1XHBA

The crystal structure of udp-galnac: polypeptide alpha-n-acetylgalactosaminyltransferase-t1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
459
structure length
447
Chain Sequence
b'NRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polypeptide N-acetylgalactosaminyltransferase 1
publication title The beginnings of mucin biosynthesis: The crystal structure of UDP-GalNAc:polypeptide {alpha}-N-acetylgalactosaminyltransferase-T1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 142
structure length 447
sequence length 459
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.460 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xhbA02
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1xhbA03
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1xhbA01
2D23A 2YUGA 2A8UA 2W0VA 1H5RA 3R2WA 4BMAA 1MP3A 1T4QA 5C3BA 5FNWA 3O4OA 2UUSA 4YOLA 1R7XA 2KLLA 3CA3A 5DVHA 5JLVA 1BLAA 3UD7A 4Q9PA 1GQCA 3E26A 1AFCA 3CA1A 4QO3A 3BRGC 1G95A 4GAFA 1TOOA 2AM5A 3N7MA 4IY8A 4IZXA 5BP5C 2CU2A 1FO9A 1SS9A 3Q4SA 4F83A 1KWSA 1ZJ0A 4G9MA 2RJ6A 2J3PA 5FZUA 4MNDA 1H7EA 4Y63A 3K8DA 2AESA 1WBAA 4EKXB 2AQZA 3V0MA 1AF9A 1H5TB 2HWAA 2Y4KA 4I4XA 2AXMA 3NBNA 4ZBVB 3PUBA 4YS8A 5AJPA 3SXEA 1GX0A 4A7ZA 1ZCYA 1Z90A 2X65A 3I0FA 1ZCTA 3FWWA 4LW6A 4I3NA 1S0BA 2OI6A 1FN0A 4J2XA 5C3AA 1R81A 3U2WA 3PKQA 3SXAA 1FRWA 3IM6A 3N0KA 4KBBA 4EE3A 5DDVA 1JVGA 4PC4A 3QVBA 1L2HA 2HWMA 1SR4C 1MP5A 3POKA 3MALA 2BO6A 1AVWB 3R3IA 5C49A 4FCUA 3BAQA 1G9DA 1SR4A 1ZI4A 4OWLA 1VICA 3FJKA 1IRAX 1KNMA 3HBWA 2D7IA 3HMYA 7I1BA 2BO8A 2Y7AA 1ZI5A 1E5KA 5CMGX 1YYNA 2ZQOA 4KNXA 3D7WB 1HKNA 1G3LA 1DQGA 1G82A 1GX4A 5FU8A 1Q03A 1INIA 4G3SA 21BIA 2KI6B 5G00A 1TTUA 1NWGB 1WVCA 3N7LA 1LZ7A 4DECA 5FYEA 1HWPB 4OUJA 1QGQA 2FYAA 2JCJA 1ZCVA 5BQUC 2FFVA 1EV2A 2Y9FA 4HJJA 4KXOA 4WBCA 4NALA 4IY9A 3H6RB 4IZEA 5BQUA 4B3UA 1JT3A 3RMXA 3ZGFA 4I4YA 1R80A 3CKOA 1FGGA 2MLLB 3AH4A 3N7KA 3BAOA 4IYBA 3WINC 2RIYA 4FRPA 4IRQA 4A7KA 3SX3A 1LZJA 4CVHA 1ISXA 1V83A 2NYYA 3DK5A 3O3QA 1A8DA 4I8MA 3IAGC 3FJFA 4OEFA 2DRZA 5HPZA 2WBCA 1JYLA 2WEEA 2BO7A 2VFZA 4FRDA 1V82A 1II4A 4OEEA 4CJMA 1FR9A 2Y4LA 3HN1A 1R7TA 6I1BA 4J2KA 2D0JA 1NZKA 2VS3A 3AKHA 4CJBA 5J49A 4Y7TA 1H7LA 1S4NA 4J2YA 3JUKA 4JAWA 4DEPA 3H6QA 2D43A 3CA0A 1TWEA 1JYKA 3VT0A 3OGGA 2FYBA 3RMWA 3SXCA 4LO0C 3P6IA 3T8SA 4ASJA 4OWKA 4FRQA 4D11C 1TZFA 2YCMA 1FGXA 2OI5A 3HSMA 1FG5N 1H7TA 1J0SA 4KPZA 4G1RA 1E0OA 2Z87A 4D11A 5EC5A 2YQHA 5F8SA 2RSTA 1FQ9A 3AH1A 4HO3A 2RQ9A 4G87A 2GZBA 1VCLA 2Q9XA 3AH2A 2KI4A 2XWNA 2ZU9A 4KC2A 4C2SA 4K6RA 3IIRA 5C4DA 2JCOA 2NM1A 1PUMB 1S0FA 2P39A 3CU1B 1FMMS 4I1BA 3RSJA 4ZKTB 2V0HA 3CKJA 3I0KA 4GBPA 3BA7A 3OH0A 1H5SD 3I0GA 2X2SA 3QR5A 4ZFUB 2APCA 5C47A 1VZTA 3OJ2A 2MZBA 2L5XA 1VGZA 2BFHA 2ET2A 3IOHA 3K1XA 4AYJA 3CKNA 1AVUA 3W9TA 2OEGA 4EE5A 1DIWA 1MP4A 1YTOA 5B2HA 2RJ8A 2WVMA 5CMJA 4JP0A 4EE4A 3ZLKA 2VLCA 1MC3A 1VH3A 2RJ9A 4JD0A 1G93A 2O1HA 1K5UA 3O4CA 1TIEA 4QC4A 3ZX7A 1H5RB 1H4DA 5I1BA 2PGVA 2QKXA 2IHOA 1ZHJA 1H7QA 2RJ7A 3CRHA 3FJEA 2W0WA 3CU0A 3EE5A 1R82A 3CA6A 2VXRA 3WMUA 2XWLA 4JKQA 1ISWA 1JT7A 2X60A 2YESA 3T7MA 3RTJB 3RSBA 4I37A 2XWMA 2DRYA 2RJ1A 4M28A 1MC9A 4P0JA 1Q04A 3I2AA 1PZYB 1FWYA 1W3GA 1O0RA 3FJHA 3V8ZA 2YC3A 2AH9A 1WT0A 3JTJA 2ICYA 5DDTA 4QD2C 2LIQA 5C4FA 5EG6C 1ILR1 1O23B 2I1BA 3JRRA 3NBDA 3PNNA 1V84A 4HO8A 3V0LA 3FJJA 4ARWA 1ZJOA 4ZFWB 3BRKX 3OBRA 4R6UB 4ZFYB 4ASYA 2E4MC 1FWUA 1HCEA 1W77A 4G6JA 4FQWA 1WBCA 1W57A 3HL3A 3T7OA 1S4OA 3AKGA 2VD4A 4Y7FA 1HIBA 5IDSA 2Q4JA 4DCKC 2FO1A 4J18A 3N7JA 1RG8A 4B4GA 1M16A 4ZGRB 5FTVA 3I0JA 3R4SA 4ISRA 2BO4A 2QGIA 3SX7A 1IOBA 4NAKA 2P73A 4I4SA 4Y7UA 1FV2A 3JUTA 4B4MA 4HO9A 5BP5A 1VGUA 4EEMA 4HO0A 3BAVA 1H3MA 5D63A 5CQOA 1DFQA 3I29B 2XOAA 3AZVA 1YP3A 3OC9A 5D62A 4AAWA 1JLXA 1S0EA 3VT2A 4LO2C 41BIA 8I1BA 2GGQA 4GOVA 2D20A 2VSHA 4AYLA 3LLPA 2I5EA 4LO2A 5CQMX 2XMHA 5CMIA 3IM5A 2AM4A 3I2XA 3SX5A 3BAHA 1IILA 3I0CA 2D22A 3Q7WA 4LO3C 4QALA 1HM8A 2ERMA 4FREA 4HR6C 4FROA 3F1RA 2VS4A 3FUQA 1HJLA 5D61A 4EB2B 1ZJ1A 1FR8A 3SX8A 4KQLA 2PGYA 2V0LA 3ZF8A 3O4BA 1IT0A 1SZ6B 1YF8B 4FRHA 1ZJ2A 4FVVA 5BOWA 3IOJA 3CGXA 4UEGA 3FUOA 1WD3A 3UDAA 2JCKA 5C1HA 4KEJA 5C1GA 3AZWA 1Z2VA 2K4AB 5CQLX 1I52A 3T7NA 3EF2A 1GWWA 1WT1A 3HALA 4Y6NA 1OQLB 3BRFA 1HWOB 4ZA3B 4D0TA 5I1FA 4L41C 3D8VA 2RG9B 2KKIA 31BIA 1VM8A 1I1EA 4X3AA 3ZLLA 2Y9GA 1YP2A 3PG0A 3AKIA 4I6IA 4P0KA 1Q1UA 3FJCA 1FXOA 4HO4A 4KC1A 3NGWA 1R7VA 1JY0A 4Y9XA 1W3FA 1IJTA 1FXJA 1G23A 2FYCB 5DZUA 5EJZA 1ZJ3A 5EJ1A 3Q7XA 4J2SA 2AGDA 4HO6A 1W3AA 5JMCA 5FUHA 1VZUA 1FGAA 4JKXB 5F8YA 3WINA 1DZCA 1V6XA 2E3DA 2I5KA 2MIBA 1ISVA 3PMEA 1QWJA 1CE7B 4I4QA 1ZI3A 4KEKA 2WAWA 3VUOA 2DS0A 4JPZA 5CQPA 5AJNA 4OW4A 1WD4A 3V90A 3A07A 1DFCA 2K43A 3CQAA 2P72A 4H04A 3E25A 3FJIA 5CMFX 1ISZA 1XZZA 2ZR1B 3RTIB 3I0HA 4AC3A 4DE7A 1BASA 1HWMB 1F31A 4D48A 4Q91A 4ZOTA 1G9CA 3WO3A 4M2AA 1OMZA 3UJ0A 2HW9A 4LO0A 1W55A 2O1GA 3GUEA 1PZZA 3VT1A 1XZ6A 3BB2A 3SNVA 1QGSA 2NXVA 2RITA 2Z86A 3USQA 3USRA 4OEGA 1G9AA 3D5NA 2VXTI 1DJSB 3OKRA 4HOCA 4I4RA 2HZ9A 2MC2A 3V0AA 2Y9WC 3TC2A 4FRMA 3BA4A 1BFGA 1FWVA 1O7OA 2O1FA 3WO2A 1H5SC 1RMLA 3IM7A 3I0EA 4DDZA 4HCQA 2NTDA 3AKFA 3V0BA 2Y4JA 1PWAA 1GWVA 1H5SA 2RIZA 1LL0A 3CA5A 1S0DA 4FRBA 1S0GA 3MPPG 1HM9A 2ZU8A 4P0LA 4IQPA 3U2UA 3I0IX 3V0PA 1O7QA 5DUYA 4Y7VA 2VSEA 4AN6A 4II0A 3POLA 4I0YA 4L4IA 2WVKA 5C8RA 4QD2B 4LO1C 4LW3A 1JQZA 1GQ9A 3TQDA 2FFUA 2AECA 3U2VA 5C38A 4M4KA 1V6UA 4LO1A 1FO8A 1G8OA 1NHEB 5JQQA 5FZZA 5FV9A 5C4EA 4EEOA 1VH1A 3Q80A 1BA7A 3BA5A 3Q7YA 4F34A 3CRIA 3V8YA 1Z0HA 4GOYA 5CQNX 3O44A 3NJ5A 4Z9WB 1NF5B 4QBVA 4ECMA 3PKPA 9ILBA 3VSZA 1QQKA 4EEAA 1CVSA 5E24E 3K8EA 3I0DA 1NMMB 1ON8A 1WSZA 2VXLA 4CJCA 4USOA 1NKHB 4DENA 4M2BA 3P53A 1G97A 3O49A 5BXPA 1JT5A 1BFFA 1N4KA 1G1LA 4LO7C 1EVTA 1YROB 3AJ6A 2P6WA 1BFBA 1S0CA 3ZXDA 1DQOA 2M49A 4KC3A 2F2FC 3WO4A 1LVWA 2E4MA 2GGOA 4HO5A 3ST8A 3SPTA 1GA8A 3BAGA 4ENDA 2F2FA 4USPA 3F1YA 1JV1A 3U0YA 5IDTA 3R4UA 1JT4A 4Z8SB 4XWIA 4BQHA 2D1ZA 1ZI1A 3DJ4A 4Y7GA 1S0LA 5FU0A 5C4BA 3TZTA 4GP0A 2AAIB 1BLDA 1WT3A 2ZU7A 3C9ZA 4X39A 2YQSA 2DREA 5C4CA 4FGFA 4Y6UA 1FOAA 2ICXA 1AVAC 3ZXGA 4EFPA 3KIAA 3SXBA 3V0OA 3KMVA 5AJOA 1ONKB 1ABRB 1EPWA 2V0JA 4B5BA 5FTSA 4IONA 4D8HA 4CJ8A 3OJVA 4KT7A 4I4UA 2QH5A 5L6SA 4FRAA 4EEEB 5L6VA 3V91A 1TVYA 3UD9A 4JRAA 2FDBM 4EVWA 3A22A 4B4BA 1EYRA 3SXDA 5BXCA 2VS5A 1ZCUA 3N9WA 5BXTA 2RJ0A 5C1LA 1ON6A 1TW1A 1AXMA 4LO3A 5C48A 1P63A 2WRYA 3NBEA 3BRDA 3BADA 2NP0A 1BFCA 3VSFA 1Z4SA 1G9BA 2Z48A 3FJ8A 4I4PA 5BXRA 1VGTA 4I2SA 1GGPB 3FJAA 5BVPI 4G3PA 2LIEA 1FZWA 2FGFA 3U2TA 4IHZA 3CRGA 1R8NA 3BCVA 1EZIA 3O4AA 2RJ4A 3OGZA 4QBCA 4E1KA 3E8LC 3VEQA 1OQMB 4L4HA 2OEFA 4GP3A 1HV9A 1ZIZA 2AFGA 3LW6A 2WVLA 3RMYA 3QYDA 2YQJA 3BTAA 4NAIA 3VWCA 1VZXA 2AE7A 1TWMA 1V6WA 3I0LA 1LZIA 1H5TA 4AN7B 2Y9XE 4KNRA 1XG6A 4Y64A 4EEGA 1HM0A 2DPWA 1TFMB 1K4VA 3ILAA 3CKVA 3ZGGA 5C36A 4P6AA 3V0AB 2YQCA 1MD6A 2GO2A 4I1EA 5DSSB 1M2TB 2NVHA 4I7IA 3OH3A 2F8XC 4HO2A 3AJ5A 3OJMA 3WMVA 4B2WA 1LL3A 2ZQNA 3OH2A 3S8JA 1R8OA 1YBIA 3P6JA 3V0BB 1WT2A 4ZDQA 1TP0A 4EFRA 1HJJA 1H5SB 4H9WA 3OAMA 2ESUA 1INJA 1UPSA 2VXMA 2BEAA 1T9FA 2QYIB 4XFSA 4XKIA 3D98A 4KEIA 3U0XA 4G6MA 2FYDB 1IINA 3HOMA 4G9NA 3O5WB 2VSIA 1EYLA 1QQLA 3FJDA 3LTQA 3OH1A 5GAQA 4A7YA 3H6SE 2Y6PA 3NBCA 4X38A 4NANA 4IRPA 1JVDA 1H7HA 3RMVA 3ZC8A 3FOQA 1PUUB 3JUJA 3CKQA 1ZJPA 1LL2A 1H7FA 2V0KA 1G0RA 4Y62A 5F90A 1YP4A 4I96A 1ISYA 4EFQA 4FCEA 1RZOB 2D24A 2D7RA 3H6RA 1JLYA 3OGFA 2A8WA 1QXMA 5FZYA 2JCLA 2K8RA 4J23B 2VSAA 4XFUA 1R7UA 2OI7A 4HG6A 3B9UA 2BEBA 3DUVA 4KC4A 4P00A 4R7PA 5IFYA 2Z49A 5CMHA 1DLLA 2Q3NB 3FJ9A 4TLPA 1TW5A 5BXSA 3O4DA 4I4VA 2KH2A 3F1CA 2PX7A 4D0ZA 4GAIA 1IHKA 4I4OA 5EHAA 3V79C 3Q7UA 4KRVA 2E8BA 3OH4A 2QN4A 1PC8B 3A21A 4HA2A 3CAHA 1R7YA 4QKSA 4LO7B 4QKRA 4G3QA 1G9RA 1DZDA 3BX1C 1VGWA 3CA4A 2X5SA 3U2XA 1PZTA 3UD8A 4MYBA 3V0NA 5EIYA 4Q9GA 2VU9A 1XYFA 4LO8B 3WA1A 1D0HA 1RY7A 1I1BA 2NZ9A 1YXWA 2X2TA 3UJ4A 4JISA 3V0QA 1FV3A 2P23A 1FMZA 2PA4A 1JV3A 3A23A 1LZ0A 3ZC9A 4B2XA 1ZDFA 1AVXB 2D44A 2RIXA 2FY7A 1BARA 1V6VA 4KPXA 1NUNA 1S4PA 1H4EA 4X37A 2YC5A 3FFZA 4XFTA 5HS2A 1IRPA 2R9KB 2RJ5A 4P02A 1HCDA 4ISQA 2XMEA 4B42A 1NQIB 2AM3A 4FRLA 1H4CA 2I7BA 2IWTB 2Y4MA 2VUAA 1ZDGA 2V0IA 3PHZA 4ZLBB 2UX8A 3FGMA 3S8KA 1IIMA 1VPAA 1H7GA 3SXGA 3IOIA 1K5VA 3FJBA 1ITBA 1HWNB 3BAUA 1XHBA 3F62B 4JQ0A 1QG8A 2X5ZA 4OWJA 1OMXA 3O3PA 2WGZA 3OBTA 5C3DA 5FNXA 2WE9A 1G2VA 1JTCA 5F8WA
chains in the Genus database with same CATH superfamily
2JY5A 3R2WA 5C3BA 3TPZA 3KFUG 5JLVA 3UD7A 4Q9PA 1WHCA 2OPFA 1JQJC 4GAFA 1TOOA 3UGJA 1FO9A 4F83A 2J3PA 2HHHM 4A3VB 1H7EA 2JY8A 1NV9A 2DNAA 1QAOA 4FCTA 2Y4KA 3DOAA 3K9PA 3NBNA 4XK8F 3FE3A 3W68A 4I5SA 1ZCYA 1NSFA 1Z90A 2X65A 1ZV1A 4LW6A 2EKKA 2KRKA 3N0KA 4Z8XA 1ZMVA 5DDVA 4PC4A 3QVBA 1MP5A 1AVWB 1GL6A 3I51A 1G9DA 1ZI4A 4OWLA 2Y7AA 2HL7A 1ZI5A 1E5KA 2ZQOA 4KNXA 1HKNA 1DQGA 5FU8A 4B7HA 1Q03A 2Y0TA 21BIA 1K3WA 1LZ7A 3GRYA 4DECA 3CF6E 5FYEA 4OUJA 4RKUF 3I01M 1L2BA 4BB9A 1EV2A 2Y9FA 3I4VA 4HJJA 4NALA 2JZ0A 3GRVA 4B3UA 3RMXA 1J09A 4L6V6 4NSOB 1HQYE 3N7KA 4IYBA 3BAOA 2RIYA 1LZJA 3HZJA 2QCUA 3O3QA 1SG9A 3SFZA 2DRZA 4OEFA 3OTOM 1QQWA 3RFWA 1FR9A 3HN1A 4MGHA 2DZOB 1NZKA 4LF8M 3AKHA 4GITA 4X64M 3KSXA 3KOZE 4LO0C 4ASJA 4FRQA 2O25A 4LFCM 1T43A 2NQ8C 4KPZA 4M9XA 1E0OA 2LVNC 2Z87A 4D11A 2YQHA 1QDRA 4IBBA 3KS8A 2D7HA 2Q9XA 5C4DA 3GQ4A 2JCOA 2NM1A 3Q4SA 5KPRA 3L28A 3J7AS 3EIEA 4ZKTB 5C36A 1H5SD 3I0GA 5C47A 1PM5A 2L5XA 2BFHA 3K1XA 2XSZD 1NNJA 2R4JA 1AVUA 1DIWA 1MP4A 5B2HA 5CMJA 4JD0A 1G93A 1K5UA 3O4CA 5FTJA 1H4DA 2PGVA 2W0WA 3CRHA 3QYBA 3CA6A 2VXRA 2XWLA 4JKQA 3NWLA 3RSBA 4I37A 2RJ1A 4M28A 2B3TA 1C1KA 4IBJA 1HQCA 1O0RA 3FJHA 2CHVA 2I1BA 3JRRA 4HO8A 5ITXE 1ZJOA 5H37D 2KNAA 1HCEA 1W5SA 1LV7A 3HL3A 4G6ZA 1S4OA 3FKEA 5IDSA 4J18A 4B4GA 4P16A 3WHKA 3D8BA 4M9SA 4ISRA 2QGIA 1XXHA 2QBYA 1IOBA 4DUZM 1C7YA 2CRUA 3VDPA 3OC9A 3FUUA 2ZAMA 3VT2A 41BIA 2GGQA 4LO2A 2XMHA 2AM4A 1T3TA 1AIPC 3Q7WA 1HM8A 4D80A 4HR6C 2VS4A 1WXQA 1FR8A 4KQLA 2PGYA 5KPZA 1HT1E 1N77A 1V92A 4FVVA 4UEGA 1TDHA 5C1HA 5FLXS 4NL4H 1GWWA 4Y6NA 4F2LA 4LJ9A 1HWOB 2RG9B 31BIA 2LVAA 4L78A 4X3AA 3AKIA 4P0KA 1JY0A 4Y9XA 1IJTA 2V1UA 4J2SA 5FTKA 2MIBA 2XFSA 3SAUA 4R71A 3TWKA 5CQPA 3VUOA 3IECA 1L2DA 2QP9X 2J0AA 1P3QQ 1DFCA 2K43A 3E25A 4X62M 5CMFX 1ISZA 1XZZA 4Q91A 3WO3A 4M2AA 4EE4A 4LO0A 2DVWB 2O1GA 3USRA 3NBIA 3D5NA 2VXTI 1DJSB 3TC2A 4KT0F 4DDZA 3WO2A 1NJFA 2C99A 2Y4JA 2K0BX 1H5SA 2RIZA 1S0DA 4FRBA 3L29A 2XSZA 4IQPA 5DUYA 5C8RA 4II0A 4L4IA 4QD2B 1PJSA 1YUBA 4LW3A 1JQZA 4KLNA 1ZMWA 2KZUA 4GKJM 4LO1A 1FO8A 1G8OA 1NHEB 1W5TA 5FZZA 1Q39A 2O01F 4EEOA 4JI0M 1IFYA 1UM8A 3V8YA 4DUYM 2V6ZM 5CQNX 3RGPA 3U6SA 3NJ5A 4Z9WB 1Z5CA 4QBVA 4ECMA 2F5OA 1XXHB 2QBYB 3UJNA 1NMMB 2JUJA 5GKNA 3P53A 4FCVA 3SYLA 3ZC7B 4AQYM 1G97A 4L4UA 1BFFA 4LO7C 1YROB 2JZ1A 3U60A 3ZXDA 1DQOA 4ENDA 4XWIA 4MGZE 5C4BA 5FU0A 4CGYB 5JI2E 2AAIB 1QANA 4FGFA 3U6LA 3ZXGA 5AJOA 1ONKB 1ZAEA 4MZFB 2DAKA 4B5BA 3OJVA 4I4UA 4DR3M 2C96A 3BOSA 4JRAA 4NRWA 4O6NA 1IN7A 4B4BA 1ZCUA 1IN5A 1TW1A 3MK6A 1OFHA 7CATA 4BBAA 2VK9A 3VSFA 5DFLA 1Z4SA 2ZM6M 2Z48A 4X65M 5BXRA 3DA1A 4GHAA 4LG2A 1VGTA 2LHGA 3PVSA 3FJAA 2LIEA 4IHZA 3CRGA 2QNJA 4E1KA 3O4AA 4QOZC 2RJ4A 3E8LC 1ZIZA 2WVLA 3QYDA 3ZH9B 3VK7A 3C3EA 3VWCA 1N75A 1V6WA 5ITXA 3EIHA 3CKVA 1TFMB 1K4VA 3ILAA 3U6OA 1L1ZA 2GO2A 4I1EA 5DSSB 4I7IA 2NVHA 4B2WA 3PNYA 4KHPM 3OH2A 1H5SB 4D81A 2ESUA 3HGIA 5E6JA 1TR8A 3C9PA 3IG8A 4XFSA 4XKIA 3U0XA 4G6MA 3VDUA 1IINA 4G9NA 2A5YB 3NBCA 2L4EA 1IN4A 2KA6B 1G0RA 2G3QA 1TTEA 5FZYA 4DR1M 2K8RA 4XFUA 4P00A 4R7PA 5IFYA 5CMHA 1GABA 2Q3NB 1JR3E 3O4DA 1D0LA 4H75A 4B3MM 3WHLA 4D0ZA 4I4OA 5EHAA 4KRVA 3U60B 2QN4A 4XGIA 1NJGA 4HA2A 1R7YA 4QKSA 4G3QA 1VGWA 4MYBA 3V0NA 1XYFA 1YXWA 1FMZA 1JV3A 3AL0C 1ZDFA 2RIXA 1NUNA 1H4EA 2YFQA 4XFTA 1IRPA 4B42A 2DAMA 5IREB 1H4CA 2I7BA 2IWTB 2V0IA 3BXWA 2UX8A 3S8KA 4DR7M 1IBKM 3KOWE 1H7GA 1K5VA 1ITBA 1HWNB 2XF3A 3O3PA 1OMXA 3M7GA 3OBTA 4ITQA 1JTCA 3KXEC 4MGKE 2D23A 2EKFA 4KO8A 1R7XA 2KLLA 1IN8A 3CA3A 5DVHA 4YY3M 1GQCA 3VLFB 4PDIA 3BRGC 3CA1A 4QNRA 3LCUA 3N7MA 2H1RA 1IXRC 4IZXA 4Y7FA 1KWSA 1ZJ0A 4Y63A 3K8DA 4MB7A 1GKIA 3PUBA 4M0DA 4YS8A 3SXEA 2KW0A 4A7ZA 1GX0A 2AHMA 1ZCTA 4I3NA 5C3AA 1R81A 1EFUB 4EE3A 4W5WA 1NY6A 5KQDA 2XLJA 1L2HA 2HWMA 1ZMUA 3MALA 4FCUA 1SR4A 4WP2A 1VICA 1IRAX 2BO8A 3HMYA 4EVWA 5BPVA 5JI3E 1WR1B 1FJGM 1G3LA 2DWNA 1SXJE 1INIA 4DV1M 5G00A 3R8FA 3N7LA 1NHWC 1WVCA 1Z5AA 2MR9A 1ZCVA 2FNAA 4IZEA 5L8RF 4G4QA 3JR5A 1FGGA 4FRPA 3SHGB 4A7KA 4CVHA 1V83A 2NYYA 3HHZA 1A8DA 1Y8GA 1AUAA 3C58A 5HPZA 2BO7A 2KRUA 3FRHA 1V82A 1E94E 2EJSA 2Y4LA 6I1BA 4J2KA 4FIYA 4Y7TA 2NS2A 1H7LA 1S4NA 1QDTA 2RRUA 1JYKA 3VT0A 3OGGA 3CF0A 5D91A 3RMWA 1RU3A 2HCBA 4D11C 3LCVB 1TZFA 1FGXA 2OI5A 3HSMA 1QVRA 1I94M 1FQ9A 4AZFA 4HO3A 4G87A 4I81A 3AH2A 1E32A 3FUXA 3TE6A 2XWNA 4C2SA 3LVVA 3RSJA 1FMMS 3I0KA 2KDLA 1IBLM 2X2SA 3QR5A 2APCA 3OJ2A 1VGZA 2ET2A 3IOHA 3ILKA 4AYJA 3KOYE 3W9TA 2LXEA 2WVMA 2RJ8A 3GPPA 3E21A 1XB2B 2RJ9A 1VH3A 1G71A 4QC4A 2IHOA 3CU0A 5EXSA 4FWGA 1ISWA 2Z8YM 5EP2A 2X60A 2YESA 3A42A 4D82A 1OKSA 4P0JA 2F5NA 4IBDA 1FWYA 1W3GA 5DDTA 1WT0A 2WZJA 2XFTA 4LJ8A 2LIQA 4QD2C 5EG6C 2D7GA 5DNYA 3PNNA 1V84A 2Q2EB 4ZFWB 3OBRA 4R6UB 1W77A 4G6JA 4CIZA 3K1JA 5ITRA 2J5YA 2Q4JA 2FO1A 2I7PA 3L27A 2EA0A 2BO4A 3M0EA 4B3SM 4NAKA 4WURA 4HO0A 3BAVA 5CQOA 5D63A 2LNHC 3HKPA 2MGWA 1JR3A 5D62A 1JLXA 4LO2C 3LQRA 2RKOA 2H5XA 2I5EA 4CISA 3B74A 3FD9A 5CMIA 3I2XA 3BAHA 1IILA 3I0CA 3DZDA 2D22A 2ERMA 1KYIA 3SX8A 4DV3M 1Z5BA 3K9OA 1IT0A 4TUWA 1SZ6B 1YF8B 1ZJ2A 1PRBA 3FUOA 4KEJA 3HX3A 3AZWA 4M0WA 3R9XB 5CQLX 3T7NA 1N33M 3EF2A 1OQLB 3BRFA 5I1FA 4IBFA 2Y20A 1VM8A 3AOGA 2Y9GA 1Q1UA 4HO4A 4KC1A 1R7VA 2XEPA 2FYCB 5DZUA 5EJZA 1ZJ3A 5FUHA 2AGDA 1ORYB 2I5KA 4FCWA 1QWJA 1ZI3A 2WAWA 4JPZA 5AJNA 4OW4A 1WD4A 3VKGA 2P72A 3FJIA 3RTIB 3SC3A 2XZUA 4D48A 1OMZA 4GEWA 4F1IA 2HW9A 3TZTA 1XZ6A 3UK6A 1TF0B 3BB2A 2RITA 2M60A 3USQA 4GKKM 3OKRA 4HOCA 2HZ9A 4MGYE 2QPAA 2VQFM 3LMMA 4FRMA 1BFGA 1A5TA 1H5SC 1RMLA 3IM7A 1GWVA 4AI6A 1LL0A 4MM3B 4S12A 1S0GA 1HM9A 4P0LA 4G4OA 3HWSA 1O7QA 4IBIA 3A45A 4LO1C 3V76A 1IY0A 1V6UA 5JQQA 1SXJA 2W82A 5C4EA 1VH1A 2KXEA 1BA7A 3Q7YA 4GOYA 3GO8A 3O44A 3PKPA 3VSZA 1CVSA 3AOEA 3O49A 4RF1A 3B9PA 2P6WA 1S0CA 2M49A 2E5LM 4QOSA 2GGOA 3SAVA 3SPTA 3BAGA 4IBCA 3MJ5A 4R7GA 1G41A 1JT4A 4Z8SB 2ERCA 4Y7GA 1ZI1A 2JY7A 1S0LA 4GP0A 3FUTA 1WT3A 2ZU7A 3C9ZA 4B08A 2YQSA 4Y6UA 1NV8A 4EFPA 3KIAA 3V0OA 3KMVA 4LJ5A 3VK8A 2V0JA 1H6UA 4IONA 4KT7A 2QH5A 5LMNM 1Q3CA 3GLIA 5C1LA 1ON6A 3BRDA 3BADA 2DHRA 2UXCM 1BFCA 1G9BA 3TWLA 1IXZA 4NC6A 2R65A 2VIIA 1XC8A 4G3PA 3CGWA 1R2ZA 5C18A 1R8NA 3GPUA 1EZIA 3VEQA 1OQMB 1IY1A 2ZTCA 4QHSA 4NXNM 3RMYA 2YQJA 2O5RA 3GPXA 4FWDA 2DZLA 3I0LA 2CE7A 3UZUA 2LVPC 1HM0A 1WIVA 3ZGGA 2YQCA 1MD6A 2F5PA 1M2TB 4PD2A 2F8XC 3AJ5A 3OJMA 3WMVA 1D0MA 1NO1A 4ZDQA 2FOIC 3P6JA 1WT2A 1HJJA 4H9WA 3OAMA 2WSEF 4CHTB 3LQQA 2VXMA 2BEAA 3D98A 4LRTA 2R62A 1IXSA 3QAUA 4LJ6A 3HOMA 3O5WB 1QQLA 5FTNA 4GRIA 2Y6PA 1WJ7A 2QQ8A 4X38A 1OIPA 1SXJB 1LL2A 4I8OA 1H7FA 2V0KA 4GC9A 3KOXE 5F90A 3FYDA 2UUCM 4FCEA 4DV2M 1JLYA 4IIWA 2FH0A 2VSAA 5C38A 3J27B 2BEBA 3Q8XA 1DLLA 3FJ9A 4TLPA 2KH2A 3KW6A 4RNAA 2CV0A 3SBJA 1PC8B 3CAHA 2JWSA 1G9RA 3CA4A 2X5SA 4Q9GA 2VU9A 4LO8B 1I1BA 1TH3A 2X2TA 1QZMA 1FV3A 2PA4A 3KSJA 4B2XA 4M9ZA 1BARA 3GLHE 4FVMA 5DYIA 1G8PA 3B7ZA 3CF2A 2XMEA 4ISQA 2JY6B 3KP0E 4ZPXA 1G3IA 4Y28F 3KP1E 2C5RA 1D2NA 2VUAA 4GMQA 2QSFX 4MIXA 2MROB 3W0LB 1XNRM 3MHVC 3ZCBB 3GLIB 3FJBA 3BAUA 2X5ZA 1QG8A 2OOBA 3B89A 5F3WA 2DKLA 2WGZA 1LTMA 3TL4X 2Z7JA 1MP3A 1J7KA 1T4QA 1DGHA 5FNWA 4YOLA 2UUAM 1GVNA 1AFCA 4FD2A 4OW0A 2AM5A 5BP5C 2CU2A 1SS9A 4G9MA 2RJ6A 5FZUA 1WBAA 4EKXB 1HNXM 2CP8A 1AF9A 3V0MA 1IY2A 2AXMA 4ZBVB 2DENA 5AJPA 3MMPA 5D92A 3FWWA 1S0BA 2OI6A 1FN0A 4J2XA 3PKQA 3SXAA 1FRWA 3IM6A 1YLAA 1R5LA 1SR4C 3POKA 3RGSA 3R3IA 5C49A 3K92A 3BAQA 3KDSE 3FJKA 1XNQM 1KNMA 7I1BA 2D7IA 1NHGC 1IXSB 3HY5A 3THGA 1MJGM 3D7WB 2Y21A 1QAQA 4G3SA 1TTUA 4G4NA 1DO2A 1VEJA 1QGQA 3J80S 2FYAA 2JCJA 4UN2B 2FFVA 4JI8M 1XWIA 5BQUA 2ZTDA 3AH4A 3WINC 3SX3A 1DGGA 4IJFA 4LGMA 1ISXA 3DK5A 4I8MA 2LTUA 3FUVA 1Q02A 5IT9S 3FJFA 1JYLA 2WEEA 4FRDA 4NSRA 1II4A 2ZBKB 4OEEA 1R7TA 3FUWA 4R3DA 2D0JA 2VS3A 3GQ5A 4DEPA 2XZFA 3H6QA 3JAMS 3GLFA 2D43A 4Z6YA 1N36M 1TWEA 3P6IA 3T8SA 4OWKA 1FG5N 1QZEA 1H7TA 5EC5A 1OIZA 4LJ4A 1NNUC 3AH1A 2JXNA 3ZQJA 1WGLA 2GZBA 1VDDA 4KC2A 4K6RA 3IIRA 3U6QA 1PUMB 1S0FA 4GBPA 3CKJA 3BA7A 3TQSA 4LZZA 3PXGA 1JB0F 1VZTA 2OEGA 1YTOA 3HHYA 4JP0A 1MC3A 3QWLA 1IQPA 2UXBM 3ZX7A 2QKXA 1ZHJA 1KSFX 3FJEA 2JNHA 3EE5A 2VF8A 1DGHB 3WMUA 1VG5A 2VF7A 1XMOM 3T7MA 5EP3A 2XWMA 3A46A 1Q04A 4OX9M 2AH9A 4DR2M 2ICYA 5C4FA 3T1YM 3NBDA 3B7QA 4ARWA 5ITTA 5BR8M 3PNVA 4ASYA 1FWUA 4LFBM 1WBCA 2RGHA 3AKGA 1HIBA 2C9OA 2DXIA 2V1CA 2WSCF 3I04M 1PJJA 2MH8A 2OO9A 4ZGRB 1KFVA 3I0JA 3R4SA 3SX7A 2DWLA 2P73A 1FV2A 2R0IA 3JUTA 5BP5A 4EEMA 1H3MA 1DFQA 2XOAA 3AZVA 4NRVA 2YNMD 2ZAOA 4GOVA 2D20A 4AYLA 5CQMX 1TDZA 3SHFA 3SX5A 1L1TA 2CHQA 4QALA 3U6PA 4FREA 4FROA 1HJLA 4EB2B 2V0LA 4L15A 1EIJA 3IOJA 3CGXA 1HNZM 1Z2VA 2K4AB 1I52A 3GLHA 3HALA 1YSYA 2K6BA 3KVWA 4L41C 3D8VA 2L6OA 4NXMM 2OOAA 2KKIA 1I1EA 2BWEA 2YQZA 3ZLLA 1FXOA 3FJCA 3HJQA 3LVWA 3L2AA 3NGWA 3HJ8A 1FNNA 1W3FA 1FXJA 1G23A 2QENA 3Q7XA 4HO6A 3UMMA 2KEBA 4MGIE 3WINA 2E3DA 1V6XA 3HU2A 3PMEA 1CE7B 3K8ZA 4I4QA 4BLCA 2DS0A 4DR5M 2LH0A 2XGNA 4PCZA 1N78A 1OQYA 1V33A 1X37A 2I7NA 4AC3A 1BASA 3BBZA 4REZA 1HWMB 1F31A 4ZOTA 2OQ4A 1W55A 2FE8A 2GNOA 1PZZA 3VT1A 2Z86A 3SNVA 1QGSA 2NXVA 3U6DA 4OEGA 1G9AA 4OU7A 2JP7A 4I4RA 3V0AA 2MC2A 3JR4A 2O1FA 2APLA 1HR0M 4HCQA 3AKFA 3FTFA 3GLIE 4GH9A 1R4GA 2ZU8A 3U2UA 3I0IX 3V0PA 2VSEA 3POLA 4I0YA 3FRIA 1I4WA 1SXJC 2EUCA 1V34A 1GQ9A 4AKIA 2FFUA 2AECA 4LF5M 4M4KA 5FV9A 2VQEM 4LF6M 3Q80A 3BA5A 2YR0A 4F34A 1DGBA 2FS1A 2BJWA 1GL7A 2L7IA 1NF5B 4YHHM 1CUKA 3AOEC 3K8EA 1WSZA 4CJCA 4USOA 2UU9M 3A98B 1N4KA 2J7NA 1EVTA 3AJ6A 1BFBA 4KC3A 3T6PA 1N32M 3ST8A 4IJEA 2RGOA 2F2FA 2R46A 4USPA 3F1YA 4G3OA 3U0YA 5IDTA 4LCBA 3T38A 3SARA 1Z59A 4Q7JA 3DJ4A 4JYAM 1BLDA 2DREA 1MN3A 3W67A 2ICXA 4JI4M 4GC5A 2DAEA 1ABRB 1MU5A 3GLHB 5FTSA 2LWXA 4CJ8A 5L6SA 1QYRA 4EEEB 4O6MA 3FTEA 3UD9A 1HT2E 2FDBM 2DI0A 3DFZA 1EYRA 5BXCA 4DV7M 2F5SA 5BXTA 2RJ0A 1AXMA 1P63A 1BVSA 2NP0A 1XMQM 3FJ8A 4JI3M 3E46A 3VFDA 4I2SA 1GGPB 2FGFA 4HEOA 4DV4M 3GRUA 4QBCA 4L4HA 2OEFA 4GP3A 1HV9A 1OAOC 2CV2A 3LW6A 3GLGE 4B3RM 4NAIA 2AE7A 1VZXA 1TWMA 3AV0A 4LY6A 1H5TA 3M6AA 1XG6A 1J5EM 4B7FA 2DPWA 3V0AB 1GO5A 2BNKA 4DV0M 3OH3A 4HO2A 3AJIB 1LL3A 1R8OA 1PJTA 1TP0A 8CATA 2G5GX 3HJSA 3RE8A 2QYIB 2X49A 2HWJA 1GJTA 2FYDB 2VSIA 1EYLA 3LTQA 5GAQA 4A7YA 3H6SE 1E9RA 4NANA 3HHWA 3RMVA 3ZC8A 5LMUM 3JUJA 3CKQA 1ZJPA 4I96A 1IM2A 2A8WA 3H6RA 4DR4M 3OGFA 1QXMA 4FWHA 4J23B 1S3SA 1R7UA 2OI7A 3B9UA 5E26A 5FTMA 3U6CA 2Z49A 3F1CA 2KNVA 2PX7A 1VEKA 4GAIA 1IHKA 3Q7UA 3V79C 3SAWA 1R6BX 1DZDA 4X66M 3BX1C 2QHOB 3U2XA 2WSFF 1PZTA 5EIYA 1VEGA 2K9DA 3WA1A 1PJQA 2NZ9A 3V0QA 4JI6M 2P23A 4MZHA 4AKHA 3ZC9A 4LF7M 2D44A 3J2PB 4KPXA 1NVMA 3FFZA 1PJIA 5HS2A 3SATA 1DO0A 1GJSA 2AM3A 2LBCA 4FRLA 4JV5M 3PHZA 4ZLBB 2ZANA 1VPAA 1IIMA 3SXGA 2CFOA 3F62B 1XHBA 4JQ0A 2Z4RA 4NOOB 2R4EA 1WGNA 2YUGA 2A8UA 2W0VA 1H5RA 1G4AE 4BMAA 1TH2A 1DV0A 3O4OA 2UUSA 4EIWA 1BLAA 1OJLA 3E26A 4QO3A 4WW0A 1G95A 3GLFE 2DAIA 4ANRA 4IY8A 4MZGB 2HKJA 4B3TM 4MNDA 2AESA 2DWZB 4MH0E 2AQZA 3SMSA 1F4IA 1H5TB 2HWAA 4I4XA 4IBEA 2KHHA 1HNWM 4UY4A 3SMPA 3I0FA 4OVZA 3U2WA 4KBBA 2M5ZA 3FTCA 2F5QA 1JVGA 2LVOC 3E9SA 2BO6A 4JI2M 3V91A 3T7OA 3HBWA 2CHGA 1YYNA 1L2CA 1GX4A 1G82A 1UFZA 5EQTA 2KI6B 3T1HM 1NWGB 2L09A 1HJPA 3E4RA 3U61A 1HWPB 4JN6A 5BQUC 4KXOA 4WBCA 4IY9A 3H6RB 1JT3A 3ZGFA 4I4YA 1R80A 3CKOA 5KQ8A 2MLLB 5CMGX 4IRQA 1E9SA 3IAGC 3CTWB 2WBCA 2VFZA 4LF9M 4LRSA 3LW5F 4CJMA 2FFJA 2F4VM 4CJBA 5J49A 4J2YA 3JUKA 4JAWA 1QUSA 2D7EA 3CA0A 2FYBA 2GQFA 3L26A 2LVQD 2YCMA 4FIXA 1J0SA 4G1RA 5F8SA 2RSTA 4AG6A 4AW4A 2RQ9A 1TH4A 1VCLA 3TWMA 2KI4A 2ZU9A 4DR6M 4I1BA 2P39A 3CU1B 2V0HA 3TQDA 3K2LA 2BJVA 4ZFUB 3KS4A 2MZBA 2K47A 3CKNA 4EE5A 3GLGA 3NBXX 3ZLKA 2VLCA 3T15A 2HAKA 2O1HA 1TIEA 1H5RB 5I1BA 2RJ7A 3SXCA 1H7QA 4HLQA 1R82A 5EXTA 1JT7A 3RTJB 4G4RA 2L2DA 2DRYA 3B7NA 1MC9A 3I2AA 1PZYB 4GIPA 3V8ZA 2YC3A 3JTJA 2UXDM 1ILR1 1O23B 3SASA 3V0LA 3FJJA 5KO3A 3BRKX 4ZFYB 2DAGA 2E4MC 4FQWA 1W57A 2L4FA 4OVZB 2VD4A 4IBKA 4DCKC 1OAIA 3N7JA 1RG8A 5EP1A 1M16A 5FTVA 4I4SA 4Y7UA 4B4MA 4HO9A 1VGUA 5EJCA 2R45A 4PT5A 3I29B 1YP3A 4JI1M 4XBOA 4AAWA 1S0EA 8I1BA 2VSHA 3LLPA 2KZSA 5ITYA 3U61B 3IM5A 4LO3C 3C3DA 1NY5A 3F1RA 3FUQA 5D61A 1ZJ1A 2J7OA 3ZF8A 3O4BA 2Z4SA 4FRHA 5BOWA 1TGUA 2JCKA 1WD3A 3UDAA 4LJ7A 2C98A 5C1GA 1WT1A 4ZA3B 4D0TA 2VDBB 4LGYA 2Z3XA 3W0FA 1YP2A 3PG0A 4I6IA 2MJ5B 1Z6TA 1PGYA 4LF4M 5EJ1A 1W3AA 5JMCA 1VZUA 1FGAA 4JKXB 5F8YA 1DZCA 3OH0A 1ISVA 1K82A 4KEKA 2CWBA 3H4JA 3V90A 5C1BA 3A07A 4II7A 3CQAA 4H04A 2UUBM 2ZR1B 3I0HA 4DE7A 2R44A 3U6EA 2X8AA 3VKHA 1G9CA 4K0KM 3GLGB 3UJ0A 2J0BA 3GUEA 4Q7CA 1IN6A 2JA2A 2N35A 4P17A 3F92A 2Y9WC 3BA4A 4DV5M 4QHTA 1FWVA 1O7OA 3I0EA 1VDLA 5A2QS 1R2YA 2NTDA 3V0BA 2KNZA 3J81S 4AKGA 1PWAA 3CA5A 3MPPG 3GRRA 4Y7VA 4AN6A 2WVKA 4LJAA 3U2VA 1D0KA 1OTRA 3U5ZA 3CRIA 1Z0HA 2DHYA 9ILBA 1G59A 1QQKA 4EEAA 5E24E 2R6FA 3I0DA 1ON8A 2VXLA 1NKHB 4DENA 3AKZA 4M2BA 3Q8GA 5BXPA 1JT5A 1G1LA 3GPYA 1R7RA 3HU3A 2EO2A 2F2FC 3WO4A 1OFIA 2E4MA 1LVWA 4HO5A 1GA8A 1L8QA 1JV1A 3R4UA 4BQHA 2D1ZA 3U6MA 5C4CA 1YE9A 2DWMA 4X39A 4PDGA 2P5TA 3J7BA 4GHLA 1Q3BA 3PFIA 1AVAC 1FOAA 3SXBA 4B7GA 1EPWA 2CUZA 4D8HA 5ITQA 5FSWA 4FRAA 5L6VA 1TVYA 1MX0A 3A22A 2G8LA 3SXDA 2VS5A 3N9WA 1N34M 4LO3A 5C48A 2WRYA 3NBEA 4HL4A 4CJ6A 3HHXA 1JR3D 4JXJA 4I4PA 2L7HA 4RF0A 5BVPI 4IBGA 4LZJA 3I4YA 1FZWA 3U2TA 2BWBA 3L25A 3BCVA 5EXPA 3OGZA 1VQ1A 1K3XA 4L16A 3GLFB 5EP4A 2AFGA 3BTAA 1LZIA 2R18A 4AN7B 2Y9XE 1GLNA 4KNRA 4Y64A 4EEGA 3IHPA 4JI5M 1DGFA 4P6AA 4DBGB 2CV1A 5IWAM 2C9CA 4AG5A 3FYCA 3FTDA 2ZQNA 3S8JA 3GP1A 1YBIA 3V0BB 4EFRA 1INJA 1UPSA 1T9FA 4KEIA 3H4MA 3FJDA 3OH1A 2XH9A 4KODA 5KPTA 4I4LA 4IRPA 1JVDA 1H7HA 3FOQA 2DZNB 1PUUB 4L8RC 2CEAA 2C0NA 4Y62A 3U5ZB 1YP4A 1ISYA 4EFQA 1XXHE 1RZOB 2D24A 2D7RA 3QYEA 2JCLA 4HG6A 3HU1A 4KC4A 3DUVA 5ITUA 3SYKA 1TW5A 4JI7M 5BXSA 4I4VA 1QAMA 5FTLA 1EE8A 2E8BA 3OH4A 3A21A 2Y0QA 5IZ7D 4QKRA 4FW9A 4LO7B 4LFAM 1ZQ9A 1IBMM 3UD8A 3D8LA 1D0HA 1RY7A 5DYGA 3UJ4A 4JISA 1T6OA 3A23A 1LZ0A 1AVXB 4QNMA 4DV6M 5EXXA 2FY7A 1V6VA 1S4PA 4X37A 2YC5A 1SXJD 1QUTA 2R9KB 2RJ5A 4P02A 1HCDA 1NQIB 3AFHA 2Y4MA 1ZDGA 2X4AA 3FGMA 3IG5A 3GQ3A 3IOIA 2QZ4A 2LHCA 4OWJA 5C3DA 5FNXA 2WE9A 1G2VA 5F8WA
chains in the Genus database with same CATH topology
3R2WA 5C3BA 3TPZA 3KFUG 5JLVA 3UD7A 4Q9PA 2OPFA 1JQJC 4GAFA 1TOOA 3UGJA 1FO9A 4F83A 2J3PA 2HHHM 4A3VB 1H7EA 1QAOA 4FCTA 2Y4KA 3DOAA 3NBNA 4I5SA 1ZCYA 1NSFA 1Z90A 2X65A 4LW6A 2KRKA 3N0KA 4Z8XA 5DDVA 4PC4A 3QVBA 1MP5A 1AVWB 1GL6A 3I51A 1G9DA 1ZI4A 4OWLA 2Y7AA 2HL7A 1ZI5A 1E5KA 2ZQOA 4KNXA 1HKNA 1DQGA 5FU8A 4B7HA 1Q03A 2Y0TA 21BIA 1K3WA 1LZ7A 3GRYA 4DECA 3CF6E 5FYEA 4OUJA 1L2BA 4BB9A 1EV2A 2Y9FA 3I4VA 4HJJA 4NALA 3GRVA 4B3UA 3RMXA 1J09A 4NSOB 1HQYE 3N7KA 4IYBA 3BAOA 2RIYA 1LZJA 2QCUA 3O3QA 4OEFA 3SFZA 2DRZA 3OTOM 1QQWA 3RFWA 1FR9A 3HN1A 4MGHA 2DZOB 1NZKA 4LF8M 3AKHA 4GITA 4X64M 3KSXA 3KOZE 4LO0C 4ASJA 4FRQA 4LFCM 2NQ8C 4KPZA 4M9XA 1E0OA 2Z87A 4D11A 2YQHA 4IBBA 3KS8A 2D7HA 2Q9XA 5C4DA 3GQ4A 2JCOA 2NM1A 3Q4SA 5KPRA 3L28A 3J7AS 3EIEA 4ZKTB 5C36A 1H5SD 3I0GA 5C47A 1PM5A 2L5XA 2BFHA 3K1XA 2XSZD 1NNJA 2R4JA 1AVUA 1DIWA 1MP4A 5B2HA 5CMJA 4JD0A 1G93A 1K5UA 3O4CA 5FTJA 1H4DA 2PGVA 2W0WA 3CRHA 3CA6A 2VXRA 2XWLA 4JKQA 3NWLA 3RSBA 4I37A 2RJ1A 4M28A 1C1KA 4IBJA 1HQCA 1O0RA 3FJHA 2CHVA 2I1BA 3JRRA 4HO8A 5ITXE 1ZJOA 5H37D 1HCEA 1W5SA 1LV7A 3HL3A 4G6ZA 1S4OA 3FKEA 5IDSA 4J18A 4B4GA 4P16A 3WHKA 3D8BA 4M9SA 4ISRA 2QGIA 1XXHA 2QBYA 1IOBA 4DUZM 3VDPA 3OC9A 3FUUA 2ZAMA 3VT2A 41BIA 2GGQA 4LO2A 2XMHA 2AM4A 1T3TA 3Q7WA 1HM8A 4D80A 4HR6C 2VS4A 1WXQA 1FR8A 4KQLA 2PGYA 5KPZA 1HT1E 1N77A 4FVVA 4UEGA 1TDHA 5C1HA 5FLXS 4NL4H 1GWWA 4Y6NA 4LJ9A 1HWOB 2RG9B 31BIA 4L78A 4X3AA 3AKIA 4P0KA 1JY0A 4Y9XA 1IJTA 2V1UA 4J2SA 5FTKA 2MIBA 2XFSA 3SAUA 3TWKA 5CQPA 3VUOA 1L2DA 2QP9X 2J0AA 1DFCA 2K43A 3E25A 4X62M 5CMFX 1ISZA 1XZZA 4Q91A 3WO3A 4M2AA 4EE4A 4LO0A 2DVWB 2O1GA 3USRA 3NBIA 3D5NA 2VXTI 1DJSB 3TC2A 4DDZA 3WO2A 1NJFA 2C99A 2Y4JA 1H5SA 2RIZA 1S0DA 4FRBA 3L29A 2XSZA 4IQPA 5DUYA 5C8RA 4II0A 4L4IA 4QD2B 1YUBA 4LW3A 1JQZA 4KLNA 2KZUA 4GKJM 4LO1A 1FO8A 1G8OA 1NHEB 1W5TA 5FZZA 1Q39A 4EEOA 4JI0M 1UM8A 3V8YA 4DUYM 2V6ZM 5CQNX 3RGPA 3U6SA 3NJ5A 4Z9WB 1Z5CA 4QBVA 4ECMA 2F5OA 1XXHB 2QBYB 3UJNA 1NMMB 5GKNA 3P53A 4FCVA 3SYLA 3ZC7B 4AQYM 1G97A 4L4UA 1BFFA 4LO7C 1YROB 3U60A 3ZXDA 1DQOA 4ENDA 4XWIA 4MGZE 5C4BA 5FU0A 4CGYB 5JI2E 2AAIB 1QANA 4FGFA 3U6LA 3ZXGA 5AJOA 1ONKB 1ZAEA 4MZFB 4B5BA 3OJVA 4I4UA 4DR3M 2C96A 3BOSA 4JRAA 4NRWA 4O6NA 1IN7A 4B4BA 1ZCUA 1IN5A 1TW1A 3MK6A 1OFHA 7CATA 4BBAA 2VK9A 3VSFA 1Z4SA 2ZM6M 2Z48A 4X65M 5BXRA 3DA1A 4GHAA 4LG2A 1VGTA 3PVSA 3FJAA 2LIEA 4IHZA 3CRGA 4E1KA 3O4AA 4QOZC 2RJ4A 3E8LC 1ZIZA 2WVLA 3QYDA 3ZH9B 3VK7A 3VWCA 1N75A 1V6WA 5ITXA 3EIHA 3CKVA 1TFMB 1K4VA 3ILAA 3U6OA 1L1ZA 2GO2A 4I1EA 5DSSB 4I7IA 2NVHA 4B2WA 3PNYA 4KHPM 3OH2A 1H5SB 4D81A 2ESUA 3HGIA 5E6JA 3IG8A 4XFSA 4XKIA 3U0XA 4G6MA 3VDUA 1IINA 4G9NA 2A5YB 3NBCA 1IN4A 2KA6B 1G0RA 5FZYA 4DR1M 2K8RA 4XFUA 4P00A 4R7PA 5IFYA 5CMHA 2Q3NB 3O4DA 4H75A 4B3MM 3WHLA 4D0ZA 4I4OA 5EHAA 4KRVA 3U60B 2QN4A 4XGIA 1NJGA 4HA2A 1R7YA 4QKSA 4G3QA 1VGWA 4MYBA 3V0NA 1XYFA 1YXWA 1FMZA 1JV3A 3AL0C 1ZDFA 2RIXA 1NUNA 1H4EA 2YFQA 4XFTA 1IRPA 4B42A 5IREB 1H4CA 2I7BA 2IWTB 2V0IA 2UX8A 3S8KA 4DR7M 1IBKM 3KOWE 1H7GA 1K5VA 1ITBA 1HWNB 2XF3A 3O3PA 1OMXA 3M7GA 3OBTA 4ITQA 1JTCA 3KXEC 4MGKE 2D23A 4KO8A 1R7XA 2KLLA 1IN8A 3CA3A 5DVHA 4YY3M 1GQCA 3VLFB 4PDIA 3BRGC 3CA1A 4QNRA 3N7MA 2H1RA 1IXRC 4IZXA 4Y7FA 1KWSA 1ZJ0A 4Y63A 3K8DA 4MB7A 1GKIA 3PUBA 4M0DA 4YS8A 3SXEA 2KW0A 4A7ZA 1GX0A 2AHMA 1ZCTA 4I3NA 5C3AA 1R81A 4EE3A 4W5WA 1NY6A 5KQDA 2XLJA 1L2HA 2HWMA 3MALA 4FCUA 1SR4A 1VICA 4EVWA 1IRAX 2BO8A 3HMYA 5BPVA 5JI3E 1FJGM 1G3LA 2DWNA 1SXJE 1INIA 4DV1M 5G00A 3R8FA 3N7LA 1NHWC 1WVCA 1Z5AA 1ZCVA 2FNAA 4IZEA 4G4QA 3JR5A 1FGGA 4FRPA 3SHGB 4A7KA 4CVHA 1V83A 2NYYA 3HHZA 1A8DA 3C58A 5HPZA 2BO7A 2KRUA 1V82A 1E94E 2Y4LA 6I1BA 4J2KA 4FIYA 4Y7TA 2NS2A 1H7LA 1S4NA 1JYKA 3VT0A 3OGGA 3CF0A 5D91A 3RMWA 2HCBA 4D11C 1TZFA 1FGXA 2OI5A 3HSMA 1QVRA 1I94M 1FQ9A 4AZFA 4HO3A 4G87A 4I81A 3AH2A 1E32A 3FUXA 3TE6A 2XWNA 4C2SA 3LVVA 3RSJA 1FMMS 3I0KA 1IBLM 2X2SA 3QR5A 2APCA 3OJ2A 1VGZA 2ET2A 3IOHA 3ILKA 4AYJA 3KOYE 3W9TA 2LXEA 2WVMA 2RJ8A 3GPPA 2RJ9A 1VH3A 4QC4A 2IHOA 3CU0A 5EXSA 4FWGA 1ISWA 5EP2A 2X60A 2YESA 3A42A 4D82A 4P0JA 2F5NA 4IBDA 1FWYA 1W3GA 5DDTA 1WT0A 2XFTA 4LJ8A 2LIQA 4QD2C 5EG6C 2D7GA 5DNYA 3PNNA 1V84A 2Q2EB 4ZFWB 3OBRA 4R6UB 1W77A 4G6JA 3K1JA 5ITRA 2Q4JA 2FO1A 2I7PA 3L27A 2EA0A 2BO4A 3M0EA 4B3SM 4NAKA 4WURA 4HO0A 3BAVA 5CQOA 5D63A 2LNHC 3HKPA 1JR3A 5D62A 1JLXA 4LO2C 3LQRA 2RKOA 2I5EA 4CISA 3FD9A 5CMIA 3I2XA 3BAHA 1IILA 3I0CA 3DZDA 2D22A 2ERMA 1KYIA 3SX8A 4DV3M 1Z5BA 1IT0A 4TUWA 1SZ6B 1YF8B 1ZJ2A 3FUOA 4KEJA 3AZWA 4M0WA 3R9XB 5CQLX 3T7NA 1N33M 3EF2A 1OQLB 3BRFA 5I1FA 4IBFA 2Y20A 1VM8A 3AOGA 2Y9GA 1Q1UA 4HO4A 4KC1A 1R7VA 2XEPA 2FYCB 5DZUA 5EJZA 1ZJ3A 5FUHA 2AGDA 1ORYB 2I5KA 4FCWA 1QWJA 1ZI3A 2WAWA 4JPZA 5AJNA 4OW4A 1WD4A 3VKGA 2P72A 3FJIA 3RTIB 3SC3A 2XZUA 4D48A 1OMZA 2HW9A 3TZTA 1XZ6A 3UK6A 3BB2A 2RITA 2M60A 3USQA 4GKKM 3OKRA 4HOCA 2HZ9A 4MGYE 2QPAA 2VQFM 3LMMA 4FRMA 1BFGA 1H5SC 1RMLA 3IM7A 1GWVA 4AI6A 1LL0A 4MM3B 4S12A 1S0GA 1HM9A 4P0LA 4G4OA 3HWSA 1O7QA 4IBIA 3A45A 4LO1C 1IY0A 1V6UA 5JQQA 1SXJA 2W82A 5C4EA 1VH1A 2KXEA 1BA7A 3Q7YA 4GOYA 3GO8A 3O44A 3PKPA 3VSZA 1CVSA 3AOEA 3O49A 4RF1A 3B9PA 2P6WA 1S0CA 2M49A 2E5LM 4QOSA 2GGOA 3SAVA 3SPTA 3BAGA 4IBCA 3MJ5A 4R7GA 1G41A 1JT4A 4Z8SB 2ERCA 4Y7GA 1ZI1A 1S0LA 4GP0A 3FUTA 1WT3A 2ZU7A 3C9ZA 4B08A 2YQSA 4Y6UA 4EFPA 3KIAA 3V0OA 3KMVA 4LJ5A 3VK8A 2V0JA 1H6UA 4IONA 4KT7A 2QH5A 5LMNM 1Q3CA 3GLIA 5C1LA 1ON6A 3BRDA 3BADA 2DHRA 2UXCM 1BFCA 1G9BA 3TWLA 1IXZA 2R65A 2VIIA 1XC8A 4G3PA 1R2ZA 5C18A 1R8NA 3GPUA 1EZIA 3VEQA 1OQMB 1IY1A 4QHSA 4NXNM 3RMYA 2YQJA 2O5RA 3GPXA 4FWDA 3I0LA 2CE7A 3UZUA 1HM0A 3ZGGA 2YQCA 1MD6A 2F5PA 1M2TB 4PD2A 2F8XC 3AJ5A 3OJMA 3WMVA 4ZDQA 2FOIC 3P6JA 1WT2A 1HJJA 4H9WA 3OAMA 4CHTB 3LQQA 2VXMA 2BEAA 3D98A 4LRTA 2R62A 3QAUA 4LJ6A 3HOMA 3O5WB 1QQLA 5FTNA 4GRIA 2Y6PA 4X38A 1SXJB 1LL2A 4I8OA 1H7FA 2V0KA 4GC9A 3KOXE 5F90A 3FYDA 2UUCM 4FCEA 4DV2M 1JLYA 4IIWA 2VSAA 5C38A 3J27B 2BEBA 3Q8XA 1DLLA 3FJ9A 4TLPA 2KH2A 3KW6A 4RNAA 2CV0A 3SBJA 1PC8B 3CAHA 1G9RA 3CA4A 2X5SA 4Q9GA 2VU9A 4LO8B 1I1BA 1TH3A 2X2TA 1QZMA 1FV3A 2PA4A 3KSJA 4B2XA 4M9ZA 1BARA 4FVMA 5DYIA 1G8PA 3CF2A 2XMEA 4ISQA 3KP0E 4ZPXA 1G3IA 3KP1E 2C5RA 1D2NA 2VUAA 4GMQA 4MIXA 3W0LB 1XNRM 3MHVC 3ZCBB 3GLIB 3FJBA 3BAUA 2X5ZA 1QG8A 5F3WA 2WGZA 3TL4X 2Z7JA 1MP3A 1J7KA 1T4QA 1DGHA 5FNWA 4YOLA 2UUAM 1GVNA 1AFCA 4FD2A 4OW0A 2AM5A 5BP5C 2CU2A 1SS9A 4G9MA 2RJ6A 5FZUA 1WBAA 4EKXB 1HNXM 1AF9A 3V0MA 1IY2A 2AXMA 4ZBVB 5AJPA 5D92A 3FWWA 1S0BA 2OI6A 1FN0A 4J2XA 3PKQA 3SXAA 1FRWA 3IM6A 1SR4C 3POKA 3RGSA 3R3IA 5C49A 3K92A 3BAQA 3KDSE 3FJKA 1XNQM 1KNMA 7I1BA 2D7IA 1NHGC 1IXSB 3THGA 3D7WB 2Y21A 1QAQA 4G3SA 1TTUA 4G4NA 1DO2A 1QGQA 3J80S 2FYAA 2JCJA 2FFVA 4JI8M 1XWIA 5BQUA 3AH4A 3WINC 3SX3A 1DGGA 4IJFA 4LGMA 1ISXA 3DK5A 4I8MA 1JYLA 3FUVA 5IT9S 3FJFA 2WEEA 4FRDA 4NSRA 1II4A 2ZBKB 4OEEA 1R7TA 3FUWA 4R3DA 2D0JA 2VS3A 3GQ5A 4DEPA 2XZFA 3H6QA 3JAMS 3GLFA 2D43A 4Z6YA 1N36M 1TWEA 3P6IA 3T8SA 4OWKA 1FG5N 1H7TA 5EC5A 4LJ4A 1NNUC 3AH1A 2GZBA 1VDDA 4KC2A 4K6RA 3IIRA 3U6QA 1PUMB 1S0FA 4GBPA 3CKJA 3BA7A 3TQSA 4LZZA 3PXGA 1VZTA 2OEGA 1YTOA 3HHYA 4JP0A 1MC3A 3QWLA 1IQPA 2UXBM 3ZX7A 2QKXA 1ZHJA 1KSFX 3FJEA 3EE5A 1DGHB 3WMUA 1XMOM 3T7MA 5EP3A 2XWMA 3A46A 1Q04A 4OX9M 2AH9A 4DR2M 2ICYA 5C4FA 3T1YM 3NBDA 4ARWA 5ITTA 5BR8M 3PNVA 4ASYA 1FWUA 4LFBM 1WBCA 2RGHA 3AKGA 1HIBA 2C9OA 2DXIA 2V1CA 1PJJA 4ZGRB 1KFVA 3I0JA 3R4SA 3SX7A 2DWLA 2P73A 1FV2A 3JUTA 5BP5A 4EEMA 1H3MA 1DFQA 2XOAA 3AZVA 4NRVA 2YNMD 2ZAOA 4GOVA 2D20A 4AYLA 5CQMX 1TDZA 3SHFA 3SX5A 1L1TA 2CHQA 4QALA 3U6PA 4FREA 4FROA 1HJLA 4EB2B 2V0LA 4L15A 3IOJA 3CGXA 1HNZM 1Z2VA 2K4AB 1I52A 3GLHA 3HALA 1YSYA 3KVWA 4L41C 3D8VA 2L6OA 4NXMM 2KKIA 1I1EA 2YQZA 3ZLLA 1FXOA 3FJCA 3HJQA 3LVWA 3L2AA 3NGWA 3HJ8A 1FNNA 1W3FA 1FXJA 1G23A 2QENA 3Q7XA 4HO6A 3UMMA 2KEBA 4MGIE 3WINA 2E3DA 1V6XA 3HU2A 3PMEA 1CE7B 3K8ZA 4I4QA 4BLCA 2DS0A 4DR5M 2LH0A 2XGNA 4PCZA 1N78A 1X37A 2I7NA 4AC3A 1BASA 4REZA 1HWMB 1F31A 4ZOTA 2OQ4A 1W55A 2FE8A 1PZZA 3VT1A 2Z86A 3SNVA 1QGSA 2NXVA 3U6DA 4OEGA 1G9AA 4OU7A 4I4RA 3V0AA 2MC2A 3JR4A 2O1FA 1HR0M 4HCQA 3AKFA 3FTFA 4GH9A 2ZU8A 3U2UA 3I0IX 3V0PA 2VSEA 3POLA 4I0YA 1I4WA 1SXJC 2EUCA 1GQ9A 4AKIA 2FFUA 2AECA 4LF5M 4M4KA 5FV9A 2VQEM 4LF6M 3Q80A 3BA5A 2YR0A 4F34A 1DGBA 2BJWA 1GL7A 2L7IA 1NF5B 4YHHM 3AOEC 3K8EA 1WSZA 4CJCA 4USOA 2UU9M 3A98B 1N4KA 2J7NA 1EVTA 3AJ6A 1BFBA 4KC3A 1N32M 3ST8A 4IJEA 2RGOA 2F2FA 2R46A 4USPA 3F1YA 3U0YA 5IDTA 4LCBA 3T38A 3SARA 1Z59A 3DJ4A 4JYAM 1BLDA 2DREA 2ICXA 4JI4M 4GC5A 1ABRB 1MU5A 3GLHB 5FTSA 2LWXA 4CJ8A 5L6SA 1QYRA 4EEEB 4O6MA 3FTEA 3UD9A 1HT2E 2FDBM 3DFZA 1EYRA 5BXCA 4DV7M 2F5SA 5BXTA 2RJ0A 1AXMA 1P63A 2NP0A 1XMQM 3FJ8A 4JI3M 3VFDA 4I2SA 1GGPB 2FGFA 4DV4M 3GRUA 4QBCA 4L4HA 2OEFA 4GP3A 1HV9A 2CV2A 3LW6A 4B3RM 4NAIA 2AE7A 1VZXA 1TWMA 3AV0A 4LY6A 1H5TA 3M6AA 1XG6A 1J5EM 4B7FA 2DPWA 3V0AB 2BNKA 4DV0M 3OH3A 4HO2A 3AJIB 1LL3A 1R8OA 1TP0A 8CATA 2G5GX 3HJSA 3RE8A 2QYIB 2X49A 2FYDB 2VSIA 1EYLA 3LTQA 5GAQA 4A7YA 3H6SE 1E9RA 4NANA 3HHWA 3RMVA 3ZC8A 5LMUM 3JUJA 3CKQA 1ZJPA 4I96A 1IM2A 2A8WA 3H6RA 4DR4M 3OGFA 1QXMA 4FWHA 4J23B 1S3SA 1R7UA 2OI7A 3B9UA 5E26A 5FTMA 3U6CA 2Z49A 3F1CA 2PX7A 4GAIA 1IHKA 3Q7UA 3V79C 3SAWA 1R6BX 1DZDA 4X66M 3BX1C 3U2XA 1PZTA 5EIYA 3WA1A 2NZ9A 3V0QA 4JI6M 2P23A 4MZHA 4AKHA 3ZC9A 4LF7M 2D44A 3J2PB 4KPXA 1NVMA 3FFZA 1PJIA 5HS2A 3SATA 1DO0A 2AM3A 4FRLA 4JV5M 3PHZA 4ZLBB 2ZANA 1VPAA 1IIMA 3SXGA 2CFOA 3F62B 1XHBA 4JQ0A 2Z4RA 4NOOB 2R4EA 2YUGA 2A8UA 2W0VA 1H5RA 1G4AE 4BMAA 1TH2A 3O4OA 2UUSA 4EIWA 1BLAA 1OJLA 3E26A 4QO3A 4WW0A 1G95A 4IY8A 4MZGB 2HKJA 4B3TM 4MNDA 2AESA 2DWZB 4MH0E 2AQZA 3SMSA 1H5TB 2HWAA 4I4XA 4IBEA 1HNWM 4UY4A 3SMPA 3I0FA 4OVZA 3U2WA 4KBBA 2M5ZA 3FTCA 2F5QA 1JVGA 3E9SA 2BO6A 4JI2M 3V91A 3T7OA 3HBWA 2CHGA 1YYNA 1L2CA 1GX4A 1G82A 5EQTA 2KI6B 3T1HM 1NWGB 2L09A 3E4RA 3U61A 1HWPB 4JN6A 5BQUC 4KXOA 4WBCA 4IY9A 3H6RB 1JT3A 3ZGFA 4I4YA 1R80A 3CKOA 5KQ8A 2MLLB 5CMGX 4IRQA 1E9SA 3IAGC 3CTWB 2WBCA 2VFZA 4LF9M 4LRSA 4CJMA 2FFJA 2F4VM 4CJBA 5J49A 4J2YA 3JUKA 4JAWA 2D7EA 3CA0A 2FYBA 3L26A 2YCMA 4FIXA 1J0SA 4G1RA 5F8SA 2RSTA 4AG6A 4AW4A 2RQ9A 1TH4A 1VCLA 3TWMA 2KI4A 2ZU9A 4DR6M 4I1BA 2P39A 3CU1B 2V0HA 3TQDA 3K2LA 2BJVA 4ZFUB 3KS4A 2MZBA 2K47A 3CKNA 4EE5A 3GLGA 3ZLKA 2VLCA 3T15A 2O1HA 1TIEA 1H5RB 5I1BA 2RJ7A 3SXCA 1H7QA 4HLQA 1R82A 5EXTA 1JT7A 3RTJB 4G4RA 2DRYA 1MC9A 3I2AA 1PZYB 4GIPA 3V8ZA 2YC3A 3JTJA 2UXDM 1ILR1 1O23B 3SASA 3V0LA 3FJJA 5KO3A 3BRKX 4ZFYB 2E4MC 4FQWA 1W57A 4OVZB 2VD4A 4IBKA 4DCKC 3N7JA 1RG8A 5EP1A 1M16A 5FTVA 4I4SA 4Y7UA 4B4MA 4HO9A 1VGUA 5EJCA 3I29B 2R45A 4PT5A 1YP3A 4JI1M 4XBOA 4AAWA 1S0EA 8I1BA 2VSHA 3LLPA 2KZSA 5ITYA 3U61B 3IM5A 4LO3C 1NY5A 3F1RA 3FUQA 5D61A 1ZJ1A 2J7OA 3ZF8A 3O4BA 2Z4SA 4FRHA 5BOWA 1TGUA 2JCKA 1WD3A 3UDAA 4LJ7A 2C98A 5C1GA 1WT1A 4ZA3B 4D0TA 4LGYA 2Z3XA 3W0FA 1YP2A 3PG0A 4I6IA 1Z6TA 4LF4M 5EJ1A 1W3AA 5JMCA 1VZUA 1FGAA 4JKXB 5F8YA 1DZCA 3OH0A 1ISVA 1K82A 4KEKA 3V90A 5C1BA 3A07A 4II7A 3CQAA 4H04A 2UUBM 2ZR1B 3I0HA 4DE7A 3U6EA 3VKHA 2X8AA 1G9CA 4K0KM 3GLGB 3UJ0A 2J0BA 3GUEA 4Q7CA 1IN6A 2JA2A 2Y9WC 3BA4A 4DV5M 4QHTA 1FWVA 1O7OA 3I0EA 5A2QS 1R2YA 2NTDA 3V0BA 3J81S 4AKGA 1PWAA 3CA5A 3MPPG 3GRRA 4Y7VA 4AN6A 2WVKA 4LJAA 3U2VA 3U5ZA 3CRIA 1Z0HA 9ILBA 1G59A 1QQKA 4EEAA 5E24E 3I0DA 1ON8A 2VXLA 1NKHB 4DENA 3AKZA 4M2BA 5BXPA 1JT5A 1G1LA 3GPYA 1R7RA 3HU3A 2EO2A 2F2FC 3WO4A 1OFIA 2E4MA 1LVWA 4HO5A 1GA8A 1L8QA 1JV1A 3R4UA 4BQHA 2D1ZA 3U6MA 5C4CA 1YE9A 2DWMA 4X39A 4PDGA 2P5TA 3J7BA 4GHLA 1Q3BA 3PFIA 1AVAC 1FOAA 3SXBA 4B7GA 1EPWA 2CUZA 4D8HA 5ITQA 5FSWA 4FRAA 5L6VA 1TVYA 1MX0A 3A22A 2G8LA 3SXDA 2VS5A 3N9WA 1N34M 4LO3A 5C48A 2WRYA 3NBEA 4HL4A 3HHXA 1JR3D 4JXJA 4I4PA 2L7HA 4RF0A 5BVPI 4IBGA 4LZJA 3I4YA 1FZWA 3U2TA 3L25A 3BCVA 5EXPA 3OGZA 1K3XA 4L16A 3GLFB 5EP4A 2AFGA 3BTAA 1LZIA 2R18A 4AN7B 2Y9XE 1GLNA 4KNRA 4Y64A 4EEGA 4JI5M 1DGFA 4P6AA 2CV1A 5IWAM 2C9CA 4AG5A 3FYCA 3FTDA 2ZQNA 3S8JA 3GP1A 1YBIA 3V0BB 4EFRA 1INJA 1UPSA 1T9FA 4KEIA 3H4MA 3FJDA 3OH1A 2XH9A 4KODA 5KPTA 4I4LA 4IRPA 1JVDA 1H7HA 3FOQA 2DZNB 1PUUB 4L8RC 2CEAA 2C0NA 4Y62A 3U5ZB 1YP4A 1ISYA 4EFQA 1RZOB 2D24A 2D7RA 2JCLA 4HG6A 3HU1A 4KC4A 3DUVA 5ITUA 3SYKA 1TW5A 4JI7M 5BXSA 4I4VA 1QAMA 5FTLA 1EE8A 2E8BA 3OH4A 3A21A 2Y0QA 5IZ7D 4QKRA 4FW9A 4LO7B 4LFAM 1ZQ9A 1IBMM 3UD8A 3D8LA 1D0HA 1RY7A 5DYGA 3UJ4A 4JISA 3A23A 1LZ0A 1AVXB 4QNMA 4DV6M 5EXXA 2FY7A 1V6VA 1S4PA 4X37A 2YC5A 1SXJD 2R9KB 2RJ5A 4P02A 1HCDA 1NQIB 3AFHA 2Y4MA 1ZDGA 2X4AA 3FGMA 3IG5A 3GQ3A 3IOIA 2QZ4A 4OWJA 5C3DA 5FNXA 2WE9A 1G2VA 5F8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D23 A;  2YUG A;  2A8U A;  2W0V A;  1H5R A;  3R2W A;  4BMA A;  1MP3 A;  1T4Q A;  5C3B A;  5FNW A;  3O4O A;  2UUS A;  4YOL A;  1R7X A;  2KLL A;  3CA3 A;  5DVH A;  5JLV A;  1BLA A;  3UD7 A;  4Q9P A;  1GQC A;  3E26 A;  1AFC A;  3CA1 A;  4QO3 A;  3BRG C;  1G95 A;  4GAF A;  1TOO A;  2AM5 A;  3N7M A;  4IY8 A;  4IZX A;  5BP5 C;  2CU2 A;  1FO9 A;  1SS9 A;  3Q4S A;  4F83 A;  1KWS A;  1ZJ0 A;  4G9M A;  2RJ6 A;  2J3P A;  5FZU A;  4MND A;  1H7E A;  4Y63 A;  3K8D A;  2AES A;  1WBA A;  4EKX B;  2AQZ A;  3V0M A;  1AF9 A;  1H5T B;  2HWA A;  2Y4K A;  4I4X A;  2AXM A;  3NBN A;  4ZBV B;  3PUB A;  4YS8 A;  5AJP A;  3SXE A;  1GX0 A;  4A7Z A;  1ZCY A;  1Z90 A;  2X65 A;  3I0F A;  1ZCT A;  3FWW A;  4LW6 A;  4I3N A;  1S0B A;  2OI6 A;  1FN0 A;  4J2X A;  5C3A A;  1R81 A;  3U2W A;  3PKQ A;  3SXA A;  1FRW A;  3IM6 A;  3N0K A;  4KBB A;  4EE3 A;  5DDV A;  1JVG A;  4PC4 A;  3QVB A;  1L2H A;  2HWM A;  1SR4 C;  1MP5 A;  3POK A;  3MAL A;  2BO6 A;  1AVW B;  3R3I A;  5C49 A;  4FCU A;  3BAQ A;  1G9D A;  1SR4 A;  1ZI4 A;  4OWL A;  1VIC A;  3FJK A;  1IRA X;  1KNM A;  3HBW A;  2D7I A;  3HMY A;  7I1B A;  2BO8 A;  2Y7A A;  1ZI5 A;  1E5K A;  5CMG X;  1YYN A;  2ZQO A;  4KNX A;  3D7W B;  1HKN A;  1G3L A;  1DQG A;  1G82 A;  1GX4 A;  5FU8 A;  1Q03 A;  1INI A;  4G3S A;  21BI A;  2KI6 B;  5G00 A;  1TTU A;  1NWG B;  1WVC A;  3N7L A;  1LZ7 A;  4DEC A;  5FYE A;  1HWP B;  4OUJ A;  1QGQ A;  2FYA A;  2JCJ A;  1ZCV A;  5BQU C;  2FFV A;  1EV2 A;  2Y9F A;  4HJJ A;  4KXO A;  4WBC A;  4NAL A;  4IY9 A;  3H6R B;  4IZE A;  5BQU A;  4B3U A;  1JT3 A;  3RMX A;  3ZGF A;  4I4Y A;  1R80 A;  3CKO A;  1FGG A;  2MLL B;  3AH4 A;  3N7K A;  3BAO A;  4IYB A;  3WIN C;  2RIY A;  4FRP A;  4IRQ A;  4A7K A;  3SX3 A;  1LZJ A;  4CVH A;  1ISX A;  1V83 A;  2NYY A;  3DK5 A;  3O3Q A;  1A8D A;  4I8M A;  3IAG C;  3FJF A;  4OEF A;  2DRZ A;  5HPZ A;  2WBC A;  1JYL A;  2WEE A;  2BO7 A;  2VFZ A;  4FRD A;  1V82 A;  1II4 A;  4OEE A;  4CJM A;  1FR9 A;  2Y4L A;  3HN1 A;  1R7T A;  6I1B A;  4J2K A;  2D0J A;  1NZK A;  2VS3 A;  3AKH A;  4CJB A;  5J49 A;  4Y7T A;  1H7L A;  1S4N A;  4J2Y A;  3JUK A;  4JAW A;  4DEP A;  3H6Q A;  2D43 A;  3CA0 A;  1TWE A;  1JYK A;  3VT0 A;  3OGG A;  2FYB A;  3RMW A;  3SXC A;  4LO0 C;  3P6I A;  3T8S A;  4ASJ A;  4OWK A;  4FRQ A;  4D11 C;  1TZF A;  2YCM A;  1FGX A;  2OI5 A;  3HSM A;  1FG5 N;  1H7T A;  1J0S A;  4KPZ A;  4G1R A;  1E0O A;  2Z87 A;  4D11 A;  5EC5 A;  2YQH A;  5F8S A;  2RST A;  1FQ9 A;  3AH1 A;  4HO3 A;  2RQ9 A;  4G87 A;  2GZB A;  1VCL A;  2Q9X A;  3AH2 A;  2KI4 A;  2XWN A;  2ZU9 A;  4KC2 A;  4C2S A;  4K6R A;  3IIR A;  5C4D A;  2JCO A;  2NM1 A;  1PUM B;  1S0F A;  2P39 A;  3CU1 B;  1FMM S;  4I1B A;  3RSJ A;  4ZKT B;  2V0H A;  3CKJ A;  3I0K A;  4GBP A;  3BA7 A;  3OH0 A;  1H5S D;  3I0G A;  2X2S A;  3QR5 A;  4ZFU B;  2APC A;  5C47 A;  1VZT A;  3OJ2 A;  2MZB A;  2L5X A;  1VGZ A;  2BFH A;  2ET2 A;  3IOH A;  3K1X A;  4AYJ A;  3CKN A;  1AVU A;  3W9T A;  2OEG A;  4EE5 A;  1DIW A;  1MP4 A;  1YTO A;  5B2H A;  2RJ8 A;  2WVM A;  5CMJ A;  4JP0 A;  4EE4 A;  3ZLK A;  2VLC A;  1MC3 A;  1VH3 A;  2RJ9 A;  4JD0 A;  1G93 A;  2O1H A;  1K5U A;  3O4C A;  1TIE A;  4QC4 A;  3ZX7 A;  1H5R B;  1H4D A;  5I1B A;  2PGV A;  2QKX A;  2IHO A;  1ZHJ A;  1H7Q A;  2RJ7 A;  3CRH A;  3FJE A;  2W0W A;  3CU0 A;  3EE5 A;  1R82 A;  3CA6 A;  2VXR A;  3WMU A;  2XWL A;  4JKQ A;  1ISW A;  1JT7 A;  2X60 A;  2YES A;  3T7M A;  3RTJ B;  3RSB A;  4I37 A;  2XWM A;  2DRY A;  2RJ1 A;  4M28 A;  1MC9 A;  4P0J A;  1Q04 A;  3I2A A;  1PZY B;  1FWY A;  1W3G A;  1O0R A;  3FJH A;  3V8Z A;  2YC3 A;  2AH9 A;  1WT0 A;  3JTJ A;  2ICY A;  5DDT A;  4QD2 C;  2LIQ A;  5C4F A;  5EG6 C;  1ILR 1;  1O23 B;  2I1B A;  3JRR A;  3NBD A;  3PNN A;  1V84 A;  4HO8 A;  3V0L A;  3FJJ A;  4ARW A;  1ZJO A;  4ZFW B;  3BRK X;  3OBR A;  4R6U B;  4ZFY B;  4ASY A;  2E4M C;  1FWU A;  1HCE A;  1W77 A;  4G6J A;  4FQW A;  1WBC A;  1W57 A;  3HL3 A;  3T7O A;  1S4O A;  3AKG A;  2VD4 A;  4Y7F A;  1HIB A;  5IDS A;  2Q4J A;  4DCK C;  2FO1 A;  4J18 A;  3N7J A;  1RG8 A;  4B4G A;  1M16 A;  4ZGR B;  5FTV A;  3I0J A;  3R4S A;  4ISR A;  2BO4 A;  2QGI A;  3SX7 A;  1IOB A;  4NAK A;  2P73 A;  4I4S A;  4Y7U A;  1FV2 A;  3JUT A;  4B4M A;  4HO9 A;  5BP5 A;  1VGU A;  4EEM A;  4HO0 A;  3BAV A;  1H3M A;  5D63 A;  5CQO A;  1DFQ A;  3I29 B;  2XOA A;  3AZV A;  1YP3 A;  3OC9 A;  5D62 A;  4AAW A;  1JLX A;  1S0E A;  3VT2 A;  4LO2 C;  41BI A;  8I1B A;  2GGQ A;  4GOV A;  2D20 A;  2VSH A;  4AYL A;  3LLP A;  2I5E A;  4LO2 A;  5CQM X;  2XMH A;  5CMI A;  3IM5 A;  2AM4 A;  3I2X A;  3SX5 A;  3BAH A;  1IIL A;  3I0C A;  2D22 A;  3Q7W A;  4LO3 C;  4QAL A;  1HM8 A;  2ERM A;  4FRE A;  4HR6 C;  4FRO A;  3F1R A;  2VS4 A;  3FUQ A;  1HJL A;  5D61 A;  4EB2 B;  1ZJ1 A;  1FR8 A;  3SX8 A;  4KQL A;  2PGY A;  2V0L A;  3ZF8 A;  3O4B A;  1IT0 A;  1SZ6 B;  1YF8 B;  4FRH A;  1ZJ2 A;  4FVV A;  5BOW A;  3IOJ A;  3CGX A;  4UEG A;  3FUO A;  1WD3 A;  3UDA A;  2JCK A;  5C1H A;  4KEJ A;  5C1G A;  3AZW A;  1Z2V A;  2K4A B;  5CQL X;  1I52 A;  3T7N A;  3EF2 A;  1GWW A;  1WT1 A;  3HAL A;  4Y6N A;  1OQL B;  3BRF A;  1HWO B;  4ZA3 B;  4D0T A;  5I1F A;  4L41 C;  3D8V A;  2RG9 B;  2KKI A;  31BI A;  1VM8 A;  1I1E A;  4X3A A;  3ZLL A;  2Y9G A;  1YP2 A;  3PG0 A;  3AKI A;  4I6I A;  4P0K A;  1Q1U A;  3FJC A;  1FXO A;  4HO4 A;  4KC1 A;  3NGW A;  1R7V A;  1JY0 A;  4Y9X A;  1W3F A;  1IJT A;  1FXJ A;  1G23 A;  2FYC B;  5DZU A;  5EJZ A;  1ZJ3 A;  5EJ1 A;  3Q7X A;  4J2S A;  2AGD A;  4HO6 A;  1W3A A;  5JMC A;  5FUH A;  1VZU A;  1FGA A;  4JKX B;  5F8Y A;  3WIN A;  1DZC A;  1V6X A;  2E3D A;  2I5K A;  2MIB A;  1ISV A;  3PME A;  1QWJ A;  1CE7 B;  4I4Q A;  1ZI3 A;  4KEK A;  2WAW A;  3VUO A;  2DS0 A;  4JPZ A;  5CQP A;  5AJN A;  4OW4 A;  1WD4 A;  3V90 A;  3A07 A;  1DFC A;  2K43 A;  3CQA A;  2P72 A;  4H04 A;  3E25 A;  3FJI A;  5CMF X;  1ISZ A;  1XZZ A;  2ZR1 B;  3RTI B;  3I0H A;  4AC3 A;  4DE7 A;  1BAS A;  1HWM B;  1F31 A;  4D48 A;  4Q91 A;  4ZOT A;  1G9C A;  3WO3 A;  4M2A A;  1OMZ A;  3UJ0 A;  2HW9 A;  4LO0 A;  1W55 A;  2O1G A;  3GUE A;  1PZZ A;  3VT1 A;  1XZ6 A;  3BB2 A;  3SNV A;  1QGS A;  2NXV A;  2RIT A;  2Z86 A;  3USQ A;  3USR A;  4OEG A;  1G9A A;  3D5N A;  2VXT I;  1DJS B;  3OKR A;  4HOC A;  4I4R A;  2HZ9 A;  2MC2 A;  3V0A A;  2Y9W C;  3TC2 A;  4FRM A;  3BA4 A;  1BFG A;  1FWV A;  1O7O A;  2O1F A;  3WO2 A;  1H5S C;  1RML A;  3IM7 A;  3I0E A;  4DDZ A;  4HCQ A;  2NTD A;  3AKF A;  3V0B A;  2Y4J A;  1PWA A;  1GWV A;  1H5S A;  2RIZ A;  1LL0 A;  3CA5 A;  1S0D A;  4FRB A;  1S0G A;  3MPP G;  1HM9 A;  2ZU8 A;  4P0L A;  4IQP A;  3U2U A;  3I0I X;  3V0P A;  1O7Q A;  5DUY A;  4Y7V A;  2VSE A;  4AN6 A;  4II0 A;  3POL A;  4I0Y A;  4L4I A;  2WVK A;  5C8R A;  4QD2 B;  4LO1 C;  4LW3 A;  1JQZ A;  1GQ9 A;  3TQD A;  2FFU A;  2AEC A;  3U2V A;  5C38 A;  4M4K A;  1V6U A;  4LO1 A;  1FO8 A;  1G8O A;  1NHE B;  5JQQ A;  5FZZ A;  5FV9 A;  5C4E A;  4EEO A;  1VH1 A;  3Q80 A;  1BA7 A;  3BA5 A;  3Q7Y A;  4F34 A;  3CRI A;  3V8Y A;  1Z0H A;  4GOY A;  5CQN X;  3O44 A;  3NJ5 A;  4Z9W B;  1NF5 B;  4QBV A;  4ECM A;  3PKP A;  9ILB A;  3VSZ A;  1QQK A;  4EEA A;  1CVS A;  5E24 E;  3K8E A;  3I0D A;  1NMM B;  1ON8 A;  1WSZ A;  2VXL A;  4CJC A;  4USO A;  1NKH B;  4DEN A;  4M2B A;  3P53 A;  1G97 A;  3O49 A;  5BXP A;  1JT5 A;  1BFF A;  1N4K A;  1G1L A;  4LO7 C;  1EVT A;  1YRO B;  3AJ6 A;  2P6W A;  1BFB A;  1S0C A;  3ZXD A;  1DQO A;  2M49 A;  4KC3 A;  2F2F C;  3WO4 A;  1LVW A;  2E4M A;  2GGO A;  4HO5 A;  3ST8 A;  3SPT A;  1GA8 A;  3BAG A;  4END A;  2F2F A;  4USP A;  3F1Y A;  1JV1 A;  3U0Y A;  5IDT A;  3R4U A;  1JT4 A;  4Z8S B;  4XWI A;  4BQH A;  2D1Z A;  1ZI1 A;  3DJ4 A;  4Y7G A;  1S0L A;  5FU0 A;  5C4B A;  3TZT A;  4GP0 A;  2AAI B;  1BLD A;  1WT3 A;  2ZU7 A;  3C9Z A;  4X39 A;  2YQS A;  2DRE A;  5C4C A;  4FGF A;  4Y6U A;  1FOA A;  2ICX A;  1AVA C;  3ZXG A;  4EFP A;  3KIA A;  3SXB A;  3V0O A;  3KMV A;  5AJO A;  1ONK B;  1ABR B;  1EPW A;  2V0J A;  4B5B A;  5FTS A;  4ION A;  4D8H A;  4CJ8 A;  3OJV A;  4KT7 A;  4I4U A;  2QH5 A;  5L6S A;  4FRA A;  4EEE B;  5L6V A;  3V91 A;  1TVY A;  3UD9 A;  4JRA A;  2FDB M;  4EVW A;  3A22 A;  4B4B A;  1EYR A;  3SXD A;  5BXC A;  2VS5 A;  1ZCU A;  3N9W A;  5BXT A;  2RJ0 A;  5C1L A;  1ON6 A;  1TW1 A;  1AXM A;  4LO3 A;  5C48 A;  1P63 A;  2WRY A;  3NBE A;  3BRD A;  3BAD A;  2NP0 A;  1BFC A;  3VSF A;  1Z4S A;  1G9B A;  2Z48 A;  3FJ8 A;  4I4P A;  5BXR A;  1VGT A;  4I2S A;  1GGP B;  3FJA A;  5BVP I;  4G3P A;  2LIE A;  1FZW A;  2FGF A;  3U2T A;  4IHZ A;  3CRG A;  1R8N A;  3BCV A;  1EZI A;  3O4A A;  2RJ4 A;  3OGZ A;  4QBC A;  4E1K A;  3E8L C;  3VEQ A;  1OQM B;  4L4H A;  2OEF A;  4GP3 A;  1HV9 A;  1ZIZ A;  2AFG A;  3LW6 A;  2WVL A;  3RMY A;  3QYD A;  2YQJ A;  3BTA A;  4NAI A;  3VWC A;  1VZX A;  2AE7 A;  1TWM A;  1V6W A;  3I0L A;  1LZI A;  1H5T A;  4AN7 B;  2Y9X E;  4KNR A;  1XG6 A;  4Y64 A;  4EEG A;  1HM0 A;  2DPW A;  1TFM B;  1K4V A;  3ILA A;  3CKV A;  3ZGG A;  5C36 A;  4P6A A;  3V0A B;  2YQC A;  1MD6 A;  2GO2 A;  4I1E A;  5DSS B;  1M2T B;  2NVH A;  4I7I A;  3OH3 A;  2F8X C;  4HO2 A;  3AJ5 A;  3OJM A;  3WMV A;  4B2W A;  1LL3 A;  2ZQN A;  3OH2 A;  3S8J A;  1R8O A;  1YBI A;  3P6J A;  3V0B B;  1WT2 A;  4ZDQ A;  1TP0 A;  4EFR A;  1HJJ A;  1H5S B;  4H9W A;  3OAM A;  2ESU A;  1INJ A;  1UPS A;  2VXM A;  2BEA A;  1T9F A;  2QYI B;  4XFS A;  4XKI A;  3D98 A;  4KEI A;  3U0X A;  4G6M A;  2FYD B;  1IIN A;  3HOM A;  4G9N A;  3O5W B;  2VSI A;  1EYL A;  1QQL A;  3FJD A;  3LTQ A;  3OH1 A;  5GAQ A;  4A7Y A;  3H6S E;  2Y6P A;  3NBC A;  4X38 A;  4NAN A;  4IRP A;  1JVD A;  1H7H A;  3RMV A;  3ZC8 A;  3FOQ A;  1PUU B;  3JUJ A;  3CKQ A;  1ZJP A;  1LL2 A;  1H7F A;  2V0K A;  1G0R A;  4Y62 A;  5F90 A;  1YP4 A;  4I96 A;  1ISY A;  4EFQ A;  4FCE A;  1RZO B;  2D24 A;  2D7R A;  3H6R A;  1JLY A;  3OGF A;  2A8W A;  1QXM A;  5FZY A;  2JCL A;  2K8R A;  4J23 B;  2VSA A;  4XFU A;  1R7U A;  2OI7 A;  4HG6 A;  3B9U A;  2BEB A;  3DUV A;  4KC4 A;  4P00 A;  4R7P A;  5IFY A;  2Z49 A;  5CMH A;  1DLL A;  2Q3N B;  3FJ9 A;  4TLP A;  1TW5 A;  5BXS A;  3O4D A;  4I4V A;  2KH2 A;  3F1C A;  2PX7 A;  4D0Z A;  4GAI A;  1IHK A;  4I4O A;  5EHA A;  3V79 C;  3Q7U A;  4KRV A;  2E8B A;  3OH4 A;  2QN4 A;  1PC8 B;  3A21 A;  4HA2 A;  3CAH A;  1R7Y A;  4QKS A;  4LO7 B;  4QKR A;  4G3Q A;  1G9R A;  1DZD A;  3BX1 C;  1VGW A;  3CA4 A;  2X5S A;  3U2X A;  1PZT A;  3UD8 A;  4MYB A;  3V0N A;  5EIY A;  4Q9G A;  2VU9 A;  1XYF A;  4LO8 B;  3WA1 A;  1D0H A;  1RY7 A;  1I1B A;  2NZ9 A;  1YXW A;  2X2T A;  3UJ4 A;  4JIS A;  3V0Q A;  1FV3 A;  2P23 A;  1FMZ A;  2PA4 A;  1JV3 A;  3A23 A;  1LZ0 A;  3ZC9 A;  4B2X A;  1ZDF A;  1AVX B;  2D44 A;  2RIX A;  2FY7 A;  1BAR A;  1V6V A;  4KPX A;  1NUN A;  1S4P A;  1H4E A;  4X37 A;  2YC5 A;  3FFZ A;  4XFT A;  5HS2 A;  1IRP A;  2R9K B;  2RJ5 A;  4P02 A;  1HCD A;  4ISQ A;  2XME A;  4B42 A;  1NQI B;  2AM3 A;  4FRL A;  1H4C A;  2I7B A;  2IWT B;  2Y4M A;  2VUA A;  1ZDG A;  2V0I A;  3PHZ A;  4ZLB B;  2UX8 A;  3FGM A;  3S8K A;  1IIM A;  1VPA A;  1H7G A;  3SXG A;  3IOI A;  1K5V A;  3FJB A;  1ITB A;  1HWN B;  3BAU A;  1XHB A;  3F62 B;  4JQ0 A;  1QG8 A;  2X5Z A;  4OWJ A;  1OMX A;  3O3P A;  2WGZ A;  3OBT A;  5C3D A;  5FNX A;  2WE9 A;  1G2V A;  1JTC A;  5F8W A; 
#chains in the Genus database with same CATH topology
 2JY5 A;  3R2W A;  5C3B A;  3TPZ A;  3KFU G;  5JLV A;  3UD7 A;  4Q9P A;  1WHC A;  2OPF A;  1JQJ C;  4GAF A;  1TOO A;  3UGJ A;  1FO9 A;  4F83 A;  2J3P A;  2HHH M;  4A3V B;  1H7E A;  2JY8 A;  1NV9 A;  2DNA A;  1QAO A;  4FCT A;  2Y4K A;  3DOA A;  3K9P A;  3NBN A;  4XK8 F;  3FE3 A;  3W68 A;  4I5S A;  1ZCY A;  1NSF A;  1Z90 A;  2X65 A;  1ZV1 A;  4LW6 A;  2EKK A;  2KRK A;  3N0K A;  4Z8X A;  1ZMV A;  5DDV A;  4PC4 A;  3QVB A;  1MP5 A;  1AVW B;  1GL6 A;  3I51 A;  1G9D A;  1ZI4 A;  4OWL A;  2Y7A A;  2HL7 A;  1ZI5 A;  1E5K A;  2ZQO A;  4KNX A;  1HKN A;  1DQG A;  5FU8 A;  4B7H A;  1Q03 A;  2Y0T A;  21BI A;  1K3W A;  1LZ7 A;  3GRY A;  4DEC A;  3CF6 E;  5FYE A;  4OUJ A;  4RKU F;  3I01 M;  1L2B A;  4BB9 A;  1EV2 A;  2Y9F A;  3I4V A;  4HJJ A;  4NAL A;  2JZ0 A;  3GRV A;  4B3U A;  3RMX A;  1J09 A;  4L6V 6;  4NSO B;  1HQY E;  3N7K A;  4IYB A;  3BAO A;  2RIY A;  1LZJ A;  3HZJ A;  2QCU A;  3O3Q A;  1SG9 A;  3SFZ A;  2DRZ A;  4OEF A;  3OTO M;  1QQW A;  3RFW A;  1FR9 A;  3HN1 A;  4MGH A;  2DZO B;  1NZK A;  4LF8 M;  3AKH A;  4GIT A;  4X64 M;  3KSX A;  3KOZ E;  4LO0 C;  4ASJ A;  4FRQ A;  2O25 A;  4LFC M;  1T43 A;  2NQ8 C;  4KPZ A;  4M9X A;  1E0O A;  2LVN C;  2Z87 A;  4D11 A;  2YQH A;  1QDR A;  4IBB A;  3KS8 A;  2D7H A;  2Q9X A;  5C4D A;  3GQ4 A;  2JCO A;  2NM1 A;  3Q4S A;  5KPR A;  3L28 A;  3J7A S;  3EIE A;  4ZKT B;  5C36 A;  1H5S D;  3I0G A;  5C47 A;  1PM5 A;  2L5X A;  2BFH A;  3K1X A;  2XSZ D;  1NNJ A;  2R4J A;  1AVU A;  1DIW A;  1MP4 A;  5B2H A;  5CMJ A;  4JD0 A;  1G93 A;  1K5U A;  3O4C A;  5FTJ A;  1H4D A;  2PGV A;  2W0W A;  3CRH A;  3QYB A;  3CA6 A;  2VXR A;  2XWL A;  4JKQ A;  3NWL A;  3RSB A;  4I37 A;  2RJ1 A;  4M28 A;  2B3T A;  1C1K A;  4IBJ A;  1HQC A;  1O0R A;  3FJH A;  2CHV A;  2I1B A;  3JRR A;  4HO8 A;  5ITX E;  1ZJO A;  5H37 D;  2KNA A;  1HCE A;  1W5S A;  1LV7 A;  3HL3 A;  4G6Z A;  1S4O A;  3FKE A;  5IDS A;  4J18 A;  4B4G A;  4P16 A;  3WHK A;  3D8B A;  4M9S A;  4ISR A;  2QGI A;  1XXH A;  2QBY A;  1IOB A;  4DUZ M;  1C7Y A;  2CRU A;  3VDP A;  3OC9 A;  3FUU A;  2ZAM A;  3VT2 A;  41BI A;  2GGQ A;  4LO2 A;  2XMH A;  2AM4 A;  1T3T A;  1AIP C;  3Q7W A;  1HM8 A;  4D80 A;  4HR6 C;  2VS4 A;  1WXQ A;  1FR8 A;  4KQL A;  2PGY A;  5KPZ A;  1HT1 E;  1N77 A;  1V92 A;  4FVV A;  4UEG A;  1TDH A;  5C1H A;  5FLX S;  4NL4 H;  1GWW A;  4Y6N A;  4F2L A;  4LJ9 A;  1HWO B;  2RG9 B;  31BI A;  2LVA A;  4L78 A;  4X3A A;  3AKI A;  4P0K A;  1JY0 A;  4Y9X A;  1IJT A;  2V1U A;  4J2S A;  5FTK A;  2MIB A;  2XFS A;  3SAU A;  4R71 A;  3TWK A;  5CQP A;  3VUO A;  3IEC A;  1L2D A;  2QP9 X;  2J0A A;  1P3Q Q;  1DFC A;  2K43 A;  3E25 A;  4X62 M;  5CMF X;  1ISZ A;  1XZZ A;  4Q91 A;  3WO3 A;  4M2A A;  4EE4 A;  4LO0 A;  2DVW B;  2O1G A;  3USR A;  3NBI A;  3D5N A;  2VXT I;  1DJS B;  3TC2 A;  4KT0 F;  4DDZ A;  3WO2 A;  1NJF A;  2C99 A;  2Y4J A;  2K0B X;  1H5S A;  2RIZ A;  1S0D A;  4FRB A;  3L29 A;  2XSZ A;  4IQP A;  5DUY A;  5C8R A;  4II0 A;  4L4I A;  4QD2 B;  1PJS A;  1YUB A;  4LW3 A;  1JQZ A;  4KLN A;  1ZMW A;  2KZU A;  4GKJ M;  4LO1 A;  1FO8 A;  1G8O A;  1NHE B;  1W5T A;  5FZZ A;  1Q39 A;  2O01 F;  4EEO A;  4JI0 M;  1IFY A;  1UM8 A;  3V8Y A;  4DUY M;  2V6Z M;  5CQN X;  3RGP A;  3U6S A;  3NJ5 A;  4Z9W B;  1Z5C A;  4QBV A;  4ECM A;  2F5O A;  1XXH B;  2QBY B;  3UJN A;  1NMM B;  2JUJ A;  5GKN A;  3P53 A;  4FCV A;  3SYL A;  3ZC7 B;  4AQY M;  1G97 A;  4L4U A;  1BFF A;  4LO7 C;  1YRO B;  2JZ1 A;  3U60 A;  3ZXD A;  1DQO A;  4END A;  4XWI A;  4MGZ E;  5C4B A;  5FU0 A;  4CGY B;  5JI2 E;  2AAI B;  1QAN A;  4FGF A;  3U6L A;  3ZXG A;  5AJO A;  1ONK B;  1ZAE A;  4MZF B;  2DAK A;  4B5B A;  3OJV A;  4I4U A;  4DR3 M;  2C96 A;  3BOS A;  4JRA A;  4NRW A;  4O6N A;  1IN7 A;  4B4B A;  1ZCU A;  1IN5 A;  1TW1 A;  3MK6 A;  1OFH A;  7CAT A;  4BBA A;  2VK9 A;  3VSF A;  5DFL A;  1Z4S A;  2ZM6 M;  2Z48 A;  4X65 M;  5BXR A;  3DA1 A;  4GHA A;  4LG2 A;  1VGT A;  2LHG A;  3PVS A;  3FJA A;  2LIE A;  4IHZ A;  3CRG A;  2QNJ A;  4E1K A;  3O4A A;  4QOZ C;  2RJ4 A;  3E8L C;  1ZIZ A;  2WVL A;  3QYD A;  3ZH9 B;  3VK7 A;  3C3E A;  3VWC A;  1N75 A;  1V6W A;  5ITX A;  3EIH A;  3CKV A;  1TFM B;  1K4V A;  3ILA A;  3U6O A;  1L1Z A;  2GO2 A;  4I1E A;  5DSS B;  4I7I A;  2NVH A;  4B2W A;  3PNY A;  4KHP M;  3OH2 A;  1H5S B;  4D81 A;  2ESU A;  3HGI A;  5E6J A;  1TR8 A;  3C9P A;  3IG8 A;  4XFS A;  4XKI A;  3U0X A;  4G6M A;  3VDU A;  1IIN A;  4G9N A;  2A5Y B;  3NBC A;  2L4E A;  1IN4 A;  2KA6 B;  1G0R A;  2G3Q A;  1TTE A;  5FZY A;  4DR1 M;  2K8R A;  4XFU A;  4P00 A;  4R7P A;  5IFY A;  5CMH A;  1GAB A;  2Q3N B;  1JR3 E;  3O4D A;  1D0L A;  4H75 A;  4B3M M;  3WHL A;  4D0Z A;  4I4O A;  5EHA A;  4KRV A;  3U60 B;  2QN4 A;  4XGI A;  1NJG A;  4HA2 A;  1R7Y A;  4QKS A;  4G3Q A;  1VGW A;  4MYB A;  3V0N A;  1XYF A;  1YXW A;  1FMZ A;  1JV3 A;  3AL0 C;  1ZDF A;  2RIX A;  1NUN A;  1H4E A;  2YFQ A;  4XFT A;  1IRP A;  4B42 A;  2DAM A;  5IRE B;  1H4C A;  2I7B A;  2IWT B;  2V0I A;  3BXW A;  2UX8 A;  3S8K A;  4DR7 M;  1IBK M;  3KOW E;  1H7G A;  1K5V A;  1ITB A;  1HWN B;  2XF3 A;  3O3P A;  1OMX A;  3M7G A;  3OBT A;  4ITQ A;  1JTC A;  3KXE C;  4MGK E;  2D23 A;  2EKF A;  4KO8 A;  1R7X A;  2KLL A;  1IN8 A;  3CA3 A;  5DVH A;  4YY3 M;  1GQC A;  3VLF B;  4PDI A;  3BRG C;  3CA1 A;  4QNR A;  3LCU A;  3N7M A;  2H1R A;  1IXR C;  4IZX A;  4Y7F A;  1KWS A;  1ZJ0 A;  4Y63 A;  3K8D A;  4MB7 A;  1GKI A;  3PUB A;  4M0D A;  4YS8 A;  3SXE A;  2KW0 A;  4A7Z A;  1GX0 A;  2AHM A;  1ZCT A;  4I3N A;  5C3A A;  1R81 A;  1EFU B;  4EE3 A;  4W5W A;  1NY6 A;  5KQD A;  2XLJ A;  1L2H A;  2HWM A;  1ZMU A;  3MAL A;  4FCU A;  1SR4 A;  4WP2 A;  1VIC A;  1IRA X;  2BO8 A;  3HMY A;  4EVW A;  5BPV A;  5JI3 E;  1WR1 B;  1FJG M;  1G3L A;  2DWN A;  1SXJ E;  1INI A;  4DV1 M;  5G00 A;  3R8F A;  3N7L A;  1NHW C;  1WVC A;  1Z5A A;  2MR9 A;  1ZCV A;  2FNA A;  4IZE A;  5L8R F;  4G4Q A;  3JR5 A;  1FGG A;  4FRP A;  3SHG B;  4A7K A;  4CVH A;  1V83 A;  2NYY A;  3HHZ A;  1A8D A;  1Y8G A;  1AUA A;  3C58 A;  5HPZ A;  2BO7 A;  2KRU A;  3FRH A;  1V82 A;  1E94 E;  2EJS A;  2Y4L A;  6I1B A;  4J2K A;  4FIY A;  4Y7T A;  2NS2 A;  1H7L A;  1S4N A;  1QDT A;  2RRU A;  1JYK A;  3VT0 A;  3OGG A;  3CF0 A;  5D91 A;  3RMW A;  1RU3 A;  2HCB A;  4D11 C;  3LCV B;  1TZF A;  1FGX A;  2OI5 A;  3HSM A;  1QVR A;  1I94 M;  1FQ9 A;  4AZF A;  4HO3 A;  4G87 A;  4I81 A;  3AH2 A;  1E32 A;  3FUX A;  3TE6 A;  2XWN A;  4C2S A;  3LVV A;  3RSJ A;  1FMM S;  3I0K A;  2KDL A;  1IBL M;  2X2S A;  3QR5 A;  2APC A;  3OJ2 A;  1VGZ A;  2ET2 A;  3IOH A;  3ILK A;  4AYJ A;  3KOY E;  3W9T A;  2LXE A;  2WVM A;  2RJ8 A;  3GPP A;  3E21 A;  1XB2 B;  2RJ9 A;  1VH3 A;  1G71 A;  4QC4 A;  2IHO A;  3CU0 A;  5EXS A;  4FWG A;  1ISW A;  2Z8Y M;  5EP2 A;  2X60 A;  2YES A;  3A42 A;  4D82 A;  1OKS A;  4P0J A;  2F5N A;  4IBD A;  1FWY A;  1W3G A;  5DDT A;  1WT0 A;  2WZJ A;  2XFT A;  4LJ8 A;  2LIQ A;  4QD2 C;  5EG6 C;  2D7G A;  5DNY A;  3PNN A;  1V84 A;  2Q2E B;  4ZFW B;  3OBR A;  4R6U B;  1W77 A;  4G6J A;  4CIZ A;  3K1J A;  5ITR A;  2J5Y A;  2Q4J A;  2FO1 A;  2I7P A;  3L27 A;  2EA0 A;  2BO4 A;  3M0E A;  4B3S M;  4NAK A;  4WUR A;  4HO0 A;  3BAV A;  5CQO A;  5D63 A;  2LNH C;  3HKP A;  2MGW A;  1JR3 A;  5D62 A;  1JLX A;  4LO2 C;  3LQR A;  2RKO A;  2H5X A;  2I5E A;  4CIS A;  3B74 A;  3FD9 A;  5CMI A;  3I2X A;  3BAH A;  1IIL A;  3I0C A;  3DZD A;  2D22 A;  2ERM A;  1KYI A;  3SX8 A;  4DV3 M;  1Z5B A;  3K9O A;  1IT0 A;  4TUW A;  1SZ6 B;  1YF8 B;  1ZJ2 A;  1PRB A;  3FUO A;  4KEJ A;  3HX3 A;  3AZW A;  4M0W A;  3R9X B;  5CQL X;  3T7N A;  1N33 M;  3EF2 A;  1OQL B;  3BRF A;  5I1F A;  4IBF A;  2Y20 A;  1VM8 A;  3AOG A;  2Y9G A;  1Q1U A;  4HO4 A;  4KC1 A;  1R7V A;  2XEP A;  2FYC B;  5DZU A;  5EJZ A;  1ZJ3 A;  5FUH A;  2AGD A;  1ORY B;  2I5K A;  4FCW A;  1QWJ A;  1ZI3 A;  2WAW A;  4JPZ A;  5AJN A;  4OW4 A;  1WD4 A;  3VKG A;  2P72 A;  3FJI A;  3RTI B;  3SC3 A;  2XZU A;  4D48 A;  1OMZ A;  4GEW A;  4F1I A;  2HW9 A;  3TZT A;  1XZ6 A;  3UK6 A;  1TF0 B;  3BB2 A;  2RIT A;  2M60 A;  3USQ A;  4GKK M;  3OKR A;  4HOC A;  2HZ9 A;  4MGY E;  2QPA A;  2VQF M;  3LMM A;  4FRM A;  1BFG A;  1A5T A;  1H5S C;  1RML A;  3IM7 A;  1GWV A;  4AI6 A;  1LL0 A;  4MM3 B;  4S12 A;  1S0G A;  1HM9 A;  4P0L A;  4G4O A;  3HWS A;  1O7Q A;  4IBI A;  3A45 A;  4LO1 C;  3V76 A;  1IY0 A;  1V6U A;  5JQQ A;  1SXJ A;  2W82 A;  5C4E A;  1VH1 A;  2KXE A;  1BA7 A;  3Q7Y A;  4GOY A;  3GO8 A;  3O44 A;  3PKP A;  3VSZ A;  1CVS A;  3AOE A;  3O49 A;  4RF1 A;  3B9P A;  2P6W A;  1S0C A;  2M49 A;  2E5L M;  4QOS A;  2GGO A;  3SAV A;  3SPT A;  3BAG A;  4IBC A;  3MJ5 A;  4R7G A;  1G41 A;  1JT4 A;  4Z8S B;  2ERC A;  4Y7G A;  1ZI1 A;  2JY7 A;  1S0L A;  4GP0 A;  3FUT A;  1WT3 A;  2ZU7 A;  3C9Z A;  4B08 A;  2YQS A;  4Y6U A;  1NV8 A;  4EFP A;  3KIA A;  3V0O A;  3KMV A;  4LJ5 A;  3VK8 A;  2V0J A;  1H6U A;  4ION A;  4KT7 A;  2QH5 A;  5LMN M;  1Q3C A;  3GLI A;  5C1L A;  1ON6 A;  3BRD A;  3BAD A;  2DHR A;  2UXC M;  1BFC A;  1G9B A;  3TWL A;  1IXZ A;  4NC6 A;  2R65 A;  2VII A;  1XC8 A;  4G3P A;  3CGW A;  1R2Z A;  5C18 A;  1R8N A;  3GPU A;  1EZI A;  3VEQ A;  1OQM B;  1IY1 A;  2ZTC A;  4QHS A;  4NXN M;  3RMY A;  2YQJ A;  2O5R A;  3GPX A;  4FWD A;  2DZL A;  3I0L A;  2CE7 A;  3UZU A;  2LVP C;  1HM0 A;  1WIV A;  3ZGG A;  2YQC A;  1MD6 A;  2F5P A;  1M2T B;  4PD2 A;  2F8X C;  3AJ5 A;  3OJM A;  3WMV A;  1D0M A;  1NO1 A;  4ZDQ A;  2FOI C;  3P6J A;  1WT2 A;  1HJJ A;  4H9W A;  3OAM A;  2WSE F;  4CHT B;  3LQQ A;  2VXM A;  2BEA A;  3D98 A;  4LRT A;  2R62 A;  1IXS A;  3QAU A;  4LJ6 A;  3HOM A;  3O5W B;  1QQL A;  5FTN A;  4GRI A;  2Y6P A;  1WJ7 A;  2QQ8 A;  4X38 A;  1OIP A;  1SXJ B;  1LL2 A;  4I8O A;  1H7F A;  2V0K A;  4GC9 A;  3KOX E;  5F90 A;  3FYD A;  2UUC M;  4FCE A;  4DV2 M;  1JLY A;  4IIW A;  2FH0 A;  2VSA A;  5C38 A;  3J27 B;  2BEB A;  3Q8X A;  1DLL A;  3FJ9 A;  4TLP A;  2KH2 A;  3KW6 A;  4RNA A;  2CV0 A;  3SBJ A;  1PC8 B;  3CAH A;  2JWS A;  1G9R A;  3CA4 A;  2X5S A;  4Q9G A;  2VU9 A;  4LO8 B;  1I1B A;  1TH3 A;  2X2T A;  1QZM A;  1FV3 A;  2PA4 A;  3KSJ A;  4B2X A;  4M9Z A;  1BAR A;  3GLH E;  4FVM A;  5DYI A;  1G8P A;  3B7Z A;  3CF2 A;  2XME A;  4ISQ A;  2JY6 B;  3KP0 E;  4ZPX A;  1G3I A;  4Y28 F;  3KP1 E;  2C5R A;  1D2N A;  2VUA A;  4GMQ A;  2QSF X;  4MIX A;  2MRO B;  3W0L B;  1XNR M;  3MHV C;  3ZCB B;  3GLI B;  3FJB A;  3BAU A;  2X5Z A;  1QG8 A;  2OOB A;  3B89 A;  5F3W A;  2DKL A;  2WGZ A;  1LTM A;  3TL4 X;  2Z7J A;  1MP3 A;  1J7K A;  1T4Q A;  1DGH A;  5FNW A;  4YOL A;  2UUA M;  1GVN A;  1AFC A;  4FD2 A;  4OW0 A;  2AM5 A;  5BP5 C;  2CU2 A;  1SS9 A;  4G9M A;  2RJ6 A;  5FZU A;  1WBA A;  4EKX B;  1HNX M;  2CP8 A;  1AF9 A;  3V0M A;  1IY2 A;  2AXM A;  4ZBV B;  2DEN A;  5AJP A;  3MMP A;  5D92 A;  3FWW A;  1S0B A;  2OI6 A;  1FN0 A;  4J2X A;  3PKQ A;  3SXA A;  1FRW A;  3IM6 A;  1YLA A;  1R5L A;  1SR4 C;  3POK A;  3RGS A;  3R3I A;  5C49 A;  3K92 A;  3BAQ A;  3KDS E;  3FJK A;  1XNQ M;  1KNM A;  7I1B A;  2D7I A;  1NHG C;  1IXS B;  3HY5 A;  3THG A;  1MJG M;  3D7W B;  2Y21 A;  1QAQ A;  4G3S A;  1TTU A;  4G4N A;  1DO2 A;  1VEJ A;  1QGQ A;  3J80 S;  2FYA A;  2JCJ A;  4UN2 B;  2FFV A;  4JI8 M;  1XWI A;  5BQU A;  2ZTD A;  3AH4 A;  3WIN C;  3SX3 A;  1DGG A;  4IJF A;  4LGM A;  1ISX A;  3DK5 A;  4I8M A;  2LTU A;  3FUV A;  1Q02 A;  5IT9 S;  3FJF A;  1JYL A;  2WEE A;  4FRD A;  4NSR A;  1II4 A;  2ZBK B;  4OEE A;  1R7T A;  3FUW A;  4R3D A;  2D0J A;  2VS3 A;  3GQ5 A;  4DEP A;  2XZF A;  3H6Q A;  3JAM S;  3GLF A;  2D43 A;  4Z6Y A;  1N36 M;  1TWE A;  3P6I A;  3T8S A;  4OWK A;  1FG5 N;  1QZE A;  1H7T A;  5EC5 A;  1OIZ A;  4LJ4 A;  1NNU C;  3AH1 A;  2JXN A;  3ZQJ A;  1WGL A;  2GZB A;  1VDD A;  4KC2 A;  4K6R A;  3IIR A;  3U6Q A;  1PUM B;  1S0F A;  4GBP A;  3CKJ A;  3BA7 A;  3TQS A;  4LZZ A;  3PXG A;  1JB0 F;  1VZT A;  2OEG A;  1YTO A;  3HHY A;  4JP0 A;  1MC3 A;  3QWL A;  1IQP A;  2UXB M;  3ZX7 A;  2QKX A;  1ZHJ A;  1KSF X;  3FJE A;  2JNH A;  3EE5 A;  2VF8 A;  1DGH B;  3WMU A;  1VG5 A;  2VF7 A;  1XMO M;  3T7M A;  5EP3 A;  2XWM A;  3A46 A;  1Q04 A;  4OX9 M;  2AH9 A;  4DR2 M;  2ICY A;  5C4F A;  3T1Y M;  3NBD A;  3B7Q A;  4ARW A;  5ITT A;  5BR8 M;  3PNV A;  4ASY A;  1FWU A;  4LFB M;  1WBC A;  2RGH A;  3AKG A;  1HIB A;  2C9O A;  2DXI A;  2V1C A;  2WSC F;  3I04 M;  1PJJ A;  2MH8 A;  2OO9 A;  4ZGR B;  1KFV A;  3I0J A;  3R4S A;  3SX7 A;  2DWL A;  2P73 A;  1FV2 A;  2R0I A;  3JUT A;  5BP5 A;  4EEM A;  1H3M A;  1DFQ A;  2XOA A;  3AZV A;  4NRV A;  2YNM D;  2ZAO A;  4GOV A;  2D20 A;  4AYL A;  5CQM X;  1TDZ A;  3SHF A;  3SX5 A;  1L1T A;  2CHQ A;  4QAL A;  3U6P A;  4FRE A;  4FRO A;  1HJL A;  4EB2 B;  2V0L A;  4L15 A;  1EIJ A;  3IOJ A;  3CGX A;  1HNZ M;  1Z2V A;  2K4A B;  1I52 A;  3GLH A;  3HAL A;  1YSY A;  2K6B A;  3KVW A;  4L41 C;  3D8V A;  2L6O A;  4NXM M;  2OOA A;  2KKI A;  1I1E A;  2BWE A;  2YQZ A;  3ZLL A;  1FXO A;  3FJC A;  3HJQ A;  3LVW A;  3L2A A;  3NGW A;  3HJ8 A;  1FNN A;  1W3F A;  1FXJ A;  1G23 A;  2QEN A;  3Q7X A;  4HO6 A;  3UMM A;  2KEB A;  4MGI E;  3WIN A;  2E3D A;  1V6X A;  3HU2 A;  3PME A;  1CE7 B;  3K8Z A;  4I4Q A;  4BLC A;  2DS0 A;  4DR5 M;  2LH0 A;  2XGN A;  4PCZ A;  1N78 A;  1OQY A;  1V33 A;  1X37 A;  2I7N A;  4AC3 A;  1BAS A;  3BBZ A;  4REZ A;  1HWM B;  1F31 A;  4ZOT A;  2OQ4 A;  1W55 A;  2FE8 A;  2GNO A;  1PZZ A;  3VT1 A;  2Z86 A;  3SNV A;  1QGS A;  2NXV A;  3U6D A;  4OEG A;  1G9A A;  4OU7 A;  2JP7 A;  4I4R A;  3V0A A;  2MC2 A;  3JR4 A;  2O1F A;  2APL A;  1HR0 M;  4HCQ A;  3AKF A;  3FTF A;  3GLI E;  4GH9 A;  1R4G A;  2ZU8 A;  3U2U A;  3I0I X;  3V0P A;  2VSE A;  3POL A;  4I0Y A;  3FRI A;  1I4W A;  1SXJ C;  2EUC A;  1V34 A;  1GQ9 A;  4AKI A;  2FFU A;  2AEC A;  4LF5 M;  4M4K A;  5FV9 A;  2VQE M;  4LF6 M;  3Q80 A;  3BA5 A;  2YR0 A;  4F34 A;  1DGB A;  2FS1 A;  2BJW A;  1GL7 A;  2L7I A;  1NF5 B;  4YHH M;  1CUK A;  3AOE C;  3K8E A;  1WSZ A;  4CJC A;  4USO A;  2UU9 M;  3A98 B;  1N4K A;  2J7N A;  1EVT A;  3AJ6 A;  1BFB A;  4KC3 A;  3T6P A;  1N32 M;  3ST8 A;  4IJE A;  2RGO A;  2F2F A;  2R46 A;  4USP A;  3F1Y A;  4G3O A;  3U0Y A;  5IDT A;  4LCB A;  3T38 A;  3SAR A;  1Z59 A;  4Q7J A;  3DJ4 A;  4JYA M;  1BLD A;  2DRE A;  1MN3 A;  3W67 A;  2ICX A;  4JI4 M;  4GC5 A;  2DAE A;  1ABR B;  1MU5 A;  3GLH B;  5FTS A;  2LWX A;  4CJ8 A;  5L6S A;  1QYR A;  4EEE B;  4O6M A;  3FTE A;  3UD9 A;  1HT2 E;  2FDB M;  2DI0 A;  3DFZ A;  1EYR A;  5BXC A;  4DV7 M;  2F5S A;  5BXT A;  2RJ0 A;  1AXM A;  1P63 A;  1BVS A;  2NP0 A;  1XMQ M;  3FJ8 A;  4JI3 M;  3E46 A;  3VFD A;  4I2S A;  1GGP B;  2FGF A;  4HEO A;  4DV4 M;  3GRU A;  4QBC A;  4L4H A;  2OEF A;  4GP3 A;  1HV9 A;  1OAO C;  2CV2 A;  3LW6 A;  3GLG E;  4B3R M;  4NAI A;  2AE7 A;  1VZX A;  1TWM A;  3AV0 A;  4LY6 A;  1H5T A;  3M6A A;  1XG6 A;  1J5E M;  4B7F A;  2DPW A;  3V0A B;  1GO5 A;  2BNK A;  4DV0 M;  3OH3 A;  4HO2 A;  3AJI B;  1LL3 A;  1R8O A;  1PJT A;  1TP0 A;  8CAT A;  2G5G X;  3HJS A;  3RE8 A;  2QYI B;  2X49 A;  2HWJ A;  1GJT A;  2FYD B;  2VSI A;  1EYL A;  3LTQ A;  5GAQ A;  4A7Y A;  3H6S E;  1E9R A;  4NAN A;  3HHW A;  3RMV A;  3ZC8 A;  5LMU M;  3JUJ A;  3CKQ A;  1ZJP A;  4I96 A;  1IM2 A;  2A8W A;  3H6R A;  4DR4 M;  3OGF A;  1QXM A;  4FWH A;  4J23 B;  1S3S A;  1R7U A;  2OI7 A;  3B9U A;  5E26 A;  5FTM A;  3U6C A;  2Z49 A;  3F1C A;  2KNV A;  2PX7 A;  1VEK A;  4GAI A;  1IHK A;  3Q7U A;  3V79 C;  3SAW A;  1R6B X;  1DZD A;  4X66 M;  3BX1 C;  2QHO B;  3U2X A;  2WSF F;  1PZT A;  5EIY A;  1VEG A;  2K9D A;  3WA1 A;  1PJQ A;  2NZ9 A;  3V0Q A;  4JI6 M;  2P23 A;  4MZH A;  4AKH A;  3ZC9 A;  4LF7 M;  2D44 A;  3J2P B;  4KPX A;  1NVM A;  3FFZ A;  1PJI A;  5HS2 A;  3SAT A;  1DO0 A;  1GJS A;  2AM3 A;  2LBC A;  4FRL A;  4JV5 M;  3PHZ A;  4ZLB B;  2ZAN A;  1VPA A;  1IIM A;  3SXG A;  2CFO A;  3F62 B;  1XHB A;  4JQ0 A;  2Z4R A;  4NOO B;  2R4E A;  1WGN A;  2YUG A;  2A8U A;  2W0V A;  1H5R A;  1G4A E;  4BMA A;  1TH2 A;  1DV0 A;  3O4O A;  2UUS A;  4EIW A;  1BLA A;  1OJL A;  3E26 A;  4QO3 A;  4WW0 A;  1G95 A;  3GLF E;  2DAI A;  4ANR A;  4IY8 A;  4MZG B;  2HKJ A;  4B3T M;  4MND A;  2AES A;  2DWZ B;  4MH0 E;  2AQZ A;  3SMS A;  1F4I A;  1H5T B;  2HWA A;  4I4X A;  4IBE A;  2KHH A;  1HNW M;  4UY4 A;  3SMP A;  3I0F A;  4OVZ A;  3U2W A;  4KBB A;  2M5Z A;  3FTC A;  2F5Q A;  1JVG A;  2LVO C;  3E9S A;  2BO6 A;  4JI2 M;  3V91 A;  3T7O A;  3HBW A;  2CHG A;  1YYN A;  1L2C A;  1GX4 A;  1G82 A;  1UFZ A;  5EQT A;  2KI6 B;  3T1H M;  1NWG B;  2L09 A;  1HJP A;  3E4R A;  3U61 A;  1HWP B;  4JN6 A;  5BQU C;  4KXO A;  4WBC A;  4IY9 A;  3H6R B;  1JT3 A;  3ZGF A;  4I4Y A;  1R80 A;  3CKO A;  5KQ8 A;  2MLL B;  5CMG X;  4IRQ A;  1E9S A;  3IAG C;  3CTW B;  2WBC A;  2VFZ A;  4LF9 M;  4LRS A;  3LW5 F;  4CJM A;  2FFJ A;  2F4V M;  4CJB A;  5J49 A;  4J2Y A;  3JUK A;  4JAW A;  1QUS A;  2D7E A;  3CA0 A;  2FYB A;  2GQF A;  3L26 A;  2LVQ D;  2YCM A;  4FIX A;  1J0S A;  4G1R A;  5F8S A;  2RST A;  4AG6 A;  4AW4 A;  2RQ9 A;  1TH4 A;  1VCL A;  3TWM A;  2KI4 A;  2ZU9 A;  4DR6 M;  4I1B A;  2P39 A;  3CU1 B;  2V0H A;  3TQD A;  3K2L A;  2BJV A;  4ZFU B;  3KS4 A;  2MZB A;  2K47 A;  3CKN A;  4EE5 A;  3GLG A;  3NBX X;  3ZLK A;  2VLC A;  3T15 A;  2HAK A;  2O1H A;  1TIE A;  1H5R B;  5I1B A;  2RJ7 A;  3SXC A;  1H7Q A;  4HLQ A;  1R82 A;  5EXT A;  1JT7 A;  3RTJ B;  4G4R A;  2L2D A;  2DRY A;  3B7N A;  1MC9 A;  3I2A A;  1PZY B;  4GIP A;  3V8Z A;  2YC3 A;  3JTJ A;  2UXD M;  1ILR 1;  1O23 B;  3SAS A;  3V0L A;  3FJJ A;  5KO3 A;  3BRK X;  4ZFY B;  2DAG A;  2E4M C;  4FQW A;  1W57 A;  2L4F A;  4OVZ B;  2VD4 A;  4IBK A;  4DCK C;  1OAI A;  3N7J A;  1RG8 A;  5EP1 A;  1M16 A;  5FTV A;  4I4S A;  4Y7U A;  4B4M A;  4HO9 A;  1VGU A;  5EJC A;  2R45 A;  4PT5 A;  3I29 B;  1YP3 A;  4JI1 M;  4XBO A;  4AAW A;  1S0E A;  8I1B A;  2VSH A;  3LLP A;  2KZS A;  5ITY A;  3U61 B;  3IM5 A;  4LO3 C;  3C3D A;  1NY5 A;  3F1R A;  3FUQ A;  5D61 A;  1ZJ1 A;  2J7O A;  3ZF8 A;  3O4B A;  2Z4S A;  4FRH A;  5BOW A;  1TGU A;  2JCK A;  1WD3 A;  3UDA A;  4LJ7 A;  2C98 A;  5C1G A;  1WT1 A;  4ZA3 B;  4D0T A;  2VDB B;  4LGY A;  2Z3X A;  3W0F A;  1YP2 A;  3PG0 A;  4I6I A;  2MJ5 B;  1Z6T A;  1PGY A;  4LF4 M;  5EJ1 A;  1W3A A;  5JMC A;  1VZU A;  1FGA A;  4JKX B;  5F8Y A;  1DZC A;  3OH0 A;  1ISV A;  1K82 A;  4KEK A;  2CWB A;  3H4J A;  3V90 A;  5C1B A;  3A07 A;  4II7 A;  3CQA A;  4H04 A;  2UUB M;  2ZR1 B;  3I0H A;  4DE7 A;  2R44 A;  3U6E A;  2X8A A;  3VKH A;  1G9C A;  4K0K M;  3GLG B;  3UJ0 A;  2J0B A;  3GUE A;  4Q7C A;  1IN6 A;  2JA2 A;  2N35 A;  4P17 A;  3F92 A;  2Y9W C;  3BA4 A;  4DV5 M;  4QHT A;  1FWV A;  1O7O A;  3I0E A;  1VDL A;  5A2Q S;  1R2Y A;  2NTD A;  3V0B A;  2KNZ A;  3J81 S;  4AKG A;  1PWA A;  3CA5 A;  3MPP G;  3GRR A;  4Y7V A;  4AN6 A;  2WVK A;  4LJA A;  3U2V A;  1D0K A;  1OTR A;  3U5Z A;  3CRI A;  1Z0H A;  2DHY A;  9ILB A;  1G59 A;  1QQK A;  4EEA A;  5E24 E;  2R6F A;  3I0D A;  1ON8 A;  2VXL A;  1NKH B;  4DEN A;  3AKZ A;  4M2B A;  3Q8G A;  5BXP A;  1JT5 A;  1G1L A;  3GPY A;  1R7R A;  3HU3 A;  2EO2 A;  2F2F C;  3WO4 A;  1OFI A;  2E4M A;  1LVW A;  4HO5 A;  1GA8 A;  1L8Q A;  1JV1 A;  3R4U A;  4BQH A;  2D1Z A;  3U6M A;  5C4C A;  1YE9 A;  2DWM A;  4X39 A;  4PDG A;  2P5T A;  3J7B A;  4GHL A;  1Q3B A;  3PFI A;  1AVA C;  1FOA A;  3SXB A;  4B7G A;  1EPW A;  2CUZ A;  4D8H A;  5ITQ A;  5FSW A;  4FRA A;  5L6V A;  1TVY A;  1MX0 A;  3A22 A;  2G8L A;  3SXD A;  2VS5 A;  3N9W A;  1N34 M;  4LO3 A;  5C48 A;  2WRY A;  3NBE A;  4HL4 A;  4CJ6 A;  3HHX A;  1JR3 D;  4JXJ A;  4I4P A;  2L7H A;  4RF0 A;  5BVP I;  4IBG A;  4LZJ A;  3I4Y A;  1FZW A;  3U2T A;  2BWB A;  3L25 A;  3BCV A;  5EXP A;  3OGZ A;  1VQ1 A;  1K3X A;  4L16 A;  3GLF B;  5EP4 A;  2AFG A;  3BTA A;  1LZI A;  2R18 A;  4AN7 B;  2Y9X E;  1GLN A;  4KNR A;  4Y64 A;  4EEG A;  3IHP A;  4JI5 M;  1DGF A;  4P6A A;  4DBG B;  2CV1 A;  5IWA M;  2C9C A;  4AG5 A;  3FYC A;  3FTD A;  2ZQN A;  3S8J A;  3GP1 A;  1YBI A;  3V0B B;  4EFR A;  1INJ A;  1UPS A;  1T9F A;  4KEI A;  3H4M A;  3FJD A;  3OH1 A;  2XH9 A;  4KOD A;  5KPT A;  4I4L A;  4IRP A;  1JVD A;  1H7H A;  3FOQ A;  2DZN B;  1PUU B;  4L8R C;  2CEA A;  2C0N A;  4Y62 A;  3U5Z B;  1YP4 A;  1ISY A;  4EFQ A;  1XXH E;  1RZO B;  2D24 A;  2D7R A;  3QYE A;  2JCL A;  4HG6 A;  3HU1 A;  4KC4 A;  3DUV A;  5ITU A;  3SYK A;  1TW5 A;  4JI7 M;  5BXS A;  4I4V A;  1QAM A;  5FTL A;  1EE8 A;  2E8B A;  3OH4 A;  3A21 A;  2Y0Q A;  5IZ7 D;  4QKR A;  4FW9 A;  4LO7 B;  4LFA M;  1ZQ9 A;  1IBM M;  3UD8 A;  3D8L A;  1D0H A;  1RY7 A;  5DYG A;  3UJ4 A;  4JIS A;  1T6O A;  3A23 A;  1LZ0 A;  1AVX B;  4QNM A;  4DV6 M;  5EXX A;  2FY7 A;  1V6V A;  1S4P A;  4X37 A;  2YC5 A;  1SXJ D;  1QUT A;  2R9K B;  2RJ5 A;  4P02 A;  1HCD A;  1NQI B;  3AFH A;  2Y4M A;  1ZDG A;  2X4A A;  3FGM A;  3IG5 A;  3GQ3 A;  3IOI A;  2QZ4 A;  2LHC A;  4OWJ A;  5C3D A;  5FNX A;  2WE9 A;  1G2V A;  5F8W A; 
#chains in the Genus database with same CATH homology
 3R2W A;  5C3B A;  3TPZ A;  3KFU G;  5JLV A;  3UD7 A;  4Q9P A;  2OPF A;  1JQJ C;  4GAF A;  1TOO A;  3UGJ A;  1FO9 A;  4F83 A;  2J3P A;  2HHH M;  4A3V B;  1H7E A;  1QAO A;  4FCT A;  2Y4K A;  3DOA A;  3NBN A;  4I5S A;  1ZCY A;  1NSF A;  1Z90 A;  2X65 A;  4LW6 A;  2KRK A;  3N0K A;  4Z8X A;  5DDV A;  4PC4 A;  3QVB A;  1MP5 A;  1AVW B;  1GL6 A;  3I51 A;  1G9D A;  1ZI4 A;  4OWL A;  2Y7A A;  2HL7 A;  1ZI5 A;  1E5K A;  2ZQO A;  4KNX A;  1HKN A;  1DQG A;  5FU8 A;  4B7H A;  1Q03 A;  2Y0T A;  21BI A;  1K3W A;  1LZ7 A;  3GRY A;  4DEC A;  3CF6 E;  5FYE A;  4OUJ A;  1L2B A;  4BB9 A;  1EV2 A;  2Y9F A;  3I4V A;  4HJJ A;  4NAL A;  3GRV A;  4B3U A;  3RMX A;  1J09 A;  4NSO B;  1HQY E;  3N7K A;  4IYB A;  3BAO A;  2RIY A;  1LZJ A;  2QCU A;  3O3Q A;  4OEF A;  3SFZ A;  2DRZ A;  3OTO M;  1QQW A;  3RFW A;  1FR9 A;  3HN1 A;  4MGH A;  2DZO B;  1NZK A;  4LF8 M;  3AKH A;  4GIT A;  4X64 M;  3KSX A;  3KOZ E;  4LO0 C;  4ASJ A;  4FRQ A;  4LFC M;  2NQ8 C;  4KPZ A;  4M9X A;  1E0O A;  2Z87 A;  4D11 A;  2YQH A;  4IBB A;  3KS8 A;  2D7H A;  2Q9X A;  5C4D A;  3GQ4 A;  2JCO A;  2NM1 A;  3Q4S A;  5KPR A;  3L28 A;  3J7A S;  3EIE A;  4ZKT B;  5C36 A;  1H5S D;  3I0G A;  5C47 A;  1PM5 A;  2L5X A;  2BFH A;  3K1X A;  2XSZ D;  1NNJ A;  2R4J A;  1AVU A;  1DIW A;  1MP4 A;  5B2H A;  5CMJ A;  4JD0 A;  1G93 A;  1K5U A;  3O4C A;  5FTJ A;  1H4D A;  2PGV A;  2W0W A;  3CRH A;  3CA6 A;  2VXR A;  2XWL A;  4JKQ A;  3NWL A;  3RSB A;  4I37 A;  2RJ1 A;  4M28 A;  1C1K A;  4IBJ A;  1HQC A;  1O0R A;  3FJH A;  2CHV A;  2I1B A;  3JRR A;  4HO8 A;  5ITX E;  1ZJO A;  5H37 D;  1HCE A;  1W5S A;  1LV7 A;  3HL3 A;  4G6Z A;  1S4O A;  3FKE A;  5IDS A;  4J18 A;  4B4G A;  4P16 A;  3WHK A;  3D8B A;  4M9S A;  4ISR A;  2QGI A;  1XXH A;  2QBY A;  1IOB A;  4DUZ M;  3VDP A;  3OC9 A;  3FUU A;  2ZAM A;  3VT2 A;  41BI A;  2GGQ A;  4LO2 A;  2XMH A;  2AM4 A;  1T3T A;  3Q7W A;  1HM8 A;  4D80 A;  4HR6 C;  2VS4 A;  1WXQ A;  1FR8 A;  4KQL A;  2PGY A;  5KPZ A;  1HT1 E;  1N77 A;  4FVV A;  4UEG A;  1TDH A;  5C1H A;  5FLX S;  4NL4 H;  1GWW A;  4Y6N A;  4LJ9 A;  1HWO B;  2RG9 B;  31BI A;  4L78 A;  4X3A A;  3AKI A;  4P0K A;  1JY0 A;  4Y9X A;  1IJT A;  2V1U A;  4J2S A;  5FTK A;  2MIB A;  2XFS A;  3SAU A;  3TWK A;  5CQP A;  3VUO A;  1L2D A;  2QP9 X;  2J0A A;  1DFC A;  2K43 A;  3E25 A;  4X62 M;  5CMF X;  1ISZ A;  1XZZ A;  4Q91 A;  3WO3 A;  4M2A A;  4EE4 A;  4LO0 A;  2DVW B;  2O1G A;  3USR A;  3NBI A;  3D5N A;  2VXT I;  1DJS B;  3TC2 A;  4DDZ A;  3WO2 A;  1NJF A;  2C99 A;  2Y4J A;  1H5S A;  2RIZ A;  1S0D A;  4FRB A;  3L29 A;  2XSZ A;  4IQP A;  5DUY A;  5C8R A;  4II0 A;  4L4I A;  4QD2 B;  1YUB A;  4LW3 A;  1JQZ A;  4KLN A;  2KZU A;  4GKJ M;  4LO1 A;  1FO8 A;  1G8O A;  1NHE B;  1W5T A;  5FZZ A;  1Q39 A;  4EEO A;  4JI0 M;  1UM8 A;  3V8Y A;  4DUY M;  2V6Z M;  5CQN X;  3RGP A;  3U6S A;  3NJ5 A;  4Z9W B;  1Z5C A;  4QBV A;  4ECM A;  2F5O A;  1XXH B;  2QBY B;  3UJN A;  1NMM B;  5GKN A;  3P53 A;  4FCV A;  3SYL A;  3ZC7 B;  4AQY M;  1G97 A;  4L4U A;  1BFF A;  4LO7 C;  1YRO B;  3U60 A;  3ZXD A;  1DQO A;  4END A;  4XWI A;  4MGZ E;  5C4B A;  5FU0 A;  4CGY B;  5JI2 E;  2AAI B;  1QAN A;  4FGF A;  3U6L A;  3ZXG A;  5AJO A;  1ONK B;  1ZAE A;  4MZF B;  4B5B A;  3OJV A;  4I4U A;  4DR3 M;  2C96 A;  3BOS A;  4JRA A;  4NRW A;  4O6N A;  1IN7 A;  4B4B A;  1ZCU A;  1IN5 A;  1TW1 A;  3MK6 A;  1OFH A;  7CAT A;  4BBA A;  2VK9 A;  3VSF A;  1Z4S A;  2ZM6 M;  2Z48 A;  4X65 M;  5BXR A;  3DA1 A;  4GHA A;  4LG2 A;  1VGT A;  3PVS A;  3FJA A;  2LIE A;  4IHZ A;  3CRG A;  4E1K A;  3O4A A;  4QOZ C;  2RJ4 A;  3E8L C;  1ZIZ A;  2WVL A;  3QYD A;  3ZH9 B;  3VK7 A;  3VWC A;  1N75 A;  1V6W A;  5ITX A;  3EIH A;  3CKV A;  1TFM B;  1K4V A;  3ILA A;  3U6O A;  1L1Z A;  2GO2 A;  4I1E A;  5DSS B;  4I7I A;  2NVH A;  4B2W A;  3PNY A;  4KHP M;  3OH2 A;  1H5S B;  4D81 A;  2ESU A;  3HGI A;  5E6J A;  3IG8 A;  4XFS A;  4XKI A;  3U0X A;  4G6M A;  3VDU A;  1IIN A;  4G9N A;  2A5Y B;  3NBC A;  1IN4 A;  2KA6 B;  1G0R A;  5FZY A;  4DR1 M;  2K8R A;  4XFU A;  4P00 A;  4R7P A;  5IFY A;  5CMH A;  2Q3N B;  3O4D A;  4H75 A;  4B3M M;  3WHL A;  4D0Z A;  4I4O A;  5EHA A;  4KRV A;  3U60 B;  2QN4 A;  4XGI A;  1NJG A;  4HA2 A;  1R7Y A;  4QKS A;  4G3Q A;  1VGW A;  4MYB A;  3V0N A;  1XYF A;  1YXW A;  1FMZ A;  1JV3 A;  3AL0 C;  1ZDF A;  2RIX A;  1NUN A;  1H4E A;  2YFQ A;  4XFT A;  1IRP A;  4B42 A;  5IRE B;  1H4C A;  2I7B A;  2IWT B;  2V0I A;  2UX8 A;  3S8K A;  4DR7 M;  1IBK M;  3KOW E;  1H7G A;  1K5V A;  1ITB A;  1HWN B;  2XF3 A;  3O3P A;  1OMX A;  3M7G A;  3OBT A;  4ITQ A;  1JTC A;  3KXE C;  4MGK E;  2D23 A;  4KO8 A;  1R7X A;  2KLL A;  1IN8 A;  3CA3 A;  5DVH A;  4YY3 M;  1GQC A;  3VLF B;  4PDI A;  3BRG C;  3CA1 A;  4QNR A;  3N7M A;  2H1R A;  1IXR C;  4IZX A;  4Y7F A;  1KWS A;  1ZJ0 A;  4Y63 A;  3K8D A;  4MB7 A;  1GKI A;  3PUB A;  4M0D A;  4YS8 A;  3SXE A;  2KW0 A;  4A7Z A;  1GX0 A;  2AHM A;  1ZCT A;  4I3N A;  5C3A A;  1R81 A;  4EE3 A;  4W5W A;  1NY6 A;  5KQD A;  2XLJ A;  1L2H A;  2HWM A;  3MAL A;  4FCU A;  1SR4 A;  1VIC A;  4EVW A;  1IRA X;  2BO8 A;  3HMY A;  5BPV A;  5JI3 E;  1FJG M;  1G3L A;  2DWN A;  1SXJ E;  1INI A;  4DV1 M;  5G00 A;  3R8F A;  3N7L A;  1NHW C;  1WVC A;  1Z5A A;  1ZCV A;  2FNA A;  4IZE A;  4G4Q A;  3JR5 A;  1FGG A;  4FRP A;  3SHG B;  4A7K A;  4CVH A;  1V83 A;  2NYY A;  3HHZ A;  1A8D A;  3C58 A;  5HPZ A;  2BO7 A;  2KRU A;  1V82 A;  1E94 E;  2Y4L A;  6I1B A;  4J2K A;  4FIY A;  4Y7T A;  2NS2 A;  1H7L A;  1S4N A;  1JYK A;  3VT0 A;  3OGG A;  3CF0 A;  5D91 A;  3RMW A;  2HCB A;  4D11 C;  1TZF A;  1FGX A;  2OI5 A;  3HSM A;  1QVR A;  1I94 M;  1FQ9 A;  4AZF A;  4HO3 A;  4G87 A;  4I81 A;  3AH2 A;  1E32 A;  3FUX A;  3TE6 A;  2XWN A;  4C2S A;  3LVV A;  3RSJ A;  1FMM S;  3I0K A;  1IBL M;  2X2S A;  3QR5 A;  2APC A;  3OJ2 A;  1VGZ A;  2ET2 A;  3IOH A;  3ILK A;  4AYJ A;  3KOY E;  3W9T A;  2LXE A;  2WVM A;  2RJ8 A;  3GPP A;  2RJ9 A;  1VH3 A;  4QC4 A;  2IHO A;  3CU0 A;  5EXS A;  4FWG A;  1ISW A;  5EP2 A;  2X60 A;  2YES A;  3A42 A;  4D82 A;  4P0J A;  2F5N A;  4IBD A;  1FWY A;  1W3G A;  5DDT A;  1WT0 A;  2XFT A;  4LJ8 A;  2LIQ A;  4QD2 C;  5EG6 C;  2D7G A;  5DNY A;  3PNN A;  1V84 A;  2Q2E B;  4ZFW B;  3OBR A;  4R6U B;  1W77 A;  4G6J A;  3K1J A;  5ITR A;  2Q4J A;  2FO1 A;  2I7P A;  3L27 A;  2EA0 A;  2BO4 A;  3M0E A;  4B3S M;  4NAK A;  4WUR A;  4HO0 A;  3BAV A;  5CQO A;  5D63 A;  2LNH C;  3HKP A;  1JR3 A;  5D62 A;  1JLX A;  4LO2 C;  3LQR A;  2RKO A;  2I5E A;  4CIS A;  3FD9 A;  5CMI A;  3I2X A;  3BAH A;  1IIL A;  3I0C A;  3DZD A;  2D22 A;  2ERM A;  1KYI A;  3SX8 A;  4DV3 M;  1Z5B A;  1IT0 A;  4TUW A;  1SZ6 B;  1YF8 B;  1ZJ2 A;  3FUO A;  4KEJ A;  3AZW A;  4M0W A;  3R9X B;  5CQL X;  3T7N A;  1N33 M;  3EF2 A;  1OQL B;  3BRF A;  5I1F A;  4IBF A;  2Y20 A;  1VM8 A;  3AOG A;  2Y9G A;  1Q1U A;  4HO4 A;  4KC1 A;  1R7V A;  2XEP A;  2FYC B;  5DZU A;  5EJZ A;  1ZJ3 A;  5FUH A;  2AGD A;  1ORY B;  2I5K A;  4FCW A;  1QWJ A;  1ZI3 A;  2WAW A;  4JPZ A;  5AJN A;  4OW4 A;  1WD4 A;  3VKG A;  2P72 A;  3FJI A;  3RTI B;  3SC3 A;  2XZU A;  4D48 A;  1OMZ A;  2HW9 A;  3TZT A;  1XZ6 A;  3UK6 A;  3BB2 A;  2RIT A;  2M60 A;  3USQ A;  4GKK M;  3OKR A;  4HOC A;  2HZ9 A;  4MGY E;  2QPA A;  2VQF M;  3LMM A;  4FRM A;  1BFG A;  1H5S C;  1RML A;  3IM7 A;  1GWV A;  4AI6 A;  1LL0 A;  4MM3 B;  4S12 A;  1S0G A;  1HM9 A;  4P0L A;  4G4O A;  3HWS A;  1O7Q A;  4IBI A;  3A45 A;  4LO1 C;  1IY0 A;  1V6U A;  5JQQ A;  1SXJ A;  2W82 A;  5C4E A;  1VH1 A;  2KXE A;  1BA7 A;  3Q7Y A;  4GOY A;  3GO8 A;  3O44 A;  3PKP A;  3VSZ A;  1CVS A;  3AOE A;  3O49 A;  4RF1 A;  3B9P A;  2P6W A;  1S0C A;  2M49 A;  2E5L M;  4QOS A;  2GGO A;  3SAV A;  3SPT A;  3BAG A;  4IBC A;  3MJ5 A;  4R7G A;  1G41 A;  1JT4 A;  4Z8S B;  2ERC A;  4Y7G A;  1ZI1 A;  1S0L A;  4GP0 A;  3FUT A;  1WT3 A;  2ZU7 A;  3C9Z A;  4B08 A;  2YQS A;  4Y6U A;  4EFP A;  3KIA A;  3V0O A;  3KMV A;  4LJ5 A;  3VK8 A;  2V0J A;  1H6U A;  4ION A;  4KT7 A;  2QH5 A;  5LMN M;  1Q3C A;  3GLI A;  5C1L A;  1ON6 A;  3BRD A;  3BAD A;  2DHR A;  2UXC M;  1BFC A;  1G9B A;  3TWL A;  1IXZ A;  2R65 A;  2VII A;  1XC8 A;  4G3P A;  1R2Z A;  5C18 A;  1R8N A;  3GPU A;  1EZI A;  3VEQ A;  1OQM B;  1IY1 A;  4QHS A;  4NXN M;  3RMY A;  2YQJ A;  2O5R A;  3GPX A;  4FWD A;  3I0L A;  2CE7 A;  3UZU A;  1HM0 A;  3ZGG A;  2YQC A;  1MD6 A;  2F5P A;  1M2T B;  4PD2 A;  2F8X C;  3AJ5 A;  3OJM A;  3WMV A;  4ZDQ A;  2FOI C;  3P6J A;  1WT2 A;  1HJJ A;  4H9W A;  3OAM A;  4CHT B;  3LQQ A;  2VXM A;  2BEA A;  3D98 A;  4LRT A;  2R62 A;  3QAU A;  4LJ6 A;  3HOM A;  3O5W B;  1QQL A;  5FTN A;  4GRI A;  2Y6P A;  4X38 A;  1SXJ B;  1LL2 A;  4I8O A;  1H7F A;  2V0K A;  4GC9 A;  3KOX E;  5F90 A;  3FYD A;  2UUC M;  4FCE A;  4DV2 M;  1JLY A;  4IIW A;  2VSA A;  5C38 A;  3J27 B;  2BEB A;  3Q8X A;  1DLL A;  3FJ9 A;  4TLP A;  2KH2 A;  3KW6 A;  4RNA A;  2CV0 A;  3SBJ A;  1PC8 B;  3CAH A;  1G9R A;  3CA4 A;  2X5S A;  4Q9G A;  2VU9 A;  4LO8 B;  1I1B A;  1TH3 A;  2X2T A;  1QZM A;  1FV3 A;  2PA4 A;  3KSJ A;  4B2X A;  4M9Z A;  1BAR A;  4FVM A;  5DYI A;  1G8P A;  3CF2 A;  2XME A;  4ISQ A;  3KP0 E;  4ZPX A;  1G3I A;  3KP1 E;  2C5R A;  1D2N A;  2VUA A;  4GMQ A;  4MIX A;  3W0L B;  1XNR M;  3MHV C;  3ZCB B;  3GLI B;  3FJB A;  3BAU A;  2X5Z A;  1QG8 A;  5F3W A;  2WGZ A;  3TL4 X;  2Z7J A;  1MP3 A;  1J7K A;  1T4Q A;  1DGH A;  5FNW A;  4YOL A;  2UUA M;  1GVN A;  1AFC A;  4FD2 A;  4OW0 A;  2AM5 A;  5BP5 C;  2CU2 A;  1SS9 A;  4G9M A;  2RJ6 A;  5FZU A;  1WBA A;  4EKX B;  1HNX M;  1AF9 A;  3V0M A;  1IY2 A;  2AXM A;  4ZBV B;  5AJP A;  5D92 A;  3FWW A;  1S0B A;  2OI6 A;  1FN0 A;  4J2X A;  3PKQ A;  3SXA A;  1FRW A;  3IM6 A;  1SR4 C;  3POK A;  3RGS A;  3R3I A;  5C49 A;  3K92 A;  3BAQ A;  3KDS E;  3FJK A;  1XNQ M;  1KNM A;  7I1B A;  2D7I A;  1NHG C;  1IXS B;  3THG A;  3D7W B;  2Y21 A;  1QAQ A;  4G3S A;  1TTU A;  4G4N A;  1DO2 A;  1QGQ A;  3J80 S;  2FYA A;  2JCJ A;  2FFV A;  4JI8 M;  1XWI A;  5BQU A;  3AH4 A;  3WIN C;  3SX3 A;  1DGG A;  4IJF A;  4LGM A;  1ISX A;  3DK5 A;  4I8M A;  1JYL A;  3FUV A;  5IT9 S;  3FJF A;  2WEE A;  4FRD A;  4NSR A;  1II4 A;  2ZBK B;  4OEE A;  1R7T A;  3FUW A;  4R3D A;  2D0J A;  2VS3 A;  3GQ5 A;  4DEP A;  2XZF A;  3H6Q A;  3JAM S;  3GLF A;  2D43 A;  4Z6Y A;  1N36 M;  1TWE A;  3P6I A;  3T8S A;  4OWK A;  1FG5 N;  1H7T A;  5EC5 A;  4LJ4 A;  1NNU C;  3AH1 A;  2GZB A;  1VDD A;  4KC2 A;  4K6R A;  3IIR A;  3U6Q A;  1PUM B;  1S0F A;  4GBP A;  3CKJ A;  3BA7 A;  3TQS A;  4LZZ A;  3PXG A;  1VZT A;  2OEG A;  1YTO A;  3HHY A;  4JP0 A;  1MC3 A;  3QWL A;  1IQP A;  2UXB M;  3ZX7 A;  2QKX A;  1ZHJ A;  1KSF X;  3FJE A;  3EE5 A;  1DGH B;  3WMU A;  1XMO M;  3T7M A;  5EP3 A;  2XWM A;  3A46 A;  1Q04 A;  4OX9 M;  2AH9 A;  4DR2 M;  2ICY A;  5C4F A;  3T1Y M;  3NBD A;  4ARW A;  5ITT A;  5BR8 M;  3PNV A;  4ASY A;  1FWU A;  4LFB M;  1WBC A;  2RGH A;  3AKG A;  1HIB A;  2C9O A;  2DXI A;  2V1C A;  1PJJ A;  4ZGR B;  1KFV A;  3I0J A;  3R4S A;  3SX7 A;  2DWL A;  2P73 A;  1FV2 A;  3JUT A;  5BP5 A;  4EEM A;  1H3M A;  1DFQ A;  2XOA A;  3AZV A;  4NRV A;  2YNM D;  2ZAO A;  4GOV A;  2D20 A;  4AYL A;  5CQM X;  1TDZ A;  3SHF A;  3SX5 A;  1L1T A;  2CHQ A;  4QAL A;  3U6P A;  4FRE A;  4FRO A;  1HJL A;  4EB2 B;  2V0L A;  4L15 A;  3IOJ A;  3CGX A;  1HNZ M;  1Z2V A;  2K4A B;  1I52 A;  3GLH A;  3HAL A;  1YSY A;  3KVW A;  4L41 C;  3D8V A;  2L6O A;  4NXM M;  2KKI A;  1I1E A;  2YQZ A;  3ZLL A;  1FXO A;  3FJC A;  3HJQ A;  3LVW A;  3L2A A;  3NGW A;  3HJ8 A;  1FNN A;  1W3F A;  1FXJ A;  1G23 A;  2QEN A;  3Q7X A;  4HO6 A;  3UMM A;  2KEB A;  4MGI E;  3WIN A;  2E3D A;  1V6X A;  3HU2 A;  3PME A;  1CE7 B;  3K8Z A;  4I4Q A;  4BLC A;  2DS0 A;  4DR5 M;  2LH0 A;  2XGN A;  4PCZ A;  1N78 A;  1X37 A;  2I7N A;  4AC3 A;  1BAS A;  4REZ A;  1HWM B;  1F31 A;  4ZOT A;  2OQ4 A;  1W55 A;  2FE8 A;  1PZZ A;  3VT1 A;  2Z86 A;  3SNV A;  1QGS A;  2NXV A;  3U6D A;  4OEG A;  1G9A A;  4OU7 A;  4I4R A;  3V0A A;  2MC2 A;  3JR4 A;  2O1F A;  1HR0 M;  4HCQ A;  3AKF A;  3FTF A;  4GH9 A;  2ZU8 A;  3U2U A;  3I0I X;  3V0P A;  2VSE A;  3POL A;  4I0Y A;  1I4W A;  1SXJ C;  2EUC A;  1GQ9 A;  4AKI A;  2FFU A;  2AEC A;  4LF5 M;  4M4K A;  5FV9 A;  2VQE M;  4LF6 M;  3Q80 A;  3BA5 A;  2YR0 A;  4F34 A;  1DGB A;  2BJW A;  1GL7 A;  2L7I A;  1NF5 B;  4YHH M;  3AOE C;  3K8E A;  1WSZ A;  4CJC A;  4USO A;  2UU9 M;  3A98 B;  1N4K A;  2J7N A;  1EVT A;  3AJ6 A;  1BFB A;  4KC3 A;  1N32 M;  3ST8 A;  4IJE A;  2RGO A;  2F2F A;  2R46 A;  4USP A;  3F1Y A;  3U0Y A;  5IDT A;  4LCB A;  3T38 A;  3SAR A;  1Z59 A;  3DJ4 A;  4JYA M;  1BLD A;  2DRE A;  2ICX A;  4JI4 M;  4GC5 A;  1ABR B;  1MU5 A;  3GLH B;  5FTS A;  2LWX A;  4CJ8 A;  5L6S A;  1QYR A;  4EEE B;  4O6M A;  3FTE A;  3UD9 A;  1HT2 E;  2FDB M;  3DFZ A;  1EYR A;  5BXC A;  4DV7 M;  2F5S A;  5BXT A;  2RJ0 A;  1AXM A;  1P63 A;  2NP0 A;  1XMQ M;  3FJ8 A;  4JI3 M;  3VFD A;  4I2S A;  1GGP B;  2FGF A;  4DV4 M;  3GRU A;  4QBC A;  4L4H A;  2OEF A;  4GP3 A;  1HV9 A;  2CV2 A;  3LW6 A;  4B3R M;  4NAI A;  2AE7 A;  1VZX A;  1TWM A;  3AV0 A;  4LY6 A;  1H5T A;  3M6A A;  1XG6 A;  1J5E M;  4B7F A;  2DPW A;  3V0A B;  2BNK A;  4DV0 M;  3OH3 A;  4HO2 A;  3AJI B;  1LL3 A;  1R8O A;  1TP0 A;  8CAT A;  2G5G X;  3HJS A;  3RE8 A;  2QYI B;  2X49 A;  2FYD B;  2VSI A;  1EYL A;  3LTQ A;  5GAQ A;  4A7Y A;  3H6S E;  1E9R A;  4NAN A;  3HHW A;  3RMV A;  3ZC8 A;  5LMU M;  3JUJ A;  3CKQ A;  1ZJP A;  4I96 A;  1IM2 A;  2A8W A;  3H6R A;  4DR4 M;  3OGF A;  1QXM A;  4FWH A;  4J23 B;  1S3S A;  1R7U A;  2OI7 A;  3B9U A;  5E26 A;  5FTM A;  3U6C A;  2Z49 A;  3F1C A;  2PX7 A;  4GAI A;  1IHK A;  3Q7U A;  3V79 C;  3SAW A;  1R6B X;  1DZD A;  4X66 M;  3BX1 C;  3U2X A;  1PZT A;  5EIY A;  3WA1 A;  2NZ9 A;  3V0Q A;  4JI6 M;  2P23 A;  4MZH A;  4AKH A;  3ZC9 A;  4LF7 M;  2D44 A;  3J2P B;  4KPX A;  1NVM A;  3FFZ A;  1PJI A;  5HS2 A;  3SAT A;  1DO0 A;  2AM3 A;  4FRL A;  4JV5 M;  3PHZ A;  4ZLB B;  2ZAN A;  1VPA A;  1IIM A;  3SXG A;  2CFO A;  3F62 B;  1XHB A;  4JQ0 A;  2Z4R A;  4NOO B;  2R4E A;  2YUG A;  2A8U A;  2W0V A;  1H5R A;  1G4A E;  4BMA A;  1TH2 A;  3O4O A;  2UUS A;  4EIW A;  1BLA A;  1OJL A;  3E26 A;  4QO3 A;  4WW0 A;  1G95 A;  4IY8 A;  4MZG B;  2HKJ A;  4B3T M;  4MND A;  2AES A;  2DWZ B;  4MH0 E;  2AQZ A;  3SMS A;  1H5T B;  2HWA A;  4I4X A;  4IBE A;  1HNW M;  4UY4 A;  3SMP A;  3I0F A;  4OVZ A;  3U2W A;  4KBB A;  2M5Z A;  3FTC A;  2F5Q A;  1JVG A;  3E9S A;  2BO6 A;  4JI2 M;  3V91 A;  3T7O A;  3HBW A;  2CHG A;  1YYN A;  1L2C A;  1GX4 A;  1G82 A;  5EQT A;  2KI6 B;  3T1H M;  1NWG B;  2L09 A;  3E4R A;  3U61 A;  1HWP B;  4JN6 A;  5BQU C;  4KXO A;  4WBC A;  4IY9 A;  3H6R B;  1JT3 A;  3ZGF A;  4I4Y A;  1R80 A;  3CKO A;  5KQ8 A;  2MLL B;  5CMG X;  4IRQ A;  1E9S A;  3IAG C;  3CTW B;  2WBC A;  2VFZ A;  4LF9 M;  4LRS A;  4CJM A;  2FFJ A;  2F4V M;  4CJB A;  5J49 A;  4J2Y A;  3JUK A;  4JAW A;  2D7E A;  3CA0 A;  2FYB A;  3L26 A;  2YCM A;  4FIX A;  1J0S A;  4G1R A;  5F8S A;  2RST A;  4AG6 A;  4AW4 A;  2RQ9 A;  1TH4 A;  1VCL A;  3TWM A;  2KI4 A;  2ZU9 A;  4DR6 M;  4I1B A;  2P39 A;  3CU1 B;  2V0H A;  3TQD A;  3K2L A;  2BJV A;  4ZFU B;  3KS4 A;  2MZB A;  2K47 A;  3CKN A;  4EE5 A;  3GLG A;  3ZLK A;  2VLC A;  3T15 A;  2O1H A;  1TIE A;  1H5R B;  5I1B A;  2RJ7 A;  3SXC A;  1H7Q A;  4HLQ A;  1R82 A;  5EXT A;  1JT7 A;  3RTJ B;  4G4R A;  2DRY A;  1MC9 A;  3I2A A;  1PZY B;  4GIP A;  3V8Z A;  2YC3 A;  3JTJ A;  2UXD M;  1ILR 1;  1O23 B;  3SAS A;  3V0L A;  3FJJ A;  5KO3 A;  3BRK X;  4ZFY B;  2E4M C;  4FQW A;  1W57 A;  4OVZ B;  2VD4 A;  4IBK A;  4DCK C;  3N7J A;  1RG8 A;  5EP1 A;  1M16 A;  5FTV A;  4I4S A;  4Y7U A;  4B4M A;  4HO9 A;  1VGU A;  5EJC A;  3I29 B;  2R45 A;  4PT5 A;  1YP3 A;  4JI1 M;  4XBO A;  4AAW A;  1S0E A;  8I1B A;  2VSH A;  3LLP A;  2KZS A;  5ITY A;  3U61 B;  3IM5 A;  4LO3 C;  1NY5 A;  3F1R A;  3FUQ A;  5D61 A;  1ZJ1 A;  2J7O A;  3ZF8 A;  3O4B A;  2Z4S A;  4FRH A;  5BOW A;  1TGU A;  2JCK A;  1WD3 A;  3UDA A;  4LJ7 A;  2C98 A;  5C1G A;  1WT1 A;  4ZA3 B;  4D0T A;  4LGY A;  2Z3X A;  3W0F A;  1YP2 A;  3PG0 A;  4I6I A;  1Z6T A;  4LF4 M;  5EJ1 A;  1W3A A;  5JMC A;  1VZU A;  1FGA A;  4JKX B;  5F8Y A;  1DZC A;  3OH0 A;  1ISV A;  1K82 A;  4KEK A;  3V90 A;  5C1B A;  3A07 A;  4II7 A;  3CQA A;  4H04 A;  2UUB M;  2ZR1 B;  3I0H A;  4DE7 A;  3U6E A;  3VKH A;  2X8A A;  1G9C A;  4K0K M;  3GLG B;  3UJ0 A;  2J0B A;  3GUE A;  4Q7C A;  1IN6 A;  2JA2 A;  2Y9W C;  3BA4 A;  4DV5 M;  4QHT A;  1FWV A;  1O7O A;  3I0E A;  5A2Q S;  1R2Y A;  2NTD A;  3V0B A;  3J81 S;  4AKG A;  1PWA A;  3CA5 A;  3MPP G;  3GRR A;  4Y7V A;  4AN6 A;  2WVK A;  4LJA A;  3U2V A;  3U5Z A;  3CRI A;  1Z0H A;  9ILB A;  1G59 A;  1QQK A;  4EEA A;  5E24 E;  3I0D A;  1ON8 A;  2VXL A;  1NKH B;  4DEN A;  3AKZ A;  4M2B A;  5BXP A;  1JT5 A;  1G1L A;  3GPY A;  1R7R A;  3HU3 A;  2EO2 A;  2F2F C;  3WO4 A;  1OFI A;  2E4M A;  1LVW A;  4HO5 A;  1GA8 A;  1L8Q A;  1JV1 A;  3R4U A;  4BQH A;  2D1Z A;  3U6M A;  5C4C A;  1YE9 A;  2DWM A;  4X39 A;  4PDG A;  2P5T A;  3J7B A;  4GHL A;  1Q3B A;  3PFI A;  1AVA C;  1FOA A;  3SXB A;  4B7G A;  1EPW A;  2CUZ A;  4D8H A;  5ITQ A;  5FSW A;  4FRA A;  5L6V A;  1TVY A;  1MX0 A;  3A22 A;  2G8L A;  3SXD A;  2VS5 A;  3N9W A;  1N34 M;  4LO3 A;  5C48 A;  2WRY A;  3NBE A;  4HL4 A;  3HHX A;  1JR3 D;  4JXJ A;  4I4P A;  2L7H A;  4RF0 A;  5BVP I;  4IBG A;  4LZJ A;  3I4Y A;  1FZW A;  3U2T A;  3L25 A;  3BCV A;  5EXP A;  3OGZ A;  1K3X A;  4L16 A;  3GLF B;  5EP4 A;  2AFG A;  3BTA A;  1LZI A;  2R18 A;  4AN7 B;  2Y9X E;  1GLN A;  4KNR A;  4Y64 A;  4EEG A;  4JI5 M;  1DGF A;  4P6A A;  2CV1 A;  5IWA M;  2C9C A;  4AG5 A;  3FYC A;  3FTD A;  2ZQN A;  3S8J A;  3GP1 A;  1YBI A;  3V0B B;  4EFR A;  1INJ A;  1UPS A;  1T9F A;  4KEI A;  3H4M A;  3FJD A;  3OH1 A;  2XH9 A;  4KOD A;  5KPT A;  4I4L A;  4IRP A;  1JVD A;  1H7H A;  3FOQ A;  2DZN B;  1PUU B;  4L8R C;  2CEA A;  2C0N A;  4Y62 A;  3U5Z B;  1YP4 A;  1ISY A;  4EFQ A;  1RZO B;  2D24 A;  2D7R A;  2JCL A;  4HG6 A;  3HU1 A;  4KC4 A;  3DUV A;  5ITU A;  3SYK A;  1TW5 A;  4JI7 M;  5BXS A;  4I4V A;  1QAM A;  5FTL A;  1EE8 A;  2E8B A;  3OH4 A;  3A21 A;  2Y0Q A;  5IZ7 D;  4QKR A;  4FW9 A;  4LO7 B;  4LFA M;  1ZQ9 A;  1IBM M;  3UD8 A;  3D8L A;  1D0H A;  1RY7 A;  5DYG A;  3UJ4 A;  4JIS A;  3A23 A;  1LZ0 A;  1AVX B;  4QNM A;  4DV6 M;  5EXX A;  2FY7 A;  1V6V A;  1S4P A;  4X37 A;  2YC5 A;  1SXJ D;  2R9K B;  2RJ5 A;  4P02 A;  1HCD A;  1NQI B;  3AFH A;  2Y4M A;  1ZDG A;  2X4A A;  3FGM A;  3IG5 A;  3GQ3 A;  3IOI A;  2QZ4 A;  4OWJ A;  5C3D A;  5FNX A;  2WE9 A;  1G2V A;  5F8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...