEA 3BELA 3R21A 5CSWA 5IA4A 3ZRLA 5C1QB 3FV8A 3HV3A 4B0GA 3D0EA 3ZM4A 2Y4IB 4FIFA 4XBUA 4R78A 2F7ZE 4AF3A 3UZTA 3LKMA 3C9WA 3LMGA 1OBGA 3NNVA 5J9LA 3O8UA 3EQHA 2PMLX 2WKMA 4Z9LA 1H1RA 1M14A 3HNGA 3NEWA 4CD0A 4IAZA 4RJ6A 2OIDA 4HGTA 3OVVA 2C69A 5E8ZA 4D5HA 3D94A 2IPXA 4XG6A 3PWDA 5CSPA 5M07A 4U81A 3I7BA 3FZTA 4DTBA 2C5OA 4FR4A 1A06A 4DH3A 2OW3A 2PVRA 4XP2A 2GQSA 4LFIA 5AADA 4MHAA 3I81A 1BKXA 3P1AA 4BBMA 2J7TA 4NM0A 3Q9ZA 4QMUA 5DEWA 3NYVA 5DR6A 4O7TA 5IQDA 4MBIA 4EH5A 2OBJA 5KZIA 4EOOA 1WBWA 3A7JA 3QUDA 3DKCA 5AUVA 4YURA 4PDPA 4RIWA 2PUIA 3JYAA 1URCA 3O2MA 4KD1A 5AUUA 5F94A 5CXZA 3E92A 4IFGA 3LFFA 3VBWA 4IMYA 4MD8E 5M4CA 3UTOA 2R0IA 1OB3A 2KULA 4EONA 4ZZNA 2R3GA 4G16A 4M15A 4TY1A 5IQAA 4D55A 3V01A 5I9ZA 3EL8A 3DNDA 1JNKA 4IZYA 1OL5A 4FIIA 3TTIA 1XH4A 3PP1A 4AT4A 3QTUA 4N0SA 4WUAA 4CT2A 1M2QA 4ANQA 2A2AA 5CQWA 4GVJA 3RP9A 2Z60A 3PJ3A 5EHYA 2YACA 4JNWA 3C4XA 2X1NA 3F5GA 1KWPA 1JKTA 4BTMA 4HVHA 5IEVA 4TWPA 4DFUA 3CY3A 4GIIA 2PVKA 4B7TA 4QMZA 3AC1A 1P14A 1KOAA 3HMMA 1UVRA 4IWDA 4MNEB
chains in the Genus database with same CATH superfamily
2B54A 2JKKA 1Q41A 3QFVA 3MFRA 3MTLA 2W1ZA 2E9UA 1PXKA 3TUDA 3NYXA 3KXZA 2ETKA 1WAKA 4TNBA 2O65A 1P5EA 3F2AA 3RBWA 5L2QA 3TXOA 4JAIA 1JOWB 1UU3A 2YM3A 3PG3A 1UNLA 3QCXA 2FYSA 4O0SA 4TXCA 2IW8A 2BDWA 4L01A 3TDVA 4CMUA 4F7JA 3ZDUA 1R78A 3ORZA 5EDRA 4BYIA 2ITYA 5T6KA 3D5UA 5D12A 4FTUA 4F4PA 5HCZA 4IXPA 4LV8A 5AP3A 3B2TA 2GTNA 4JDKA 4O4CA 3NNWA 4X2GA 2GSFA 3M2WA 4FIHA 4RJ7A 4U80A 3HAMA 2BKKA 4L7FA 3UOHA 2R3OA 3MPMA 5IQBA 3WI6A 4QRCA 3WE8A 3ZUVA 4F6SA 3O0GA 5D10A 3W0RA 2J5EA 3RTPA 2QONA 4D4VA 2Y8OA 3QWJA 4OTIA 4E4XA 3ORMA 4ZJVA 4ZLYA 4K77A 2QG7A 1HOWA 3DLZA 4JAJA 5HG7A 1R0EA 2VWZA 4HGLA 3UZPA 5T3QA 2YLFA 2CGWA 4U7ZA 4BBEA 3Q4TA 4CV8A 4Y5QA 2WTKB 3R9OA 4QYHA 3L8VA 4O7VA 2XS0A 5LJJA 3BCEA 3FKLA 2RSVA 2BIYA 5FXQA 3BIZA 4CFUA 4JQEA 5CVHA 4ZEGA 3GCPA 5T68A 1KSWA 3WF9A 3MV5A 5EG3A 4AZTA 3LLAA 2C6TA 5F1ZA 1UA2A 5C8NA 3MN3A 1I09A 5TO8A 2W1HA 2V7AA 4FKIA 4ZZMA 4QYGA 2UW8A 3W2RA 2CKOA 3PIZA 3A4OX 2PWLA 2X0PA 4EJNA 3IDPA 3SKCA 4BJJB 2CJMA 3ZOSA 4WRGA 5HVKA 2JDSA 2Y9QA 5C9CA 5IEXA 2YFXA 3EQPA 3LXKA 4IM0A 3I60A 5F4NA 2OF2A 4I24A 2I7QA 4X2NA 2JKQA 4EQCA 5IKWA 4GU9A 4FKQA 3NIEA 4YR8A 4J7BA 1SMHA 2WMQA 2X81A 2HW6A 4BCFA 1H4LA 3PJCA 4QNYA 4AGDA 4BCJA 4BDDA 3C0HA 3TL8A 3DKOA 4O4DA 4TWOA 3W16A 3AD5A 3DZQA 4FEWA 4AUAA 5B0XA 5ACBC 5I3RA 5LXMA 3AGLA 3RPRA 2C5YA 3QTZA 2JGZA 4WBOA 4NFMA 5ETIA 3TKHA 2BZIB 3VRZA 4IW0A 3S00A 3PFYA 3BYVA 1VJYA 4M7IA 4R7IA 3VBQA 3LZBA 4ZTNA 3FLZA 1DAWA 2X7FA 3NVKI 2C47A 3GT8A 3GCSA 4HJOA 2PU8A 2C3KA 5DN3A 2EU9A 1IEPA 4LMNA 5H8EA 4S2ZA 4BDFA 1WBOA 4YJNA 4FV8A 2PMNX 1KE7A 2FO0A 4CLIA 3F5PA 4O84A 4L44A 1UWHA 4FVRA 4S34A 1CSNA 4FZ6A 3KXHA 4MD9E 1NA7A 4YLKA 2ZM4A 4E93A 5C4KA 3BL9A 3ZYAA 2J90A 4R7HA 3PXKA 2JDVA 1KOBA 4AGWA 4DEHA 1Q24A 2Z7SA 2BFYA 3ZBXA 5L6PA 4GJ2A 3V5PA 5A54A 4JBOA 3ZDIA 4IAIA 4LRMA 1G8AA 1ZLTA 4KKEA 2V22A 2XAMA 4I6FA 4TZRA 3OCGA 5AP4A 2OH4A 4O91A 4PDYA 3QQLA 1QPEA 2IEWA 5GZ9A 3DZOA 4KRDA 3CSVA 3RPYA 4D2WA 1OI9A 5KMOA 4DITA 2YIQA 4W4YA 4K1BA 3NVMB 4H05A 4EYJA 4ZIMA 4Z16A 2CCHA 2I40A 4GYGA 4N57A 1KUTA 5ANJA 5DWRA 3VWAA 3GOKA 3DS6A 3OXTA 4HVIA 1O9UA 3QC4A 5JFSA 1OKWA 3G6GA 5IQHA 4UMUA 2R0UA 5E8TA 1IAHA 3ORXA 4BI0A 4ZLZA 3PZEA 3N9XA 3E7OA 2GHMA 5EH0A 3NAXA 4CQEA 3TJCA 3D5VA 4I4EA 4FKPA 3VS7A 3UQCA 3G15A 2PPQA 1RJBA 2CMWA 3RPOA 2HY0A 2XKCA 5CSVA 3TIYA 4MTAA 3G0EA 5A3XA 4ACGA 3WARA 2PZPA 4V0GB 3R7IA 4QTBA 4NT4A 4U45A 2P4IA 3TZ8A 3I4BA 4FTTA 3QHRA 1H24A 3RAIA 2WMBA 5AP7A 4WG4A 4BDHA 3KXGA 4I0TA 4ZY5A 5CQUA 4K6ZA 3V5WA 2RG5A 4GKIA 3O8TA 3O51A 1WZYA 4FT5A 3ZLWA 2WEIA 3FHRA 4P5QA 4RWJA 2XK3A 4EUTA 4GYIA 5HX8A 2OFVA 4NM3A 4E6QA 2UZTA 3OCTA 3DXNA 4A4LA 4KIOA 4M69B 4DEGA 4IC7A 3GC9A 2ITUA 4YZCA 5BVDA 5CSXA 4RIXA 3COHA 3P7AA 3NPCA 3HYHA 4XNEA 4FZDB 1PMUA 4AXAA 3ZM9A 5CVFA 3R2BA 3N4TA 2X4ZA 3NNXA 2PZYA 3RI1A 2LAVA 2R7BA 5HHWA 4JRVA 2C6DA 1MRYA 4FV5A 5L2TA 4AN2A 1PXIA 2BRBA 4BY9E 1OBDA 3BYSA 4LUDA 3VONA 2X9EA 3ANQA 3QL8A 1SNXA 4K2RA 4L67A 4XYFA 3ATSA 5EKOA 2NP8A 4QDVA 1H0WA 1Y91A 2I0YA 1YWRA 1AGWA 4FNYA 1WBNA 3GXLA 4IAAA 4JDIA 4O7ZA 4O7YA 2YIRA 5I9WA 1DM2A 4DG3E 1TVOA 4HCVA 3IG7A 3LQ8A 5B7VA 4NYEA 2IW9A 4L6QA 4FKTA 3BHUA 3FLYA 4FIGA 3EQDA 5HD4A 4AW1A 3NNUA 4RVMA 3OW4A 2VU3A 4BTKA 4ZMFA 4KRCA 3U87A 4O2PA 4RZVA 2VZ6A 5DYJA 1XH7A 2VWVA 3EWHA 1J3HA 3VHKA 4NWMA 1CKJA 3EQIA 2ZB0A 4EEVA 1IA9A 3EMGA 3MFUA 1W98A 2WTVA 3TT0A 4AA4A 1WVWA 3VS1A 3T3VA 1ZMVA 2BROA 4OGRA 4EOMA 5BYLA 5HGIA 4EK3A 1WBTA 2WQNA 4JQ8A 3DXQA 1OECA 1FVVA 3QD3A 4CG8A 5HBEA 5ANOA 2PE1A 2QO2A 3KRXA 1O6LA 2C0OA 2VTLA 3TNPC 2ZFYA 3KB7A 2R4BA 3PWYA 3QC9A 2ZV2A 3SRVA 2C4GA 5JFXA 5CY3A 2PUPA 4R77A 3V5LA 2CLXA 5E90A 3GEQA 2XF0A 4XEYA 4IM2A 4F70A 3COMA 3CP9A 2XH5A 3PXYA 4FKUA 1MP8A 3MYGA 3F3WA 3OEZA 2XNPA 1LP4A 4QT1A 4BCMA 2WTWA 5HIEA 4XV2A 4E6CA 4BGQA 3DLSA 1OVEA 3ZCLA 2CKEA 3KXXA 3S1HA 2F2UA 2Q0NA 4FEXA 3CTJA 3E5AA 1SYKA 2ERKA 5DA3A 4U9AA 4TPTA 4AW2A 4H3PA 1Q8UA 3HECA 4BR3A 3FI4A 4WT6A 3UDBA 3UDZA 4AXDA 4YZDA 4O4BB 5J95A 3OP5A 3P7CA 4PMMA 3VQHA 3RAWA 4XLVA 3LFAA 3EQRA 3OC1A 3SAYA 3SOAA 4NCTC 3UNJA 3F3UA 3VIDA 3NAYA 3WYYA 2XARA 3IGGA 4D2VA 3VQUA 2W9ZB 3QTSA 2XKEA 3VUDA 2CSNA 2GNGA 1RW8A 5CNOA 4M12A 5AR7A 2XEYA 2IF8A 3FSFA 3WF8A 5M4IA 4F9CA 5KKRB 5IQIA 3FXWA 3VO3A 4AZFA 4DHJA 3TKIA 2PE0A 3HRCA 4EK6A 3O5AA 4NTTA 1ZYCA 3WZDA 3PXFA 5FLFA 3UO6A 1V0BA 2E9VA 3C4WA 4ALVA 4M67A 4FV0A 5HTIA 3KCKA 2RF9A 2E9OA 4PNKA 2Y6OA 2HZIA 4OTPA 4YTFA 5BV3A 5BPYA 2W1GA 2PUUA 3QGWA 4HZRA 4E20A 2ZDUA 4G6NA 4U5JA 4AZWA 3JUHA 4Z55A 2Y4PA 3P9JA 4F65A 1UNHA 4ARKA 4D2TA 3BKBA 5JKGA 2PVHA 4FUYA 4D2RA 4FT3A 2XBJA 4HVSA 1WVYA 4QP8A 3LPBA 2CNQA 4FVQA 4HGSA 4BCKA 3UYSA 3A8WA 3R2YA 3LCTA 2XEZA 2XKFA 1FMOE 2F9GA 2QOLA 3MH1A 5HE2A 1OIYA 2PZIA 3CLYA 1E1VA 3ORTA 4FYOA 3D15A 2H34A 4JG7A 4PX6A 5EYMA 4O6LA 5AUZA 4XH6A 4RX5A 4MCVA 5AP5A 4NH1A 3QXOA 4XJ0A 2PVMA 4IEBA 3NZ0A 4N4SA 3AT4A 3NW5A 2QOCA 4CFXA 1Z5MA 5LVMA 4YBKA 4DHIB 4O1PA 2WTDA 2F49A 4PWNA 2BILB 4U8ZA 4DH5A 2R3LA 4FK6A 5CAPA 1J7LA 2J0MB 5EHOA 1J7IA 4D58A 5FM2A 4JQ7A 4DH1A 2UZNA 3GU4A 3TTJA 4UX9A 4LGHA 1FBNA 3G9NA 4EK8A 4E3CA 3WZJA 2XYNA 4H3QA 4FEVA 2WMVA 4JOAA 3CE3A 5I0BA 4AU8A 3BWJA 1YVJA 3PZHA 3PA3A 2B4SB 5K4IA 4CSVA 3RVGA 3CJGA 2R3JA 2OZOA 4F9WA 4WA9A 1X8BA 3KVWA 2UZLA 3R1YA 4KKHA 3DV3A 5AM7A 4OBQA 2PVYA 3H3CA 4LGGA 3FC2A 4QPMA 3KN5A 1Q5KA 4G31A 4R6VA 4UZHA 4CTCA 3HZTA 4BC6A 2QG5A 3F61A 2PZ5A 3VBYA 4FSRA 1XWSA 3PUFC 4YNOA 2QHMA 2WD1A 4O0XA 4PPAA 4WG3A 4F1OA 2JAMA 3HRFA 2YWVA 1YOMA 2GTMA 3P7BA 1SNUA 5ANIA 2BUJA 4JDJA 4WNOA 4BCHA 4FJVA 3A60A 2VTOA 1G3NA 3DB8A 3QWKA 5H8GA 2C1BA 4I5HA 3HMIA 4FOCA 2RFSA 4IDVA 1FOTA 4AACA 4C62A 3OWKA 3PVBA 2VTSA 4A9RA 3O7LB 4O81A 5HG5A 3QKLA 3THBA 1H01A 3PE2A 3L9MA 3MPTA 3ETAA 4J95A 5EQYA 5DGZA 2WOTA 4GVAA 4APPA 4AFJA 5CALA 4F78A 3LFSA 4OUCA 3VNTA 5EDPA 4W4XA 4BZDA 1TKIA 1FVRA 1OPKA 2CGUA 4FSUA 2XUUA 3ZRMA 2XB7A 4A9SA 3ZTXA 4LV5A 4EH2A 2HELA 1G8KA 2WNTA 1U59A 3BHTA 3QTIA 4H36A 4J98A 4HYIA 3FHIA 4QQJA 4MBJA 2HOGA 2A1AB 3FUPA 2X8IA 4MXZA 3ZC6A 3DBCA 1YW2A 3QXPA 4P4CA 2WQOA 5LOHA 3PXZA 5J9ZA 4XG7A 1K2PA 2R5TA 4I6BA 3R1QA 4F63A 2Z2WA 3E8EA 3TNWA 4JVGA 3LM5A 4L43A 3H0ZA 3ROYA 5B2MA 3U8WA 3R83A 2GNIA 4LUEA 5TR6A 3ZEWA 4CEGA 5EYCA 4N6YA 3UQFA 4RBLA 3KGAA 4EHGA 4BDEA 4CKRA 4WHZA 4I0SA 5CU2A 1YXTA 3NYNA 1IG1A 4OW8A 2GFCA 2W4OA 2V55A 1W82A 4GKHA 3DK7A 2WEVA 4D28A 5IQEA 1JAMA 4FTRA 4V01A 1TFFA 1Y6AA 2C6KA 2IVTA 5FD2A 2PVLA 4IX5A 2QOOA 3DT1A 4WSYA 4AOJA 1CTPE 4FIJA 4HYSA 3E63A 3K5VA 4XUFA 3W0SA 3IDBA 5KBRA 4OBOA 1R0PA 3WF5A 3ODYX 5M53A 4FV1A 4ERWA 4I22A 4O86A 4FICA 2VAGA 2CNVA 3DGKA 3DKGA 1GY3A 4IWPA 3K2LA 4FIEA 4WUNA 5BVKA 3SXRA 4FGRA 3RK5A 4GEOA 4ID7A 3UIBA 2VTAA 3LCOA 3UMWA 4DN5A 4QP7A 4PTEA 3D2KA 4UY9A 3B8RA 5D9HA 4I0RA 4RSSA 4E73A 3ZZEA 4FKGA 1JKLA 4RLLA 4WIHA 3RM7A 1ZY5A 4RWKA 4PUZA 3WE4A 4BVUA 3BV3A 4NU1A 5K9IA 5AR5A 4KWPA 2C6MA 2RG6A 3BHHA 4H1MA 4ZXTA 3VW6A 3W0MA 1UWJA 3R71A 1V1KA 3O17A 2BALA 3UG2A 4E7WA 4AXCA 5I5ZA 3CIKA 1K3AA 4P90A 4B8LA 3NDMA 3FE3A 3SC1A 3C7QA 4IZ5A 4EWHA 2WFYA 2CKPA 4EH9A 4O6EA 4A06A 4NW6A 2OXDA 3S4QA 4NUSA 3OF0A 2R3PA 3M11A 3VUTA 4G5JA 4HVDA 3QRUA 2GNFA 3A8XA 4IE9A 1CMKE 3D2IA 4C34A 1RE8A 4UXQA 4FKVA 4G9CA 2VTHA 4MNEA 1KV1A 2EXMA 2QOHA 2XIYA 5HLPA 2VWUA 3VF8A 3CKXA 4G2FA 4B6LA 4EHVA 5CU0A 5JMSA 4BB4A 2W5BA 5BVEA 4FVPA 5EM5A 3F3VA 3JVSA 1PY5A 3VHEA 1Q8TA 2OJGA 3E64A 4S33A 3ZRKA 4BGHA 4QMNA 4OBPA 4FC0A 5M4UA 4FKJA 2XIKA 2B9IA 1XMLA 3I0QA 3KXNA 2QKRA 4RQKA 2JFMA 3OD6X 3OWPA 4FNZA 4Y85A 5DVRA 4D2SA 4DHFA 2XNMA 1H00A 3IW5A 4CYIA 2C30A 3O96A 5GIPE 1OGUA 2OJ9A 1NVSA 5D7AA 4EZ7A 1Q99A 4BWPA 5HU9A 4Z3VA 4MXXA 3V6SA 4DE4A 3EOCA 4FMQA 3Q9WA 4L68A 4DF3A 5ACKA 3UDSA 4FL1A 4YC6A 3LFDA 4BDBA 3QHWA 2WMAA 1IA8A 4FSWA 4JX3A 1L8TA 3PY1A 4IAFA 2OICA 2YABA 4RZWA 5A4QA 3N4UA 3FC1X 4J8MA 3C4FA 5HKMA 2ITVA 3KL8A 4KAOA 5CSHA 4QPAA 2BTRA 1S9JA 2CGVA 5M09A 5K5XA 5AR8A 4DDIA 4F7LA 2C6LA 2JLDA 4FYNA 2HYYA 3FDNA 5EW9A 3F5UA 5CU4A 4HCTA 2G1TA 3AT3A 4GT5A 3KRRA 4V04A 2ITQA 5CENA 2CKQA 3OBGA 4RMZA 1XH6A 3P86A 2VTTA 3TV7A 3WIGA 2XNEA 2JDTA 4OTWA 4CYJA 3NW7A 3PUPA 3PXRA 3ROCA 4GG7A 2ZMCA 3EH9A 2VWYA 3BI6A 3GB2A 5L8JA 5CANA 3KRWA 4EK4A 1JVPP 2ITNA 3Q9XA 1OL6A 5J8IA 4E4MA 3TJDA 3PIXA 4WKQA 4CTBA 3BQCA 4KIQA 5FTQA 3QGYA 5HLWA 2VO7A 4AQKA 5CEKA 2DWBA 2J9MA 1XHAA 2YIXA 4EHEA 3QQUA 4CLJA 1AD5A 3KQ7A 3QUPA 4O0TA 4J8NA 3CQEA 4U44A 5KX8A 4NJ3A 4X7QA 4BJJA 2GFSA 3ZEPA 4L9IA 4CZTA 3CGFA 4PMSA 3CBLA 3MGYA 2R3HA 3NX8A 4D4RA 4CNHA 2XNOA 3PY0A 5ANGA 5E91A 3UNZA 4A9TA 1YHWA 3MSSA 4KSQA 4PL5A 5DBXA 5BUIA 2FUMA 3EHAA 3GCVA 4I3ZA 4E4LA 3FI8A 3QCQA 4FK3A 4QMLA 4M97A 2JIIA 2PVFA 4DLIA 4OTGA 2QR7A 5CEQA 3DTWA 3PJ2A 4GUEA 3KY2A 4GV1A 4DH7A 4PL3A 3EN6A 4V05A 3BL7A 4QP4A 4Y95A 3ORLA 1CKIA 3CEKA 3G2FA 1TZDA 2WXVA 3HVCA 5DHJA 3RNYA 4F9AA 4YO4A 4QP2A 3TI1A 3C0IA 3E93A 3AC3A 4C38A 4F6WA 4IX4A 5E8VA 5A4TA 3OTUA 2AEGA 2G2IA 4D9UA 2Z8CA 3GBZA 1OKZA 1Q97A 2QLQA 4ZSEA 3VUMA 1VYZA 2Z7QA 3Q53A 3SHEA 1B6CB 3WZUA 5CAVA 1ZAOA 2ZJWA 3ZSIA 4UWCA 3WBLA 4ZZOA 2B0QA 4USDA 3AD6A 3VS0A 1W2DA 3PY3A 4JBPA 3R8LA 5JK3A 3DK3A 4EQMA 3NR9A 2X8DA 3UVRA 3P08A 1Y6BA 5EM6A 3SQQA 4FTNA 1SM2A 5E4HA 4FTAA 4X6RA 4NM5A 4QMXA 4CFMA 2VWWA 5IQFA 3AOXA 2WGJA 2C3JA 1H1PA 1WBSA 5HO7A 4QMVA 1RQQA 2WAJA 2WTJA 2P55A 4O0UA 4D1XA 3JR1A 3PIYA 4CQGA 3CQUA 4D0XA 3H9FA 4RJ4A 2ETRA 5HE3A 5L2WA 4C3RA 1WVXA 3O50A 4XG2A 4YHFA 4AGCA 1A48A 3A7GA 3OTVA 2R64A 4I20A 2W5HA 3AG9A 1TQPA 3D7ZA 3FZOA 1PYEA 2AQXA 3PPJA 1YXUA 3T8OA 3V5QA 3JS2A 4DLJA 4YZBA 5KKRC 4OTQA 4RPVA 2W4JA 4XG9A 3SD0A 3BU5A 4GK2A 4G3FA 3POOA 4IC8A 4V0GA 4C59A 3CY2A 1R3CA 3LCSA 4YO6A 5AAFA 1P4OA 3E8CA 3TWJA 3C4EA 4M68A 4QYYA 3MDYA 2J2IB 4J99A 4M84A 2HZ0A 3OFMA 3QTRA 5C8MA 4EOSA 1GIHA 3MPAA 4WSQA 3QRIA 4KS8A 4IVDA 1XJDA 3TG1A 2PSQA 4L3LA 4QP6A 5BUEA 5KMKA 4ANOA 3QZIA 4DTAA 2XJ0A 1P4FA 2FH9A 4EBWA 5AV4A 3U54A 2XJ1A 3P79A 4XV1A 1Q3WA 2XRWA 5EW3A 5A6NA 3QQGA 3PVGA 2ITPA 3GGFA 3MVMA 4G3EA 5EQEA 2XP2A 3VS4A 1ZARA 4QTAA 5ETFA 3FXXA 5IF1A 4CFNA 2YEXA 3MIYA 2UZDA 2XNGA 4JIKA 3VC4A 4Z7GA 2OJIA 1OIQA 2G9XA 4FV3A 2XA4A 2J50A 4BDGA 5FTGA 3UE4A 2IJMA 1U54B 2JKMA 3AGMA 3VULA 4W9WA 4YP8A 5IU2A 3ZSGA 4C61A 3NSZA 1L3RE 3FMDA 5BVFA 4O7NA 1YDRE 4QTEA 5DR2A 3HDMA 4OTHA 2E9PA 4LMUA 4C37A 1UKIA 1FVTA 3R7GA 3RAKA 4MF0A 2EXCX 2HXQA 2IVVA 1RDQE 4GUBA 4IX3A 4O22A 2ZB1A 3PSCA 4O96A 3GFEA 4K9YA 4WNMA 3R1NA 3RCDA 2VD5A 1H28A 3R9HA 3MY5A 5EOBA 1H8FA 5KE0A 4BZOA 4C4JA 5JGAA 3W2OA 2HK5A 2C6OA 3C50A 4J52A 4IADA 4MD7E 4G17A 3HEGA 4GFMA 3PDTA 2JFLA 3IDCA 4R5SA 2YM4A 3Q96A 3W55A 4LL5A 5EYDA 4L7SA 3FY2A 5FEDA 3TV6A 4APCA 4FTIA 3GCQA 3ULIA 2X0OA 4O0WA 5C8KA 2WQEA 3EFWA 1ATPE 2YM5A 4FG7A 4MQ1A 3DXPA 4FTOA 1ZOEA 2QOFA 4BHZA 1V0OA 3CKWA 3FZSA 3ZUTA 4RJ8A 1JSVA 3SG9A 5KHXA 5CAQA 2WMTA 4MUQA 4I21A 2BIKB 4YZMA 3EZRA 3AMYA 4DBXA 1H25A 3ZLSA 5E92A 5CT0A 3RGFA 4YJSA 4F64A 2VO0A 3BYOA 3EYHA 4EI4A 2ZV8A 4IIRA 5H8BA 4DC2A 3I1AA 2HZNA 4XG4A 5DMZA 2JKOA 4RC3A 4J53A 4TN6A 4IANA 4GSBA 4ZSJA 2YDJA 1ZY4A 4IB1A 4X3FC 4JX7A 4X2KA 3TACA 3I6UA 4L42A 4JT3A 4DEEA 3QTXA 1REJA 4MK0A 5LWMA 2HIWA 3FEGA 2VX1A 3PPZA 3ZXTA 3EL7A 2BRNA 5EM7A 4BDIA 4GFGA 3FPQA 4EZ3A 3ORPA 5IUIA 3TKUA 4PDSA 2W99B 1QMZA 3K3JA 1EH4A 3NUXA 4N6ZA 2ONLC 5ANEA 4E5BA 2F7XE 5M51A 2WOUA 4E1ZA 4GL9A 1ZWSA 4AOIA 4ZMEA 3IW8A 4P7EA 4L3JA 3JXWA 4IWQA 2JDRA 4XG3A 2YCFA 5DIAA 1XR1A 4G6OA 3MB7A 2NNWB 3GQLA 4O7SA 3Q52A 4F08A 3FAAA 2GMXA 4EBVA 3DDPA 3PJ8A 3MY1A 4F1MA 1LEWA 5HG8A 3NLBA 5G6VA 2BZJA 1OUKA 4O83A 2ETMA 1VYWA 2AYPA 2E9NA 3FMJA 4F7SA 4FOBA 4WG5A 2VTJA 4MAOA 3SV0A 4DGGA 1LR4A 4IQ6A 5A4CA 5GIOE 2W4KA 3M42A 5GJDA 3UOLA 3FZ1A 3EQCA 3PA5A 1J1BA 3R30A 4U6RA 4YJVA 5FBOA 2XK8A 3W32A 5IQGA 3CJFA 4RFYA 3Q2MA 2WU6A 3MI9A 1M2RA 2F7EE 4R3RA 3MTFA 4U40A 4XRLA 4EOJA 5IZFA 2YZLA 4YLLA 1OIRA 1YWNA 3MS9A 4G3DA 4MXCA 3KK9A 1CM8A 5E8UA 5FP5A 5JZNA 3OG7A 3PRFA 4BWXA 4ZAUA 1DAYA 3DY7A 1ZZ2A 3LXPA 4O1OA 3LXLA 5HO8A 4J97A 1ZXEA 4GT3A 2VO3A 1XBCA 4TYIA 3P0MA 2PVJA 3R6XA 2VTMA 5AWMA 2GPHA 5HCXA 3CCNA 3R8ZA 1KE8A 1UU7A 1W2CA 4RC4A 4AWIA 5J1VA 1OKYA 3TM0A 2H6DA 3UMXA 2XK7A 3DBQA 1PXOA 2ZOQA 3BGQA 4C58A 2C5VA 2V5QA 2X2LA 2YITA 3QZHA 5HE0A 5BYYA 4HZSA 2BZHB 5JQ5A 3RPVA 5L3AA 5KHWA 2YIYA 2JC6A 4JG6A 4R3CA 4RX7A 3HMPA 4QTDA 5HIDA 3U9CA 4ASXA 5JEBA 5AUTA 4FV2A 4R1YA 5FUTA 3TN8A 5DRBA 5J9YA 1IR3A 1ND4A 5GINE 3ENHA 4UWBA 4BDCA 5C4LA 3LFNA 4C36A 4CZUA 3OXIA 3KK8A 1U5QA 4AE6A 4HW7A 4BN1A 4C7TA 4X0MA 4G3CA 4O27B 5HNGA 3I6WA 3LW0A 4JLCA 3TZMA 1LEZA 3QBNA 3CXWA 4EH3A 4LYNA 5CU3A 5AP6A 2IO6A 5J79A 4CKIA 5IA0A 2IVSA 4M0YA 5CEOA 5BX0A 2CGXA 2BHEA 2O0UA 3LJ0A 4HPUE 4O0RA 3AMBA 4PV0A 5AM6A 3L9LA 4CCUA 1VLRA 1JSUA 4NFNA 4FA2A 2EXEA 4U41A 5CI6A 3V5JA 4GIHA 1YQJA 5DT0A 3ATTA 3W0OA 4BHNA 4OTFA 4H3BA 3BGZA 2HCKA 4EC9A 3QKMA 4PTGA 5CF5A 4XLIA 5LARA 2QQ7A 3HV6A 2YISA 4Z7HA 3HUBA 4QD6A 3PTGA 3D7TB 3GFWA 4IB3A 5HCYA 1U5RA 4PRJA 5AV0A 4IZ7A 1OPJA 3VAPA 5M56A 3OROA 3BPRA 4CRSA 2UW5A 2R3RA 3OOGA 4XP0A 5CAUA 5DPVA 2P33A 2BKZA 2VRXA 4K33A 3UGCA 1XBAA 3UOKA 5LMBA 3Q04A 4D9TA 2QODA 2OGVA 5LWNA 3AC4A 4Q5HA 5DT3A 1J1CA 5B2KA 4M14A 4XOZA 3FLWA 2J0KA 2R9SA 1IASA 2ZV7A 4U79A 1NVRA 3U51A 2ZVAA 3AKKA 3IS5A 4FKLA 2V7OA 4ZS4A 4OR5A 3F2RA 2FA2A 2OZAB 4O38A 4YHJA 4I5PA 4DAWA 3RHKA 4F0GA 1ZRZA 4ENYA 3BBTB 2IW6A 2YM6A 4LOQA 4B8MA 3E8NA 4BF2A 2YAAA 2R3KA 3LJ1A 4YZNA 2A98A 3MH2A 5EM8A 1GZOA 4RIYB 4FSTA 4I6HA 4FZAB 4NIFA 4YTIA 1BI7A 3AKJA 2WMWA 4IJPA 1YI3A 3K5UA 2WIPA 4ZTSA 3PSDA 3TDWA 3SLSA 3VUIA 4DGOA 4P2KA 4DINA 4G3GA 4C8BA 3K3IA 4J71A 5IUGA 3SDJA 3QA0A 3A7FA 2B9JA 4AG8A 2EUFB 3W18A 1ZMUA 3QYZA 3FKNA 4UMPA 3TNIA 4AAAA 2CCIA 3HP2A 2W1CA 4JR7A 3TUCA 3LCDA 4EUUA 3KREA 2XNNA 2UW3A 4JRNA 4OLIA 4Y83A 4CMOA 5BYZA 3CD8A 1OL7A 2HY81 5AV1A 5KZ0A 3EN4A 5LVLA 4C2VA 3PA4A 2ITZA 3VUKA 4YBJA 3OCSA 2VX0A 2XCHA 3E87A 3D83A 3PFQA 4LQMA