1XHBA

The crystal structure of udp-galnac: polypeptide alpha-n-acetylgalactosaminyltransferase-t1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
459
structure length
447
Chain Sequence
NRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The beginnings of mucin biosynthesis: The crystal structure of UDP-GalNAc:polypeptide {alpha}-N-acetylgalactosaminyltransferase-T1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Polypeptide N-acetylgalactosaminyltransferase 1
total genus 142
structure length 447
sequence length 459
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.460 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xhbA02
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1xhbA03
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1xhbA01
2Y9FA 1I1BA 4OEFA 5E24E 1R7XA 3AJ6A 1G9DA 3PKPA 5CQPA 3FGMA 3V0LA 1D0HA 4ZFYB 1FWVA 2RITA 1ZCUA 1VGUA 3O4BA 5BXSA 1R7UA 1JT4A 3R2WA 3A23A 4MYBA 3CKVA 3U2UA 4X37A 1V6UA 1ZDFA 3AKIA 3UDAA 2D0JA 4NALA 5C3BA 1HJJA 2OEFA 3WO2A 4KC4A 4IZEA 4DECA 5L6VA 3FJFA 3R3IA 2K4AB 3I0EA 1AF9A 1JLYA 1KNMA 3FWWA 1FXJA 2UUSA 5D63A 1G95A 1VCLA 1K5VA 1JQZA 4EFPA 5BQUA 4JRAA 1KWSA 4J2SA 3CKQA 1FN0A 2YUGA 6I1BA 3OKRA 3H6RB 2I7BA 4FQWA 4K6RA 4XFTA 3H6RA 4IY9A 4HCQA 1NQIB 4OEEA 1ISVA 3AKHA 4G6MA 4LO1A 3HN1A 3BAOA 3CA0A 1I52A 4NAIA 4LO3A 4QALA 4X3AA 4DEPA 3GUEA 3KMVA 3IIRA 5JMCA 1R8NA 2BEAA 3A21A 1R82A 4EE5A 1P63A 4AYLA 2D7RA 3OJMA 1ISXA 1HWOB 3OAMA 1QXMA 3JRRA 5J49A 3I0LA 1PWAA 2WRYA 5FU8A 4I4PA 2DREA 4I0YA 1Q1UA 2M49A 4USPA 1ILR1 3VSFA 3BAGA 1H5SD 2FO1A 4EEEB 1R80A 4FRQA 2KKIA 2RQ9A 1WT2A 1T9FA 4FRHA 1DQOA 1V6VA 2Y4LA 1TW5A 4KBBA 2YQHA 5DDTA 2ZQOA 1JT3A 2D43A 1H4CA 5C4CA 1FGGA 1EZIA 2O1HA 2NZ9A 5C3DA 4HO8A 1VZXA 2W0VA 4QD2B 1AFCA 3N7MA 5F8YA 1V6XA 4FRPA 4CVHA 1BFCA 4JKXB 1YP2A 1TZFA 3K8DA 2AXMA 4FRBA 1CE7B 2E8BA 4P00A 4Y7GA 5CQLX 1JT5A 3EF2A 4H04A 3BTAA 5IFYA 5DSSB 3HBWA 1SZ6B 3BRFA 1FXOA 4B42A 4ZBVB 2ZU7A 4G9MA 4X39A 3T8SA 3AH4A 5FZYA 2X60A 3RMYA 3VT0A 4ISQA 1LL0A 1QG8A 3I29B 1JY0A 1OQMB 1R81A 1G9BA 2AH9A 1G93A 5C47A 1DFCA 2PGVA 4I4UA 2VSHA 3RTIB 1VZTA 4L41C 1JT7A 2YC3A 2VSIA 3BAVA 2KI6B 4B5BA 1JVDA 4I1BA 3RMXA 3BA4A 3V0MA 4I2SA 2FYCB 1HM0A 1Z0HA 1IINA 4ENDA 1HV9A 1GA8A 1VZUA 3W9TA 2V0JA 9ILBA 2FFVA 3FJJA 3OJVA 5BP5C 3HL3A 3VT2A 1HIBA 3I0JA 3Q7UA 2VLCA 3LW6A 3HALA 4LO7C 2QH5A 2QYIB 1RG8A 4G1RA 3VUOA 1XHBA 3V79C 5FUHA 1RZOB 1ZJ3A 5DUYA 5DVHA 4KPZA 4LW3A 4HO9A 5FYEA 4I7IA 4P02A 4B4MA 1S0DA 5I1FA 4EEGA 4GOVA 1MD6A 4GOYA 5B2HA 2P23A 2P72A 1O7QA 3D7WB 3ZC9A 4FCEA 1WBAA 2RJ7A 2K8RA 1MC9A 1YROB 3UJ4A 3SX7A 2BO8A 1FV3A 3WO4A 1T4QA 1JV1A 4B3UA 4BQHA 4LO2A 4YOLA 1NF5B 2ZU9A 3F1YA 1PUMB 1OQLB 2ZR1B 3U2XA 3V0OA 3U0XA 4ZDQA 1HCEA 1EVTA 2E3DA 1SR4C 5DDVA 3RTJB 1IRAX 3FJ8A 5F8SA 2MZBA 4ECMA 1IILA 2ET2A 2D22A 1YP3A 1ON6A 4EVWA 3A07A 4P0JA 4HO3A 5IDTA 4GP0A 2Z49A 3WMUA 1MP4A 3OC9A 1UPSA 1QWJA 3T7NA 5CMIA 2IHOA 1K5UA 3IM6A 4IZXA 4KEJA 2V0HA 1BARA 1DJSB 4EFQA 1QGSA 4HR6C 3RMVA 3I2XA 5AJPA 1WBCA 3O4DA 1Z2VA 2F2FC 1FO9A 3EE5A 1VM8A 1YBIA 41BIA 1DZCA 5C1GA 1DLLA 4EEOA 4G6JA 2NXVA 5FTVA 5C1HA 1ZCTA 3O4AA 3PMEA 3BB2A 4ISRA 1G8OA 3NBCA 2ZQNA 1HWPB 2OI7A 4ASYA 1JLXA 3OBTA 4I4YA 2AM4A 3ZXGA 1IRPA 2NVHA 4GAIA 4HA2A 1FR9A 1LZJA 1XYFA 2JCLA 4JD0A 4EE4A 2VSEA 3I0IX 2RIYA 4G9NA 1Q04A 4KT7A 2Y9WC 3V0AB 4KEIA 4ZFUB 3IOJA 2AAIB 4GAFA 3D5NA 3KIAA 2MIBA 3QYDA 5C48A 4JPZA 2NTDA 3FJAA 1Z90A 3V90A 3E25A 2V0LA 3H6QA 1G2VA 1LZ7A 3SX8A 1ON8A 2YQCA 1GWVA 1AVUA 3Q80A 3AZVA 1PZZA 1WD4A 1S0BA 2X2SA 3P53A 4J23B 1IHKA 4LO0C 4QKRA 1FOAA 1H5RB 1H5RA 1H5SA 4I4VA 5D62A 1H5SB 3N0KA 2ERMA 1QGQA 4J18A 4KQLA 4HJJA 4FRLA 3IM5A 3WO3A 1G9RA 3UD9A 3ST8A 5FU0A 1PUUB 1W3FA 5CMGX 1EYLA 4KXOA 1S0LA 2Y7AA 1W57A 3WMVA 1TW1A 3OH1A 3BAUA 3SNVA 3ZXDA 4J2YA 3B9UA 4CJ8A 1JTCA 3Q7XA 1MP3A 3USRA 3BX1C 1JVGA 4ARWA 2P39A 1SS9A 3CQAA 4QKSA 1GQCA 2VUAA 3NBDA 1GGPB 4IONA 2WVLA 3QR5A 3TZTA 3CA6A 2VS3A 3AH2A 5HPZA 4F34A 1XZZA 2WGZA 1NKHB 5FTSA 2YC5A 1ZDGA 4UEGA 4BMAA 1G23A 2RIZA 1LVWA 1H5TB 4IYBA 5BVPI 2AFGA 4FRDA 2VXRA 2L5XA 4A7ZA 3P6JA 1GQ9A 3JUKA 2KH2A 3PKQA 3LTQA 2BFHA 3AKGA 2AESA 1YF8B 3VWCA 3FOQA 2VS4A 3HOMA 3V0QA 1OMXA 2XMHA 4Y64A 1R8OA 1BA7A 1HKNA 3NJ5A 1TIEA 3F62B 3RMWA 7I1BA 1LZIA 3R4UA 1LL2A 3DUVA 3ZGGA 2E4MC 3TQDA 3O49A 3K1XA 5HS2A 4LO8B 1ZI4A 2RJ0A 4P0KA 1H4EA 1V83A 1N4KA 2VXLA 2WEEA 2K43A 2X65A 1J0SA 1TP0A 1ZI1A 4I4QA 2FYDB 3VEQA 2ZU8A 2GGQA 1K4VA 2DS0A 1WT3A 2W0WA 1R7YA 5EHAA 2VS5A 3PNNA 3Q4SA 2Z48A 3FFZA 2AECA 5C38A 4IY8A 1ZCYA 1H7GA 5C3AA 1EPWA 4OWJA 2DRYA 4I96A 1HM8A 2I5EA 4LW6A 3N9WA 4B2XA 1HCDA 2RG9B 1NHEB 1TWMA 2XMEA 3BRKX 4Y6UA 3CA5A 2YQJA 3SXCA 4II0A 2NYYA 5F8WA 2OI5A 4M2AA 4HO0A 1ISWA 5C49A 3CU1B 1F31A 1ZI3A 1IT0A 3DK5A 1G1LA 1O0RA 4I3NA 2GO2A 4KRVA 1YTOA 1VGTA 4KNRA 4I4OA 5CMJA 1H7TA 1M16A 5D61A 1S4PA 1NMMB 3SX3A 4EKXB 2MLLB 1E5KA 1ZJ2A 4JP0A 1O7OA 1QQLA 2AM3A 2QKXA 4AN7B 4Q91A 5I1BA 2RIXA 3ZLKA 2RJ4A 4D11C 2HWMA 3CRHA 1I1EA 1FWYA 4A7YA 4L4IA 1JYLA 4Y7VA 2D23A 3U2TA 5C4FA 2O1GA 5BOWA 5BP5A 5CQMX 5BXCA 1H7FA 3BA7A 4FRMA 1XG6A 2Y9GA 1DQGA 3IAGC 3HSMA 3BRGC 1ZJPA 5C4DA 2QN4A 2VXMA 1HM9A 4J2KA 2OEGA 2RJ6A 3CKJA 3I0DA 3S8KA 2JCJA 3V8ZA 2LIEA 1BLAA 1AVWB 5CMHA 4CJBA 5FNXA 3VT1A 1L2HA 4HO6A 2YCMA 2A8WA 3SPTA 1E0OA 3PG0A 1PZTA 3AKFA 4EE3A 5AJOA 3T7MA 1ZJOA 3V0NA 4LO3C 3K8EA 5C36A 4Y62A 2KLLA 4LO7B 1FGAA 4PC4A 4DCKC 2FYBA 1MC3A 2GGOA 8I1BA 2NM1A 3CRGA 4USOA 2X5ZA 2XWMA 2YESA 4FREA 1FV2A 3ILAA 3FUOA 3V0BB 4ZLBB 4G3QA 5L6SA 4OW4A 3O4CA 3FJHA 1ITBA 1NUNA 4M4KA 3WINC 4Y6NA 3O4OA 4E1KA 3R4SA 2PA4A 4I1EA 3SXBA 2BO4A 3SXGA 1VGZA 3Q7YA 1BASA 1H7QA 2VFZA 3U2VA 1G0RA 1DZDA 4QBVA 4Q9GA 3OGFA 4DE7A 2Y4JA 3FJ9A 4DDZA 1S4OA 3FJKA 1DIWA 1PC8B 2WE9A 1FQ9A 4EEMA 1JV3A 4XFUA 2JCKA 2RJ9A 1GX0A 1CVSA 4IRQA 2Q4JA 2F2FA 1EYRA 1BFFA 1H4DA 2FYAA 3ZLLA 1HWMB 1ZJ0A 4AYJA 5DZUA 2FGFA 2I1BA 3BRDA 3FUQA 4WBCA 3U2WA 3O5WB 4HO5A 2WBCA 3E8LC 4TLPA 2RJ1A 2RJ5A 2GZBA 3LLPA 2P73A 1A8DA 3HMYA 1H7EA 2R9KB 2APCA 4FGFA 1FG5N 2VD4A 1ZCVA 2Y9XE 3NBNA 2Y6PA 3BCVA 3I0HA 4I6IA 2Z86A 2ICXA 4D48A 4ZGRB 1S0FA 1Q03A 1O23B 3USQA 2CU2A 2IWTB 5GAQA 2VU9A 3O3QA 3JUJA 2YQSA 1AXMA 2D1ZA 3O44A 4ZOTA 1WSZA 3V8YA 5F90A 3CU0A 3CKNA 4JKQA 3JTJA 4H9WA 1AVAC 3OBRA 31BIA 5C1LA 3SX5A 1H7LA 3FJEA 3IOHA 4M28A 1S0CA 3OJ2A 1R7TA 3SXEA 1H5SC 4Z8SB 1EV2A 3VSZA 3ZGFA 1FMMS 1WT1A 1OMZA 3ZF8A 1W55A 4OEGA 4I4XA 4JQ0A 3NBEA 1JYKA 3E26A 4OWKA 2D20A 2JCOA 3FJBA 1Z4SA 4LO2C 1W77A 3RSJA 1TVYA 5EIYA 1TOOA 5EJ1A 4IRPA 1YP4A 1V84A 4I37A 4OUJA 3WA1A 1FO8A 3D98A 3POLA 4R6UB 1TTUA 3JUTA 2KI4A 5JLVA 4HO2A 5CMFX 4B4GA 2D44A 4XFSA 1RMLA 2AE7A 3DJ4A 4B2WA 1M2TB 4Y7FA 2RJ8A 1TWEA 3ZC8A 5C4EA 1S0EA 4KEKA 1W3AA 1NZKA 1VH3A 3I0KA 1BFBA 2NP0A 2BO7A 4A7KA 2X2TA 3UD7A 2HWAA 4F83A 1WD3A 3V0BA 1ZI5A 5FZUA 4G87A 4HOCA 4NANA 4EEAA 3OGGA 1LL3A 4I4SA 1ABRB 5FZZA 2LIQA 2V0IA 1G3LA 1HJLA 1ZIZA 2ICYA 4YS8A 2Q9XA 3I0CA 4GBPA 3BAHA 4QO3A 3POKA 2RSTA 3CA4A 3MALA 3OH4A 1DFQA 2FY7A 2J3PA 3IOIA 4M2BA 5JQQA 3AZWA 3FJIA 1SR4A 3BAQA 1HWNB 3AH1A 3V0AA 1G97A 1S0GA 1AVXB 2OI6A 3OH2A 1TFMB 1GWWA 3I2AA 2F8XC 2O1FA 2Y4KA 2Y4MA 4CJMA 1H5TA 5FV9A 4QC4A 1G82A 1ONKB 2DRZA 3SXAA 3CAHA 3CKOA 4D11A 3AJ5A 4G3PA 5EC5A 5FNWA 1FRWA 4P6AA 4JISA 5BXRA 2AM5A 2PGYA 4IQPA 2Q3NB 3F1RA 1IIMA 1H7HA 3QVBA 4Y9XA 3CGXA 3RSBA 5EJZA 4G3SA 2PX7A 3FJCA 4L4HA 4R7PA 4AC3A 5IDSA 3MPPG 2V0KA 1RY7A 1VICA 3CRIA 4KNXA 4KPXA 3I0GA 4I8MA 1INIA 4Y63A 5CQOA 1PZYB 2ESUA 2HZ9A 2I5KA 1ISYA 3H6SE 1LZ0A 4JAWA 1FZWA 4QD2C 4MNDA 2MC2A 2VSAA 2BO6A 2XOAA 1ZHJA 4J2XA 1WT0A 4FVVA 4ZA3B 3UJ0A 2UX8A 3I0FA 4KC1A 4AAWA 3CA1A 1NWGB 4XKIA 1VPAA 1ZJ1A 2WVKA 3A22A 4EB2B 4D8HA 3N7JA 1FWUA 4C2SA 3Q7WA 4DENA 3NGWA 1ISZA 2FFUA 3N7LA 2QGIA 4IHZA 3WINA 4EFRA 1FR8A 4LO0A 4HG6A 4ZFWB 3V0PA 4CJCA 4ZKTB 3BADA 4Y7TA 4KC2A 4ASJA 2D24A 3PUBA 4X38A 3O3PA 3C9ZA 3TC2A 1VH1A 2DPWA 2HW9A 1WVCA 3OH0A 5BXTA 3SXDA 4NAKA 4OWLA 4B4BA 3FJDA 4D0TA 2P6WA 3T7OA 3U0YA 1G9AA 2BEBA 2D7IA 2VXTI 4I4RA 4FCUA 2X5SA 3N7KA 3F1CA 5BQUC 3V91A 1GX4A 2WAWA 2XWNA 2FDBM 2WVMA 1FMZA 3BA5A 1YYNA 4Y7UA 4QBCA 1S4NA 1VGWA 4GP3A 2XWLA 4HO4A 1BFGA 1IJTA 4XWIA 4Z9WB 3OH3A 2AGDA 4LO1C 3S8JA 1V82A 3PHZA 1XZ6A 1YXWA 1R7VA 3UD8A 3P6IA 21BIA 1BLDA 5AJNA 5G00A 1H3MA 1II4A 5EG6C 5C8RA 3CA3A 3ZX7A 4D0ZA 5BXPA 1W3GA 1G9CA 1INJA 4Q9PA 2AQZA 2A8UA 1MP5A 1FGXA 1QQKA 3IM7A 4KC3A 4FROA 3D8VA 4AN6A 1IOBA 4P0LA 2Z87A 3OGZA 2E4MA 1V6WA 4FRAA 5C4BA 5CQNX
chains in the Genus database with same CATH superfamily
1IY2A 4RNAA 4G4OA 2Y9FA 1R7XA 3AJ6A 1EE8A 1G9DA 5CQPA 1EFUB 4ZFYB 2RITA 1VGUA 3M7GA 3A23A 5FTJA 3CF2A 5FTMA 4XGIA 1HJJA 2OEFA 1QUSA 4IZEA 3FTCA 4KC4A 4QOSA 1QAQA 1JR3D 1KNMA 1G95A 1VCLA 5BQUA 2YQZA 4JRAA 5EXTA 1SXJA 1K3XA 1FN0A 6I1BA 3OKRA 4K6RA 1TH2A 1XC8A 3J2PB 3H6RA 4OEEA 1ISVA 3CA0A 4NAIA 4X3AA 2UXCM 3T15A 5JMCA 4LRSA 1W5TA 4EE5A 3J7AS 4L16A 4FWHA 2D7RA 3OJMA 1ISXA 4DV6M 2M49A 2LBCA 1ILR1 2XGNA 1DGGA 3GRRA 4X62M 3KOYE 1WT2A 4FRQA 1DQOA 3I04M 1V6VA 1KFVA 3GLHA 1AUAA 1JT3A 2D43A 2VIIA 4Z6YA 2W0VA 3N7MA 5F8YA 4ZPXA 3K8DA 2DAMA 3U6QA 1YLAA 4GC9A 2H1RA 1FXOA 4B42A 4ZBVB 1K3WA 3VFDA 5C18A 3AH4A 2X60A 3I29B 1R7RA 1G93A 5C47A 2LVPC 4I4UA 1N36M 1JVDA 4IIWA 1L8QA 1IINA 4OX9M 1VZUA 3UGJA 3FJJA 3OJVA 1N34M 5BP5C 3Q7UA 3I0JA 1NY5A 2CFOA 4G1RA 4X66M 1XHBA 1ZJ3A 2JXNA 5DVHA 2G3QA 5FYEA 1ORYB 2P72A 2D7EA 3ZC9A 1WBAA 1NV8A 2BO8A 1FV3A 1ZAEA 2R65A 3WO4A 4JI3M 1GVNA 4BLCA 3F1YA 4M9SA 2CRUA 1PUMB 3V0OA 3U0XA 1SR4C 1IRAX 1TGUA 2ET2A 1SXJE 1YP3A 1SG9A 2ZANA 4P0JA 4GP0A 3OC9A 4MGHA 1UPSA 2CE7A 5CMIA 2MROB 2IHOA 3IM6A 4IZXA 2VF8A 2LNHC 2C99A 3I2XA 3KOZE 1WBCA 3O4DA 4MZFB 5AJPA 2QSFX 1VM8A 3THGA 1WGLA 2JY6B 4WP2A 2NXVA 4CISA 1Z59A 3PMEA 4QOZC 1OFIA 1MN3A 2OI7A 4CJ6A 4NSOB 2NVHA 1LV7A 4EE4A 4LF6M 4ZFUB 5IREB 3L2AA 2NTDA 3WHKA 3V90A 2V0LA 3H6QA 2YFQA 2KHHA 4MGZE 1IHKA 4LO0C 1H5SB 2ERMA 1QGQA 2C98A 2JZ1A 4DR7M 3C9PA 2Z4RA 5CMGX 4KXOA 5EQTA 1W57A 1IN4A 3BAUA 1JTCA 3USRA 4ARWA 4AW4A 3CQAA 2MH8A 5KQDA 3CA6A 2VS3A 1NKHB 1R6BX 1ZDGA 2XEPA 2RIZA 2FS1A 4HEOA 4IYBA 4NSRA 4A7ZA 3P6JA 2WSFF 1T6OA 1YF8B 2QPAA 2VS4A 1OMXA 2XMHA 1BA7A 3SATA 3F62B 1LL2A 3O49A 3B74A 4LO8B 4P0KA 3K8ZA 1H4EA 4RF1A 2K43A 1J0SA 3FKEA 2FYDB 1ZI1A 1G59A 3FFZA 4IY8A 2CWBA 2B3TA 4LW6A 1HCDA 2KZUA 2LVAA 1TWMA 4Y6UA 3B89A 3SXCA 1XMOM 2KXEA 2CV0A 2OI5A 4XBOA 1ZI3A 3CF0A 4G4QA 4KRVA 2L2DA 4I4OA 5EXPA 5D61A 1S4PA 2MJ5B 3SX3A 4EKXB 4LGMA 1E5KA 1ZJ2A 1V92A 2JNHA 4JP0A 2AM3A 1QQLA 3QWLA 4AN7B 2R4JA 4D11C 3GRVA 1I1EA 4A7YA 2O1GA 5BOWA 3BA7A 1XG6A 1DQGA 3BRGC 2VXMA 2RJ6A 3CKJA 2Z8YM 5JI2E 2E5LM 3K8EA 1JQJC 4FIXA 4Y62A 1FNNA 2KLLA 1FGAA 2GGOA 8I1BA 2NM1A 3CRGA 2YESA 4P17A 3V0BB 3C3DA 4G3QA 1NUNA 2X8AA 4LY6A 2QQ8A 4IBJA 4E1KA 2PA4A 5E6JA 3Q7YA 1BASA 3U2VA 3SC3A 3KDSE 2Y4JA 2Y0TA 4B3SM 1ZQ9A 3R9XB 1DIWA 1JV3A 4XFUA 3GLHB 5ITUA 3WHLA 2JCKA 2FNAA 1GX0A 1NHWC 2F2FA 2FYAA 5DZUA 2WBCA 3E8LC 2GZBA 3LLPA 3A46A 2R9KB 4GMQA 1ZCVA 1GABA 4MM3B 2ICXA 4D81A 2DZOB 1Q03A 3QYBA 2CU2A 2IWTB 2YQSA 1AXMA 4ZOTA 3B7NA 3CU0A 3JTJA 4H9WA 4FIYA 4JI5M 4M28A 1MJGM 1R7TA 2Z7JA 3M0EA 3VSZA 1FMMS 2LHCA 4OEGA 2DWZB 4DUYM 4JV5M 4JQ0A 1JYKA 3E26A 1Z4SA 1RU3A 1V84A 3FUWA 4OUJA 3D98A 4W5WA 4R6UB 1TTUA 3JUTA 4HO2A 4B4GA 4GITA 1JR3E 2AE7A 1IBKM 1A5TA 3GLGA 3ZQJA 1BFBA 3V0LA 3FTFA 4A7KA 3UD7A 2HWAA 3B7ZA 4HOCA 1PJIA 4G87A 4EEAA 2R44A 3K2LA 5FZZA 1IY1A 1C7YA 2LIQA 2Q9XA 1MU5A 2HL7A 1G3IA 4NOOB 1SR4A 3AH1A 1G97A 2R18A 1S0GA 3I2AA 1Z6TA 4CJMA 3FRIA 3CAHA 4G3PA 5EC5A 1FRWA 5BXRA 2FH0A 1OKSA 5EJCA 2F5NA 3QVBA 1H7HA 3B7QA 2RGOA 4AC3A 4R7PA 5IDSA 3RE8A 4KNXA 1INIA 2ESUA 3W0FA 3H6SE 2GNOA 3KSXA 2UX8A 2XOAA 1ZHJA 1D0MA 1NY6A 4ZA3B 2H5XA 3CA1A 4XKIA 2DKLA 4EB2B 3T38A 4D8HA 4C2SA 4LRTA 2FFUA 4HG6A 4LO0A 4ZKTB 1Y8GA 4NXNM 4AI6A 4FCWA 3J81S 4X38A 3O3PA 2P5TA 1IN8A 4LF8M 4MH0E 1WVCA 3OH0A 3SBJA 1XXHE 3HU1A 4NAKA 2XSZD 2DWMA 3FJDA 4OWLA 4D0TA 3T7OA 2BEBA 2D7IA 2VXTI 4FCUA 4IBKA 3F1CA 4AZFA 5BQUC 4GKKM 2BNKA 1SXJC 2BWEA 2FDBM 3FD9A 1FMZA 3BA5A 1YYNA 1VGWA 4GP3A 2LWXA 4HO4A 1BFGA 4XWIA 4PD2A 1T43A 1V82A 1XZ6A 3L29A 2L09A 5AJNA 1BLDA 4LJ8A 1IN7A 4OVZB 4NRWA 2O5RA 4MB7A 1HJPA 1G9CA 1INJA 4KODA 5KPZA 3HU3A 1QQKA 3IM7A 3H4JA 4AN6A 2C0NA 3TL4X 1VG5A 4IJEA 4G6ZA 5EXSA 5E24E 4DBGB 2JY5A 3PKPA 3C3EA 2XZFA 1FWVA 4DR3M 1IBMM 3O4BA 1R7UA 3GQ3A 3CKVA 4X37A 2Y0QA 1E94E 5C3BA 4DECA 2LVQD 1GJSA 1EIJA 1G71A 1JLYA 1FXJA 2HCBA 2UU9M 1JQZA 3L27A 5ITXA 1KWSA 3CKQA 1SXJB 2YUGA 2R45A 2I7BA 4FQWA 1N33M 3BXWA 4LO1A 3SPTA 3HN1A 3BAOA 2LHGA 3DZDA 4R3DA 4DV0M 3AJIB 2G5GX 3KMVA 3M6AA 4LZJA 2BEAA 4G3OA 1VEGA 1P63A 2LTUA 1QXMA 5J49A 4BB9A 4I4PA 4O6MA 3HHXA 2Z3XA 3B9PA 3BAGA 2ZBKB 2R6FA 2BJWA 4R7GA 3GLFA 1TW5A 4KBBA 2YQHA 5DDTA 2ZQOA 1NSFA 2XSZA 2R46A 1FGGA 5C3DA 3GLIE 1VZXA 3U61A 3AFHA 1BFCA 1YP2A 3E46A 4IBEA 1VEJA 4FRBA 3FUVA 4Y7GA 5CQLX 3EF2A 4H04A 5DSSB 3TQSA 4LJAA 3BRFA 2Y20A 4A3VB 5DYIA 2ZU7A 5FZYA 1QZEA 4BBAA 3RMYA 2Y21A 1I4WA 1OQMB 3SMSA 2YC3A 2J0AA 4I1BA 3RMXA 2FYCB 4WW0A 4DV3M 4DR4M 1GA8A 3TWLA 3W9TA 4LJ5A 3HL3A 3LW6A 4PDGA 3HHZA 5FTNA 3VUOA 1RZOB 1HNXM 4LJ4A 3SAUA 3LQQA 4I7IA 2Z4SA 4P02A 1S0DA 4GOVA 2XH9A 3LVVA 3D7WB 1BVSA 1DGBA 2RJ7A 5LMUM 1YROB 3UJ4A 3D8LA 1T4QA 3U60B 2EUCA 2ZU9A 1G41A 1OQLB 3U2XA 4ZDQA 4I81A 3RTJB 5F8SA 3FJ8A 4ECMA 2RGHA 2I7NA 3HZJA 5GKNA 2D22A 4EVWA 1NNUC 4ITQA 5IDTA 2Z49A 1MP4A 1QWJA 1S3SA 2A5YB 2JUJA 3T7NA 2M5ZA 3FRHA 4LF5M 4KEJA 2V0HA 1BARA 4DV7M 4JI2M 3EE5A 3HJQA 5EP3A 1YBIA 41BIA 1DZCA 1DLLA 3VK8A 5FTVA 1ZCTA 3BB2A 4ISRA 3NBCA 3BOSA 2ZQNA 1HWPB 4ASYA 3K9PA 3OBTA 4I4YA 4HA2A 3HWSA 3TPZA 3IOJA 4Y7VA 2AAIB 3D5NA 5C48A 3UMMA 4IBFA 3E25A 1F4IA 1KYIA 1OAOC 2XLJA 1YE9A 1GWVA 3Q80A 1PZZA 1WD4A 4QKRA 1ZMVA 2X2SA 2X4AA 4HJJA 2C96A 1G9RA 1PUUB 1W3FA 1S0LA 2Y7AA 3B9UA 3Q7XA 1ZMWA 1Z5AA 3RGSA 2P39A 1SS9A 4DUZM 4MZHA 1GGPB 2QENA 4B3TM 4LFBM 3TZTA 3AH2A 1XZZA 4LCBA 1TF0B 2RKOA 2HAKA 2UXDM 4UEGA 4BMAA 3LVWA 4FRDA 2AFGA 2KH2A 3LTQA 4LFAM 5DYGA 1QANA 1HT2E 1HKNA 1TIEA 3RMWA 7I1BA 1LZIA 3R4UA 2E4MC 3KSJA 3ZC7B 2RJ0A 2DWLA 2VXLA 1N78A 2WEEA 2X65A 3VEQA 2ZU8A 2GGQA 1R2YA 2F5SA 5EHAA 1R7YA 3GLIB 3PNNA 2Z48A 5C38A 4OWJA 1D2NA 4I96A 1HM8A 4B2XA 3N9WA 2XMEA 1F31A 1IT0A 3DK5A 1VGTA 1H7TA 1M16A 2C5RA 2ZTCA 4Q91A 2F5PA 4JI7M 1X37A 3U2TA 2XF3A 1D0LA 1H7FA 1L2DA 3LCVB 2Y9GA 3IAGC 1ZJPA 5C4DA 3S8KA 4QHSA 2LIEA 4CJBA 5FNXA 3VT1A 1L2HA 1IXZA 4LZZA 3PG0A 3MK6A 3KW6A 5AJOA 1ZJOA 5C36A 1MC3A 1XB2B 3T6PA 3ILAA 4PT5A 3FUOA 4ZLBB 4OW4A 1UFZA 3O4CA 3FJHA 2KDLA 4CIZA 4M4KA 4I4LA 3WINC 3O4OA 1NJGA 2BO4A 3SXBA 1H7QA 4L6V6 5IZ7D 3A45A 1G0RA 4QBVA 4Q9GA 2JZ0A 3FJ9A 1S4OA 1PC8B 4LG2A 3SHGB 2ZAMA 1CVSA 4IRQA 1EYRA 1BFFA 3ZLLA 2FGFA 3FUQA 4WBCA 3O5WB 4HO5A 2V6ZM 1DO0A 2RJ1A 3J80S 2VD4A 1FG5N 4Q7CA 2Y9XE 1TDZA 2Z86A 1O23B 3USQA 3CGWA 4LJ6A 5GAQA 3O3QA 3JUJA 4IBGA 2D1ZA 3PNVA 4JKQA 3OBRA 1WGNA 3SX5A 3VDUA 3IOHA 2J7NA 3U6DA 3SXEA 3L28A 1H5SC 3ZGFA 3UJNA 4L15A 1OMZA 1T3TA 3NBEA 3KS4A 3FJBA 1TDHA 5FTKA 1VDLA 3WA1A 3HHYA 2KI4A 5JLVA 2D44A 2CP8A 4DV4M 1RMLA 3HKPA 1TWEA 3GLGB 1W3AA 1R4GA 3I0KA 3CTWB 2BO7A 3V0BA 2DAGA 1ZI5A 1UM8A 1JB0F 4I4SA 1LL3A 4G4NA 4XK8F 1V34A 1XXHB 2KW0A 1L2CA 1HJLA 2V0IA 4GBPA 4GC5A 3BAHA 3OH4A 1DFQA 2FY7A 2MGWA 4FCTA 3V0AA 2QZ4A 1WHCA 2HWJA 3U6OA 1GWWA 2DZNB 2WSCF 2NS2A 2F8XC 4L8RC 4D11A 3KS8A 3KOWE 2VDBB 4IQPA 2Q3NB 3F1RA 5DNYA 4MZGB 4Y9XA 4GHAA 4GH9A 3MPPG 1RY7A 4KPXA 4I8MA 2HZ9A 1FZWA 3VDPA 3AOGA 1XNRM 2VSAA 2LH0A 8CATA 2BO6A 4J2XA 1WT0A 2WVKA 3N7JA 1IM2A 5H37D 4IHZA 4CJCA 3V0PA 3ZCBB 3NBIA 2KNVA 2JWSA 4KC2A 3PUBA 2K6BA 5D91A 3TC2A 1VH1A 2DPWA 1PJSA 1PJQA 4AKGA 3SXDA 3BBZA 3U0YA 1G8PA 1PJJA 1GX4A 2WAWA 1SXJD 1OJLA 3LMMA 1TTEA 3HHWA 1NVMA 5KO3A 4FD2A 2AGDA 4LO1C 3W67A 5IWAM 3PHZA 3UD8A 21BIA 4OVZA 1PM5A 3FTDA 2OO9A 5BXPA 2FE8A 4NC6A 2C9CA 1W3GA 4KHPM 5BR8M 1MP5A 1FGXA 1Q02A 2E4MA 4R71A 4OEFA 4MGYE 3FGMA 1D0HA 1WJ7A 1DV0A 1P3QQ 5BXSA 1JT4A 3R2WA 4MYBA 2KNZA 3GPPA 1ZDFA 3WO2A 1Z5BA 3R3IA 1HT1E 4UN2B 2K4AB 3I0EA 5ITXE 4EFPA 1K5VA 3PVSA 4AKHA 1E9RA 2WZJA 5IT9S 4HCQA 1NQIB 4G6MA 3AKHA 1I52A 3GLHE 3KVWA 4LO3A 2V1CA 4DEPA 3GUEA 1R8NA 3A21A 3PFIA 1R82A 3GO8A 3U6LA 3EIHA 4F1IA 3OAMA 4LF7M 1IQPA 1PWAA 4I0YA 1Q1UA 5EXXA 4USPA 3VSFA 2K9DA 2XZUA 1H5SD 2FO1A 4EEEB 3T1HM 2RQ9A 4MIXA 2Y4LA 3MJ5A 1DGHB 3IHPA 1H4CA 1EZIA 2ZAOA 5ITTA 4JI8M 4QD2B 1V6XA 4FRPA 4JKXB 1PRBA 5EP2A 2DAIA 2E8BA 4P00A 4JI6M 2YR0A 4X39A 4ISQA 4P16A 1JY0A 1G9BA 2DHYA 1NJFA 4L41C 4DR1M 1JT7A 2KI6B 3BAVA 3BA4A 1HM0A 1IXSA 4ENDA 1Q3CA 3VT2A 1HIBA 2VLCA 2F5QA 4LO7C 2EJSA 1RG8A 5FUHA 2W82A 4KO8A 1W5SA 5DUYA 4LW3A 4KPZA 3C58A 3K9OA 4EEGA 1MD6A 2P23A 2OQ4A 1O7QA 2G8LA 2K8RA 3VLFB 3SX7A 4L78A 1JV1A 4BQHA 2ZR1B 4CGYB 1HCEA 2E3DA 1DGHA 5DDVA 2FOIC 2MZBA 1IILA 1ON6A 5FSWA 1GJTA 2XFTA 1DJSB 4F2LA 4EFQA 4HR6C 3RMVA 3FE3A 4LF9M 1Z2VA 2F2FC 5C1GA 4EEOA 3O4AA 2BWBA 1YSYA 1JLXA 3ZXGA 1IRPA 4GAIA 3GRUA 4DR2M 1FR9A 1LZJA 1XYFA 2DHRA 1GLNA 4KT7A 4LFCM 2Y9WC 4B3RM 4GAFA 1OIPA 4JPZA 1Z90A 4FVMA 5JI3E 4KT0F 2K0BX 1ON8A 2YQCA 1G4AE 3IG8A 3AZVA 4J23B 3P53A 1FOAA 5EIYA 4KQLA 1IY0A 4FRLA 3ST8A 5FU0A 2LVOC 1R2ZA 2UXBM 2MR9A 2X49A 3SNVA 4J2YA 3ZXDA 1MP3A 2J0BA 3BX1C 2CV1A 4QKSA 1GQCA 2VUAA 1IXRC 3NBDA 3FUUA 3QR5A 3U6EA 1N75A 3U5ZB 1QAOA 3QAUA 5BVPI 1HQYE 4B3MM 2L5XA 2VXRA 3JUKA 1GQ9A 2VQFM 3PKQA 2QP9X 2BFHA 3AKGA 3V0QA 4Y64A 1R8OA 3FYDA 3U6SA 3DUVA 4DV5M 2VQEM 2M60A 3A42A 1ZI4A 3FUXA 4I4QA 3D8BA 1HR0M 1FJGM 2VS5A 2AECA 2L7HA 5C3AA 1EPWA 2DRYA 1VEKA 2RG9B 3BRKX 4II0A 5F8WA 4B7HA 2HKJA 5C49A 3ILKA 1G1LA 1O0RA 5EP4A 4KNRA 5CMJA 2EO2A 4B08A 3A98B 2MLLB 3GRYA 3GP1A 2QKXA 2HWMA 3CRHA 1FWYA 1JYLA 2DENA 4L4IA 5C4FA 5CQMX 5ITYA 2QBYA 5BP5A 5BXCA 3E9SA 2QN4A 4J2KA 3AOEA 2OEGA 3I0DA 5FTLA 3V8ZA 1BLAA 2JA2A 2YCMA 2A8WA 4GKJM 3CF6E 4LO3C 4RF0A 3U6CA 4PC4A 2FYBA 1Z5CA 4USOA 2X5ZA 1E32A 5L6SA 3UZUA 4EIWA 1ITBA 4Y6NA 3GPUA 3R4SA 3FYCA 2VFZA 1DZDA 3LCUA 4IBCA 3OGFA 4DE7A 2NQ8C 4DDZA 3OTOM 4I5SA 3FJKA 3GLFB 5BPVA 2WE9A 4EEMA 1DO2A 2RJ9A 2Q4JA 1H4DA 1ZMUA 4AYJA 1HWMB 1ZJ0A 4Y28F 3BRDA 2DAKA 4TLPA 2P73A 1A8DA 1H7EA 2APCA 4M0WA 2Y6PA 1NNJA 2LVNC 2J5YA 4D48A 4ZGRB 1S0FA 3W0LB 3O44A 3V8YA 5F90A 3VKHA 1AVAC 5C1LA 1H7LA 1S0CA 2OOAA 2DVWB 4FCVA 2FFJA 1W55A 4I4XA 4OWKA 2JCOA 4LO2C 3RSJA 1TVYA 1TOOA 5EJ1A 2ZTDA 1XWIA 4NRVA 4I37A 1FO8A 3POLA 3KOXE 4G4RA 5CMFX 4XFSA 3HU2A 4B2WA 1M2TB 4NL4H 4KEKA 4B7FA 1NZKA 1VH3A 2CHGA 4II7A 4F83A 2X2TA 2NP0A 5FZUA 3KXEC 3OGGA 2R62A 4LJ9A 1ABRB 2DNAA 2CUZA 2ICYA 4YS8A 4LF4M 2RSTA 3CA4A 3MALA 4WURA 4OU7A 2J3PA 4FWDA 2UUCM 3AZWA 3U60A 3OH2A 1L1ZA 2Y4MA 4D80A 1H5TA 5FV9A 1J09A 4QC4A 2EA0A 1ONKB 2J7OA 3AJ5A 5FNWA 4JISA 4P6AA 1I94M 4JI4M 2R0IA 3PXGA 1IIMA 5EJZA 4G3SA 2PX7A 3FJCA 4L4HA 1WIVA 4B7GA 2V0KA 2GQFA 3CRIA 1OTRA 4ANRA 1ISYA 1PGYA 3J27B 1J5EM 4JAWA 1LZ0A 3KFUG 3DFZA 3U5ZA 4MNDA 4M2AA 3I0FA 4FVVA 3UJ0A 1NWGB 1VPAA 1KSFX 2F4VM 4H75A 2L6OA 2VF7A 4QHTA 1OFHA 1ISZA 1GL6A 3WINA 4EFRA 1FR8A 2KRKA 2VK9A 4Y7TA 2DWNA 1H6UA 2OOBA 5L8RF 5BXTA 1G9AA 3SYLA 2D7HA 2X5SA 2O25A 5EP1A 3SHFA 3V91A 1QVRA 3GLGE 2XWNA 3FTEA 1IJTA 4Z9WB 3OH3A 4HLQA 3S8JA 1YXWA 3TE6A 3I4VA 5G00A 1H3MA 1II4A 5C8RA 4D0ZA 4Q9PA 2AQZA 3HGIA 4FROA 3D8VA 4FRAA 5CQNX 2DI0A 1I1BA 4YY3M 1DGFA 2KNAA 1ZCUA 1QQWA 3GPXA 3U2UA 1V6UA 2D0JA 3AKIA 3UDAA 3E4RA 4NALA 5L6VA 3FJFA 1AF9A 3FWWA 2UUSA 5D63A 3DOAA 4J2SA 1ZV1A 3H6RB 2L4EA 4XFTA 5DFLA 4IBIA 4IY9A 4DR6M 3SAWA 1L1TA 4QALA 1N77A 3IIRA 2EKFA 1HQCA 1MX0A 4AYLA 1HWOB 3JRRA 3I0LA 2WRYA 5FU8A 5KPTA 2DREA 1WXQA 1HNWM 3J7BA 1NHGC 1R80A 2KKIA 3SASA 1T9FA 3VKGA 1QZMA 2AHMA 3W68A 5C4CA 2O1HA 2NZ9A 1GO5A 4HO8A 1AFCA 1XMQM 1OQYA 4CVHA 1CUKA 1TZFA 4CHTB 2AXMA 1CE7B 1N32M 1JT5A 3BTAA 4LGYA 5IFYA 3HBWA 1SZ6B 3LQRA 5D92A 4JXJA 4G9MA 3T8SA 3VT0A 1LL0A 2QBYB 1QG8A 2WSEF 1R81A 1IN5A 2AH9A 1DFCA 2PGVA 2I7PA 2VSHA 2CHQA 3RTIB 1VZTA 2L7IA 2VSIA 4B5BA 3V0MA 4I2SA 1Z0HA 1HV9A 3JAMS 2V0JA 4MGKE 9ILBA 2FFVA 3ZH9B 1E9SA 4FW9A 4GEWA 1OAIA 3HALA 2QH5A 2QYIB 3V79C 4JI1M 2JP7A 2EKKA 2KA6B 4HO9A 3FUTA 4B4MA 5A2QS 5I1FA 4GOYA 5B2HA 2F5OA 4FCEA 1MC9A 5E26A 2LXEA 4B3UA 4LO2A 4YOLA 1NF5B 3SMPA 1EVTA 3U61B 3A07A 3L25A 4HO3A 4AG6A 1LTMA 3WMUA 2N35A 1K5UA 5C1BA 1QGSA 4AG5A 2L4FA 3SFZA 1FO9A 3KP0E 1QYRA 1PJTA 4G6JA 5C1HA 3U6PA 3KP1E 3AV0A 3AKZA 4Q7JA 1G8OA 3GLIA 2KZSA 2AM4A 2JCLA 4REZA 4JD0A 2VSEA 5FLXS 3K1JA 3JR4A 2RIYA 3I0IX 3GLFE 3Q8XA 1Q04A 4G9NA 3V0AB 4KEIA 3KIAA 2MIBA 3QYDA 3FJAA 4AQYM 2UUAM 4OW0A 1G2VA 4TUWA 1LZ7A 3SX8A 3RFWA 1AVUA 4FRHA 1S0BA 1H5RA 1W77A 1H5SA 1H5RB 4I4VA 5D62A 3N0KA 4J18A 3IM5A 3WO3A 3UD9A 1EYLA 4LJ7A 1QDRA 3WMVA 1TW1A 3OH1A 4CJ8A 3MHVC 1JVGA 1NO1A 1C1KA 2OPFA 2WVLA 4S12A 4IONA 3R8FA 1TR8A 3HX3A 1QDTA 4AKIA 2WGZA 5HPZA 4F34A 1IFYA 3I01M 3MMPA 5FTSA 2YC5A 4KLNA 1G23A 3Q8GA 1LVWA 4GRIA 1H5TB 3I4YA 5KQ8A 1GL7A 3GQ4A 2K47A 2D7GA 2AESA 3VWCA 3FOQA 3HOMA 2XFSA 3GPYA 2YNMD 3NJ5A 1D0KA 3ZGGA 3TQDA 3K1XA 5LMNM 1V83A 1N4KA 5F3WA 3IECA 1TP0A 1K4VA 4JI0M 2DS0A 1WT3A 2W0WA 4RKUF 3Q4SA 3AL0C 1ZCYA 1V33A 1H7GA 4JYAM 2I5EA 3IG5A 1NHEB 3CA5A 2YQJA 4DV1M 2Q2EB 4UY4A 2NYYA 1K82A 3TWMA 4HO0A 2CHVA 1ISWA 5KPRA 3CU1B 3U6MA 1TH3A 4I3NA 2GO2A 3H4MA 1YTOA 1NMMB 1GKIA 1XNQM 1O7OA 5I1BA 2RIXA 3ZLKA 4MGIE 2RJ4A 2D23A 4PCZA 4FRMA 4FWGA 3HSMA 4QNRA 1HM9A 1Q39A 4PDIA 2JCJA 5CMHA 1AVWB 4HO6A 1Q3BA 3E21A 3GQ5A 1E0OA 4QNMA 1PZTA 3AKFA 4EE3A 4JN6A 3T7MA 1R5LA 3V0NA 5ITQA 4LO7B 4DCKC 4FREA 2XWMA 3QYEA 4GIPA 1FV2A 2KRUA 4I1EA 4HL4A 3SXGA 1VGZA 4X64M 3DA1A 3SYKA 1FQ9A 3EIEA 1J7KA 1WR1B 1QUTA 2QNJA 4L4UA 2I1BA 3U2WA 1VQ1A 3LW5F 2RJ5A 3HJSA 3T1YM 1HNZM 3HMYA 4FGFA 3I0HA 3BCVA 3NBNA 4O6NA 2APLA 4I6IA 1AIPC 3L26A 2VU9A 1WSZA 2DXIA 3CKNA 2ERCA 31BIA 3FJEA 1OIZA 3OJ2A 2CV2A 4Z8SB 1EV2A 1WT1A 3K92A 3ZF8A 2KEBA 2D20A 2DAEA 4M9XA 4IRPA 1YP4A 3V76A 4DR5M 3DJ4A 4Y7FA 2RJ8A 2UUBM 5C4EA 4X65M 3ZC8A 1S0EA 4M9ZA 1NV9A 3JR5A 3SARA 1WD3A 4NANA 3NWLA 2CEAA 1G3LA 2ZM6M 3UK6A 1ZIZA 3I0CA 4QO3A 2R4EA 3POKA 2HHHM 4M2BA 3IOIA 5JQQA 3FJIA 3BAQA 1HWNB 1IXSB 1AVXB 1QAMA 2OI6A 1TFMB 1IBLM 2O1FA 2Y4KA 4Z8XA 4I8OA 1G82A 2DRZA 3SXAA 2BJVA 3CKOA 4D82A 3RGPA 2C9OA 2AM5A 2PGYA 3CGXA 3RSBA 3F92A 3AOEC 1IN6A 1JR3A 1VICA 2V1UA 4Y63A 5CQOA 3I0GA 1PZYB 3HY5A 2I5KA 4IJFA 4QD2C 1YUBA 2DZLA 2MC2A 4AAWA 4KC1A 4IBBA 3SAVA 1ZJ1A 3A22A 2QCUA 1FWUA 3Q7WA 4DENA 3NGWA 2QHOB 1TH4A 3N7LA 1L2BA 2QGIA 4ZFWB 4YHHM 5ITRA 4IBDA 3BADA 4ASJA 3I51A 2D24A 2JY7A 3C9ZA 3VK7A 2HW9A 3TWKA 4B4BA 2P6WA 3HJ8A 1XXHA 4I4RA 3N7KA 4NXMM 4K0KM 3PNYA 4DV2M 2WVMA 4Y7UA 4QBCA 1S4NA 2XWLA 2RRUA 2JY8A 4M0DA 1R7VA 3P6IA 2O01F 5EG6C 3CA3A 3ZX7A 7CATA 4GHLA 2A8UA 3NBXX 4KC3A 1VDDA 5HS2A 5C4BA 1IOBA 4P0LA 2Z87A 3OGZA 1V6WA
chains in the Genus database with same CATH topology
1IY2A 4RNAA 4G4OA 2Y9FA 1R7XA 3AJ6A 1EE8A 1G9DA 5CQPA 4ZFYB 2RITA 1VGUA 3M7GA 3A23A 5FTJA 3CF2A 5FTMA 4XGIA 1HJJA 2OEFA 4KC4A 4IZEA 3FTCA 4QOSA 1QAQA 1JR3D 1KNMA 1G95A 1VCLA 5BQUA 2YQZA 4JRAA 5EXTA 1SXJA 1K3XA 1FN0A 6I1BA 3OKRA 4K6RA 1TH2A 1XC8A 3J2PB 3H6RA 4OEEA 1ISVA 3CA0A 4NAIA 4X3AA 2UXCM 3T15A 5JMCA 4LRSA 1W5TA 4EE5A 3J7AS 4L16A 4FWHA 2D7RA 3OJMA 1ISXA 4DV6M 2M49A 1ILR1 2XGNA 1DGGA 3GRRA 4X62M 3KOYE 1WT2A 4FRQA 1DQOA 1V6VA 1KFVA 3GLHA 1JT3A 2D43A 2VIIA 4Z6YA 2W0VA 3N7MA 5F8YA 4ZPXA 3K8DA 3U6QA 4GC9A 2H1RA 1FXOA 4B42A 4ZBVB 1K3WA 3VFDA 5C18A 3AH4A 2X60A 3I29B 1R7RA 1G93A 5C47A 4I4UA 1N36M 1JVDA 4IIWA 1L8QA 1IINA 4OX9M 1VZUA 3UGJA 3FJJA 3OJVA 1N34M 5BP5C 3Q7UA 3I0JA 1NY5A 2CFOA 4G1RA 4X66M 1XHBA 1ZJ3A 5DVHA 5FYEA 1ORYB 2P72A 2D7EA 3ZC9A 1WBAA 2BO8A 1FV3A 1ZAEA 2R65A 3WO4A 4JI3M 1GVNA 4BLCA 3F1YA 4M9SA 1PUMB 3V0OA 3U0XA 1SR4C 1IRAX 1TGUA 2ET2A 1SXJE 1YP3A 2ZANA 4P0JA 4GP0A 3OC9A 4MGHA 1UPSA 2CE7A 5CMIA 2IHOA 3IM6A 4IZXA 2LNHC 2C99A 3I2XA 3KOZE 1WBCA 3O4DA 4MZFB 5AJPA 1VM8A 3THGA 2NXVA 4CISA 1Z59A 3PMEA 4QOZC 1OFIA 2OI7A 4NSOB 2NVHA 1LV7A 4EE4A 4LF6M 4ZFUB 5IREB 3L2AA 2NTDA 3WHKA 3V90A 2V0LA 3H6QA 2YFQA 1IHKA 4MGZE 4LO0C 1H5SB 2ERMA 1QGQA 2C98A 4DR7M 2Z4RA 5CMGX 4KXOA 5EQTA 1W57A 1IN4A 3BAUA 1JTCA 3USRA 4ARWA 4AW4A 3CQAA 5KQDA 3CA6A 2VS3A 1NKHB 1R6BX 1ZDGA 2XEPA 2RIZA 4IYBA 4NSRA 4A7ZA 3P6JA 1YF8B 2QPAA 2VS4A 1OMXA 2XMHA 1BA7A 3SATA 3F62B 1LL2A 3O49A 4LO8B 4P0KA 3K8ZA 1H4EA 4RF1A 2K43A 1J0SA 3FKEA 2FYDB 1ZI1A 1G59A 3FFZA 4IY8A 4LW6A 1HCDA 2KZUA 1TWMA 4Y6UA 3SXCA 1XMOM 2KXEA 2CV0A 2OI5A 4XBOA 1ZI3A 3CF0A 4G4QA 4KRVA 4I4OA 5EXPA 5D61A 1S4PA 3SX3A 4EKXB 4LGMA 1E5KA 1ZJ2A 4JP0A 2AM3A 1QQLA 3QWLA 4AN7B 2R4JA 4D11C 3GRVA 1I1EA 4A7YA 2O1GA 5BOWA 3BA7A 1XG6A 1DQGA 3BRGC 2VXMA 2RJ6A 3CKJA 5JI2E 2E5LM 3K8EA 1JQJC 4FIXA 4Y62A 1FNNA 2KLLA 1FGAA 2GGOA 8I1BA 2NM1A 3CRGA 2YESA 3V0BB 4G3QA 1NUNA 2X8AA 4LY6A 4E1KA 4IBJA 2PA4A 5E6JA 3Q7YA 1BASA 3U2VA 3SC3A 3KDSE 2Y4JA 2Y0TA 4B3SM 1ZQ9A 3R9XB 1DIWA 1JV3A 4XFUA 3GLHB 5ITUA 3WHLA 2JCKA 2FNAA 1GX0A 1NHWC 2F2FA 2FYAA 5DZUA 2WBCA 3E8LC 2GZBA 3LLPA 3A46A 2R9KB 4GMQA 1ZCVA 4MM3B 2ICXA 4D81A 2DZOB 1Q03A 2CU2A 2IWTB 2YQSA 1AXMA 4ZOTA 3CU0A 3JTJA 4H9WA 4FIYA 4JI5M 4M28A 1R7TA 2Z7JA 3M0EA 3VSZA 1FMMS 4OEGA 2DWZB 4DUYM 4JV5M 4JQ0A 1JYKA 3E26A 1Z4SA 1V84A 3FUWA 4OUJA 3D98A 4W5WA 4R6UB 1TTUA 3JUTA 4HO2A 4B4GA 4GITA 2AE7A 1IBKM 3GLGA 1BFBA 3V0LA 3FTFA 4A7KA 3UD7A 2HWAA 4HOCA 1PJIA 4G87A 4EEAA 3K2LA 5FZZA 1IY1A 2LIQA 2Q9XA 1MU5A 2HL7A 1G3IA 4NOOB 1SR4A 3AH1A 1G97A 2R18A 1S0GA 3I2AA 1Z6TA 4CJMA 3CAHA 4G3PA 5EC5A 1FRWA 5BXRA 5EJCA 2F5NA 3QVBA 1H7HA 2RGOA 4AC3A 4R7PA 5IDSA 3RE8A 4KNXA 1INIA 2ESUA 3W0FA 3H6SE 3KSXA 2UX8A 2XOAA 1ZHJA 4ZA3B 1NY6A 3CA1A 4XKIA 4EB2B 3T38A 4D8HA 4C2SA 4LRTA 2FFUA 4HG6A 4LO0A 4ZKTB 4AI6A 4NXNM 4FCWA 3J81S 4X38A 3O3PA 2P5TA 1IN8A 4LF8M 4MH0E 1WVCA 3OH0A 3SBJA 3HU1A 4NAKA 2XSZD 2DWMA 3FJDA 4OWLA 4D0TA 3T7OA 2BEBA 2D7IA 2VXTI 4FCUA 4IBKA 3F1CA 4AZFA 5BQUC 4GKKM 2BNKA 1SXJC 3FD9A 2FDBM 1FMZA 3BA5A 1YYNA 1VGWA 4GP3A 2LWXA 4HO4A 1BFGA 4XWIA 4PD2A 1V82A 1XZ6A 3L29A 2L09A 5AJNA 1BLDA 4LJ8A 1IN7A 4OVZB 4NRWA 2O5RA 4MB7A 1G9CA 1INJA 4KODA 5KPZA 3HU3A 1QQKA 3IM7A 4AN6A 2C0NA 3TL4X 5E24E 4IJEA 4G6ZA 5EXSA 3PKPA 2XZFA 1FWVA 4DR3M 1IBMM 3O4BA 1R7UA 3GQ3A 3CKVA 4X37A 2Y0QA 1E94E 5C3BA 4DECA 1JLYA 1FXJA 2HCBA 2UU9M 1JQZA 3L27A 5ITXA 1KWSA 3CKQA 1SXJB 2YUGA 2R45A 2I7BA 4FQWA 1N33M 4LO1A 3SPTA 3HN1A 3BAOA 3DZDA 4R3DA 4DV0M 3AJIB 2G5GX 3KMVA 3M6AA 4LZJA 2BEAA 1P63A 1QXMA 5J49A 4BB9A 4I4PA 4O6MA 3HHXA 2Z3XA 3B9PA 3BAGA 2ZBKB 2BJWA 4R7GA 3GLFA 1TW5A 4KBBA 2YQHA 5DDTA 2ZQOA 1NSFA 2XSZA 2R46A 1FGGA 5C3DA 1VZXA 3U61A 3AFHA 1BFCA 1YP2A 4IBEA 4FRBA 3FUVA 4Y7GA 5CQLX 3EF2A 4H04A 5DSSB 3TQSA 4LJAA 3BRFA 2Y20A 4A3VB 5DYIA 2ZU7A 5FZYA 4BBAA 3RMYA 2Y21A 1I4WA 1OQMB 3SMSA 2YC3A 2J0AA 4I1BA 3RMXA 2FYCB 4WW0A 4DV3M 4DR4M 1GA8A 3TWLA 3W9TA 4LJ5A 3HL3A 3LW6A 4PDGA 3HHZA 5FTNA 3VUOA 1RZOB 1HNXM 4LJ4A 3SAUA 3LQQA 4I7IA 2Z4SA 4P02A 1S0DA 4GOVA 2XH9A 3LVVA 3D7WB 1DGBA 2RJ7A 5LMUM 1YROB 3UJ4A 3D8LA 1T4QA 3U60B 2EUCA 2ZU9A 1G41A 1OQLB 3U2XA 4ZDQA 4I81A 3RTJB 5F8SA 3FJ8A 4ECMA 2RGHA 2I7NA 5GKNA 2D22A 4EVWA 1NNUC 4ITQA 5IDTA 2Z49A 1MP4A 1QWJA 1S3SA 2A5YB 3T7NA 2M5ZA 4LF5M 4KEJA 2V0HA 1BARA 4DV7M 4JI2M 3EE5A 3HJQA 5EP3A 1YBIA 41BIA 1DZCA 1DLLA 3VK8A 5FTVA 1ZCTA 3BB2A 4ISRA 3NBCA 3BOSA 2ZQNA 1HWPB 4ASYA 3OBTA 4I4YA 4HA2A 3HWSA 3TPZA 3IOJA 4Y7VA 2AAIB 3D5NA 5C48A 3UMMA 4IBFA 3E25A 1KYIA 2XLJA 1YE9A 1GWVA 3Q80A 1PZZA 1WD4A 4QKRA 2X2SA 2X4AA 4HJJA 2C96A 1G9RA 1PUUB 1W3FA 1S0LA 2Y7AA 3B9UA 3Q7XA 1Z5AA 3RGSA 2P39A 1SS9A 4DUZM 4MZHA 1GGPB 2QENA 4B3TM 4LFBM 3TZTA 3AH2A 1XZZA 4LCBA 2RKOA 2UXDM 4UEGA 4BMAA 3LVWA 4FRDA 2AFGA 2KH2A 3LTQA 4LFAM 5DYGA 1QANA 1HT2E 1HKNA 1TIEA 3RMWA 7I1BA 1LZIA 3R4UA 2E4MC 3KSJA 3ZC7B 2RJ0A 2DWLA 2VXLA 1N78A 2WEEA 2X65A 3VEQA 2ZU8A 2GGQA 1R2YA 2F5SA 5EHAA 1R7YA 3GLIB 3PNNA 2Z48A 5C38A 4OWJA 1D2NA 4I96A 1HM8A 4B2XA 3N9WA 2XMEA 1F31A 1IT0A 3DK5A 1VGTA 1H7TA 1M16A 2C5RA 4Q91A 2F5PA 4JI7M 1X37A 3U2TA 2XF3A 1H7FA 1L2DA 2Y9GA 3IAGC 1ZJPA 5C4DA 3S8KA 4QHSA 2LIEA 4CJBA 5FNXA 3VT1A 1L2HA 1IXZA 4LZZA 3PG0A 3MK6A 3KW6A 5AJOA 1ZJOA 5C36A 1MC3A 3ILAA 4PT5A 3FUOA 4ZLBB 4OW4A 3O4CA 3FJHA 4M4KA 4I4LA 3WINC 3O4OA 1NJGA 2BO4A 3SXBA 1H7QA 5IZ7D 3A45A 1G0RA 4QBVA 4Q9GA 3FJ9A 1S4OA 1PC8B 4LG2A 3SHGB 2ZAMA 1CVSA 4IRQA 1EYRA 1BFFA 3ZLLA 2FGFA 3FUQA 4WBCA 3O5WB 4HO5A 2V6ZM 1DO0A 2RJ1A 3J80S 2VD4A 1FG5N 4Q7CA 2Y9XE 1TDZA 2Z86A 1O23B 3USQA 4LJ6A 5GAQA 3O3QA 3JUJA 4IBGA 2D1ZA 3PNVA 4JKQA 3OBRA 3SX5A 3VDUA 3IOHA 2J7NA 3U6DA 3SXEA 3L28A 1H5SC 3ZGFA 3UJNA 4L15A 1OMZA 1T3TA 3NBEA 3KS4A 3FJBA 1TDHA 5FTKA 3WA1A 3HHYA 2KI4A 5JLVA 2D44A 4DV4M 1RMLA 3HKPA 1TWEA 3GLGB 1W3AA 3I0KA 3CTWB 2BO7A 3V0BA 1ZI5A 1UM8A 1LL3A 4I4SA 4G4NA 2V0IA 1XXHB 2KW0A 1L2CA 1HJLA 4GBPA 4GC5A 3BAHA 3OH4A 1DFQA 2FY7A 4FCTA 3V0AA 2QZ4A 3U6OA 1GWWA 2DZNB 2NS2A 2F8XC 4L8RC 4D11A 3KS8A 3KOWE 4IQPA 2Q3NB 3F1RA 5DNYA 4MZGB 4Y9XA 4GHAA 4GH9A 3MPPG 1RY7A 4KPXA 4I8MA 2HZ9A 1FZWA 3VDPA 3AOGA 1XNRM 2VSAA 2LH0A 8CATA 2BO6A 4J2XA 1WT0A 2WVKA 3N7JA 1IM2A 5H37D 4IHZA 4CJCA 3V0PA 3ZCBB 3NBIA 4KC2A 3PUBA 5D91A 3TC2A 1VH1A 2DPWA 4AKGA 3SXDA 3U0YA 1G8PA 1PJJA 1GX4A 2WAWA 1SXJD 1OJLA 3LMMA 3HHWA 1NVMA 5KO3A 4FD2A 2AGDA 4LO1C 5IWAM 3PHZA 3UD8A 21BIA 4OVZA 1PM5A 3FTDA 5BXPA 2FE8A 2C9CA 1W3GA 4KHPM 5BR8M 1MP5A 1FGXA 2E4MA 4OEFA 4MGYE 3FGMA 1D0HA 5BXSA 1JT4A 3R2WA 4MYBA 3GPPA 1ZDFA 3WO2A 1Z5BA 3R3IA 1HT1E 2K4AB 3I0EA 5ITXE 4EFPA 1K5VA 3PVSA 4AKHA 1E9RA 5IT9S 4HCQA 1NQIB 4G6MA 3AKHA 1I52A 3KVWA 4LO3A 2V1CA 4DEPA 3GUEA 1R8NA 3A21A 3PFIA 1R82A 3GO8A 3U6LA 3EIHA 3OAMA 4LF7M 1IQPA 1PWAA 4I0YA 1Q1UA 5EXXA 4USPA 3VSFA 1H5SD 2XZUA 2FO1A 4EEEB 3T1HM 2RQ9A 4MIXA 2Y4LA 3MJ5A 1DGHB 1H4CA 1EZIA 2ZAOA 5ITTA 4JI8M 4QD2B 1V6XA 4FRPA 4JKXB 5EP2A 2E8BA 4P00A 4JI6M 2YR0A 4X39A 4ISQA 4P16A 1JY0A 1G9BA 1NJFA 4L41C 4DR1M 1JT7A 2KI6B 3BAVA 3BA4A 1HM0A 4ENDA 1Q3CA 3VT2A 1HIBA 2VLCA 2F5QA 4LO7C 1RG8A 5FUHA 2W82A 4KO8A 1W5SA 5DUYA 4LW3A 4KPZA 3C58A 4EEGA 1MD6A 2P23A 2OQ4A 1O7QA 2G8LA 2K8RA 3VLFB 3SX7A 4L78A 1JV1A 4BQHA 2ZR1B 4CGYB 1HCEA 2E3DA 1DGHA 5DDVA 2FOIC 2MZBA 1IILA 1ON6A 5FSWA 2XFTA 1DJSB 4EFQA 3RMVA 4HR6C 4LF9M 1Z2VA 2F2FC 5C1GA 4EEOA 3O4AA 1YSYA 1JLXA 3ZXGA 1IRPA 4GAIA 3GRUA 4DR2M 1FR9A 1LZJA 1XYFA 2DHRA 1GLNA 4KT7A 4LFCM 2Y9WC 4B3RM 4GAFA 4JPZA 1Z90A 4FVMA 5JI3E 1ON8A 2YQCA 1G4AE 3IG8A 3AZVA 4J23B 3P53A 1FOAA 5EIYA 4KQLA 1IY0A 4FRLA 3ST8A 5FU0A 1R2ZA 2UXBM 2X49A 3SNVA 3ZXDA 4J2YA 1MP3A 2J0BA 3BX1C 2CV1A 4QKSA 1GQCA 2VUAA 1IXRC 3NBDA 3FUUA 3QR5A 3U6EA 1N75A 3U5ZB 1QAOA 3QAUA 5BVPI 1HQYE 4B3MM 2L5XA 2VXRA 3JUKA 1GQ9A 2VQFM 3PKQA 2QP9X 2BFHA 3AKGA 3V0QA 4Y64A 1R8OA 3FYDA 3U6SA 3DUVA 4DV5M 2VQEM 2M60A 3A42A 1ZI4A 3FUXA 4I4QA 3D8BA 1HR0M 1FJGM 2VS5A 2AECA 2L7HA 5C3AA 1EPWA 2DRYA 2RG9B 3BRKX 4II0A 5F8WA 4B7HA 2HKJA 5C49A 3ILKA 1G1LA 1O0RA 5EP4A 4KNRA 5CMJA 2EO2A 4B08A 3A98B 2MLLB 3GRYA 3GP1A 2QKXA 2HWMA 3CRHA 1FWYA 1JYLA 4L4IA 5C4FA 5CQMX 5ITYA 2QBYA 5BP5A 5BXCA 3E9SA 2QN4A 4J2KA 3AOEA 2OEGA 3I0DA 5FTLA 3V8ZA 1BLAA 2JA2A 2YCMA 2A8WA 4GKJM 3CF6E 4LO3C 4RF0A 3U6CA 4PC4A 2FYBA 1Z5CA 4USOA 2X5ZA 1E32A 5L6SA 3UZUA 4EIWA 1ITBA 4Y6NA 3GPUA 3R4SA 3FYCA 2VFZA 1DZDA 4IBCA 3OGFA 4DE7A 2NQ8C 4DDZA 3OTOM 4I5SA 3FJKA 3GLFB 5BPVA 2WE9A 4EEMA 1DO2A 2RJ9A 2Q4JA 1H4DA 4AYJA 1HWMB 1ZJ0A 3BRDA 4TLPA 2P73A 1A8DA 1H7EA 2APCA 4M0WA 2Y6PA 1NNJA 4D48A 4ZGRB 1S0FA 3W0LB 3O44A 3V8YA 5F90A 3VKHA 1AVAC 5C1LA 1H7LA 1S0CA 2DVWB 4FCVA 2FFJA 1W55A 4I4XA 4OWKA 2JCOA 4LO2C 3RSJA 1TVYA 1TOOA 5EJ1A 4NRVA 1XWIA 4I37A 1FO8A 3POLA 3KOXE 4G4RA 5CMFX 4XFSA 3HU2A 4B2WA 1M2TB 4NL4H 4KEKA 4B7FA 1NZKA 1VH3A 2CHGA 4II7A 4F83A 2X2TA 2NP0A 5FZUA 3KXEC 3OGGA 2R62A 4LJ9A 1ABRB 2CUZA 2ICYA 4YS8A 4LF4M 2RSTA 3CA4A 3MALA 4WURA 4OU7A 2J3PA 4FWDA 2UUCM 3AZWA 3U60A 3OH2A 1L1ZA 2Y4MA 4D80A 1H5TA 5FV9A 1J09A 4QC4A 2EA0A 1ONKB 2J7OA 3AJ5A 5FNWA 4JISA 4P6AA 1I94M 4JI4M 3PXGA 1IIMA 5EJZA 4G3SA 2PX7A 3FJCA 4L4HA 4B7GA 2V0KA 3CRIA 1ISYA 1J5EM 3J27B 4JAWA 1LZ0A 3KFUG 3DFZA 3U5ZA 4MNDA 4M2AA 3I0FA 4FVVA 3UJ0A 1NWGB 1VPAA 1KSFX 2F4VM 4H75A 2L6OA 4QHTA 1OFHA 1ISZA 1GL6A 3WINA 4EFRA 1FR8A 2KRKA 2VK9A 4Y7TA 2DWNA 1H6UA 5BXTA 1G9AA 3SYLA 2D7HA 2X5SA 5EP1A 3SHFA 3V91A 1QVRA 2XWNA 3FTEA 1IJTA 4Z9WB 3OH3A 4HLQA 3S8JA 1YXWA 3TE6A 3I4VA 5G00A 1H3MA 1II4A 5C8RA 4D0ZA 4Q9PA 2AQZA 3HGIA 4FROA 3D8VA 4FRAA 5CQNX 1I1BA 4YY3M 1DGFA 1ZCUA 1QQWA 3GPXA 3U2UA 1V6UA 2D0JA 3AKIA 3UDAA 3E4RA 4NALA 5L6VA 3FJFA 1AF9A 3FWWA 2UUSA 5D63A 3DOAA 4J2SA 3H6RB 4XFTA 4IBIA 4IY9A 4DR6M 3SAWA 1L1TA 4QALA 1N77A 3IIRA 1HQCA 1MX0A 4AYLA 1HWOB 3JRRA 3I0LA 2WRYA 5FU8A 5KPTA 2DREA 1WXQA 1HNWM 3J7BA 1NHGC 1R80A 2KKIA 3SASA 1T9FA 3VKGA 1QZMA 2AHMA 5C4CA 2O1HA 2NZ9A 4HO8A 1AFCA 1XMQM 4CVHA 1TZFA 4CHTB 2AXMA 1CE7B 1N32M 1JT5A 3BTAA 4LGYA 5IFYA 3HBWA 1SZ6B 3LQRA 5D92A 4JXJA 4G9MA 3T8SA 3VT0A 1LL0A 2QBYB 1QG8A 1R81A 1IN5A 2AH9A 1DFCA 2PGVA 2I7PA 2VSHA 2CHQA 3RTIB 1VZTA 2L7IA 2VSIA 4B5BA 3V0MA 4I2SA 1Z0HA 1HV9A 3JAMS 2V0JA 4MGKE 9ILBA 2FFVA 3ZH9B 1E9SA 4FW9A 3HALA 2QH5A 2QYIB 3V79C 4JI1M 2KA6B 4HO9A 3FUTA 4B4MA 5A2QS 5I1FA 4GOYA 5B2HA 2F5OA 4FCEA 1MC9A 5E26A 2LXEA 4B3UA 4LO2A 4YOLA 1NF5B 3SMPA 1EVTA 3U61B 3A07A 3L25A 4HO3A 4AG6A 3WMUA 1K5UA 5C1BA 1QGSA 4AG5A 3SFZA 1FO9A 3KP0E 1QYRA 4G6JA 5C1HA 3U6PA 3KP1E 3AV0A 3AKZA 1G8OA 3GLIA 2KZSA 2AM4A 2JCLA 4REZA 4JD0A 2VSEA 5FLXS 3K1JA 3JR4A 2RIYA 3I0IX 3Q8XA 1Q04A 4G9NA 3V0AB 4KEIA 3KIAA 2MIBA 3QYDA 3FJAA 4AQYM 2UUAM 4OW0A 1G2VA 4TUWA 1LZ7A 3SX8A 3RFWA 1AVUA 4FRHA 1S0BA 1H5RA 1W77A 1H5SA 1H5RB 4I4VA 5D62A 3N0KA 4J18A 3IM5A 3WO3A 3UD9A 1EYLA 4LJ7A 3WMVA 1TW1A 3OH1A 4CJ8A 3MHVC 1JVGA 1C1KA 2OPFA 2WVLA 4S12A 4IONA 3R8FA 4AKIA 2WGZA 5HPZA 4F34A 5FTSA 2YC5A 4KLNA 1G23A 1LVWA 4GRIA 1H5TB 3I4YA 5KQ8A 1GL7A 3GQ4A 2K47A 2D7GA 2AESA 3VWCA 3FOQA 3HOMA 2XFSA 3GPYA 2YNMD 3NJ5A 3ZGGA 3TQDA 3K1XA 5LMNM 1V83A 1N4KA 5F3WA 1TP0A 1K4VA 4JI0M 2DS0A 1WT3A 2W0WA 3Q4SA 3AL0C 1ZCYA 1H7GA 4JYAM 2I5EA 3IG5A 1NHEB 3CA5A 2YQJA 4DV1M 2Q2EB 4UY4A 2NYYA 1K82A 3TWMA 4HO0A 2CHVA 1ISWA 5KPRA 3CU1B 3U6MA 1TH3A 4I3NA 2GO2A 3H4MA 1YTOA 1NMMB 1GKIA 1XNQM 1O7OA 5I1BA 2RIXA 3ZLKA 4MGIE 2RJ4A 2D23A 4PCZA 4FRMA 4FWGA 3HSMA 4QNRA 1HM9A 1Q39A 4PDIA 2JCJA 5CMHA 1AVWB 4HO6A 1Q3BA 3GQ5A 1E0OA 4QNMA 1PZTA 3AKFA 4EE3A 4JN6A 3T7MA 3V0NA 5ITQA 4LO7B 4DCKC 4FREA 2XWMA 4GIPA 1FV2A 2KRUA 4I1EA 4HL4A 3SXGA 1VGZA 4X64M 3DA1A 3SYKA 1FQ9A 3EIEA 1J7KA 4L4UA 2I1BA 3U2WA 2RJ5A 3HJSA 3T1YM 1HNZM 3HMYA 4FGFA 3I0HA 3BCVA 3NBNA 4O6NA 4I6IA 3L26A 2VU9A 1WSZA 2DXIA 3CKNA 2ERCA 31BIA 3FJEA 3OJ2A 2CV2A 4Z8SB 1EV2A 1WT1A 3K92A 3ZF8A 2KEBA 2D20A 4M9XA 4IRPA 1YP4A 4DR5M 3DJ4A 4Y7FA 2RJ8A 2UUBM 5C4EA 4X65M 3ZC8A 1S0EA 4M9ZA 3JR5A 3SARA 1WD3A 4NANA 3NWLA 2CEAA 1G3LA 2ZM6M 3UK6A 1ZIZA 3I0CA 4QO3A 2R4EA 3POKA 2HHHM 4M2BA 3IOIA 5JQQA 3FJIA 3BAQA 1HWNB 1IXSB 1AVXB 1QAMA 2OI6A 1TFMB 1IBLM 2O1FA 2Y4KA 4Z8XA 4I8OA 1G82A 2DRZA 3SXAA 2BJVA 3CKOA 4D82A 3RGPA 2C9OA 2AM5A 2PGYA 3CGXA 3RSBA 3AOEC 1IN6A 1JR3A 1VICA 2V1UA 4Y63A 5CQOA 3I0GA 1PZYB 2I5KA 4IJFA 4QD2C 1YUBA 2MC2A 4AAWA 4KC1A 4IBBA 3SAVA 1ZJ1A 3A22A 2QCUA 1FWUA 3Q7WA 4DENA 3NGWA 1TH4A 3N7LA 1L2BA 2QGIA 4ZFWB 4YHHM 5ITRA 4IBDA 3BADA 4ASJA 3I51A 2D24A 3C9ZA 3VK7A 2HW9A 3TWKA 4B4BA 2P6WA 3HJ8A 1XXHA 4I4RA 3N7KA 4NXMM 4K0KM 3PNYA 4DV2M 2WVMA 4Y7UA 4QBCA 1S4NA 2XWLA 4M0DA 1R7VA 3P6IA 5EG6C 3CA3A 3ZX7A 7CATA 4GHLA 2A8UA 4KC3A 1VDDA 5HS2A 5C4BA 1IOBA 4P0LA 2Z87A 3OGZA 1V6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9F A;  1I1B A;  4OEF A;  5E24 E;  1R7X A;  3AJ6 A;  1G9D A;  3PKP A;  5CQP A;  3FGM A;  3V0L A;  1D0H A;  4ZFY B;  1FWV A;  2RIT A;  1ZCU A;  1VGU A;  3O4B A;  5BXS A;  1R7U A;  1JT4 A;  3R2W A;  3A23 A;  4MYB A;  3CKV A;  3U2U A;  4X37 A;  1V6U A;  1ZDF A;  3AKI A;  3UDA A;  2D0J A;  4NAL A;  5C3B A;  1HJJ A;  2OEF A;  3WO2 A;  4KC4 A;  4IZE A;  4DEC A;  5L6V A;  3FJF A;  3R3I A;  2K4A B;  3I0E A;  1AF9 A;  1JLY A;  1KNM A;  3FWW A;  1FXJ A;  2UUS A;  5D63 A;  1G95 A;  1VCL A;  1K5V A;  1JQZ A;  4EFP A;  5BQU A;  4JRA A;  1KWS A;  4J2S A;  3CKQ A;  1FN0 A;  2YUG A;  6I1B A;  3OKR A;  3H6R B;  2I7B A;  4FQW A;  4K6R A;  4XFT A;  3H6R A;  4IY9 A;  4HCQ A;  1NQI B;  4OEE A;  1ISV A;  3AKH A;  4G6M A;  4LO1 A;  3HN1 A;  3BAO A;  3CA0 A;  1I52 A;  4NAI A;  4LO3 A;  4QAL A;  4X3A A;  4DEP A;  3GUE A;  3KMV A;  3IIR A;  5JMC A;  1R8N A;  2BEA A;  3A21 A;  1R82 A;  4EE5 A;  1P63 A;  4AYL A;  2D7R A;  3OJM A;  1ISX A;  1HWO B;  3OAM A;  1QXM A;  3JRR A;  5J49 A;  3I0L A;  1PWA A;  2WRY A;  5FU8 A;  4I4P A;  2DRE A;  4I0Y A;  1Q1U A;  2M49 A;  4USP A;  1ILR 1;  3VSF A;  3BAG A;  1H5S D;  2FO1 A;  4EEE B;  1R80 A;  4FRQ A;  2KKI A;  2RQ9 A;  1WT2 A;  1T9F A;  4FRH A;  1DQO A;  1V6V A;  2Y4L A;  1TW5 A;  4KBB A;  2YQH A;  5DDT A;  2ZQO A;  1JT3 A;  2D43 A;  1H4C A;  5C4C A;  1FGG A;  1EZI A;  2O1H A;  2NZ9 A;  5C3D A;  4HO8 A;  1VZX A;  2W0V A;  4QD2 B;  1AFC A;  3N7M A;  5F8Y A;  1V6X A;  4FRP A;  4CVH A;  1BFC A;  4JKX B;  1YP2 A;  1TZF A;  3K8D A;  2AXM A;  4FRB A;  1CE7 B;  2E8B A;  4P00 A;  4Y7G A;  5CQL X;  1JT5 A;  3EF2 A;  4H04 A;  3BTA A;  5IFY A;  5DSS B;  3HBW A;  1SZ6 B;  3BRF A;  1FXO A;  4B42 A;  4ZBV B;  2ZU7 A;  4G9M A;  4X39 A;  3T8S A;  3AH4 A;  5FZY A;  2X60 A;  3RMY A;  3VT0 A;  4ISQ A;  1LL0 A;  1QG8 A;  3I29 B;  1JY0 A;  1OQM B;  1R81 A;  1G9B A;  2AH9 A;  1G93 A;  5C47 A;  1DFC A;  2PGV A;  4I4U A;  2VSH A;  3RTI B;  1VZT A;  4L41 C;  1JT7 A;  2YC3 A;  2VSI A;  3BAV A;  2KI6 B;  4B5B A;  1JVD A;  4I1B A;  3RMX A;  3BA4 A;  3V0M A;  4I2S A;  2FYC B;  1HM0 A;  1Z0H A;  1IIN A;  4END A;  1HV9 A;  1GA8 A;  1VZU A;  3W9T A;  2V0J A;  9ILB A;  2FFV A;  3FJJ A;  3OJV A;  5BP5 C;  3HL3 A;  3VT2 A;  1HIB A;  3I0J A;  3Q7U A;  2VLC A;  3LW6 A;  3HAL A;  4LO7 C;  2QH5 A;  2QYI B;  1RG8 A;  4G1R A;  3VUO A;  1XHB A;  3V79 C;  5FUH A;  1RZO B;  1ZJ3 A;  5DUY A;  5DVH A;  4KPZ A;  4LW3 A;  4HO9 A;  5FYE A;  4I7I A;  4P02 A;  4B4M A;  1S0D A;  5I1F A;  4EEG A;  4GOV A;  1MD6 A;  4GOY A;  5B2H A;  2P23 A;  2P72 A;  1O7Q A;  3D7W B;  3ZC9 A;  4FCE A;  1WBA A;  2RJ7 A;  2K8R A;  1MC9 A;  1YRO B;  3UJ4 A;  3SX7 A;  2BO8 A;  1FV3 A;  3WO4 A;  1T4Q A;  1JV1 A;  4B3U A;  4BQH A;  4LO2 A;  4YOL A;  1NF5 B;  2ZU9 A;  3F1Y A;  1PUM B;  1OQL B;  2ZR1 B;  3U2X A;  3V0O A;  3U0X A;  4ZDQ A;  1HCE A;  1EVT A;  2E3D A;  1SR4 C;  5DDV A;  3RTJ B;  1IRA X;  3FJ8 A;  5F8S A;  2MZB A;  4ECM A;  1IIL A;  2ET2 A;  2D22 A;  1YP3 A;  1ON6 A;  4EVW A;  3A07 A;  4P0J A;  4HO3 A;  5IDT A;  4GP0 A;  2Z49 A;  3WMU A;  1MP4 A;  3OC9 A;  1UPS A;  1QWJ A;  3T7N A;  5CMI A;  2IHO A;  1K5U A;  3IM6 A;  4IZX A;  4KEJ A;  2V0H A;  1BAR A;  1DJS B;  4EFQ A;  1QGS A;  4HR6 C;  3RMV A;  3I2X A;  5AJP A;  1WBC A;  3O4D A;  1Z2V A;  2F2F C;  1FO9 A;  3EE5 A;  1VM8 A;  1YBI A;  41BI A;  1DZC A;  5C1G A;  1DLL A;  4EEO A;  4G6J A;  2NXV A;  5FTV A;  5C1H A;  1ZCT A;  3O4A A;  3PME A;  3BB2 A;  4ISR A;  1G8O A;  3NBC A;  2ZQN A;  1HWP B;  2OI7 A;  4ASY A;  1JLX A;  3OBT A;  4I4Y A;  2AM4 A;  3ZXG A;  1IRP A;  2NVH A;  4GAI A;  4HA2 A;  1FR9 A;  1LZJ A;  1XYF A;  2JCL A;  4JD0 A;  4EE4 A;  2VSE A;  3I0I X;  2RIY A;  4G9N A;  1Q04 A;  4KT7 A;  2Y9W C;  3V0A B;  4KEI A;  4ZFU B;  3IOJ A;  2AAI B;  4GAF A;  3D5N A;  3KIA A;  2MIB A;  3QYD A;  5C48 A;  4JPZ A;  2NTD A;  3FJA A;  1Z90 A;  3V90 A;  3E25 A;  2V0L A;  3H6Q A;  1G2V A;  1LZ7 A;  3SX8 A;  1ON8 A;  2YQC A;  1GWV A;  1AVU A;  3Q80 A;  3AZV A;  1PZZ A;  1WD4 A;  1S0B A;  2X2S A;  3P53 A;  4J23 B;  1IHK A;  4LO0 C;  4QKR A;  1FOA A;  1H5R B;  1H5R A;  1H5S A;  4I4V A;  5D62 A;  1H5S B;  3N0K A;  2ERM A;  1QGQ A;  4J18 A;  4KQL A;  4HJJ A;  4FRL A;  3IM5 A;  3WO3 A;  1G9R A;  3UD9 A;  3ST8 A;  5FU0 A;  1PUU B;  1W3F A;  5CMG X;  1EYL A;  4KXO A;  1S0L A;  2Y7A A;  1W57 A;  3WMV A;  1TW1 A;  3OH1 A;  3BAU A;  3SNV A;  3ZXD A;  4J2Y A;  3B9U A;  4CJ8 A;  1JTC A;  3Q7X A;  1MP3 A;  3USR A;  3BX1 C;  1JVG A;  4ARW A;  2P39 A;  1SS9 A;  3CQA A;  4QKS A;  1GQC A;  2VUA A;  3NBD A;  1GGP B;  4ION A;  2WVL A;  3QR5 A;  3TZT A;  3CA6 A;  2VS3 A;  3AH2 A;  5HPZ A;  4F34 A;  1XZZ A;  2WGZ A;  1NKH B;  5FTS A;  2YC5 A;  1ZDG A;  4UEG A;  4BMA A;  1G23 A;  2RIZ A;  1LVW A;  1H5T B;  4IYB A;  5BVP I;  2AFG A;  4FRD A;  2VXR A;  2L5X A;  4A7Z A;  3P6J A;  1GQ9 A;  3JUK A;  2KH2 A;  3PKQ A;  3LTQ A;  2BFH A;  3AKG A;  2AES A;  1YF8 B;  3VWC A;  3FOQ A;  2VS4 A;  3HOM A;  3V0Q A;  1OMX A;  2XMH A;  4Y64 A;  1R8O A;  1BA7 A;  1HKN A;  3NJ5 A;  1TIE A;  3F62 B;  3RMW A;  7I1B A;  1LZI A;  3R4U A;  1LL2 A;  3DUV A;  3ZGG A;  2E4M C;  3TQD A;  3O49 A;  3K1X A;  5HS2 A;  4LO8 B;  1ZI4 A;  2RJ0 A;  4P0K A;  1H4E A;  1V83 A;  1N4K A;  2VXL A;  2WEE A;  2K43 A;  2X65 A;  1J0S A;  1TP0 A;  1ZI1 A;  4I4Q A;  2FYD B;  3VEQ A;  2ZU8 A;  2GGQ A;  1K4V A;  2DS0 A;  1WT3 A;  2W0W A;  1R7Y A;  5EHA A;  2VS5 A;  3PNN A;  3Q4S A;  2Z48 A;  3FFZ A;  2AEC A;  5C38 A;  4IY8 A;  1ZCY A;  1H7G A;  5C3A A;  1EPW A;  4OWJ A;  2DRY A;  4I96 A;  1HM8 A;  2I5E A;  4LW6 A;  3N9W A;  4B2X A;  1HCD A;  2RG9 B;  1NHE B;  1TWM A;  2XME A;  3BRK X;  4Y6U A;  3CA5 A;  2YQJ A;  3SXC A;  4II0 A;  2NYY A;  5F8W A;  2OI5 A;  4M2A A;  4HO0 A;  1ISW A;  5C49 A;  3CU1 B;  1F31 A;  1ZI3 A;  1IT0 A;  3DK5 A;  1G1L A;  1O0R A;  4I3N A;  2GO2 A;  4KRV A;  1YTO A;  1VGT A;  4KNR A;  4I4O A;  5CMJ A;  1H7T A;  1M16 A;  5D61 A;  1S4P A;  1NMM B;  3SX3 A;  4EKX B;  2MLL B;  1E5K A;  1ZJ2 A;  4JP0 A;  1O7O A;  1QQL A;  2AM3 A;  2QKX A;  4AN7 B;  4Q91 A;  5I1B A;  2RIX A;  3ZLK A;  2RJ4 A;  4D11 C;  2HWM A;  3CRH A;  1I1E A;  1FWY A;  4A7Y A;  4L4I A;  1JYL A;  4Y7V A;  2D23 A;  3U2T A;  5C4F A;  2O1G A;  5BOW A;  5BP5 A;  5CQM X;  5BXC A;  1H7F A;  3BA7 A;  4FRM A;  1XG6 A;  2Y9G A;  1DQG A;  3IAG C;  3HSM A;  3BRG C;  1ZJP A;  5C4D A;  2QN4 A;  2VXM A;  1HM9 A;  4J2K A;  2OEG A;  2RJ6 A;  3CKJ A;  3I0D A;  3S8K A;  2JCJ A;  3V8Z A;  2LIE A;  1BLA A;  1AVW B;  5CMH A;  4CJB A;  5FNX A;  3VT1 A;  1L2H A;  4HO6 A;  2YCM A;  2A8W A;  3SPT A;  1E0O A;  3PG0 A;  1PZT A;  3AKF A;  4EE3 A;  5AJO A;  3T7M A;  1ZJO A;  3V0N A;  4LO3 C;  3K8E A;  5C36 A;  4Y62 A;  2KLL A;  4LO7 B;  1FGA A;  4PC4 A;  4DCK C;  2FYB A;  1MC3 A;  2GGO A;  8I1B A;  2NM1 A;  3CRG A;  4USO A;  2X5Z A;  2XWM A;  2YES A;  4FRE A;  1FV2 A;  3ILA A;  3FUO A;  3V0B B;  4ZLB B;  4G3Q A;  5L6S A;  4OW4 A;  3O4C A;  3FJH A;  1ITB A;  1NUN A;  4M4K A;  3WIN C;  4Y6N A;  3O4O A;  4E1K A;  3R4S A;  2PA4 A;  4I1E A;  3SXB A;  2BO4 A;  3SXG A;  1VGZ A;  3Q7Y A;  1BAS A;  1H7Q A;  2VFZ A;  3U2V A;  1G0R A;  1DZD A;  4QBV A;  4Q9G A;  3OGF A;  4DE7 A;  2Y4J A;  3FJ9 A;  4DDZ A;  1S4O A;  3FJK A;  1DIW A;  1PC8 B;  2WE9 A;  1FQ9 A;  4EEM A;  1JV3 A;  4XFU A;  2JCK A;  2RJ9 A;  1GX0 A;  1CVS A;  4IRQ A;  2Q4J A;  2F2F A;  1EYR A;  1BFF A;  1H4D A;  2FYA A;  3ZLL A;  1HWM B;  1ZJ0 A;  4AYJ A;  5DZU A;  2FGF A;  2I1B A;  3BRD A;  3FUQ A;  4WBC A;  3U2W A;  3O5W B;  4HO5 A;  2WBC A;  3E8L C;  4TLP A;  2RJ1 A;  2RJ5 A;  2GZB A;  3LLP A;  2P73 A;  1A8D A;  3HMY A;  1H7E A;  2R9K B;  2APC A;  4FGF A;  1FG5 N;  2VD4 A;  1ZCV A;  2Y9X E;  3NBN A;  2Y6P A;  3BCV A;  3I0H A;  4I6I A;  2Z86 A;  2ICX A;  4D48 A;  4ZGR B;  1S0F A;  1Q03 A;  1O23 B;  3USQ A;  2CU2 A;  2IWT B;  5GAQ A;  2VU9 A;  3O3Q A;  3JUJ A;  2YQS A;  1AXM A;  2D1Z A;  3O44 A;  4ZOT A;  1WSZ A;  3V8Y A;  5F90 A;  3CU0 A;  3CKN A;  4JKQ A;  3JTJ A;  4H9W A;  1AVA C;  3OBR A;  31BI A;  5C1L A;  3SX5 A;  1H7L A;  3FJE A;  3IOH A;  4M28 A;  1S0C A;  3OJ2 A;  1R7T A;  3SXE A;  1H5S C;  4Z8S B;  1EV2 A;  3VSZ A;  3ZGF A;  1FMM S;  1WT1 A;  1OMZ A;  3ZF8 A;  1W55 A;  4OEG A;  4I4X A;  4JQ0 A;  3NBE A;  1JYK A;  3E26 A;  4OWK A;  2D20 A;  2JCO A;  3FJB A;  1Z4S A;  4LO2 C;  1W77 A;  3RSJ A;  1TVY A;  5EIY A;  1TOO A;  5EJ1 A;  4IRP A;  1YP4 A;  1V84 A;  4I37 A;  4OUJ A;  3WA1 A;  1FO8 A;  3D98 A;  3POL A;  4R6U B;  1TTU A;  3JUT A;  2KI4 A;  5JLV A;  4HO2 A;  5CMF X;  4B4G A;  2D44 A;  4XFS A;  1RML A;  2AE7 A;  3DJ4 A;  4B2W A;  1M2T B;  4Y7F A;  2RJ8 A;  1TWE A;  3ZC8 A;  5C4E A;  1S0E A;  4KEK A;  1W3A A;  1NZK A;  1VH3 A;  3I0K A;  1BFB A;  2NP0 A;  2BO7 A;  4A7K A;  2X2T A;  3UD7 A;  2HWA A;  4F83 A;  1WD3 A;  3V0B A;  1ZI5 A;  5FZU A;  4G87 A;  4HOC A;  4NAN A;  4EEA A;  3OGG A;  1LL3 A;  4I4S A;  1ABR B;  5FZZ A;  2LIQ A;  2V0I A;  1G3L A;  1HJL A;  1ZIZ A;  2ICY A;  4YS8 A;  2Q9X A;  3I0C A;  4GBP A;  3BAH A;  4QO3 A;  3POK A;  2RST A;  3CA4 A;  3MAL A;  3OH4 A;  1DFQ A;  2FY7 A;  2J3P A;  3IOI A;  4M2B A;  5JQQ A;  3AZW A;  3FJI A;  1SR4 A;  3BAQ A;  1HWN B;  3AH1 A;  3V0A A;  1G97 A;  1S0G A;  1AVX B;  2OI6 A;  3OH2 A;  1TFM B;  1GWW A;  3I2A A;  2F8X C;  2O1F A;  2Y4K A;  2Y4M A;  4CJM A;  1H5T A;  5FV9 A;  4QC4 A;  1G82 A;  1ONK B;  2DRZ A;  3SXA A;  3CAH A;  3CKO A;  4D11 A;  3AJ5 A;  4G3P A;  5EC5 A;  5FNW A;  1FRW A;  4P6A A;  4JIS A;  5BXR A;  2AM5 A;  2PGY A;  4IQP A;  2Q3N B;  3F1R A;  1IIM A;  1H7H A;  3QVB A;  4Y9X A;  3CGX A;  3RSB A;  5EJZ A;  4G3S A;  2PX7 A;  3FJC A;  4L4H A;  4R7P A;  4AC3 A;  5IDS A;  3MPP G;  2V0K A;  1RY7 A;  1VIC A;  3CRI A;  4KNX A;  4KPX A;  3I0G A;  4I8M A;  1INI A;  4Y63 A;  5CQO A;  1PZY B;  2ESU A;  2HZ9 A;  2I5K A;  1ISY A;  3H6S E;  1LZ0 A;  4JAW A;  1FZW A;  4QD2 C;  4MND A;  2MC2 A;  2VSA A;  2BO6 A;  2XOA A;  1ZHJ A;  4J2X A;  1WT0 A;  4FVV A;  4ZA3 B;  3UJ0 A;  2UX8 A;  3I0F A;  4KC1 A;  4AAW A;  3CA1 A;  1NWG B;  4XKI A;  1VPA A;  1ZJ1 A;  2WVK A;  3A22 A;  4EB2 B;  4D8H A;  3N7J A;  1FWU A;  4C2S A;  3Q7W A;  4DEN A;  3NGW A;  1ISZ A;  2FFU A;  3N7L A;  2QGI A;  4IHZ A;  3WIN A;  4EFR A;  1FR8 A;  4LO0 A;  4HG6 A;  4ZFW B;  3V0P A;  4CJC A;  4ZKT B;  3BAD A;  4Y7T A;  4KC2 A;  4ASJ A;  2D24 A;  3PUB A;  4X38 A;  3O3P A;  3C9Z A;  3TC2 A;  1VH1 A;  2DPW A;  2HW9 A;  1WVC A;  3OH0 A;  5BXT A;  3SXD A;  4NAK A;  4OWL A;  4B4B A;  3FJD A;  4D0T A;  2P6W A;  3T7O A;  3U0Y A;  1G9A A;  2BEB A;  2D7I A;  2VXT I;  4I4R A;  4FCU A;  2X5S A;  3N7K A;  3F1C A;  5BQU C;  3V91 A;  1GX4 A;  2WAW A;  2XWN A;  2FDB M;  2WVM A;  1FMZ A;  3BA5 A;  1YYN A;  4Y7U A;  4QBC A;  1S4N A;  1VGW A;  4GP3 A;  2XWL A;  4HO4 A;  1BFG A;  1IJT A;  4XWI A;  4Z9W B;  3OH3 A;  2AGD A;  4LO1 C;  3S8J A;  1V82 A;  3PHZ A;  1XZ6 A;  1YXW A;  1R7V A;  3UD8 A;  3P6I A;  21BI A;  1BLD A;  5AJN A;  5G00 A;  1H3M A;  1II4 A;  5EG6 C;  5C8R A;  3CA3 A;  3ZX7 A;  4D0Z A;  5BXP A;  1W3G A;  1G9C A;  1INJ A;  4Q9P A;  2AQZ A;  2A8U A;  1MP5 A;  1FGX A;  1QQK A;  3IM7 A;  4KC3 A;  4FRO A;  3D8V A;  4AN6 A;  1IOB A;  4P0L A;  2Z87 A;  3OGZ A;  2E4M A;  1V6W A;  4FRA A;  5C4B A;  5CQN X; 
#chains in the Genus database with same CATH topology
 1IY2 A;  4RNA A;  4G4O A;  2Y9F A;  1R7X A;  3AJ6 A;  1EE8 A;  1G9D A;  5CQP A;  1EFU B;  4ZFY B;  2RIT A;  1VGU A;  3M7G A;  3A23 A;  5FTJ A;  3CF2 A;  5FTM A;  4XGI A;  1HJJ A;  2OEF A;  1QUS A;  4IZE A;  3FTC A;  4KC4 A;  4QOS A;  1QAQ A;  1JR3 D;  1KNM A;  1G95 A;  1VCL A;  5BQU A;  2YQZ A;  4JRA A;  5EXT A;  1SXJ A;  1K3X A;  1FN0 A;  6I1B A;  3OKR A;  4K6R A;  1TH2 A;  1XC8 A;  3J2P B;  3H6R A;  4OEE A;  1ISV A;  3CA0 A;  4NAI A;  4X3A A;  2UXC M;  3T15 A;  5JMC A;  4LRS A;  1W5T A;  4EE5 A;  3J7A S;  4L16 A;  4FWH A;  2D7R A;  3OJM A;  1ISX A;  4DV6 M;  2M49 A;  2LBC A;  1ILR 1;  2XGN A;  1DGG A;  3GRR A;  4X62 M;  3KOY E;  1WT2 A;  4FRQ A;  1DQO A;  3I04 M;  1V6V A;  1KFV A;  3GLH A;  1AUA A;  1JT3 A;  2D43 A;  2VII A;  4Z6Y A;  2W0V A;  3N7M A;  5F8Y A;  4ZPX A;  3K8D A;  2DAM A;  3U6Q A;  1YLA A;  4GC9 A;  2H1R A;  1FXO A;  4B42 A;  4ZBV B;  1K3W A;  3VFD A;  5C18 A;  3AH4 A;  2X60 A;  3I29 B;  1R7R A;  1G93 A;  5C47 A;  2LVP C;  4I4U A;  1N36 M;  1JVD A;  4IIW A;  1L8Q A;  1IIN A;  4OX9 M;  1VZU A;  3UGJ A;  3FJJ A;  3OJV A;  1N34 M;  5BP5 C;  3Q7U A;  3I0J A;  1NY5 A;  2CFO A;  4G1R A;  4X66 M;  1XHB A;  1ZJ3 A;  2JXN A;  5DVH A;  2G3Q A;  5FYE A;  1ORY B;  2P72 A;  2D7E A;  3ZC9 A;  1WBA A;  1NV8 A;  2BO8 A;  1FV3 A;  1ZAE A;  2R65 A;  3WO4 A;  4JI3 M;  1GVN A;  4BLC A;  3F1Y A;  4M9S A;  2CRU A;  1PUM B;  3V0O A;  3U0X A;  1SR4 C;  1IRA X;  1TGU A;  2ET2 A;  1SXJ E;  1YP3 A;  1SG9 A;  2ZAN A;  4P0J A;  4GP0 A;  3OC9 A;  4MGH A;  1UPS A;  2CE7 A;  5CMI A;  2MRO B;  2IHO A;  3IM6 A;  4IZX A;  2VF8 A;  2LNH C;  2C99 A;  3I2X A;  3KOZ E;  1WBC A;  3O4D A;  4MZF B;  5AJP A;  2QSF X;  1VM8 A;  3THG A;  1WGL A;  2JY6 B;  4WP2 A;  2NXV A;  4CIS A;  1Z59 A;  3PME A;  4QOZ C;  1OFI A;  1MN3 A;  2OI7 A;  4CJ6 A;  4NSO B;  2NVH A;  1LV7 A;  4EE4 A;  4LF6 M;  4ZFU B;  5IRE B;  3L2A A;  2NTD A;  3WHK A;  3V90 A;  2V0L A;  3H6Q A;  2YFQ A;  2KHH A;  4MGZ E;  1IHK A;  4LO0 C;  1H5S B;  2ERM A;  1QGQ A;  2C98 A;  2JZ1 A;  4DR7 M;  3C9P A;  2Z4R A;  5CMG X;  4KXO A;  5EQT A;  1W57 A;  1IN4 A;  3BAU A;  1JTC A;  3USR A;  4ARW A;  4AW4 A;  3CQA A;  2MH8 A;  5KQD A;  3CA6 A;  2VS3 A;  1NKH B;  1R6B X;  1ZDG A;  2XEP A;  2RIZ A;  2FS1 A;  4HEO A;  4IYB A;  4NSR A;  4A7Z A;  3P6J A;  2WSF F;  1T6O A;  1YF8 B;  2QPA A;  2VS4 A;  1OMX A;  2XMH A;  1BA7 A;  3SAT A;  3F62 B;  1LL2 A;  3O49 A;  3B74 A;  4LO8 B;  4P0K A;  3K8Z A;  1H4E A;  4RF1 A;  2K43 A;  1J0S A;  3FKE A;  2FYD B;  1ZI1 A;  1G59 A;  3FFZ A;  4IY8 A;  2CWB A;  2B3T A;  4LW6 A;  1HCD A;  2KZU A;  2LVA A;  1TWM A;  4Y6U A;  3B89 A;  3SXC A;  1XMO M;  2KXE A;  2CV0 A;  2OI5 A;  4XBO A;  1ZI3 A;  3CF0 A;  4G4Q A;  4KRV A;  2L2D A;  4I4O A;  5EXP A;  5D61 A;  1S4P A;  2MJ5 B;  3SX3 A;  4EKX B;  4LGM A;  1E5K A;  1ZJ2 A;  1V92 A;  2JNH A;  4JP0 A;  2AM3 A;  1QQL A;  3QWL A;  4AN7 B;  2R4J A;  4D11 C;  3GRV A;  1I1E A;  4A7Y A;  2O1G A;  5BOW A;  3BA7 A;  1XG6 A;  1DQG A;  3BRG C;  2VXM A;  2RJ6 A;  3CKJ A;  2Z8Y M;  5JI2 E;  2E5L M;  3K8E A;  1JQJ C;  4FIX A;  4Y62 A;  1FNN A;  2KLL A;  1FGA A;  2GGO A;  8I1B A;  2NM1 A;  3CRG A;  2YES A;  4P17 A;  3V0B B;  3C3D A;  4G3Q A;  1NUN A;  2X8A A;  4LY6 A;  2QQ8 A;  4IBJ A;  4E1K A;  2PA4 A;  5E6J A;  3Q7Y A;  1BAS A;  3U2V A;  3SC3 A;  3KDS E;  2Y4J A;  2Y0T A;  4B3S M;  1ZQ9 A;  3R9X B;  1DIW A;  1JV3 A;  4XFU A;  3GLH B;  5ITU A;  3WHL A;  2JCK A;  2FNA A;  1GX0 A;  1NHW C;  2F2F A;  2FYA A;  5DZU A;  2WBC A;  3E8L C;  2GZB A;  3LLP A;  3A46 A;  2R9K B;  4GMQ A;  1ZCV A;  1GAB A;  4MM3 B;  2ICX A;  4D81 A;  2DZO B;  1Q03 A;  3QYB A;  2CU2 A;  2IWT B;  2YQS A;  1AXM A;  4ZOT A;  3B7N A;  3CU0 A;  3JTJ A;  4H9W A;  4FIY A;  4JI5 M;  4M28 A;  1MJG M;  1R7T A;  2Z7J A;  3M0E A;  3VSZ A;  1FMM S;  2LHC A;  4OEG A;  2DWZ B;  4DUY M;  4JV5 M;  4JQ0 A;  1JYK A;  3E26 A;  1Z4S A;  1RU3 A;  1V84 A;  3FUW A;  4OUJ A;  3D98 A;  4W5W A;  4R6U B;  1TTU A;  3JUT A;  4HO2 A;  4B4G A;  4GIT A;  1JR3 E;  2AE7 A;  1IBK M;  1A5T A;  3GLG A;  3ZQJ A;  1BFB A;  3V0L A;  3FTF A;  4A7K A;  3UD7 A;  2HWA A;  3B7Z A;  4HOC A;  1PJI A;  4G87 A;  4EEA A;  2R44 A;  3K2L A;  5FZZ A;  1IY1 A;  1C7Y A;  2LIQ A;  2Q9X A;  1MU5 A;  2HL7 A;  1G3I A;  4NOO B;  1SR4 A;  3AH1 A;  1G97 A;  2R18 A;  1S0G A;  3I2A A;  1Z6T A;  4CJM A;  3FRI A;  3CAH A;  4G3P A;  5EC5 A;  1FRW A;  5BXR A;  2FH0 A;  1OKS A;  5EJC A;  2F5N A;  3QVB A;  1H7H A;  3B7Q A;  2RGO A;  4AC3 A;  4R7P A;  5IDS A;  3RE8 A;  4KNX A;  1INI A;  2ESU A;  3W0F A;  3H6S E;  2GNO A;  3KSX A;  2UX8 A;  2XOA A;  1ZHJ A;  1D0M A;  1NY6 A;  4ZA3 B;  2H5X A;  3CA1 A;  4XKI A;  2DKL A;  4EB2 B;  3T38 A;  4D8H A;  4C2S A;  4LRT A;  2FFU A;  4HG6 A;  4LO0 A;  4ZKT B;  1Y8G A;  4NXN M;  4AI6 A;  4FCW A;  3J81 S;  4X38 A;  3O3P A;  2P5T A;  1IN8 A;  4LF8 M;  4MH0 E;  1WVC A;  3OH0 A;  3SBJ A;  1XXH E;  3HU1 A;  4NAK A;  2XSZ D;  2DWM A;  3FJD A;  4OWL A;  4D0T A;  3T7O A;  2BEB A;  2D7I A;  2VXT I;  4FCU A;  4IBK A;  3F1C A;  4AZF A;  5BQU C;  4GKK M;  2BNK A;  1SXJ C;  2BWE A;  2FDB M;  3FD9 A;  1FMZ A;  3BA5 A;  1YYN A;  1VGW A;  4GP3 A;  2LWX A;  4HO4 A;  1BFG A;  4XWI A;  4PD2 A;  1T43 A;  1V82 A;  1XZ6 A;  3L29 A;  2L09 A;  5AJN A;  1BLD A;  4LJ8 A;  1IN7 A;  4OVZ B;  4NRW A;  2O5R A;  4MB7 A;  1HJP A;  1G9C A;  1INJ A;  4KOD A;  5KPZ A;  3HU3 A;  1QQK A;  3IM7 A;  3H4J A;  4AN6 A;  2C0N A;  3TL4 X;  1VG5 A;  4IJE A;  4G6Z A;  5EXS A;  5E24 E;  4DBG B;  2JY5 A;  3PKP A;  3C3E A;  2XZF A;  1FWV A;  4DR3 M;  1IBM M;  3O4B A;  1R7U A;  3GQ3 A;  3CKV A;  4X37 A;  2Y0Q A;  1E94 E;  5C3B A;  4DEC A;  2LVQ D;  1GJS A;  1EIJ A;  1G71 A;  1JLY A;  1FXJ A;  2HCB A;  2UU9 M;  1JQZ A;  3L27 A;  5ITX A;  1KWS A;  3CKQ A;  1SXJ B;  2YUG A;  2R45 A;  2I7B A;  4FQW A;  1N33 M;  3BXW A;  4LO1 A;  3SPT A;  3HN1 A;  3BAO A;  2LHG A;  3DZD A;  4R3D A;  4DV0 M;  3AJI B;  2G5G X;  3KMV A;  3M6A A;  4LZJ A;  2BEA A;  4G3O A;  1VEG A;  1P63 A;  2LTU A;  1QXM A;  5J49 A;  4BB9 A;  4I4P A;  4O6M A;  3HHX A;  2Z3X A;  3B9P A;  3BAG A;  2ZBK B;  2R6F A;  2BJW A;  4R7G A;  3GLF A;  1TW5 A;  4KBB A;  2YQH A;  5DDT A;  2ZQO A;  1NSF A;  2XSZ A;  2R46 A;  1FGG A;  5C3D A;  3GLI E;  1VZX A;  3U61 A;  3AFH A;  1BFC A;  1YP2 A;  3E46 A;  4IBE A;  1VEJ A;  4FRB A;  3FUV A;  4Y7G A;  5CQL X;  3EF2 A;  4H04 A;  5DSS B;  3TQS A;  4LJA A;  3BRF A;  2Y20 A;  4A3V B;  5DYI A;  2ZU7 A;  5FZY A;  1QZE A;  4BBA A;  3RMY A;  2Y21 A;  1I4W A;  1OQM B;  3SMS A;  2YC3 A;  2J0A A;  4I1B A;  3RMX A;  2FYC B;  4WW0 A;  4DV3 M;  4DR4 M;  1GA8 A;  3TWL A;  3W9T A;  4LJ5 A;  3HL3 A;  3LW6 A;  4PDG A;  3HHZ A;  5FTN A;  3VUO A;  1RZO B;  1HNX M;  4LJ4 A;  3SAU A;  3LQQ A;  4I7I A;  2Z4S A;  4P02 A;  1S0D A;  4GOV A;  2XH9 A;  3LVV A;  3D7W B;  1BVS A;  1DGB A;  2RJ7 A;  5LMU M;  1YRO B;  3UJ4 A;  3D8L A;  1T4Q A;  3U60 B;  2EUC A;  2ZU9 A;  1G41 A;  1OQL B;  3U2X A;  4ZDQ A;  4I81 A;  3RTJ B;  5F8S A;  3FJ8 A;  4ECM A;  2RGH A;  2I7N A;  3HZJ A;  5GKN A;  2D22 A;  4EVW A;  1NNU C;  4ITQ A;  5IDT A;  2Z49 A;  1MP4 A;  1QWJ A;  1S3S A;  2A5Y B;  2JUJ A;  3T7N A;  2M5Z A;  3FRH A;  4LF5 M;  4KEJ A;  2V0H A;  1BAR A;  4DV7 M;  4JI2 M;  3EE5 A;  3HJQ A;  5EP3 A;  1YBI A;  41BI A;  1DZC A;  1DLL A;  3VK8 A;  5FTV A;  1ZCT A;  3BB2 A;  4ISR A;  3NBC A;  3BOS A;  2ZQN A;  1HWP B;  4ASY A;  3K9P A;  3OBT A;  4I4Y A;  4HA2 A;  3HWS A;  3TPZ A;  3IOJ A;  4Y7V A;  2AAI B;  3D5N A;  5C48 A;  3UMM A;  4IBF A;  3E25 A;  1F4I A;  1KYI A;  1OAO C;  2XLJ A;  1YE9 A;  1GWV A;  3Q80 A;  1PZZ A;  1WD4 A;  4QKR A;  1ZMV A;  2X2S A;  2X4A A;  4HJJ A;  2C96 A;  1G9R A;  1PUU B;  1W3F A;  1S0L A;  2Y7A A;  3B9U A;  3Q7X A;  1ZMW A;  1Z5A A;  3RGS A;  2P39 A;  1SS9 A;  4DUZ M;  4MZH A;  1GGP B;  2QEN A;  4B3T M;  4LFB M;  3TZT A;  3AH2 A;  1XZZ A;  4LCB A;  1TF0 B;  2RKO A;  2HAK A;  2UXD M;  4UEG A;  4BMA A;  3LVW A;  4FRD A;  2AFG A;  2KH2 A;  3LTQ A;  4LFA M;  5DYG A;  1QAN A;  1HT2 E;  1HKN A;  1TIE A;  3RMW A;  7I1B A;  1LZI A;  3R4U A;  2E4M C;  3KSJ A;  3ZC7 B;  2RJ0 A;  2DWL A;  2VXL A;  1N78 A;  2WEE A;  2X65 A;  3VEQ A;  2ZU8 A;  2GGQ A;  1R2Y A;  2F5S A;  5EHA A;  1R7Y A;  3GLI B;  3PNN A;  2Z48 A;  5C38 A;  4OWJ A;  1D2N A;  4I96 A;  1HM8 A;  4B2X A;  3N9W A;  2XME A;  1F31 A;  1IT0 A;  3DK5 A;  1VGT A;  1H7T A;  1M16 A;  2C5R A;  2ZTC A;  4Q91 A;  2F5P A;  4JI7 M;  1X37 A;  3U2T A;  2XF3 A;  1D0L A;  1H7F A;  1L2D A;  3LCV B;  2Y9G A;  3IAG C;  1ZJP A;  5C4D A;  3S8K A;  4QHS A;  2LIE A;  4CJB A;  5FNX A;  3VT1 A;  1L2H A;  1IXZ A;  4LZZ A;  3PG0 A;  3MK6 A;  3KW6 A;  5AJO A;  1ZJO A;  5C36 A;  1MC3 A;  1XB2 B;  3T6P A;  3ILA A;  4PT5 A;  3FUO A;  4ZLB B;  4OW4 A;  1UFZ A;  3O4C A;  3FJH A;  2KDL A;  4CIZ A;  4M4K A;  4I4L A;  3WIN C;  3O4O A;  1NJG A;  2BO4 A;  3SXB A;  1H7Q A;  4L6V 6;  5IZ7 D;  3A45 A;  1G0R A;  4QBV A;  4Q9G A;  2JZ0 A;  3FJ9 A;  1S4O A;  1PC8 B;  4LG2 A;  3SHG B;  2ZAM A;  1CVS A;  4IRQ A;  1EYR A;  1BFF A;  3ZLL A;  2FGF A;  3FUQ A;  4WBC A;  3O5W B;  4HO5 A;  2V6Z M;  1DO0 A;  2RJ1 A;  3J80 S;  2VD4 A;  1FG5 N;  4Q7C A;  2Y9X E;  1TDZ A;  2Z86 A;  1O23 B;  3USQ A;  3CGW A;  4LJ6 A;  5GAQ A;  3O3Q A;  3JUJ A;  4IBG A;  2D1Z A;  3PNV A;  4JKQ A;  3OBR A;  1WGN A;  3SX5 A;  3VDU A;  3IOH A;  2J7N A;  3U6D A;  3SXE A;  3L28 A;  1H5S C;  3ZGF A;  3UJN A;  4L15 A;  1OMZ A;  1T3T A;  3NBE A;  3KS4 A;  3FJB A;  1TDH A;  5FTK A;  1VDL A;  3WA1 A;  3HHY A;  2KI4 A;  5JLV A;  2D44 A;  2CP8 A;  4DV4 M;  1RML A;  3HKP A;  1TWE A;  3GLG B;  1W3A A;  1R4G A;  3I0K A;  3CTW B;  2BO7 A;  3V0B A;  2DAG A;  1ZI5 A;  1UM8 A;  1JB0 F;  4I4S A;  1LL3 A;  4G4N A;  4XK8 F;  1V34 A;  1XXH B;  2KW0 A;  1L2C A;  1HJL A;  2V0I A;  4GBP A;  4GC5 A;  3BAH A;  3OH4 A;  1DFQ A;  2FY7 A;  2MGW A;  4FCT A;  3V0A A;  2QZ4 A;  1WHC A;  2HWJ A;  3U6O A;  1GWW A;  2DZN B;  2WSC F;  2NS2 A;  2F8X C;  4L8R C;  4D11 A;  3KS8 A;  3KOW E;  2VDB B;  4IQP A;  2Q3N B;  3F1R A;  5DNY A;  4MZG B;  4Y9X A;  4GHA A;  4GH9 A;  3MPP G;  1RY7 A;  4KPX A;  4I8M A;  2HZ9 A;  1FZW A;  3VDP A;  3AOG A;  1XNR M;  2VSA A;  2LH0 A;  8CAT A;  2BO6 A;  4J2X A;  1WT0 A;  2WVK A;  3N7J A;  1IM2 A;  5H37 D;  4IHZ A;  4CJC A;  3V0P A;  3ZCB B;  3NBI A;  2KNV A;  2JWS A;  4KC2 A;  3PUB A;  2K6B A;  5D91 A;  3TC2 A;  1VH1 A;  2DPW A;  1PJS A;  1PJQ A;  4AKG A;  3SXD A;  3BBZ A;  3U0Y A;  1G8P A;  1PJJ A;  1GX4 A;  2WAW A;  1SXJ D;  1OJL A;  3LMM A;  1TTE A;  3HHW A;  1NVM A;  5KO3 A;  4FD2 A;  2AGD A;  4LO1 C;  3W67 A;  5IWA M;  3PHZ A;  3UD8 A;  21BI A;  4OVZ A;  1PM5 A;  3FTD A;  2OO9 A;  5BXP A;  2FE8 A;  4NC6 A;  2C9C A;  1W3G A;  4KHP M;  5BR8 M;  1MP5 A;  1FGX A;  1Q02 A;  2E4M A;  4R71 A;  4OEF A;  4MGY E;  3FGM A;  1D0H A;  1WJ7 A;  1DV0 A;  1P3Q Q;  5BXS A;  1JT4 A;  3R2W A;  4MYB A;  2KNZ A;  3GPP A;  1ZDF A;  3WO2 A;  1Z5B A;  3R3I A;  1HT1 E;  4UN2 B;  2K4A B;  3I0E A;  5ITX E;  4EFP A;  1K5V A;  3PVS A;  4AKH A;  1E9R A;  2WZJ A;  5IT9 S;  4HCQ A;  1NQI B;  4G6M A;  3AKH A;  1I52 A;  3GLH E;  3KVW A;  4LO3 A;  2V1C A;  4DEP A;  3GUE A;  1R8N A;  3A21 A;  3PFI A;  1R82 A;  3GO8 A;  3U6L A;  3EIH A;  4F1I A;  3OAM A;  4LF7 M;  1IQP A;  1PWA A;  4I0Y A;  1Q1U A;  5EXX A;  4USP A;  3VSF A;  2K9D A;  2XZU A;  1H5S D;  2FO1 A;  4EEE B;  3T1H M;  2RQ9 A;  4MIX A;  2Y4L A;  3MJ5 A;  1DGH B;  3IHP A;  1H4C A;  1EZI A;  2ZAO A;  5ITT A;  4JI8 M;  4QD2 B;  1V6X A;  4FRP A;  4JKX B;  1PRB A;  5EP2 A;  2DAI A;  2E8B A;  4P00 A;  4JI6 M;  2YR0 A;  4X39 A;  4ISQ A;  4P16 A;  1JY0 A;  1G9B A;  2DHY A;  1NJF A;  4L41 C;  4DR1 M;  1JT7 A;  2KI6 B;  3BAV A;  3BA4 A;  1HM0 A;  1IXS A;  4END A;  1Q3C A;  3VT2 A;  1HIB A;  2VLC A;  2F5Q A;  4LO7 C;  2EJS A;  1RG8 A;  5FUH A;  2W82 A;  4KO8 A;  1W5S A;  5DUY A;  4LW3 A;  4KPZ A;  3C58 A;  3K9O A;  4EEG A;  1MD6 A;  2P23 A;  2OQ4 A;  1O7Q A;  2G8L A;  2K8R A;  3VLF B;  3SX7 A;  4L78 A;  1JV1 A;  4BQH A;  2ZR1 B;  4CGY B;  1HCE A;  2E3D A;  1DGH A;  5DDV A;  2FOI C;  2MZB A;  1IIL A;  1ON6 A;  5FSW A;  1GJT A;  2XFT A;  1DJS B;  4F2L A;  4EFQ A;  4HR6 C;  3RMV A;  3FE3 A;  4LF9 M;  1Z2V A;  2F2F C;  5C1G A;  4EEO A;  3O4A A;  2BWB A;  1YSY A;  1JLX A;  3ZXG A;  1IRP A;  4GAI A;  3GRU A;  4DR2 M;  1FR9 A;  1LZJ A;  1XYF A;  2DHR A;  1GLN A;  4KT7 A;  4LFC M;  2Y9W C;  4B3R M;  4GAF A;  1OIP A;  4JPZ A;  1Z90 A;  4FVM A;  5JI3 E;  4KT0 F;  2K0B X;  1ON8 A;  2YQC A;  1G4A E;  3IG8 A;  3AZV A;  4J23 B;  3P53 A;  1FOA A;  5EIY A;  4KQL A;  1IY0 A;  4FRL A;  3ST8 A;  5FU0 A;  2LVO C;  1R2Z A;  2UXB M;  2MR9 A;  2X49 A;  3SNV A;  4J2Y A;  3ZXD A;  1MP3 A;  2J0B A;  3BX1 C;  2CV1 A;  4QKS A;  1GQC A;  2VUA A;  1IXR C;  3NBD A;  3FUU A;  3QR5 A;  3U6E A;  1N75 A;  3U5Z B;  1QAO A;  3QAU A;  5BVP I;  1HQY E;  4B3M M;  2L5X A;  2VXR A;  3JUK A;  1GQ9 A;  2VQF M;  3PKQ A;  2QP9 X;  2BFH A;  3AKG A;  3V0Q A;  4Y64 A;  1R8O A;  3FYD A;  3U6S A;  3DUV A;  4DV5 M;  2VQE M;  2M60 A;  3A42 A;  1ZI4 A;  3FUX A;  4I4Q A;  3D8B A;  1HR0 M;  1FJG M;  2VS5 A;  2AEC A;  2L7H A;  5C3A A;  1EPW A;  2DRY A;  1VEK A;  2RG9 B;  3BRK X;  4II0 A;  5F8W A;  4B7H A;  2HKJ A;  5C49 A;  3ILK A;  1G1L A;  1O0R A;  5EP4 A;  4KNR A;  5CMJ A;  2EO2 A;  4B08 A;  3A98 B;  2MLL B;  3GRY A;  3GP1 A;  2QKX A;  2HWM A;  3CRH A;  1FWY A;  1JYL A;  2DEN A;  4L4I A;  5C4F A;  5CQM X;  5ITY A;  2QBY A;  5BP5 A;  5BXC A;  3E9S A;  2QN4 A;  4J2K A;  3AOE A;  2OEG A;  3I0D A;  5FTL A;  3V8Z A;  1BLA A;  2JA2 A;  2YCM A;  2A8W A;  4GKJ M;  3CF6 E;  4LO3 C;  4RF0 A;  3U6C A;  4PC4 A;  2FYB A;  1Z5C A;  4USO A;  2X5Z A;  1E32 A;  5L6S A;  3UZU A;  4EIW A;  1ITB A;  4Y6N A;  3GPU A;  3R4S A;  3FYC A;  2VFZ A;  1DZD A;  3LCU A;  4IBC A;  3OGF A;  4DE7 A;  2NQ8 C;  4DDZ A;  3OTO M;  4I5S A;  3FJK A;  3GLF B;  5BPV A;  2WE9 A;  4EEM A;  1DO2 A;  2RJ9 A;  2Q4J A;  1H4D A;  1ZMU A;  4AYJ A;  1HWM B;  1ZJ0 A;  4Y28 F;  3BRD A;  2DAK A;  4TLP A;  2P73 A;  1A8D A;  1H7E A;  2APC A;  4M0W A;  2Y6P A;  1NNJ A;  2LVN C;  2J5Y A;  4D48 A;  4ZGR B;  1S0F A;  3W0L B;  3O44 A;  3V8Y A;  5F90 A;  3VKH A;  1AVA C;  5C1L A;  1H7L A;  1S0C A;  2OOA A;  2DVW B;  4FCV A;  2FFJ A;  1W55 A;  4I4X A;  4OWK A;  2JCO A;  4LO2 C;  3RSJ A;  1TVY A;  1TOO A;  5EJ1 A;  2ZTD A;  1XWI A;  4NRV A;  4I37 A;  1FO8 A;  3POL A;  3KOX E;  4G4R A;  5CMF X;  4XFS A;  3HU2 A;  4B2W A;  1M2T B;  4NL4 H;  4KEK A;  4B7F A;  1NZK A;  1VH3 A;  2CHG A;  4II7 A;  4F83 A;  2X2T A;  2NP0 A;  5FZU A;  3KXE C;  3OGG A;  2R62 A;  4LJ9 A;  1ABR B;  2DNA A;  2CUZ A;  2ICY A;  4YS8 A;  4LF4 M;  2RST A;  3CA4 A;  3MAL A;  4WUR A;  4OU7 A;  2J3P A;  4FWD A;  2UUC M;  3AZW A;  3U60 A;  3OH2 A;  1L1Z A;  2Y4M A;  4D80 A;  1H5T A;  5FV9 A;  1J09 A;  4QC4 A;  2EA0 A;  1ONK B;  2J7O A;  3AJ5 A;  5FNW A;  4JIS A;  4P6A A;  1I94 M;  4JI4 M;  2R0I A;  3PXG A;  1IIM A;  5EJZ A;  4G3S A;  2PX7 A;  3FJC A;  4L4H A;  1WIV A;  4B7G A;  2V0K A;  2GQF A;  3CRI A;  1OTR A;  4ANR A;  1ISY A;  1PGY A;  3J27 B;  1J5E M;  4JAW A;  1LZ0 A;  3KFU G;  3DFZ A;  3U5Z A;  4MND A;  4M2A A;  3I0F A;  4FVV A;  3UJ0 A;  1NWG B;  1VPA A;  1KSF X;  2F4V M;  4H75 A;  2L6O A;  2VF7 A;  4QHT A;  1OFH A;  1ISZ A;  1GL6 A;  3WIN A;  4EFR A;  1FR8 A;  2KRK A;  2VK9 A;  4Y7T A;  2DWN A;  1H6U A;  2OOB A;  5L8R F;  5BXT A;  1G9A A;  3SYL A;  2D7H A;  2X5S A;  2O25 A;  5EP1 A;  3SHF A;  3V91 A;  1QVR A;  3GLG E;  2XWN A;  3FTE A;  1IJT A;  4Z9W B;  3OH3 A;  4HLQ A;  3S8J A;  1YXW A;  3TE6 A;  3I4V A;  5G00 A;  1H3M A;  1II4 A;  5C8R A;  4D0Z A;  4Q9P A;  2AQZ A;  3HGI A;  4FRO A;  3D8V A;  4FRA A;  5CQN X;  2DI0 A;  1I1B A;  4YY3 M;  1DGF A;  2KNA A;  1ZCU A;  1QQW A;  3GPX A;  3U2U A;  1V6U A;  2D0J A;  3AKI A;  3UDA A;  3E4R A;  4NAL A;  5L6V A;  3FJF A;  1AF9 A;  3FWW A;  2UUS A;  5D63 A;  3DOA A;  4J2S A;  1ZV1 A;  3H6R B;  2L4E A;  4XFT A;  5DFL A;  4IBI A;  4IY9 A;  4DR6 M;  3SAW A;  1L1T A;  4QAL A;  1N77 A;  3IIR A;  2EKF A;  1HQC A;  1MX0 A;  4AYL A;  1HWO B;  3JRR A;  3I0L A;  2WRY A;  5FU8 A;  5KPT A;  2DRE A;  1WXQ A;  1HNW M;  3J7B A;  1NHG C;  1R80 A;  2KKI A;  3SAS A;  1T9F A;  3VKG A;  1QZM A;  2AHM A;  3W68 A;  5C4C A;  2O1H A;  2NZ9 A;  1GO5 A;  4HO8 A;  1AFC A;  1XMQ M;  1OQY A;  4CVH A;  1CUK A;  1TZF A;  4CHT B;  2AXM A;  1CE7 B;  1N32 M;  1JT5 A;  3BTA A;  4LGY A;  5IFY A;  3HBW A;  1SZ6 B;  3LQR A;  5D92 A;  4JXJ A;  4G9M A;  3T8S A;  3VT0 A;  1LL0 A;  2QBY B;  1QG8 A;  2WSE F;  1R81 A;  1IN5 A;  2AH9 A;  1DFC A;  2PGV A;  2I7P A;  2VSH A;  2CHQ A;  3RTI B;  1VZT A;  2L7I A;  2VSI A;  4B5B A;  3V0M A;  4I2S A;  1Z0H A;  1HV9 A;  3JAM S;  2V0J A;  4MGK E;  9ILB A;  2FFV A;  3ZH9 B;  1E9S A;  4FW9 A;  4GEW A;  1OAI A;  3HAL A;  2QH5 A;  2QYI B;  3V79 C;  4JI1 M;  2JP7 A;  2EKK A;  2KA6 B;  4HO9 A;  3FUT A;  4B4M A;  5A2Q S;  5I1F A;  4GOY A;  5B2H A;  2F5O A;  4FCE A;  1MC9 A;  5E26 A;  2LXE A;  4B3U A;  4LO2 A;  4YOL A;  1NF5 B;  3SMP A;  1EVT A;  3U61 B;  3A07 A;  3L25 A;  4HO3 A;  4AG6 A;  1LTM A;  3WMU A;  2N35 A;  1K5U A;  5C1B A;  1QGS A;  4AG5 A;  2L4F A;  3SFZ A;  1FO9 A;  3KP0 E;  1QYR A;  1PJT A;  4G6J A;  5C1H A;  3U6P A;  3KP1 E;  3AV0 A;  3AKZ A;  4Q7J A;  1G8O A;  3GLI A;  2KZS A;  2AM4 A;  2JCL A;  4REZ A;  4JD0 A;  2VSE A;  5FLX S;  3K1J A;  3JR4 A;  2RIY A;  3I0I X;  3GLF E;  3Q8X A;  1Q04 A;  4G9N A;  3V0A B;  4KEI A;  3KIA A;  2MIB A;  3QYD A;  3FJA A;  4AQY M;  2UUA M;  4OW0 A;  1G2V A;  4TUW A;  1LZ7 A;  3SX8 A;  3RFW A;  1AVU A;  4FRH A;  1S0B A;  1H5R A;  1W77 A;  1H5S A;  1H5R B;  4I4V A;  5D62 A;  3N0K A;  4J18 A;  3IM5 A;  3WO3 A;  3UD9 A;  1EYL A;  4LJ7 A;  1QDR A;  3WMV A;  1TW1 A;  3OH1 A;  4CJ8 A;  3MHV C;  1JVG A;  1NO1 A;  1C1K A;  2OPF A;  2WVL A;  4S12 A;  4ION A;  3R8F A;  1TR8 A;  3HX3 A;  1QDT A;  4AKI A;  2WGZ A;  5HPZ A;  4F34 A;  1IFY A;  3I01 M;  3MMP A;  5FTS A;  2YC5 A;  4KLN A;  1G23 A;  3Q8G A;  1LVW A;  4GRI A;  1H5T B;  3I4Y A;  5KQ8 A;  1GL7 A;  3GQ4 A;  2K47 A;  2D7G A;  2AES A;  3VWC A;  3FOQ A;  3HOM A;  2XFS A;  3GPY A;  2YNM D;  3NJ5 A;  1D0K A;  3ZGG A;  3TQD A;  3K1X A;  5LMN M;  1V83 A;  1N4K A;  5F3W A;  3IEC A;  1TP0 A;  1K4V A;  4JI0 M;  2DS0 A;  1WT3 A;  2W0W A;  4RKU F;  3Q4S A;  3AL0 C;  1ZCY A;  1V33 A;  1H7G A;  4JYA M;  2I5E A;  3IG5 A;  1NHE B;  3CA5 A;  2YQJ A;  4DV1 M;  2Q2E B;  4UY4 A;  2NYY A;  1K82 A;  3TWM A;  4HO0 A;  2CHV A;  1ISW A;  5KPR A;  3CU1 B;  3U6M A;  1TH3 A;  4I3N A;  2GO2 A;  3H4M A;  1YTO A;  1NMM B;  1GKI A;  1XNQ M;  1O7O A;  5I1B A;  2RIX A;  3ZLK A;  4MGI E;  2RJ4 A;  2D23 A;  4PCZ A;  4FRM A;  4FWG A;  3HSM A;  4QNR A;  1HM9 A;  1Q39 A;  4PDI A;  2JCJ A;  5CMH A;  1AVW B;  4HO6 A;  1Q3B A;  3E21 A;  3GQ5 A;  1E0O A;  4QNM A;  1PZT A;  3AKF A;  4EE3 A;  4JN6 A;  3T7M A;  1R5L A;  3V0N A;  5ITQ A;  4LO7 B;  4DCK C;  4FRE A;  2XWM A;  3QYE A;  4GIP A;  1FV2 A;  2KRU A;  4I1E A;  4HL4 A;  3SXG A;  1VGZ A;  4X64 M;  3DA1 A;  3SYK A;  1FQ9 A;  3EIE A;  1J7K A;  1WR1 B;  1QUT A;  2QNJ A;  4L4U A;  2I1B A;  3U2W A;  1VQ1 A;  3LW5 F;  2RJ5 A;  3HJS A;  3T1Y M;  1HNZ M;  3HMY A;  4FGF A;  3I0H A;  3BCV A;  3NBN A;  4O6N A;  2APL A;  4I6I A;  1AIP C;  3L26 A;  2VU9 A;  1WSZ A;  2DXI A;  3CKN A;  2ERC A;  31BI A;  3FJE A;  1OIZ A;  3OJ2 A;  2CV2 A;  4Z8S B;  1EV2 A;  1WT1 A;  3K92 A;  3ZF8 A;  2KEB A;  2D20 A;  2DAE A;  4M9X A;  4IRP A;  1YP4 A;  3V76 A;  4DR5 M;  3DJ4 A;  4Y7F A;  2RJ8 A;  2UUB M;  5C4E A;  4X65 M;  3ZC8 A;  1S0E A;  4M9Z A;  1NV9 A;  3JR5 A;  3SAR A;  1WD3 A;  4NAN A;  3NWL A;  2CEA A;  1G3L A;  2ZM6 M;  3UK6 A;  1ZIZ A;  3I0C A;  4QO3 A;  2R4E A;  3POK A;  2HHH M;  4M2B A;  3IOI A;  5JQQ A;  3FJI A;  3BAQ A;  1HWN B;  1IXS B;  1AVX B;  1QAM A;  2OI6 A;  1TFM B;  1IBL M;  2O1F A;  2Y4K A;  4Z8X A;  4I8O A;  1G82 A;  2DRZ A;  3SXA A;  2BJV A;  3CKO A;  4D82 A;  3RGP A;  2C9O A;  2AM5 A;  2PGY A;  3CGX A;  3RSB A;  3F92 A;  3AOE C;  1IN6 A;  1JR3 A;  1VIC A;  2V1U A;  4Y63 A;  5CQO A;  3I0G A;  1PZY B;  3HY5 A;  2I5K A;  4IJF A;  4QD2 C;  1YUB A;  2DZL A;  2MC2 A;  4AAW A;  4KC1 A;  4IBB A;  3SAV A;  1ZJ1 A;  3A22 A;  2QCU A;  1FWU A;  3Q7W A;  4DEN A;  3NGW A;  2QHO B;  1TH4 A;  3N7L A;  1L2B A;  2QGI A;  4ZFW B;  4YHH M;  5ITR A;  4IBD A;  3BAD A;  4ASJ A;  3I51 A;  2D24 A;  2JY7 A;  3C9Z A;  3VK7 A;  2HW9 A;  3TWK A;  4B4B A;  2P6W A;  3HJ8 A;  1XXH A;  4I4R A;  3N7K A;  4NXM M;  4K0K M;  3PNY A;  4DV2 M;  2WVM A;  4Y7U A;  4QBC A;  1S4N A;  2XWL A;  2RRU A;  2JY8 A;  4M0D A;  1R7V A;  3P6I A;  2O01 F;  5EG6 C;  3CA3 A;  3ZX7 A;  7CAT A;  4GHL A;  2A8U A;  3NBX X;  4KC3 A;  1VDD A;  5HS2 A;  5C4B A;  1IOB A;  4P0L A;  2Z87 A;  3OGZ A;  1V6W A; 
#chains in the Genus database with same CATH homology
 1IY2 A;  4RNA A;  4G4O A;  2Y9F A;  1R7X A;  3AJ6 A;  1EE8 A;  1G9D A;  5CQP A;  4ZFY B;  2RIT A;  1VGU A;  3M7G A;  3A23 A;  5FTJ A;  3CF2 A;  5FTM A;  4XGI A;  1HJJ A;  2OEF A;  4KC4 A;  4IZE A;  3FTC A;  4QOS A;  1QAQ A;  1JR3 D;  1KNM A;  1G95 A;  1VCL A;  5BQU A;  2YQZ A;  4JRA A;  5EXT A;  1SXJ A;  1K3X A;  1FN0 A;  6I1B A;  3OKR A;  4K6R A;  1TH2 A;  1XC8 A;  3J2P B;  3H6R A;  4OEE A;  1ISV A;  3CA0 A;  4NAI A;  4X3A A;  2UXC M;  3T15 A;  5JMC A;  4LRS A;  1W5T A;  4EE5 A;  3J7A S;  4L16 A;  4FWH A;  2D7R A;  3OJM A;  1ISX A;  4DV6 M;  2M49 A;  1ILR 1;  2XGN A;  1DGG A;  3GRR A;  4X62 M;  3KOY E;  1WT2 A;  4FRQ A;  1DQO A;  1V6V A;  1KFV A;  3GLH A;  1JT3 A;  2D43 A;  2VII A;  4Z6Y A;  2W0V A;  3N7M A;  5F8Y A;  4ZPX A;  3K8D A;  3U6Q A;  4GC9 A;  2H1R A;  1FXO A;  4B42 A;  4ZBV B;  1K3W A;  3VFD A;  5C18 A;  3AH4 A;  2X60 A;  3I29 B;  1R7R A;  1G93 A;  5C47 A;  4I4U A;  1N36 M;  1JVD A;  4IIW A;  1L8Q A;  1IIN A;  4OX9 M;  1VZU A;  3UGJ A;  3FJJ A;  3OJV A;  1N34 M;  5BP5 C;  3Q7U A;  3I0J A;  1NY5 A;  2CFO A;  4G1R A;  4X66 M;  1XHB A;  1ZJ3 A;  5DVH A;  5FYE A;  1ORY B;  2P72 A;  2D7E A;  3ZC9 A;  1WBA A;  2BO8 A;  1FV3 A;  1ZAE A;  2R65 A;  3WO4 A;  4JI3 M;  1GVN A;  4BLC A;  3F1Y A;  4M9S A;  1PUM B;  3V0O A;  3U0X A;  1SR4 C;  1IRA X;  1TGU A;  2ET2 A;  1SXJ E;  1YP3 A;  2ZAN A;  4P0J A;  4GP0 A;  3OC9 A;  4MGH A;  1UPS A;  2CE7 A;  5CMI A;  2IHO A;  3IM6 A;  4IZX A;  2LNH C;  2C99 A;  3I2X A;  3KOZ E;  1WBC A;  3O4D A;  4MZF B;  5AJP A;  1VM8 A;  3THG A;  2NXV A;  4CIS A;  1Z59 A;  3PME A;  4QOZ C;  1OFI A;  2OI7 A;  4NSO B;  2NVH A;  1LV7 A;  4EE4 A;  4LF6 M;  4ZFU B;  5IRE B;  3L2A A;  2NTD A;  3WHK A;  3V90 A;  2V0L A;  3H6Q A;  2YFQ A;  1IHK A;  4MGZ E;  4LO0 C;  1H5S B;  2ERM A;  1QGQ A;  2C98 A;  4DR7 M;  2Z4R A;  5CMG X;  4KXO A;  5EQT A;  1W57 A;  1IN4 A;  3BAU A;  1JTC A;  3USR A;  4ARW A;  4AW4 A;  3CQA A;  5KQD A;  3CA6 A;  2VS3 A;  1NKH B;  1R6B X;  1ZDG A;  2XEP A;  2RIZ A;  4IYB A;  4NSR A;  4A7Z A;  3P6J A;  1YF8 B;  2QPA A;  2VS4 A;  1OMX A;  2XMH A;  1BA7 A;  3SAT A;  3F62 B;  1LL2 A;  3O49 A;  4LO8 B;  4P0K A;  3K8Z A;  1H4E A;  4RF1 A;  2K43 A;  1J0S A;  3FKE A;  2FYD B;  1ZI1 A;  1G59 A;  3FFZ A;  4IY8 A;  4LW6 A;  1HCD A;  2KZU A;  1TWM A;  4Y6U A;  3SXC A;  1XMO M;  2KXE A;  2CV0 A;  2OI5 A;  4XBO A;  1ZI3 A;  3CF0 A;  4G4Q A;  4KRV A;  4I4O A;  5EXP A;  5D61 A;  1S4P A;  3SX3 A;  4EKX B;  4LGM A;  1E5K A;  1ZJ2 A;  4JP0 A;  2AM3 A;  1QQL A;  3QWL A;  4AN7 B;  2R4J A;  4D11 C;  3GRV A;  1I1E A;  4A7Y A;  2O1G A;  5BOW A;  3BA7 A;  1XG6 A;  1DQG A;  3BRG C;  2VXM A;  2RJ6 A;  3CKJ A;  5JI2 E;  2E5L M;  3K8E A;  1JQJ C;  4FIX A;  4Y62 A;  1FNN A;  2KLL A;  1FGA A;  2GGO A;  8I1B A;  2NM1 A;  3CRG A;  2YES A;  3V0B B;  4G3Q A;  1NUN A;  2X8A A;  4LY6 A;  4E1K A;  4IBJ A;  2PA4 A;  5E6J A;  3Q7Y A;  1BAS A;  3U2V A;  3SC3 A;  3KDS E;  2Y4J A;  2Y0T A;  4B3S M;  1ZQ9 A;  3R9X B;  1DIW A;  1JV3 A;  4XFU A;  3GLH B;  5ITU A;  3WHL A;  2JCK A;  2FNA A;  1GX0 A;  1NHW C;  2F2F A;  2FYA A;  5DZU A;  2WBC A;  3E8L C;  2GZB A;  3LLP A;  3A46 A;  2R9K B;  4GMQ A;  1ZCV A;  4MM3 B;  2ICX A;  4D81 A;  2DZO B;  1Q03 A;  2CU2 A;  2IWT B;  2YQS A;  1AXM A;  4ZOT A;  3CU0 A;  3JTJ A;  4H9W A;  4FIY A;  4JI5 M;  4M28 A;  1R7T A;  2Z7J A;  3M0E A;  3VSZ A;  1FMM S;  4OEG A;  2DWZ B;  4DUY M;  4JV5 M;  4JQ0 A;  1JYK A;  3E26 A;  1Z4S A;  1V84 A;  3FUW A;  4OUJ A;  3D98 A;  4W5W A;  4R6U B;  1TTU A;  3JUT A;  4HO2 A;  4B4G A;  4GIT A;  2AE7 A;  1IBK M;  3GLG A;  1BFB A;  3V0L A;  3FTF A;  4A7K A;  3UD7 A;  2HWA A;  4HOC A;  1PJI A;  4G87 A;  4EEA A;  3K2L A;  5FZZ A;  1IY1 A;  2LIQ A;  2Q9X A;  1MU5 A;  2HL7 A;  1G3I A;  4NOO B;  1SR4 A;  3AH1 A;  1G97 A;  2R18 A;  1S0G A;  3I2A A;  1Z6T A;  4CJM A;  3CAH A;  4G3P A;  5EC5 A;  1FRW A;  5BXR A;  5EJC A;  2F5N A;  3QVB A;  1H7H A;  2RGO A;  4AC3 A;  4R7P A;  5IDS A;  3RE8 A;  4KNX A;  1INI A;  2ESU A;  3W0F A;  3H6S E;  3KSX A;  2UX8 A;  2XOA A;  1ZHJ A;  4ZA3 B;  1NY6 A;  3CA1 A;  4XKI A;  4EB2 B;  3T38 A;  4D8H A;  4C2S A;  4LRT A;  2FFU A;  4HG6 A;  4LO0 A;  4ZKT B;  4AI6 A;  4NXN M;  4FCW A;  3J81 S;  4X38 A;  3O3P A;  2P5T A;  1IN8 A;  4LF8 M;  4MH0 E;  1WVC A;  3OH0 A;  3SBJ A;  3HU1 A;  4NAK A;  2XSZ D;  2DWM A;  3FJD A;  4OWL A;  4D0T A;  3T7O A;  2BEB A;  2D7I A;  2VXT I;  4FCU A;  4IBK A;  3F1C A;  4AZF A;  5BQU C;  4GKK M;  2BNK A;  1SXJ C;  3FD9 A;  2FDB M;  1FMZ A;  3BA5 A;  1YYN A;  1VGW A;  4GP3 A;  2LWX A;  4HO4 A;  1BFG A;  4XWI A;  4PD2 A;  1V82 A;  1XZ6 A;  3L29 A;  2L09 A;  5AJN A;  1BLD A;  4LJ8 A;  1IN7 A;  4OVZ B;  4NRW A;  2O5R A;  4MB7 A;  1G9C A;  1INJ A;  4KOD A;  5KPZ A;  3HU3 A;  1QQK A;  3IM7 A;  4AN6 A;  2C0N A;  3TL4 X;  5E24 E;  4IJE A;  4G6Z A;  5EXS A;  3PKP A;  2XZF A;  1FWV A;  4DR3 M;  1IBM M;  3O4B A;  1R7U A;  3GQ3 A;  3CKV A;  4X37 A;  2Y0Q A;  1E94 E;  5C3B A;  4DEC A;  1JLY A;  1FXJ A;  2HCB A;  2UU9 M;  1JQZ A;  3L27 A;  5ITX A;  1KWS A;  3CKQ A;  1SXJ B;  2YUG A;  2R45 A;  2I7B A;  4FQW A;  1N33 M;  4LO1 A;  3SPT A;  3HN1 A;  3BAO A;  3DZD A;  4R3D A;  4DV0 M;  3AJI B;  2G5G X;  3KMV A;  3M6A A;  4LZJ A;  2BEA A;  1P63 A;  1QXM A;  5J49 A;  4BB9 A;  4I4P A;  4O6M A;  3HHX A;  2Z3X A;  3B9P A;  3BAG A;  2ZBK B;  2BJW A;  4R7G A;  3GLF A;  1TW5 A;  4KBB A;  2YQH A;  5DDT A;  2ZQO A;  1NSF A;  2XSZ A;  2R46 A;  1FGG A;  5C3D A;  1VZX A;  3U61 A;  3AFH A;  1BFC A;  1YP2 A;  4IBE A;  4FRB A;  3FUV A;  4Y7G A;  5CQL X;  3EF2 A;  4H04 A;  5DSS B;  3TQS A;  4LJA A;  3BRF A;  2Y20 A;  4A3V B;  5DYI A;  2ZU7 A;  5FZY A;  4BBA A;  3RMY A;  2Y21 A;  1I4W A;  1OQM B;  3SMS A;  2YC3 A;  2J0A A;  4I1B A;  3RMX A;  2FYC B;  4WW0 A;  4DV3 M;  4DR4 M;  1GA8 A;  3TWL A;  3W9T A;  4LJ5 A;  3HL3 A;  3LW6 A;  4PDG A;  3HHZ A;  5FTN A;  3VUO A;  1RZO B;  1HNX M;  4LJ4 A;  3SAU A;  3LQQ A;  4I7I A;  2Z4S A;  4P02 A;  1S0D A;  4GOV A;  2XH9 A;  3LVV A;  3D7W B;  1DGB A;  2RJ7 A;  5LMU M;  1YRO B;  3UJ4 A;  3D8L A;  1T4Q A;  3U60 B;  2EUC A;  2ZU9 A;  1G41 A;  1OQL B;  3U2X A;  4ZDQ A;  4I81 A;  3RTJ B;  5F8S A;  3FJ8 A;  4ECM A;  2RGH A;  2I7N A;  5GKN A;  2D22 A;  4EVW A;  1NNU C;  4ITQ A;  5IDT A;  2Z49 A;  1MP4 A;  1QWJ A;  1S3S A;  2A5Y B;  3T7N A;  2M5Z A;  4LF5 M;  4KEJ A;  2V0H A;  1BAR A;  4DV7 M;  4JI2 M;  3EE5 A;  3HJQ A;  5EP3 A;  1YBI A;  41BI A;  1DZC A;  1DLL A;  3VK8 A;  5FTV A;  1ZCT A;  3BB2 A;  4ISR A;  3NBC A;  3BOS A;  2ZQN A;  1HWP B;  4ASY A;  3OBT A;  4I4Y A;  4HA2 A;  3HWS A;  3TPZ A;  3IOJ A;  4Y7V A;  2AAI B;  3D5N A;  5C48 A;  3UMM A;  4IBF A;  3E25 A;  1KYI A;  2XLJ A;  1YE9 A;  1GWV A;  3Q80 A;  1PZZ A;  1WD4 A;  4QKR A;  2X2S A;  2X4A A;  4HJJ A;  2C96 A;  1G9R A;  1PUU B;  1W3F A;  1S0L A;  2Y7A A;  3B9U A;  3Q7X A;  1Z5A A;  3RGS A;  2P39 A;  1SS9 A;  4DUZ M;  4MZH A;  1GGP B;  2QEN A;  4B3T M;  4LFB M;  3TZT A;  3AH2 A;  1XZZ A;  4LCB A;  2RKO A;  2UXD M;  4UEG A;  4BMA A;  3LVW A;  4FRD A;  2AFG A;  2KH2 A;  3LTQ A;  4LFA M;  5DYG A;  1QAN A;  1HT2 E;  1HKN A;  1TIE A;  3RMW A;  7I1B A;  1LZI A;  3R4U A;  2E4M C;  3KSJ A;  3ZC7 B;  2RJ0 A;  2DWL A;  2VXL A;  1N78 A;  2WEE A;  2X65 A;  3VEQ A;  2ZU8 A;  2GGQ A;  1R2Y A;  2F5S A;  5EHA A;  1R7Y A;  3GLI B;  3PNN A;  2Z48 A;  5C38 A;  4OWJ A;  1D2N A;  4I96 A;  1HM8 A;  4B2X A;  3N9W A;  2XME A;  1F31 A;  1IT0 A;  3DK5 A;  1VGT A;  1H7T A;  1M16 A;  2C5R A;  4Q91 A;  2F5P A;  4JI7 M;  1X37 A;  3U2T A;  2XF3 A;  1H7F A;  1L2D A;  2Y9G A;  3IAG C;  1ZJP A;  5C4D A;  3S8K A;  4QHS A;  2LIE A;  4CJB A;  5FNX A;  3VT1 A;  1L2H A;  1IXZ A;  4LZZ A;  3PG0 A;  3MK6 A;  3KW6 A;  5AJO A;  1ZJO A;  5C36 A;  1MC3 A;  3ILA A;  4PT5 A;  3FUO A;  4ZLB B;  4OW4 A;  3O4C A;  3FJH A;  4M4K A;  4I4L A;  3WIN C;  3O4O A;  1NJG A;  2BO4 A;  3SXB A;  1H7Q A;  5IZ7 D;  3A45 A;  1G0R A;  4QBV A;  4Q9G A;  3FJ9 A;  1S4O A;  1PC8 B;  4LG2 A;  3SHG B;  2ZAM A;  1CVS A;  4IRQ A;  1EYR A;  1BFF A;  3ZLL A;  2FGF A;  3FUQ A;  4WBC A;  3O5W B;  4HO5 A;  2V6Z M;  1DO0 A;  2RJ1 A;  3J80 S;  2VD4 A;  1FG5 N;  4Q7C A;  2Y9X E;  1TDZ A;  2Z86 A;  1O23 B;  3USQ A;  4LJ6 A;  5GAQ A;  3O3Q A;  3JUJ A;  4IBG A;  2D1Z A;  3PNV A;  4JKQ A;  3OBR A;  3SX5 A;  3VDU A;  3IOH A;  2J7N A;  3U6D A;  3SXE A;  3L28 A;  1H5S C;  3ZGF A;  3UJN A;  4L15 A;  1OMZ A;  1T3T A;  3NBE A;  3KS4 A;  3FJB A;  1TDH A;  5FTK A;  3WA1 A;  3HHY A;  2KI4 A;  5JLV A;  2D44 A;  4DV4 M;  1RML A;  3HKP A;  1TWE A;  3GLG B;  1W3A A;  3I0K A;  3CTW B;  2BO7 A;  3V0B A;  1ZI5 A;  1UM8 A;  1LL3 A;  4I4S A;  4G4N A;  2V0I A;  1XXH B;  2KW0 A;  1L2C A;  1HJL A;  4GBP A;  4GC5 A;  3BAH A;  3OH4 A;  1DFQ A;  2FY7 A;  4FCT A;  3V0A A;  2QZ4 A;  3U6O A;  1GWW A;  2DZN B;  2NS2 A;  2F8X C;  4L8R C;  4D11 A;  3KS8 A;  3KOW E;  4IQP A;  2Q3N B;  3F1R A;  5DNY A;  4MZG B;  4Y9X A;  4GHA A;  4GH9 A;  3MPP G;  1RY7 A;  4KPX A;  4I8M A;  2HZ9 A;  1FZW A;  3VDP A;  3AOG A;  1XNR M;  2VSA A;  2LH0 A;  8CAT A;  2BO6 A;  4J2X A;  1WT0 A;  2WVK A;  3N7J A;  1IM2 A;  5H37 D;  4IHZ A;  4CJC A;  3V0P A;  3ZCB B;  3NBI A;  4KC2 A;  3PUB A;  5D91 A;  3TC2 A;  1VH1 A;  2DPW A;  4AKG A;  3SXD A;  3U0Y A;  1G8P A;  1PJJ A;  1GX4 A;  2WAW A;  1SXJ D;  1OJL A;  3LMM A;  3HHW A;  1NVM A;  5KO3 A;  4FD2 A;  2AGD A;  4LO1 C;  5IWA M;  3PHZ A;  3UD8 A;  21BI A;  4OVZ A;  1PM5 A;  3FTD A;  5BXP A;  2FE8 A;  2C9C A;  1W3G A;  4KHP M;  5BR8 M;  1MP5 A;  1FGX A;  2E4M A;  4OEF A;  4MGY E;  3FGM A;  1D0H A;  5BXS A;  1JT4 A;  3R2W A;  4MYB A;  3GPP A;  1ZDF A;  3WO2 A;  1Z5B A;  3R3I A;  1HT1 E;  2K4A B;  3I0E A;  5ITX E;  4EFP A;  1K5V A;  3PVS A;  4AKH A;  1E9R A;  5IT9 S;  4HCQ A;  1NQI B;  4G6M A;  3AKH A;  1I52 A;  3KVW A;  4LO3 A;  2V1C A;  4DEP A;  3GUE A;  1R8N A;  3A21 A;  3PFI A;  1R82 A;  3GO8 A;  3U6L A;  3EIH A;  3OAM A;  4LF7 M;  1IQP A;  1PWA A;  4I0Y A;  1Q1U A;  5EXX A;  4USP A;  3VSF A;  1H5S D;  2XZU A;  2FO1 A;  4EEE B;  3T1H M;  2RQ9 A;  4MIX A;  2Y4L A;  3MJ5 A;  1DGH B;  1H4C A;  1EZI A;  2ZAO A;  5ITT A;  4JI8 M;  4QD2 B;  1V6X A;  4FRP A;  4JKX B;  5EP2 A;  2E8B A;  4P00 A;  4JI6 M;  2YR0 A;  4X39 A;  4ISQ A;  4P16 A;  1JY0 A;  1G9B A;  1NJF A;  4L41 C;  4DR1 M;  1JT7 A;  2KI6 B;  3BAV A;  3BA4 A;  1HM0 A;  4END A;  1Q3C A;  3VT2 A;  1HIB A;  2VLC A;  2F5Q A;  4LO7 C;  1RG8 A;  5FUH A;  2W82 A;  4KO8 A;  1W5S A;  5DUY A;  4LW3 A;  4KPZ A;  3C58 A;  4EEG A;  1MD6 A;  2P23 A;  2OQ4 A;  1O7Q A;  2G8L A;  2K8R A;  3VLF B;  3SX7 A;  4L78 A;  1JV1 A;  4BQH A;  2ZR1 B;  4CGY B;  1HCE A;  2E3D A;  1DGH A;  5DDV A;  2FOI C;  2MZB A;  1IIL A;  1ON6 A;  5FSW A;  2XFT A;  1DJS B;  4EFQ A;  3RMV A;  4HR6 C;  4LF9 M;  1Z2V A;  2F2F C;  5C1G A;  4EEO A;  3O4A A;  1YSY A;  1JLX A;  3ZXG A;  1IRP A;  4GAI A;  3GRU A;  4DR2 M;  1FR9 A;  1LZJ A;  1XYF A;  2DHR A;  1GLN A;  4KT7 A;  4LFC M;  2Y9W C;  4B3R M;  4GAF A;  4JPZ A;  1Z90 A;  4FVM A;  5JI3 E;  1ON8 A;  2YQC A;  1G4A E;  3IG8 A;  3AZV A;  4J23 B;  3P53 A;  1FOA A;  5EIY A;  4KQL A;  1IY0 A;  4FRL A;  3ST8 A;  5FU0 A;  1R2Z A;  2UXB M;  2X49 A;  3SNV A;  3ZXD A;  4J2Y A;  1MP3 A;  2J0B A;  3BX1 C;  2CV1 A;  4QKS A;  1GQC A;  2VUA A;  1IXR C;  3NBD A;  3FUU A;  3QR5 A;  3U6E A;  1N75 A;  3U5Z B;  1QAO A;  3QAU A;  5BVP I;  1HQY E;  4B3M M;  2L5X A;  2VXR A;  3JUK A;  1GQ9 A;  2VQF M;  3PKQ A;  2QP9 X;  2BFH A;  3AKG A;  3V0Q A;  4Y64 A;  1R8O A;  3FYD A;  3U6S A;  3DUV A;  4DV5 M;  2VQE M;  2M60 A;  3A42 A;  1ZI4 A;  3FUX A;  4I4Q A;  3D8B A;  1HR0 M;  1FJG M;  2VS5 A;  2AEC A;  2L7H A;  5C3A A;  1EPW A;  2DRY A;  2RG9 B;  3BRK X;  4II0 A;  5F8W A;  4B7H A;  2HKJ A;  5C49 A;  3ILK A;  1G1L A;  1O0R A;  5EP4 A;  4KNR A;  5CMJ A;  2EO2 A;  4B08 A;  3A98 B;  2MLL B;  3GRY A;  3GP1 A;  2QKX A;  2HWM A;  3CRH A;  1FWY A;  1JYL A;  4L4I A;  5C4F A;  5CQM X;  5ITY A;  2QBY A;  5BP5 A;  5BXC A;  3E9S A;  2QN4 A;  4J2K A;  3AOE A;  2OEG A;  3I0D A;  5FTL A;  3V8Z A;  1BLA A;  2JA2 A;  2YCM A;  2A8W A;  4GKJ M;  3CF6 E;  4LO3 C;  4RF0 A;  3U6C A;  4PC4 A;  2FYB A;  1Z5C A;  4USO A;  2X5Z A;  1E32 A;  5L6S A;  3UZU A;  4EIW A;  1ITB A;  4Y6N A;  3GPU A;  3R4S A;  3FYC A;  2VFZ A;  1DZD A;  4IBC A;  3OGF A;  4DE7 A;  2NQ8 C;  4DDZ A;  3OTO M;  4I5S A;  3FJK A;  3GLF B;  5BPV A;  2WE9 A;  4EEM A;  1DO2 A;  2RJ9 A;  2Q4J A;  1H4D A;  4AYJ A;  1HWM B;  1ZJ0 A;  3BRD A;  4TLP A;  2P73 A;  1A8D A;  1H7E A;  2APC A;  4M0W A;  2Y6P A;  1NNJ A;  4D48 A;  4ZGR B;  1S0F A;  3W0L B;  3O44 A;  3V8Y A;  5F90 A;  3VKH A;  1AVA C;  5C1L A;  1H7L A;  1S0C A;  2DVW B;  4FCV A;  2FFJ A;  1W55 A;  4I4X A;  4OWK A;  2JCO A;  4LO2 C;  3RSJ A;  1TVY A;  1TOO A;  5EJ1 A;  4NRV A;  1XWI A;  4I37 A;  1FO8 A;  3POL A;  3KOX E;  4G4R A;  5CMF X;  4XFS A;  3HU2 A;  4B2W A;  1M2T B;  4NL4 H;  4KEK A;  4B7F A;  1NZK A;  1VH3 A;  2CHG A;  4II7 A;  4F83 A;  2X2T A;  2NP0 A;  5FZU A;  3KXE C;  3OGG A;  2R62 A;  4LJ9 A;  1ABR B;  2CUZ A;  2ICY A;  4YS8 A;  4LF4 M;  2RST A;  3CA4 A;  3MAL A;  4WUR A;  4OU7 A;  2J3P A;  4FWD A;  2UUC M;  3AZW A;  3U60 A;  3OH2 A;  1L1Z A;  2Y4M A;  4D80 A;  1H5T A;  5FV9 A;  1J09 A;  4QC4 A;  2EA0 A;  1ONK B;  2J7O A;  3AJ5 A;  5FNW A;  4JIS A;  4P6A A;  1I94 M;  4JI4 M;  3PXG A;  1IIM A;  5EJZ A;  4G3S A;  2PX7 A;  3FJC A;  4L4H A;  4B7G A;  2V0K A;  3CRI A;  1ISY A;  1J5E M;  3J27 B;  4JAW A;  1LZ0 A;  3KFU G;  3DFZ A;  3U5Z A;  4MND A;  4M2A A;  3I0F A;  4FVV A;  3UJ0 A;  1NWG B;  1VPA A;  1KSF X;  2F4V M;  4H75 A;  2L6O A;  4QHT A;  1OFH A;  1ISZ A;  1GL6 A;  3WIN A;  4EFR A;  1FR8 A;  2KRK A;  2VK9 A;  4Y7T A;  2DWN A;  1H6U A;  5BXT A;  1G9A A;  3SYL A;  2D7H A;  2X5S A;  5EP1 A;  3SHF A;  3V91 A;  1QVR A;  2XWN A;  3FTE A;  1IJT A;  4Z9W B;  3OH3 A;  4HLQ A;  3S8J A;  1YXW A;  3TE6 A;  3I4V A;  5G00 A;  1H3M A;  1II4 A;  5C8R A;  4D0Z A;  4Q9P A;  2AQZ A;  3HGI A;  4FRO A;  3D8V A;  4FRA A;  5CQN X;  1I1B A;  4YY3 M;  1DGF A;  1ZCU A;  1QQW A;  3GPX A;  3U2U A;  1V6U A;  2D0J A;  3AKI A;  3UDA A;  3E4R A;  4NAL A;  5L6V A;  3FJF A;  1AF9 A;  3FWW A;  2UUS A;  5D63 A;  3DOA A;  4J2S A;  3H6R B;  4XFT A;  4IBI A;  4IY9 A;  4DR6 M;  3SAW A;  1L1T A;  4QAL A;  1N77 A;  3IIR A;  1HQC A;  1MX0 A;  4AYL A;  1HWO B;  3JRR A;  3I0L A;  2WRY A;  5FU8 A;  5KPT A;  2DRE A;  1WXQ A;  1HNW M;  3J7B A;  1NHG C;  1R80 A;  2KKI A;  3SAS A;  1T9F A;  3VKG A;  1QZM A;  2AHM A;  5C4C A;  2O1H A;  2NZ9 A;  4HO8 A;  1AFC A;  1XMQ M;  4CVH A;  1TZF A;  4CHT B;  2AXM A;  1CE7 B;  1N32 M;  1JT5 A;  3BTA A;  4LGY A;  5IFY A;  3HBW A;  1SZ6 B;  3LQR A;  5D92 A;  4JXJ A;  4G9M A;  3T8S A;  3VT0 A;  1LL0 A;  2QBY B;  1QG8 A;  1R81 A;  1IN5 A;  2AH9 A;  1DFC A;  2PGV A;  2I7P A;  2VSH A;  2CHQ A;  3RTI B;  1VZT A;  2L7I A;  2VSI A;  4B5B A;  3V0M A;  4I2S A;  1Z0H A;  1HV9 A;  3JAM S;  2V0J A;  4MGK E;  9ILB A;  2FFV A;  3ZH9 B;  1E9S A;  4FW9 A;  3HAL A;  2QH5 A;  2QYI B;  3V79 C;  4JI1 M;  2KA6 B;  4HO9 A;  3FUT A;  4B4M A;  5A2Q S;  5I1F A;  4GOY A;  5B2H A;  2F5O A;  4FCE A;  1MC9 A;  5E26 A;  2LXE A;  4B3U A;  4LO2 A;  4YOL A;  1NF5 B;  3SMP A;  1EVT A;  3U61 B;  3A07 A;  3L25 A;  4HO3 A;  4AG6 A;  3WMU A;  1K5U A;  5C1B A;  1QGS A;  4AG5 A;  3SFZ A;  1FO9 A;  3KP0 E;  1QYR A;  4G6J A;  5C1H A;  3U6P A;  3KP1 E;  3AV0 A;  3AKZ A;  1G8O A;  3GLI A;  2KZS A;  2AM4 A;  2JCL A;  4REZ A;  4JD0 A;  2VSE A;  5FLX S;  3K1J A;  3JR4 A;  2RIY A;  3I0I X;  3Q8X A;  1Q04 A;  4G9N A;  3V0A B;  4KEI A;  3KIA A;  2MIB A;  3QYD A;  3FJA A;  4AQY M;  2UUA M;  4OW0 A;  1G2V A;  4TUW A;  1LZ7 A;  3SX8 A;  3RFW A;  1AVU A;  4FRH A;  1S0B A;  1H5R A;  1W77 A;  1H5S A;  1H5R B;  4I4V A;  5D62 A;  3N0K A;  4J18 A;  3IM5 A;  3WO3 A;  3UD9 A;  1EYL A;  4LJ7 A;  3WMV A;  1TW1 A;  3OH1 A;  4CJ8 A;  3MHV C;  1JVG A;  1C1K A;  2OPF A;  2WVL A;  4S12 A;  4ION A;  3R8F A;  4AKI A;  2WGZ A;  5HPZ A;  4F34 A;  5FTS A;  2YC5 A;  4KLN A;  1G23 A;  1LVW A;  4GRI A;  1H5T B;  3I4Y A;  5KQ8 A;  1GL7 A;  3GQ4 A;  2K47 A;  2D7G A;  2AES A;  3VWC A;  3FOQ A;  3HOM A;  2XFS A;  3GPY A;  2YNM D;  3NJ5 A;  3ZGG A;  3TQD A;  3K1X A;  5LMN M;  1V83 A;  1N4K A;  5F3W A;  1TP0 A;  1K4V A;  4JI0 M;  2DS0 A;  1WT3 A;  2W0W A;  3Q4S A;  3AL0 C;  1ZCY A;  1H7G A;  4JYA M;  2I5E A;  3IG5 A;  1NHE B;  3CA5 A;  2YQJ A;  4DV1 M;  2Q2E B;  4UY4 A;  2NYY A;  1K82 A;  3TWM A;  4HO0 A;  2CHV A;  1ISW A;  5KPR A;  3CU1 B;  3U6M A;  1TH3 A;  4I3N A;  2GO2 A;  3H4M A;  1YTO A;  1NMM B;  1GKI A;  1XNQ M;  1O7O A;  5I1B A;  2RIX A;  3ZLK A;  4MGI E;  2RJ4 A;  2D23 A;  4PCZ A;  4FRM A;  4FWG A;  3HSM A;  4QNR A;  1HM9 A;  1Q39 A;  4PDI A;  2JCJ A;  5CMH A;  1AVW B;  4HO6 A;  1Q3B A;  3GQ5 A;  1E0O A;  4QNM A;  1PZT A;  3AKF A;  4EE3 A;  4JN6 A;  3T7M A;  3V0N A;  5ITQ A;  4LO7 B;  4DCK C;  4FRE A;  2XWM A;  4GIP A;  1FV2 A;  2KRU A;  4I1E A;  4HL4 A;  3SXG A;  1VGZ A;  4X64 M;  3DA1 A;  3SYK A;  1FQ9 A;  3EIE A;  1J7K A;  4L4U A;  2I1B A;  3U2W A;  2RJ5 A;  3HJS A;  3T1Y M;  1HNZ M;  3HMY A;  4FGF A;  3I0H A;  3BCV A;  3NBN A;  4O6N A;  4I6I A;  3L26 A;  2VU9 A;  1WSZ A;  2DXI A;  3CKN A;  2ERC A;  31BI A;  3FJE A;  3OJ2 A;  2CV2 A;  4Z8S B;  1EV2 A;  1WT1 A;  3K92 A;  3ZF8 A;  2KEB A;  2D20 A;  4M9X A;  4IRP A;  1YP4 A;  4DR5 M;  3DJ4 A;  4Y7F A;  2RJ8 A;  2UUB M;  5C4E A;  4X65 M;  3ZC8 A;  1S0E A;  4M9Z A;  3JR5 A;  3SAR A;  1WD3 A;  4NAN A;  3NWL A;  2CEA A;  1G3L A;  2ZM6 M;  3UK6 A;  1ZIZ A;  3I0C A;  4QO3 A;  2R4E A;  3POK A;  2HHH M;  4M2B A;  3IOI A;  5JQQ A;  3FJI A;  3BAQ A;  1HWN B;  1IXS B;  1AVX B;  1QAM A;  2OI6 A;  1TFM B;  1IBL M;  2O1F A;  2Y4K A;  4Z8X A;  4I8O A;  1G82 A;  2DRZ A;  3SXA A;  2BJV A;  3CKO A;  4D82 A;  3RGP A;  2C9O A;  2AM5 A;  2PGY A;  3CGX A;  3RSB A;  3AOE C;  1IN6 A;  1JR3 A;  1VIC A;  2V1U A;  4Y63 A;  5CQO A;  3I0G A;  1PZY B;  2I5K A;  4IJF A;  4QD2 C;  1YUB A;  2MC2 A;  4AAW A;  4KC1 A;  4IBB A;  3SAV A;  1ZJ1 A;  3A22 A;  2QCU A;  1FWU A;  3Q7W A;  4DEN A;  3NGW A;  1TH4 A;  3N7L A;  1L2B A;  2QGI A;  4ZFW B;  4YHH M;  5ITR A;  4IBD A;  3BAD A;  4ASJ A;  3I51 A;  2D24 A;  3C9Z A;  3VK7 A;  2HW9 A;  3TWK A;  4B4B A;  2P6W A;  3HJ8 A;  1XXH A;  4I4R A;  3N7K A;  4NXM M;  4K0K M;  3PNY A;  4DV2 M;  2WVM A;  4Y7U A;  4QBC A;  1S4N A;  2XWL A;  4M0D A;  1R7V A;  3P6I A;  5EG6 C;  3CA3 A;  3ZX7 A;  7CAT A;  4GHL A;  2A8U A;  4KC3 A;  1VDD A;  5HS2 A;  5C4B A;  1IOB A;  4P0L A;  2Z87 A;  3OGZ A;  1V6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...