1XHBA

The crystal structure of udp-galnac: polypeptide alpha-n-acetylgalactosaminyltransferase-t1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
459
structure length
447
Chain Sequence
NRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polypeptide N-acetylgalactosaminyltransferase 1
publication title The beginnings of mucin biosynthesis: The crystal structure of UDP-GalNAc:polypeptide {alpha}-N-acetylgalactosaminyltransferase-T1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 142
structure length 447
sequence length 459
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.460 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xhbA02
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1xhbA03
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1xhbA01
1YP3A 4I2SA 4KC3A 3V0LA 5AJPA 3VEQA 4DDZA 1FV2A 4IY9A 1E0OA 4FRBA 5C4DA 1BFCA 2JCOA 3CRHA 1RZOB 2VSAA 4JPZA 3VUOA 5C3BA 1MP5A 3OH3A 1NWGB 2FYBA 3JUKA 1ISVA 1GX0A 2NXVA 2VUAA 4G6JA 3VWCA 4KPZA 1FN0A 1H7FA 5E24E 3F1CA 8I1BA 3JRRA 4X39A 1H5TB 2JCKA 1AVAC 3F1RA 4GOYA 3MALA 5BOWA 5FU0A 1K4VA 3NBDA 1HWPB 5C4FA 1IINA 2UUSA 3HN1A 5FNWA 2A8UA 3R4UA 4I4VA 2Y4MA 3SXGA 2E8BA 1T9FA 4F83A 2AXMA 2BO4A 1S0DA 1M16A 1S0GA 3FGMA 1G23A 2QGIA 5FUHA 1QQKA 5L6SA 1MP4A 2X2SA 2XOAA 5DDVA 1H4CA 4JAWA 2AESA 1F31A 3N7MA 3OJMA 3SX3A 2VS3A 4UEGA 2Y4LA 1FWVA 4F34A 3BAGA 4FRDA 1FWUA 1ZI5A 3USQA 4GOVA 3ZGFA 1V6VA 5FTVA 4G6MA 4EFRA 3Q7UA 1MC3A 5FYEA 1VGWA 4I0YA 1TW5A 4EB2B 4HA2A 2NM1A 3N0KA 2Z86A 4ZBVB 2D43A 4DENA 1VPAA 2BEBA 1K5VA 4ZFUB 1LL2A 3AH2A 1WT2A 2FYCB 4I96A 2QN4A 1QGQA 3RMWA 2DPWA 1ONKB 4KEJA 4EEEB 1FXJA 4FREA 1D0HA 2WBCA 3AKFA 4A7KA 2VLCA 3I2AA 5JMCA 4IYBA 1S4OA 4CJ8A 4Q9PA 1DFQA 4HO2A 1SR4C 1JY0A 1JT7A 4HG6A 5C1GA 3WMVA 1JVGA 1V6XA 2PA4A 2XWLA 3N7KA 1H7QA 3I0KA 4ECMA 4R7PA 3LTQA 3CKJA 3P6JA 2D44A 3K8DA 2AM4A 4HJJA 2E4MC 1V6UA 3BCVA 1LZJA 4GAIA 4I4YA 1R7UA 2OI7A 3JTJA 1H7HA 4P00A 1BFGA 1G0RA 3V8ZA 5JLVA 2DS0A 4IZEA 4LO7B 4M2AA 3D7WB 1JYKA 3ST8A 3AKGA 2XWNA 4JKXB 3I0JA 2LIQA 3V0AB 1TVYA 3TZTA 2MZBA 2ZU7A 1IILA 2E4MA 1JV1A 3V91A 4E1KA 2DRYA 3BADA 3QR5A 2GGQA 3OJVA 2X5ZA 3BA5A 3I0HA 3JUJA 4OEFA 3ZXDA 4WBCA 3O44A 1JLXA 3BB2A 5FTSA 5BP5C 4I4XA 2I5EA 3DK5A 4Y7GA 1JVDA 3KMVA 3N9WA 5DUYA 3VT1A 3IIRA 3O4DA 4KEKA 3IAGC 3IOJA 2KLLA 1NKHB 4J2XA 1NZKA 3IM5A 3V90A 2GO2A 1ISWA 4XFTA 1G9CA 4X37A 4XFUA 3WO4A 2HW9A 1G9DA 4G3PA 2Z49A 4KC4A 3ZLKA 1HCDA 3B9UA 2APCA 5CQOA 4FCUA 1W3GA 3OBTA 3F62B 1GX4A 4CJMA 2A8WA 4KRVA 1S4NA 1FR9A 1YYNA 5D61A 3ZC9A 2YQJA 4EEAA 2RJ0A 2RG9B 4B42A 1NUNA 1N4KA 2FFUA 4LO7C 2P39A 1I1BA 3CA3A 4J23B 3SXBA 1Z2VA 1TWMA 3K1XA 1VH3A 4KC2A 2Y9FA 4I37A 4DEPA 4IRQA 5CMFX 1H7EA 2OEFA 2ZU9A 5JQQA 4I8MA 4EEGA 3A22A 1G8OA 1I52A 2X2TA 1Q1UA 4LO2C 1JLYA 1ZI4A 3V0AA 1ZJOA 4Y6NA 1JT4A 1O23B 3CRGA 2Y7AA 2WVLA 3U2WA 3PHZA 3USRA 1S0FA 4ZKTB 4ASYA 1DLLA 3UDAA 3FWWA 4EEOA 5C49A 3TC2A 3UD9A 4EEMA 1PC8B 1LVWA 2YQCA 4B2XA 1O0RA 1XYFA 2V0KA 3CA1A 3OBRA 2YQHA 3O3PA 4GP3A 2AQZA 3AZVA 3BA7A 4XFSA 2VSHA 3PKPA 4CJCA 5F90A 1INJA 2ZQOA 2MIBA 4K6RA 2V0HA 2R9KB 5EIYA 1FMZA 1H4DA 2DREA 3FJIA 1J0SA 1BASA 1NMMB 3SXEA 5CQMX 3O5WB 3OGZA 4G3QA 1BARA 1CVSA 2RIXA 1XHBA 2AM3A 4ZFWB 2ICXA 5CQPA 4II0A 2ICYA 1PUMB 4L4HA 4D48A 1IJTA 1HM8A 4I4SA 4P0LA 2GGOA 2V0JA 3OKRA 4B3UA 3AKIA 3V8YA 3T7NA 4ZLBB 4QO3A 4AN7B 1G1LA 4J18A 5IDTA 4HCQA 1FMMS 3SXCA 3W9TA 4BQHA 2DRZA 5BXCA 4NAKA 3BAUA 3FJKA 4J2SA 1HJJA 4USPA 3ZXGA 3PNNA 4QKSA 1HWNB 4G9MA 2RJ9A 4EFQA 2YCMA 3FJCA 3FJ8A 1ITBA 1WD4A 4L4IA 1Z0HA 2KI6B 1JT5A 4OEEA 3AJ5A 3I29B 3VSFA 2BO7A 4FROA 5C3AA 4FCEA 1V6WA 3FJBA 3VSZA 5I1BA 3BRFA 3FJHA 3Q80A 3SXAA 1EV2A 3CQAA 3E26A 3LLPA 3FUOA 4LO1C 4DECA 5AJOA 2LIEA 4HO9A 1DFCA 4M2BA 3EF2A 1R8OA 2WVMA 2JCJA 1R81A 1CE7B 1G95A 4JP0A 1WVCA 1IRAX 1HCEA 4GP0A 2WVKA 1FV3A 3OJ2A 4Z8SB 3JUTA 1H5RB 1S0EA 3FOQA 4LO1A 2Y9WC 1ZJ1A 3CU0A 1IT0A 1VM8A 2VD4A 3V79C 1QXMA 3PG0A 3Q7XA 2KI4A 2I7BA 2YQSA 2ZU8A 1ZCUA 1ZJPA 4QBVA 4HOCA 4CJBA 1HM0A 2X60A 2AE7A 2VSIA 3V0BB 4G3SA 1PUUB 1GWVA 1H5SD 4D0ZA 1YP4A 3QVBA 4JQ0A 4EE4A 4LW6A 3BRDA 3FFZA 4OWJA 1PZYB 2YESA 1II4A 4D0TA 2BO8A 1LZ7A 4KQLA 1W57A 4IQPA 3RSBA 2RIYA 3RTIB 2J3PA 1IIMA 4EE3A 5C1HA 4FRMA 1H5TA 1FR8A 1WT1A 3H6RB 3N7JA 2KH2A 1LL3A 5FU8A 5C38A 1SR4A 3KIAA 2I5KA 1HWOB 9ILBA 1ZI3A 2P72A 1AXMA 3S8JA 4ZFYB 2XMEA 3DUVA 4LW3A 1FOAA 1XZZA 4NANA 3E25A 2BFHA 4D11C 1ON8A 2AGDA 3OC9A 3SXDA 1IRPA 3DJ4A 4FGFA 1FZWA 1JV3A 1VICA 4J2YA 3WMUA 2XWMA 3U2UA 4KT7A 3TQDA 1ZHJA 1E5KA 3CKQA 4D11A 2O1GA 4I3NA 2RITA 1O7QA 4Y7TA 4B5BA 3NJ5A 4FVVA 2YC5A 5F8YA 5C3DA 5FNXA 4HR6C 1H5RA 1ZDGA 1I1EA 3AJ6A 1ABRB 1P63A 2D20A 2VXTI 1ILR1 2IHOA 2Q3NB 2WE9A 1HKNA 5BP5A 4IONA 2AECA 2FYAA 2ESUA 4ZOTA 2QH5A 3CGXA 3A21A 4MNDA 4Y7FA 1EZIA 4Y62A 3T7OA 4AC3A 1BFFA 4DE7A 2D7RA 3HMYA 3V0BA 1FXOA 7I1BA 4P02A 4I6IA 1V84A 4B2WA 3RMYA 1PWAA 4OWLA 4I1BA 2YUGA 3N7LA 2FY7A 2K4AB 3I2XA 2X65A 5CQLX 3O3QA 4IZXA 1ISZA 3CRIA 4KPXA 2ZQNA 3I0FA 1YF8B 1UPSA 2RJ6A 3D8VA 3HBWA 3RTJB 4J2KA 4JRAA 31BIA 41BIA 3H6RA 3BAVA 2NP0A 2BO6A 3HL3A 5CMGX 4I4RA 2D22A 1FRWA 2Y4KA 3HSMA 1H5SB 2VU9A 1S0CA 3I0IX 2P23A 1Q03A 4X38A 3CKVA 4AYLA 4R6UB 4H9WA 3UD8A 1G2VA 1TP0A 1AVWB 3CA6A 3WO2A 2RJ8A 1ZCVA 1G82A 1Q04A 3CAHA 1FGAA 2L5XA 3IM6A 4I1EA 4D8HA 1FO8A 1R80A 3Q4SA 1TTUA 2ERMA 1EYRA 4LO2A 1NQIB 2VFZA 3E8LC 1G97A 2MLLB 1W3AA 5DVHA 5G00A 4FRLA 3AH1A 3ZGGA 1YP2A 5C8RA 1DZCA 1ZJ0A 4JKQA 1DZDA 2FDBM 4KNRA 3BA4A 3PKQA 1AVUA 3CA4A 2W0WA 3BRGC 2RJ4A 2QKXA 2Y4JA 4XKIA 2VXLA 3CA0A 5HPZA 3FJEA 4G1RA 4X3AA 4EKXB 2WRYA 3IOIA 5CMJA 1WD3A 1OMXA 1WSZA 4P0KA 1AFCA 1PZZA 3WO3A 3V0PA 1GQCA 4CVHA 1MC9A 4YOLA 3T7MA 1TWEA 6I1BA 1TOOA 4QC4A 2D23A 5IDSA 1ZCYA 1EPWA 1H7LA 3Q7YA 4HO3A 3V0MA 1QWJA 1DIWA 4IY8A 1ZDFA 4LO3C 1H5SC 1ISYA 2JCLA 3O49A 4ARWA 2Q9XA 4ENDA 2K43A 2RJ5A 3D5NA 5D63A 3SPTA 4NALA 5CMIA 2K8RA 3RMXA 1S0LA 3PMEA 3QYDA 1VZUA 3IOHA 1GA8A 4HO8A 5C48A 1ZJ3A 3WA1A 3S8KA 4C2SA 4LO3A 1H5SA 3WINC 2Q4JA 4QKRA 5BXRA 1WBCA 1O7OA 5AJNA 1BLDA 3OH2A 1TW1A 2RJ1A 4DCKC 4Q91A 3U0XA 3P53A 4P6AA 4QBCA 1V83A 1WT0A 2NYYA 1R7VA 1NF5B 2O1FA 2I1BA 1MP3A 2OEGA 4M4KA 3RMVA 3P6IA 2NTDA 3HALA 3UJ0A 3WINA 4XWIA 3CU1B 3V0NA 1H7GA 2AAIB 2Y9XE 3AZWA 5EHAA 3U2VA 3POKA 2E3DA 1JTCA 2YC3A 1GGPB 2PX7A 2IWTB 3CKOA 3U2XA 3AKHA 5IFYA 4FQWA 3ILAA 5CQNX 5F8WA 5BQUC 5BXPA 2VS5A 5D62A 3FJ9A 3HOMA 2PGYA 2Z87A 4IHZA 5C4BA 2D24A 3NBNA 4KC1A 2FGFA 1ZCTA 1JQZA 2O1HA 3ZC8A 5CMHA 4M28A 4Z9WB 2D1ZA 1VGZA 4JISA 4G9NA 21BIA 1VGTA 4B4BA 3RSJA 4I4UA 3I0LA 4B4MA 5BQUA 2F2FC 1GQ9A 3UD7A 3FJDA 1TIEA 2X5SA 3BRKX 4MYBA 3T8SA 1DJSB 3BX1C 2FYDB 3BAOA 2D7IA 3ZLLA 3H6QA 2HZ9A 3POLA 1NHEB 4YS8A 1G9RA 3ZF8A 1QG8A 3O4OA 2V0IA 1G93A 5L6VA 2MC2A 1G3LA 4A7YA 3C9ZA 2F2FA 1RY7A 4OEGA 3FUQA 2FO1A 4QD2B 1BLAA 2WGZA 3V0QA 4GAFA 1INIA 2OI5A 4ZDQA 5EJZA 1OQLB 3IM7A 1IHKA 3F1YA 1TZFA 3SX5A 1YXWA 4OWKA 1R7YA 3R4SA 3OAMA 5B2HA 4HO4A 1VCLA 4LO0C 4Y64A 4FRQA 4ISQA 1H7TA 5DSSB 1R7XA 1PZTA 1R82A 1K5UA 3CA5A 2RJ7A 1JYLA 1KNMA 3H6SE 1YBIA 4FRPA 5J49A 4OUJA 1EVTA 2ZR1B 1V82A 2WAWA 5HS2A 2RSTA 4I4PA 1HIBA 1FQ9A 1TFMB 4LO0A 1YROB 2XMHA 3NBEA 1FO9A 1ZI1A 3D98A 4A7ZA 3V0OA 5F8SA 5C4CA 1AVXB 1OMZA 3A23A 1WT3A 5BVPI 4GBPA 1W3FA 3UJ4A 4Y9XA 2VXRA 3U0YA 2AH9A 1Z4SA 2RQ9A 4B4GA 1IOBA 1R7TA 2VXMA 4FRAA 5FV9A 1VZXA 2FFVA 5EC5A 3SX8A 1WBAA 2RIZA 3O4BA 3LW6A 2AFGA 3R2WA 3OH4A 1DQGA 1JT3A 3NBCA 3PUBA 4Q9GA 5DZUA 1W77A 1DQOA 4QD2C 2D0JA 3I0EA 1LL0A 4NAIA 4HO6A 3OH1A 4H04A 5BXSA 1Z90A 2UX8A 2M49A 4PC4A 4OW4A 4TLPA 2Y6PA 4FRHA 4EE5A 1S4PA 2V0LA 4USOA 1HWMB 1RMLA 1VZTA 1AF9A 3SNVA 1LZ0A 3CKNA 2NZ9A 3FJFA 3Q7WA 1ZJ2A 1R8NA 1L2HA 5DDTA 2HWAA 1XG6A 2VS4A 2P73A 2CU2A 1MD6A 1YTOA 5FZYA 1FGGA 4AYJA 1SS9A 5C1LA 1QQLA 4L41C 2Y9GA 3O4CA 3BTAA 4EFPA 1H3MA 3VT0A 2GZBA 2HWMA 4AN6A 4ZGRB 2F8XC 1HM9A 4KNXA 1QGSA 1OQMB 3I0GA 3OH0A 1RG8A 1GWWA 3VT2A 4HO5A 4JD0A 1VH1A 2PGVA 4ASJA 1HJLA 3AH4A 3BAHA 1A8DA 3FJAA 1G9AA 4I7IA 4P0JA 4Y6UA 2Z48A 3O4AA 3OGFA 2ET2A 1G9BA 3FJJA 1XZ6A 1W55A 2VSEA 2OI6A 4Y63A 4I4QA 5I1FA 1LZIA 2BEAA 2NVHA 4Y7UA 1VGUA 3I0CA 5C4EA 4HO0A 4ZA3B 4LO8B 3K8EA 1M2TB 3ZX7A 3U2TA 3OGGA 4KXOA 1ISXA 4IRPA 5FZUA 3GUEA 1BA7A 5GAQA 3I0DA 4ISRA 3R3IA 5EJ1A 2QYIB 1ZIZA 2W0VA 3EE5A 4AAWA 1EYLA 1FWYA 2AM5A 4G87A 1H4EA 4BMAA 1SZ6B 3SX7A 1S0BA 3MPPG 4QALA 3A07A 1KWSA 5C47A 1ON6A 5EG6C 1FG5N 4KBBA 4Y7VA 4EVWA 3BAQA 3NGWA 5C36A 2KKIA 5BXTA 5FZZA 1FGXA 1T4QA 2P6WA 2WEEA 1HV9A 1BFBA 4KEIA 4I4OA
chains in the Genus database with same CATH superfamily
5AJPA 3VEQA 4WW0A 4JPZA 5C3BA 1MP5A 1NWGB 4DR4M 4IIWA 4ITQA 5E24E 2JY8A 1H5TB 3F1RA 5BOWA 3RGPA 1K4VA 5C4FA 1IINA 3SC3A 4UN2B 3R4UA 4F83A 2AXMA 5C18A 1QQKA 1MP4A 5DDVA 2R65A 1FWVA 2JZ0A 4FRDA 3KXEC 5FYEA 1KYIA 3E9SA 2G5GX 1QAQA 1VPAA 2BEBA 2DAGA 1K5VA 4ZFUB 1LL2A 3AH2A 1QGQA 4DV0M 1GL7A 3A46A 3SAWA 4BBAA 4CJ8A 4HL4A 4IYBA 1N78A 4HO2A 1SR4C 2DENA 3WMVA 2EA0A 3N7KA 3LTQA 5E6JA 2D44A 3BCVA 1OQYA 1V6UA 4GAIA 1H7HA 1T3TA 4IZEA 2LH0A 3D7WB 1JYKA 5EXSA 3I0JA 1TVYA 1IILA 1NVMA 1PJTA 1Q39A 3QR5A 2YNMD 3TPZA 2X5ZA 3I0HA 3JUJA 4OEFA 3ZXDA 1G8PA 1JLXA 5FTSA 4I4XA 1IXSA 1JVDA 4LF9M 3O4DA 3IOJA 1NZKA 3E4RA 3AL0C 2OOAA 4X37A 2ERCA 3TQSA 4KC4A 4MH0E 4O6MA 1D2NA 4AKHA 3D8LA 4LF6M 2RG9B 2OQ4A 2VQFM 3SXBA 2H1RA 2Y9FA 4DEPA 4IRQA 1EE8A 5JQQA 2MH8A 4R7GA 3SARA 1G8OA 1JR3E 1QZEA 1I52A 1Q1UA 1ZI4A 3H4MA 3V0AA 4ANRA 3V76A 4Y6NA 3U5ZA 1IN5A 2Y7AA 1Q3CA 2APLA 1XNRM 3FUVA 2CV1A 1YE9A 1S0FA 3PHZA 4ZKTB 2JZ1A 3UD9A 2JXNA 2YQHA 3CA1A 4IBGA 4S12A 2AQZA 2KZSA 3FUXA 4NXNM 4LGMA 2MIBA 2ZQOA 4K6RA 4MGYE 2DREA 1NMMB 4FWHA 3I4VA 1XHBA 4ZFWB 5CQPA 4II0A 1XNQM 4W5WA 3L29A 3AJIB 3V8YA 4AN7B 3W9TA 4BQHA 1QUSA 4QOZC 5BXCA 3M0EA 2J0AA 3PNNA 1Q02A 4QKSA 1HWNB 4G9MA 5A2QS 2YCMA 2I7PA 3FJ8A 1ITBA 4L4IA 1Z0HA 2KI6B 1N32M 2BO7A 4FROA 1V6WA 4IBCA 3BRFA 4JV5M 3Q80A 3FJHA 4I5SA 5AJOA 1DFCA 4M2BA 2WVMA 2JCJA 3SHFA 4K0KM 1LTMA 1HCEA 4LJ7A 1FV3A 3OJ2A 4G4NA 2F5QA 3J80S 3V79C 2BWBA 1IN8A 2VSIA 3FTDA 1R2YA 3FTEA 1YP4A 4JQ0A 2K9DA 1II4A 2F5OA 4L4UA 1W57A 2KRKA 2NQ8C 3KS8A 2HKJA 4FRMA 5FU8A 3KIAA 3A45A 1ZI3A 2XMEA 4LW3A 1FOAA 3FTCA 4D11C 3SXDA 2RGOA 2V6ZM 2FH0A 4J2YA 3WMUA 3U2UA 4LCBA 4KT7A 3KSJA 4LF5M 5EJCA 2C96A 2RITA 3NJ5A 4FVVA 2EUCA 3Q8GA 1ZDGA 4IBJA 2D20A 2VXTI 3EIHA 3DUVA 5BP5A 2ESUA 3MHVC 3CGXA 4MNDA 4AC3A 4DE7A 1BFFA 3HMYA 1FXOA 1OIZA 1QAMA 3RMYA 2FY7A 5CQLX 1VDDA 2C5RA 2ZQNA 2C0NA 3I0FA 1UPSA 3D8VA 3U6CA 4OVZB 3RTJB 2KXEA 3H6RA 3HL3A 4IBIA 2LNHC 3HSMA 1IN7A 4LJ4A 4H9WA 2G8LA 2RJ8A 1OAOC 1ZCVA 1SXJD 3CAHA 1Q04A 1FO8A 1ZMUA 3Q4SA 1TTUA 4IBFA 4LO2A 1NQIB 4FRLA 4GHAA 1XC8A 1YP2A 1DZCA 1ZJ0A 4JKQA 1AVUA 1HNXM 2RJ4A 1XXHE 1MJGM 5HPZA 4II7A 3HY5A 3C58A 1WJ7A 1QVRA 3NBXX 5IDSA 3PXGA 2OPFA 3Q7YA 3W67A 2WSFF 2XSZD 1NSFA 4YY3M 4DBGB 4AKGA 1S0LA 4PDIA 4JN6A 3WA1A 4LO3A 1WBCA 1OAIA 4AQYM 4AG5A 4Q91A 4DR2M 3P53A 4P6AA 1WT0A 1V83A 2VDBB 1R7VA 3RMVA 1MP3A 5ITXA 3WINA 3HJ8A 4A3VB 3DOAA 1IN6A 2Y9XE 3AZWA 3U2VA 3GLFB 3RGSA 1GGPB 2PX7A 2IWTB 3CKOA 3U2XA 3AKHA 4FQWA 5BQUC 2Z87A 2ZTDA 5C4BA 3HOMA 1SXJB 1J5EM 2O1HA 3ZC8A 3VDPA 2VQEM 4B3MM 1VGTA 4B4BA 3RSJA 2XF3A 3I4YA 5FLXS 3T8SA 2FYDB 3BX1C 3H4JA 3BAOA 3GLGA 4LZJA 1QG8A 2V0IA 4A7YA 1OKSA 3C9ZA 5EP1A 4OEGA 2FO1A 1BLAA 2WGZA 4GAFA 5JI3E 3SX5A 4OWKA 2DAMA 5B2HA 1Z6TA 3U60B 4LJ6A 5IWAM 1R82A 1K5UA 3FUTA 4DR5M 4XK8F 3H6SE 2LXEA 1TH3A 3B7QA 4OUJA 5J49A 1V82A 3D98A 2KA6B 3V0OA 1FO9A 2HCBA 3A23A 5BVPI 4Y9XA 3UJ4A 4F2LA 2AH9A 4WURA 2RQ9A 4CIZA 4FRAA 3KOXE 3OTOM 2AFGA 3AOGA 2H5XA 3R2WA 4RF0A 3OH4A 1DQGA 4Q9GA 4LRTA 3IHPA 2D0JA 4NAIA 4LGYA 2JP7A 4HO6A 4NRWA 4H04A 5BXSA 2M49A 1XWIA 4TLPA 4FW9A 1HQCA 2QQ8A 1HWMB 4Z6YA 1LZ0A 1ZJ2A 4AI6A 1L2HA 5DDTA 2VS4A 1MD6A 2BWEA 5FZYA 1FGGA 1ZQ9A 3TWMA 1QQLA 4EFPA 1TF0B 4AN6A 4KNXA 1OQMB 3TWKA 3FKEA 3I0GA 4HO5A 4JD0A 2PGVA 5JI2E 3U61A 3BAHA 1A8DA 3FJAA 4DV2M 4I7IA 4P0JA 5FU0A 3O4AA 3FJJA 3SYLA 2OO9A 1WXQA 3ZQJA 1N34M 4JI1M 5DYIA 4HO0A 2KNVA 3ZX7A 5EJ1A 4LFCM 2CUZA 3MPPG 1JR3A 1NNJA 4Y7VA 3BAQA 4D80A 3NGWA 5BXTA 5FZZA 1NY6A 1Y8GA 1FGXA 2WEEA 2C9OA 2M5ZA 3I04M 3MJ5A 4YS8A 3GRRA 4I4OA 4I2SA 4KC3A 3V0LA 2XLJA 4DDZA 1CUKA 2VSAA 2RRUA 3C3EA 1DV0A 1ISVA 4B3SM 2K0BX 2NXVA 3F1CA 4X39A 3THGA 1AVAC 1XMOM 3MALA 1KFVA 2KDLA 4RNAA 5FNWA 3T38A 4G4QA 2A8UA 1R4GA 4I4VA 4JI0M 4GKJM 2E8BA 1T9FA 1L8QA 3FGMA 2QGIA 3HU2A 1UFZA 1H4CA 2AESA 1X37A 3OJMA 2VS3A 1ZMVA 2Y4LA 2NS2A 1PJQA 3BAGA 3USQA 5FTVA 4G6MA 4EFRA 4I0YA 1TW5A 4EB2B 4HA2A 3GLFE 4ZBVB 1GABA 1OIPA 4P17A 1GKIA 3U6LA 3RMWA 1W5TA 1SXJE 4KO8A 1ONKB 4KEJA 3C3DA 3AKFA 2DVWB 3T15A 5JMCA 3HGIA 3M6AA 1JT7A 1JVGA 3LQRA 1H7QA 4R7PA 3P6JA 1C1KA 2DAIA 4HJJA 2E4MC 1LZJA 2JY6B 3KDSE 1R2ZA 1R7UA 2OI7A 3JTJA 3V8ZA 1BFGA 1G0RA 5JLVA 2R4EA 2DS0A 4M2AA 4LO7B 3GLHE 3ST8A 3AKGA 3TZTA 2X4AA 2MZBA 3TE6A 5D91A 3V91A 3BADA 3OJVA 3NBIA 1VQ1A 3BA5A 4WBCA 3O44A 2O25A 3KOZE 4Y7GA 4AKIA 3N9WA 4GITA 3VT1A 3IIRA 4IBDA 3IAGC 2KLLA 1NKHB 5ITRA 4M0DA 1G9CA 3WO4A 1G9DA 2Z49A 3ZLKA 3B9UA 1J7KA 3OBTA 1GX4A 2YQJA 2RJ0A 4BB9A 4LO7C 3CA3A 4NC6A 3K1XA 3ZCBB 1D0MA 4DUZM 3GQ5A 1H7EA 1XMQM 4R3DA 2E5LM 4EEGA 3A22A 2X2TA 1ZJOA 3MMPA 1JT4A 3SMPA 4ASYA 1V33A 3TC2A 4EEMA 4LY6A 1PC8B 5IT9S 2UUAM 1NY5A 3O3PA 4MB7A 4GP3A 2VSHA 3SYKA 2V0HA 4DUYM 3QYBA 1H4DA 3GQ3A 1LV7A 1J0SA 3SXEA 2AHMA 3OGZA 3E21A 3D8BA 3L28A 1MU5A 2AM3A 3HWSA 1PUMB 3WHKA 1IJTA 4I4SA 3OKRA 1G41A 4IBEA 4WP2A 4QO3A 3KVWA 4ZLBB 1XXHA 3E46A 5IDTA 2DRZA 3BAUA 3FJKA 1HJJA 4USPA 3FJCA 4BLCA 2ZTCA 1QYRA 3AJ5A 5C3AA 2CHGA 3CQAA 3FUOA 4LO1C 3I01M 2LIEA 2RGHA 1VEKA 4FWGA 1R8OA 4DR3M 3K2LA 3ZC7B 1G95A 3T6PA 4JI6M 1H5RB 1S0EA 2Y9WC 4CGYB 1IT0A 1GLNA 3PG0A 2ZU8A 2KI4A 2I7BA 1DGGA 4LFAM 1HM0A 2X60A 2KEBA 2AE7A 3V0BB 1H5SD 5FTMA 3BRDA 4LF4M 3FFZA 3K9PA 2BO8A 1UM8A 4LJ9A 4AW4A 3L26A 3RSBA 4GKKM 1VEGA 5C1HA 1WT1A 3N7JA 2C98A 2CWBA 2MROB 4DR6M 9ILBA 4ZFYB 4DR7M 2X8AA 3E25A 1ON8A 2HHHM 3OC9A 1NJGA 4G4RA 4FGFA 3CF6E 4KEIA 1Z5BA 3CKQA 4D11A 5F8YA 5FNXA 1I1EA 3AJ6A 2WE9A 3TWLA 5C1GA 2B3TA 1FJGM 5IREB 3VK7A 4Y7FA 1IY2A 1EZIA 4Y62A 3T7OA 3KP1E 4MGKE 4P02A 4I6IA 1V84A 3PNYA 1PWAA 4OWLA 2X65A 2K4AB 3I2XA 1P3QQ 4IZXA 2F5NA 4KPXA 2QZ4A 1YF8B 3VDUA 4J2KA 31BIA 2BO6A 2NP0A 3A42A 2R45A 2D22A 1H5SB 2VU9A 3CKVA 1G2VA 3CA6A 2WSEF 1G82A 4I1EA 2L5XA 1FGAA 1F4IA 1R80A 4LJ8A 1EYRA 3E8LC 1G97A 4X65M 5C8RA 2DZLA 2FDBM 3CA4A 4XKIA 2VXLA 3FJEA 2F5SA 1TOOA 2VF8A 5ITUA 2D23A 4B08A 3R8FA 1H7LA 4HO3A 5H37D 2JCLA 1H5SC 1QDRA 2RJ5A 2K43A 3D5NA 2UUBM 4OVZA 2UUCM 4Z8XA 5FTKA 3QYDA 3IOHA 5C48A 3DZDA 4C2SA 3S8KA 4QKRA 5BXRA 4GC5A 4KT0F 1BLDA 5EP2A 4HLQA 1HR0M 2VS5A 2O1FA 2OEGA 1NF5B 3CF0A 3HALA 2FOIC 4CHTB 3V0NA 1H7GA 2CHQA 5EHAA 5C1BA 3POKA 2BNKA 2YC3A 5E26A 4R71A 2XEPA 4FWDA 5IFYA 4ZPXA 2LVAA 3HJSA 5LMNM 5D62A 2PGYA 1DGFA 1ZCTA 2DWMA 4M28A 4Z9WB 4B3RM 1YSYA 5BQUA 3KP0E 4NOOB 3FJDA 1TIEA 2X5SA 4MYBA 1E9RA 3SFZA 3ZLLA 2D7IA 1NO1A 3H6QA 1NHEB 1G9RA 3UGJA 1FNNA 1G3LA 1T6OA 2MR9A 2J7NA 2QCUA 1RY7A 3ZH9B 5EJZA 1OQLB 3HU1A 3F1YA 4FIXA 3OAMA 4HO4A 4LO0C 3R9XB 5FTNA 5DSSB 1TR8A 3HHYA 1E9SA 1KNMA 1YBIA 3GLFA 2RSTA 3T7MA 5C4CA 4A7ZA 3IG8A 5F8SA 3FTFA 4GBPA 3U0YA 1SXJA 1R7TA 2VXMA 5FV9A 2FFVA 1WBAA 3O4BA 2CHVA 3SAVA 4H75A 3NBCA 5DZUA 1LL0A 4CJ6A 4EE5A 4I81A 4USOA 1RMLA 1VZTA 3GLHA 3CKNA 3Q7WA 1ZMWA 5DNYA 2CE7A 2CRUA 2HWAA 1XG6A 2Z3XA 2XSZA 1YTOA 3U60A 5C1LA 2JNHA 2P5TA 2Y9GA 2A5YB 4LF7M 1JB0F 3OH0A 1RG8A 1GWWA 5D92A 2XH9A 3LVVA 4M9XA 4LF8M 3PVSA 3OGFA 3B7ZA 1XZ6A 7CATA 1W55A 4GEWA 1HT1E 4QHSA 2OI6A 4Y63A 1MN3A 4I4QA 3BOSA 4Y7UA 1DO2A 1VGUA 3I0CA 2R0IA 5C4EA 3HHZA 3K8EA 3EIEA 3FUWA 1PJSA 5BR8M 4L15A 2QYIB 2W0VA 2XZFA 1WHCA 1EYLA 4G87A 1Z59A 1S0BA 2I7NA 3A07A 3SATA 5C47A 5KPTA 5EG6C 2KKIA 1T4QA 1BFBA 3B74A 1YP3A 2KNAA 4IY9A 5C4DA 1BFCA 3JR4A 2JCOA 2BJWA 1RZOB 3VUOA 5ITQA 1PM5A 4G6JA 3VWCA 4KPZA 1H7FA 4JXJA 2JCKA 4IJFA 4GOYA 3GRVA 3SXGA 1IM2A 2BO4A 1S0GA 1M16A 1G23A 5FUHA 3W0LB 1V92A 2X2SA 2F5PA 4LFBM 4JAWA 1F31A 4UEGA 1FWUA 4MM3B 1ZI5A 4GOVA 1V6VA 2XGNA 1VGWA 3N0KA 3U6MA 2Z86A 4GC9A 2L4FA 2FYCB 4L8RC 4EEEB 4FREA 1D0HA 4A7KA 2VLCA 3I2AA 3FRIA 4Q9PA 4G3OA 4HG6A 1V6XA 2PA4A 4ECMA 3I0KA 3CKJA 3K8DA 4HO9A 4P00A 3SMSA 2KZUA 4YHHM 3K8ZA 1K82A 4JKXB 2HAKA 2ZU7A 2E4MA 4XGIA 1JV1A 2DRYA 1DO0A 2GGQA 1WIVA 4GMQA 5BP5C 4B7GA 4KEKA 4J2XA 4G4OA 1SG9A 2GO2A 1NHWC 1ISWA 4XFTA 2DWNA 2R46A 2HW9A 4JI4M 5CQOA 3GRUA 1FR9A 1YYNA 5D61A 1NUNA 1N4KA 1VEJA 3HKPA 1KSFX 1I1BA 1Z5CA 1L2DA 1TWMA 4I37A 2Z8YM 3MK6A 1VG5A 3BXWA 3L27A 1TH4A 3AOEC 2ZU9A 4I8MA 4NSOB 1WGNA 4LO2C 2R18A 1O23B 1PJIA 3U2WA 3VKHA 1VDLA 3USRA 1R6BX 3UDAA 3FWWA 4EEOA 5C49A 2QBYA 3SASA 1LVWA 2YQCA 1XYFA 2V0KA 4LJAA 3AZVA 3BA7A 4XFSA 4Y28F 2R9KB 5EIYA 3B7NA 5FTLA 3FJIA 3SBJA 5CQMX 3O5WB 4G3QA 1CVSA 2RIXA 4OW0A 5KPZA 2EKFA 3LQQA 1L2BA 2ICYA 1QAOA 4KHPM 1HM8A 4B3UA 2V0JA 5ITYA 3T7NA 1G1LA 4J18A 4HCQA 3GLGB 1FMMS 3SXCA 5KO3A 4DV4M 3J7BA 2Y0TA 3FRHA 2HWJA 3ZXGA 4DV3M 2RJ9A 2W82A 4EFQA 2YQZA 4QHTA 3QAUA 4IJEA 4OEEA 3I29B 1IBLM 3VSFA 4FCEA 2C99A 3FJBA 3VSZA 3SXAA 2L7HA 3E26A 2LVNC 3LLPA 4DECA 1GJSA 4QNRA 3EF2A 2EO2A 2Z4SA 5KPRA 2CFOA 3UMMA 1R81A 1CE7B 2L2DA 2CV0A 4JP0A 1IRAX 2WVKA 4Z8SB 2DNAA 3B89A 3JUTA 1GVNA 4LO1A 1ZJ1A 3Q7XA 2YQSA 1ZCUA 4QBVA 4CJBA 4G3SA 2DWLA 3QVBA 4EE4A 3LVWA 4OWJA 4D0TA 1E94E 5DYGA 3RTIB 2Y0QA 4QNMA 4EE3A 2L4EA 3AKZA 1H5TA 1FR8A 1SR4A 1HNWM 1GJTA 2I5KA 2L6OA 1AXMA 2DAKA 2Y20A 2BFHA 2CEAA 2AGDA 1AUAA 5LMUM 1IRPA 2UXBM 3DJ4A 1H6UA 1FZWA 1JV3A 1VICA 2XWMA 3TQDA 1E5KA 3T1YM 2O1GA 3U61B 3KSXA 2CP8A 1G3IA 4HR6C 1H5RA 4FRBA 5EXPA 1PGYA 1ABRB 1ILR1 2Q3NB 2FYAA 2QH5A 4ZOTA 5EQTA 5F3WA 2LVQD 3V0BA 4IBKA 7I1BA 1QUTA 2G3QA 3KOYE 2LHCA 4I1BA 2OOBA 2YUGA 3N7LA 4OX9M 4LZZA 4NRVA 3CRIA 3PNVA 2RJ6A 3LMMA 4JRAA 3BAVA 4JI3M 1L2CA 1FRWA 2Y4KA 1S0CA 2XFTA 3I0IX 2P23A 4X38A 4AYLA 1N36M 3LW5F 3WO2A 2R44A 3IM6A 3M7GA 3GPPA 4D8HA 1NV9A 2VFZA 5G00A 3AH1A 1I94M 1OFHA 3BA4A 2W0WA 3VFDA 3BRGC 3T1HM 1TGUA 3IOIA 4EKXB 3U6OA 3U6SA 1WD3A 1OMXA 1GQCA 1MC9A 3HHXA 2LTUA 1TWEA 2WZJA 4JYAM 4QC4A 5FSWA 4LRSA 1ZCYA 4P16A 3V0MA 2XZUA 1DIWA 1QWJA 1ZDFA 1ISYA 2Q9XA 2DHYA 4NALA 2K8RA 3RMXA 5FTJA 1VZUA 3K92A 1H5SA 2Q4JA 4TUWA 4X66M 3OH2A 4DV6M 1TW1A 4DCKC 3U0XA 4QBCA 2ZBKB 1HNZM 2KRUA 1NJFA 3CU1B 2AAIB 3SAUA 2D7EA 1JTCA 3U6EA 2VIIA 4B3TM 1DGHB 4NSRA 3GLGE 5CQNX 5BXPA 3FJ9A 4IHZA 2D24A 3NBNA 2FGFA 1S3SA 5CMHA 1E32A 2D1ZA 3I0LA 2EKKA 2F2FC 3JR5A 1BVSA 3GLIB 1DJSB 1NV8A 2HZ9A 3O4OA 5L6VA 2MC2A 1G4AE 2FNAA 3FUQA 4QD2B 2DKLA 4CISA 2OI5A 3IM7A 4MIXA 1IHKA 1TZFA 2Z7JA 1YXWA 1R7YA 2K47A 4Y64A 4B7HA 3IECA 1R7XA 4Q7JA 2Q2EB 3J81S 4FRPA 2ZR1B 2WAWA 1G71A 2VF7A 4LO0A 1FQ9A 1TFMB 2XMHA 1IBKM 2LHGA 4PCZA 1OMZA 2D7HA 2VXRA 2X49A 1Z4SA 4MZHA 1Q3BA 2DZNB 3K9OA 3TL4X 1VZXA 5EC5A 3LW6A 3PUBA 3LCVB 1W77A 4QD2C 3I0EA 3B9PA 2DAEA 1Z90A 2EJSA 4OW4A 1ZV1A 2JA2A 3KOWE 1AF9A 1Z5AA 4FIYA 1D0LA 2YR0A 4AYJA 1SS9A 4L41C 3O4CA 3I51A 3VT0A 2GZBA 2HWMA 2N35A 2F8XC 1HM9A 1TDHA 3VT2A 2UXDM 1XXHB 2ZAOA 3AH4A 1G9AA 1HJLA 2Z48A 2D7GA 2O01F 5EP3A 4PDGA 1HJPA 2J7OA 4ZA3B 4LO8B 1M2TB 3HU3A 3U2TA 4MGZE 1HQYE 4JI7M 4ISRA 3J27B 1ZIZA 3EE5A 1IN4A 4AAWA 2AM5A 3SX7A 1R7RA 4QALA 2VK9A 5BPVA 4Q7CA 2FE8A 2Z4RA 1ON6A 4KBBA 3HZJA 4DV7M 1D0KA 2P6WA 1EFUB 2GGOA 1IY0A 5L8RF 1FV2A 1E0OA 2LVPC 2DXIA 3CRHA 3RFWA 1QQWA 3OH3A 2FYBA 3JUKA 1GX0A 2VUAA 1FN0A 8I1BA 3JRRA 2DI0A 5DFLA 3NBDA 1HWPB 4JI2M 2UUSA 4DR1M 3HN1A 2R62A 2Y4MA 1S0DA 2XOAA 3VK8A 3N7MA 3SX3A 4F34A 1IXSB 3ZGFA 3GPYA 3Q7UA 1MC3A 2NM1A 2D43A 2JWSA 4DENA 3JAMS 3KW6A 4RKUF 1WT2A 4I96A 2QN4A 2DPWA 2BJVA 4FCTA 4HEOA 1FXJA 1W5SA 2WBCA 1S4OA 3UJNA 1DFQA 1JY0A 2R6FA 3PFIA 2XWLA 4LG2A 3GLIE 3ILKA 1N77A 2AM4A 4G6ZA 4I4YA 3GP1A 2XWNA 2LIQA 3V0AB 3VLFB 3BBZA 3U5ZB 4E1KA 2M60A 4EIWA 3BB2A 2I5EA 3DK5A 3KMVA 5DUYA 4MZFB 4DV5M 2R4JA 3IM5A 3V90A 1MX0A 4M9ZA 4GRIA 2DWZB 3GPUA 2UXCM 4XFUA 4G3PA 1HCDA 2APCA 4FCUA 2ZAMA 1W3GA 3F62B 4CJMA 2A8WA 4KRVA 1S4NA 4EEAA 3CGWA 2FS1A 4I4LA 3ZC9A 4B42A 2FFUA 2YFQA 2P39A 3LCUA 4J23B 1Z2VA 4KC2A 2F4VM 1VH3A 5CMFX 2OEFA 1TDZA 1JQJC 1JLYA 4RF1A 3CRGA 2WVLA 3AOEA 2CV2A 3GRYA 1DLLA 4GIPA 3C9PA 4B2XA 1L1ZA 1O0RA 3OBRA 2J0BA 3K1JA 3PKPA 4GH9A 4CJCA 5F90A 1INJA 1FMZA 3HX3A 1BASA 4XBOA 1BARA 4FCVA 1IFYA 2ICXA 4L4HA 4D48A 1G59A 4P0LA 3AKIA 3L25A 3CF2A 3GQ4A 4GHLA 3SHGB 4NAKA 4FD2A 4J2SA 4F1IA 1WD4A 1JT5A 3IG5A 2QENA 2MGWA 5I1BA 2K6BA 1EV2A 3FUUA 2RKOA 5KQ8A 3L2AA 5ITTA 1ZAEA 2JY5A 1WVCA 4GP0A 3FOQA 1AIPC 2V1CA 1QDTA 3CU0A 1L1TA 1VM8A 2MJ5B 2VD4A 1QXMA 2Y21A 3QWLA 1ZJPA 1NHGC 4HOCA 1PUUB 4D81A 3VKGA 4D0ZA 1GWVA 4LW6A 2YESA 1PZYB 1LZ7A 4KQLA 3U6PA 4IQPA 2RIYA 2J3PA 1IIMA 3AV0A 3H6RB 3GLHB 2KH2A 1IY1A 1LL3A 5C38A 3U6DA 1HWOB 2P72A 3S8JA 1QANA 3WHLA 1XZZA 4NANA 1C7YA 4IBBA 2FFJA 2KNZA 1SXJC 4O6NA 1K3XA 1DGBA 2V1UA 1ZHJA 4I3NA 4Y7TA 1O7QA 4B5BA 2YC5A 5C3DA 1N33M 1P63A 5IZ7D 2IHOA 5I1FA 1HKNA 2AECA 4IONA 3A21A 2XFSA 2HL7A 2D7RA 5KQDA 4B2WA 3UK6A 3O3QA 3DFZA 1ISZA 2LVOC 1IXZA 4MGHA 3HBWA 4NXMM 4JI5M 41BIA 1YLAA 5CMGX 4I4RA 3KS4A 2C9CA 1Q03A 3UZUA 4R6UB 3UD8A 1TP0A 1IBMM 1AVWB 2JUJA 4UY4A 2L7IA 2L09A 3CTWB 4X64M 2ERMA 5EXXA 4AZFA 2ZANA 2MLLB 4MGIE 1W3AA 5DVHA 3J2PB 3HHWA 3ZGGA 4KNRA 1DZDA 3PKQA 2QHOB 3FYCA 2Y4JA 1ORYB 2QKXA 3CA0A 4G1RA 4X3AA 5CMJA 2WRYA 2QP9X 1WSZA 4P0KA 1AFCA 1PZZA 4L78A 3WO3A 3HJQA 3V0PA 4CVHA 4YOLA 6I1BA 2DHRA 4L6V6 4PT5A 1EPWA 4IY8A 4ARWA 4LO3C 3O49A 1IQPA 4ENDA 5D63A 3SPTA 5CMIA 5GKNA 3PMEA 4HO8A 1GA8A 4I8OA 1ZJ3A 3W0FA 3WINC 5AJNA 1O7OA 5EXTA 2RJ1A 2NYYA 1WR1B 2I1BA 4M4KA 3P6IA 2NTDA 1OJLA 3UJ0A 4XWIA 3A98B 1PRBA 4LJ5A 1GO5A 2E3DA 4KLNA 1T43A 2ZM6M 5EP4A 3ILAA 5F8WA 1EIJA 3U6QA 4QOSA 4KC1A 1JQZA 1JR3D 1OFIA 1VGZA 4JISA 4G9NA 21BIA 2QPAA 4I4UA 4B4MA 1V34A 1GQ9A 3UD7A 3BRKX 3F92A 2QSFX 3POLA 3ZF8A 3FD9A 1OTRA 4D82A 1G93A 2F2FA 3V0QA 3KFUG 4OU7A 1K3WA 1INIA 4ZDQA 2LWXA 2GQFA 1IXRC 4B7FA 3R4SA 4FCWA 1VCLA 1I4WA 4FRQA 4ISQA 1H7TA 1PZTA 3CA5A 2RJ7A 1JYLA 4NL4H 1EVTA 4REZA 2LBCA 1PJJA 5L6SA 5HS2A 4I4PA 1YROB 1HIBA 8CATA 3NBEA 1ZI1A 1DGHA 1NNUC 2GNOA 1AVXB 4M9SA 1WT3A 1W3FA 1QZMA 4AG6A 4B4GA 1IOBA 1XB2B 3SX8A 2RIZA 1GL6A 1JT3A 2UU9M 1YUBA 1DQOA 1TH2A 2J5YA 3GLIA 2QBYB 3OH1A 2O5RA 2UX8A 4FRHA 4PC4A 2Y6PA 2KHHA 3FE3A 1S4PA 4X62M 2V0LA 3SNVA 2NZ9A 3FJFA 3Q8XA 3RE8A 1R8NA 2P73A 2CU2A 1WGLA 3AFHA 3BTAA 1H3MA 2QNJA 4ZGRB 1QGSA 1J09A 3FYDA 1R5LA 3J7AS 4KODA 1VH1A 4ASJA 4Y6UA 2ET2A 1G9BA 2VSEA 2WSCF 2KW0A 1TTEA 1LZIA 2BEAA 2NVHA 4MZGB 4FVMA 4L16A 2JY7A 3OGGA 1HT2E 4KXOA 1ISXA 4IRPA 4DV1M 5FZUA 3GUEA 1BA7A 5GAQA 3I0DA 3R3IA 1N75A 1FWYA 5ITXE 1H4EA 3DA1A 1SZ6B 4BMAA 2DZOB 1KWSA 1A5TA 1FG5N 4EVWA 5C36A 4M0WA 3QYEA 4PD2A 1HV9A 1RU3A 3NWLA 3GO8A 3W68A 3GPXA 4JI8M
chains in the Genus database with same CATH topology
5AJPA 3VEQA 4WW0A 4JPZA 5C3BA 1MP5A 1NWGB 4DR4M 4IIWA 4ITQA 5E24E 1H5TB 3F1RA 5BOWA 3RGPA 1K4VA 5C4FA 1IINA 3SC3A 3R4UA 4F83A 2AXMA 5C18A 1QQKA 1MP4A 5DDVA 2R65A 1FWVA 4FRDA 3KXEC 5FYEA 1KYIA 3E9SA 2G5GX 1QAQA 1VPAA 2BEBA 1K5VA 4ZFUB 1LL2A 3AH2A 1QGQA 4DV0M 1GL7A 3A46A 3SAWA 4BBAA 4CJ8A 4HL4A 4IYBA 1N78A 4HO2A 1SR4C 3WMVA 2EA0A 3N7KA 3LTQA 5E6JA 2D44A 3BCVA 1V6UA 4GAIA 1H7HA 1T3TA 4IZEA 2LH0A 3D7WB 1JYKA 5EXSA 3I0JA 1TVYA 1IILA 1NVMA 3QR5A 1Q39A 2YNMD 3TPZA 2X5ZA 3I0HA 3JUJA 4OEFA 3ZXDA 1G8PA 1JLXA 5FTSA 4I4XA 1JVDA 4LF9M 3O4DA 3IOJA 1NZKA 3E4RA 3AL0C 4X37A 2ERCA 3TQSA 4KC4A 4MH0E 4O6MA 1D2NA 4AKHA 3D8LA 4LF6M 2RG9B 2OQ4A 2VQFM 3SXBA 2H1RA 2Y9FA 4DEPA 4IRQA 1EE8A 5JQQA 4R7GA 3SARA 1G8OA 1I52A 1Q1UA 1ZI4A 3H4MA 3V0AA 4Y6NA 3U5ZA 1IN5A 2Y7AA 1Q3CA 3FUVA 2CV1A 1XNRM 1YE9A 1S0FA 3PHZA 4ZKTB 3UD9A 2YQHA 3CA1A 4IBGA 4S12A 2AQZA 2KZSA 3FUXA 4NXNM 4LGMA 2MIBA 2ZQOA 4K6RA 4MGYE 2DREA 1NMMB 4FWHA 3I4VA 1XHBA 4ZFWB 5CQPA 4II0A 1XNQM 4W5WA 3L29A 3AJIB 3V8YA 4AN7B 3W9TA 4BQHA 4QOZC 5BXCA 3M0EA 2J0AA 3PNNA 4QKSA 1HWNB 4G9MA 5A2QS 2YCMA 2I7PA 3FJ8A 1ITBA 4L4IA 1Z0HA 2KI6B 1N32M 2BO7A 4FROA 1V6WA 4IBCA 3BRFA 4JV5M 3Q80A 3FJHA 4I5SA 5AJOA 1DFCA 4M2BA 2WVMA 2JCJA 3SHFA 4K0KM 1HCEA 4LJ7A 1FV3A 3OJ2A 4G4NA 2F5QA 3J80S 3V79C 1IN8A 2VSIA 3FTDA 1R2YA 3FTEA 1YP4A 4JQ0A 1II4A 2F5OA 4L4UA 1W57A 2KRKA 2NQ8C 3KS8A 2HKJA 4FRMA 5FU8A 3KIAA 3A45A 1ZI3A 2XMEA 4LW3A 1FOAA 3FTCA 4D11C 3SXDA 2RGOA 2V6ZM 3U2UA 4J2YA 3WMUA 4LCBA 4KT7A 3KSJA 4LF5M 5EJCA 2C96A 2RITA 3NJ5A 4FVVA 2EUCA 1ZDGA 4IBJA 2D20A 2VXTI 3EIHA 3DUVA 5BP5A 2ESUA 3MHVC 3CGXA 4MNDA 4AC3A 4DE7A 1BFFA 3HMYA 1FXOA 1QAMA 3RMYA 2FY7A 5CQLX 1VDDA 2C5RA 2ZQNA 2C0NA 3I0FA 1UPSA 3D8VA 3U6CA 4OVZB 3RTJB 2KXEA 3H6RA 3HL3A 4IBIA 2LNHC 3HSMA 1IN7A 4LJ4A 4H9WA 2G8LA 2RJ8A 1ZCVA 1SXJD 3CAHA 1Q04A 1FO8A 3Q4SA 1TTUA 4IBFA 4LO2A 1NQIB 4FRLA 4GHAA 1XC8A 1YP2A 1DZCA 1ZJ0A 4JKQA 1AVUA 1HNXM 2RJ4A 5HPZA 4II7A 3C58A 1QVRA 5IDSA 3PXGA 2OPFA 3Q7YA 2XSZD 1NSFA 4YY3M 4AKGA 1S0LA 4PDIA 4JN6A 3WA1A 4LO3A 1WBCA 4AQYM 4AG5A 4Q91A 4DR2M 3P53A 4P6AA 1WT0A 1V83A 1R7VA 3RMVA 1MP3A 5ITXA 3WINA 3HJ8A 4A3VB 3DOAA 1IN6A 2Y9XE 3AZWA 3U2VA 3GLFB 3RGSA 1GGPB 2PX7A 2IWTB 3CKOA 3U2XA 3AKHA 4FQWA 5BQUC 2Z87A 5C4BA 3HOMA 1SXJB 1J5EM 2O1HA 3ZC8A 3VDPA 2VQEM 4B3MM 1VGTA 4B4BA 3RSJA 2XF3A 3I4YA 5FLXS 3T8SA 2FYDB 3BX1C 3BAOA 3GLGA 4LZJA 1QG8A 2V0IA 4A7YA 3C9ZA 5EP1A 4OEGA 2FO1A 1BLAA 2WGZA 4GAFA 5JI3E 3SX5A 4OWKA 5B2HA 1Z6TA 3U60B 4LJ6A 5IWAM 1R82A 1K5UA 3FUTA 4DR5M 3H6SE 2LXEA 1TH3A 4OUJA 5J49A 1V82A 3D98A 2KA6B 3V0OA 1FO9A 2HCBA 3A23A 5BVPI 4Y9XA 3UJ4A 2AH9A 4WURA 2RQ9A 4FRAA 3KOXE 3OTOM 2AFGA 3AOGA 3R2WA 4RF0A 3OH4A 4Q9GA 1DQGA 4LRTA 2D0JA 4NAIA 4LGYA 4HO6A 4NRWA 4H04A 5BXSA 2M49A 1XWIA 4TLPA 4FW9A 1HQCA 1HWMB 4Z6YA 1LZ0A 1ZJ2A 4AI6A 1L2HA 5DDTA 2VS4A 1MD6A 5FZYA 1FGGA 1ZQ9A 3TWMA 1QQLA 4EFPA 4AN6A 4KNXA 1OQMB 3TWKA 3FKEA 3I0GA 4HO5A 4JD0A 2PGVA 5JI2E 3U61A 3BAHA 1A8DA 3FJAA 4DV2M 4I7IA 4P0JA 5FU0A 3O4AA 3FJJA 3SYLA 1WXQA 1N34M 4JI1M 5DYIA 4HO0A 3ZX7A 5EJ1A 4LFCM 2CUZA 3MPPG 1JR3A 1NNJA 4Y7VA 3BAQA 4D80A 3NGWA 5BXTA 5FZZA 1NY6A 3GO8A 1FGXA 2WEEA 2C9OA 2M5ZA 4YS8A 3MJ5A 3GRRA 4I4OA 4I2SA 4KC3A 3V0LA 2XLJA 4DDZA 2VSAA 1ISVA 4B3SM 2NXVA 3F1CA 4X39A 3THGA 1AVAC 1XMOM 3MALA 1KFVA 4RNAA 5FNWA 3T38A 4G4QA 2A8UA 4I4VA 4JI0M 4GKJM 2E8BA 1T9FA 1L8QA 3FGMA 2QGIA 3HU2A 1H4CA 2AESA 1X37A 3OJMA 2VS3A 2Y4LA 2NS2A 3BAGA 3USQA 5FTVA 4G6MA 4EFRA 4I0YA 1TW5A 4EB2B 4HA2A 4ZBVB 1GKIA 3U6LA 3RMWA 1W5TA 1SXJE 4KO8A 1ONKB 4KEJA 3AKFA 2DVWB 3T15A 5JMCA 3HGIA 3M6AA 1JT7A 1JVGA 3LQRA 1H7QA 4R7PA 3P6JA 1C1KA 4HJJA 2E4MC 1LZJA 3KDSE 1R2ZA 1R7UA 2OI7A 3JTJA 3V8ZA 1BFGA 1G0RA 5JLVA 2R4EA 2DS0A 4M2AA 4LO7B 3ST8A 3AKGA 3TZTA 2X4AA 2MZBA 3TE6A 5D91A 3V91A 3BADA 3OJVA 3NBIA 3BA5A 4WBCA 3O44A 3KOZE 4Y7GA 4AKIA 3N9WA 4GITA 3VT1A 3IIRA 4IBDA 3IAGC 2KLLA 1NKHB 5ITRA 4M0DA 1G9CA 3WO4A 1G9DA 2Z49A 3ZLKA 3B9UA 1J7KA 3OBTA 1GX4A 2YQJA 2RJ0A 4BB9A 4LO7C 3CA3A 3K1XA 3ZCBB 4DUZM 3GQ5A 1H7EA 1XMQM 4R3DA 2E5LM 4EEGA 3A22A 2X2TA 1ZJOA 1JT4A 3SMPA 4ASYA 3TC2A 4EEMA 4LY6A 1PC8B 5IT9S 2UUAM 1NY5A 3O3PA 4MB7A 4GP3A 2VSHA 3SYKA 2V0HA 4DUYM 1H4DA 3GQ3A 1LV7A 1J0SA 3SXEA 2AHMA 3OGZA 3D8BA 3L28A 1MU5A 2AM3A 3HWSA 1PUMB 3WHKA 1IJTA 4I4SA 3OKRA 1G41A 4IBEA 4ZLBB 4QO3A 3KVWA 5IDTA 1XXHA 2DRZA 3BAUA 3FJKA 1HJJA 4USPA 3FJCA 4BLCA 1QYRA 3AJ5A 5C3AA 2CHGA 3CQAA 3FUOA 4LO1C 2LIEA 2RGHA 4FWGA 1R8OA 4DR3M 3K2LA 3ZC7B 1G95A 4JI6M 1H5RB 1S0EA 2Y9WC 4CGYB 1IT0A 1GLNA 3PG0A 2ZU8A 2KI4A 2I7BA 1DGGA 4LFAM 1HM0A 2X60A 2KEBA 2AE7A 3V0BB 1H5SD 5FTMA 3BRDA 4LF4M 3FFZA 2BO8A 1UM8A 4LJ9A 4AW4A 3L26A 3RSBA 4GKKM 5C1HA 1WT1A 3N7JA 2C98A 4DR6M 9ILBA 4ZFYB 4DR7M 2X8AA 3E25A 1ON8A 2HHHM 3OC9A 1NJGA 4G4RA 4FGFA 3CF6E 1Z5BA 3CKQA 4D11A 5F8YA 5FNXA 1I1EA 3AJ6A 2WE9A 3TWLA 5C1GA 1FJGM 5IREB 3VK7A 4Y7FA 1IY2A 1EZIA 4Y62A 3T7OA 3KP1E 4MGKE 4P02A 4I6IA 1V84A 3PNYA 1PWAA 4OWLA 2X65A 2K4AB 3I2XA 4IZXA 2F5NA 4KPXA 2QZ4A 1YF8B 3VDUA 4J2KA 31BIA 2BO6A 2NP0A 3A42A 2R45A 2D22A 1H5SB 2VU9A 3CKVA 1G2VA 3CA6A 1G82A 4I1EA 1FGAA 2L5XA 1R80A 4LJ8A 1EYRA 3E8LC 1G97A 4X65M 5C8RA 2FDBM 3CA4A 4XKIA 2VXLA 3FJEA 2F5SA 1TOOA 5ITUA 2D23A 4B08A 3R8FA 1H7LA 4HO3A 5H37D 2JCLA 1H5SC 2RJ5A 2K43A 3D5NA 2UUBM 4OVZA 2UUCM 4Z8XA 5FTKA 3QYDA 3IOHA 5C48A 3DZDA 4C2SA 3S8KA 4QKRA 5BXRA 4GC5A 1BLDA 5EP2A 4HLQA 1HR0M 2VS5A 2O1FA 2OEGA 1NF5B 3CF0A 3HALA 2FOIC 4CHTB 3V0NA 1H7GA 2CHQA 5EHAA 5C1BA 3POKA 2BNKA 2YC3A 5E26A 2XEPA 4FWDA 5IFYA 4ZPXA 3HJSA 5LMNM 5D62A 2PGYA 1DGFA 1ZCTA 2DWMA 4M28A 4Z9WB 4B3RM 1YSYA 5BQUA 3KP0E 4NOOB 3FJDA 1TIEA 2X5SA 4MYBA 1E9RA 3SFZA 3ZLLA 2D7IA 3H6QA 1NHEB 1G9RA 3UGJA 1FNNA 1G3LA 2J7NA 2QCUA 1RY7A 3ZH9B 5EJZA 1OQLB 3HU1A 3F1YA 4FIXA 3OAMA 4HO4A 4LO0C 3R9XB 5FTNA 5DSSB 3HHYA 1E9SA 1KNMA 1YBIA 3GLFA 2RSTA 3T7MA 5C4CA 4A7ZA 3IG8A 5F8SA 3FTFA 4GBPA 3U0YA 1SXJA 1R7TA 2VXMA 5FV9A 2FFVA 1WBAA 3O4BA 2CHVA 3SAVA 4H75A 3NBCA 5DZUA 1LL0A 4EE5A 4I81A 4USOA 1RMLA 1VZTA 3GLHA 3CKNA 3Q7WA 5DNYA 2CE7A 2HWAA 1XG6A 2Z3XA 2XSZA 1YTOA 3U60A 5C1LA 2P5TA 2Y9GA 2A5YB 4LF7M 3OH0A 1RG8A 1GWWA 5D92A 2XH9A 3LVVA 4M9XA 4LF8M 3PVSA 3OGFA 1XZ6A 7CATA 1W55A 1HT1E 4QHSA 2OI6A 4Y63A 4I4QA 3BOSA 4Y7UA 1DO2A 1VGUA 3I0CA 5C4EA 3HHZA 3K8EA 3EIEA 3FUWA 5BR8M 4L15A 2QYIB 2W0VA 2XZFA 1EYLA 4G87A 1Z59A 1S0BA 2I7NA 3A07A 3SATA 5C47A 5KPTA 5EG6C 2KKIA 1T4QA 1BFBA 1YP3A 4IY9A 5C4DA 1BFCA 3JR4A 2JCOA 2BJWA 1RZOB 3VUOA 5ITQA 1PM5A 4G6JA 3VWCA 4KPZA 1H7FA 4JXJA 2JCKA 4IJFA 4GOYA 3GRVA 3SXGA 1IM2A 2BO4A 1S0GA 1M16A 1G23A 5FUHA 3W0LB 2X2SA 2F5PA 4LFBM 4JAWA 1F31A 4UEGA 1FWUA 4MM3B 1ZI5A 4GOVA 1V6VA 2XGNA 1VGWA 3N0KA 3U6MA 2Z86A 4GC9A 2FYCB 4L8RC 4EEEB 4FREA 1D0HA 4A7KA 2VLCA 3I2AA 4Q9PA 4HG6A 1V6XA 2PA4A 4ECMA 3I0KA 3CKJA 3K8DA 4HO9A 4P00A 3SMSA 2KZUA 4YHHM 3K8ZA 1K82A 4JKXB 2ZU7A 2E4MA 4XGIA 1JV1A 2DRYA 1DO0A 2GGQA 4GMQA 5BP5C 4B7GA 4KEKA 4J2XA 4G4OA 2GO2A 1NHWC 1ISWA 4XFTA 2DWNA 2R46A 2HW9A 4JI4M 5CQOA 3GRUA 1FR9A 1YYNA 5D61A 1NUNA 1N4KA 3HKPA 1KSFX 1I1BA 1Z5CA 1L2DA 1TWMA 4I37A 3MK6A 3L27A 1TH4A 3AOEC 2ZU9A 4I8MA 4NSOB 4LO2C 2R18A 1O23B 1PJIA 3U2WA 3VKHA 3USRA 1R6BX 3UDAA 3FWWA 4EEOA 5C49A 2QBYA 3SASA 1LVWA 2YQCA 1XYFA 2V0KA 4LJAA 3AZVA 3BA7A 4XFSA 2R9KB 5EIYA 5FTLA 3FJIA 3SBJA 5CQMX 3O5WB 4G3QA 1CVSA 2RIXA 4OW0A 5KPZA 3LQQA 1L2BA 2ICYA 1QAOA 4KHPM 1HM8A 4B3UA 2V0JA 5ITYA 3T7NA 1G1LA 4J18A 4HCQA 3GLGB 1FMMS 3SXCA 5KO3A 4DV4M 3J7BA 2Y0TA 3ZXGA 4DV3M 2RJ9A 2W82A 4EFQA 2YQZA 4QHTA 3QAUA 4IJEA 4OEEA 3I29B 1IBLM 3VSFA 4FCEA 2C99A 3FJBA 3VSZA 3SXAA 2L7HA 3E26A 4DECA 3LLPA 4QNRA 3EF2A 2EO2A 2Z4SA 5KPRA 2CFOA 3UMMA 1R81A 1CE7B 2CV0A 4JP0A 1IRAX 2WVKA 4Z8SB 3JUTA 1GVNA 4LO1A 1ZJ1A 3Q7XA 2YQSA 1ZCUA 4QBVA 4CJBA 4G3SA 2DWLA 3QVBA 4EE4A 3LVWA 4OWJA 4D0TA 1E94E 5DYGA 3RTIB 2Y0QA 4QNMA 4EE3A 3AKZA 1H5TA 1FR8A 1SR4A 1HNWM 2I5KA 2L6OA 1AXMA 2Y20A 2BFHA 2CEAA 2AGDA 5LMUM 1IRPA 2UXBM 3DJ4A 1H6UA 1FZWA 1JV3A 1VICA 2XWMA 3TQDA 1E5KA 3T1YM 2O1GA 3U61B 3KSXA 1G3IA 4HR6C 1H5RA 4FRBA 5EXPA 1ABRB 1ILR1 2Q3NB 2FYAA 2QH5A 4ZOTA 5EQTA 5F3WA 3V0BA 4IBKA 7I1BA 3KOYE 4I1BA 2YUGA 3N7LA 4OX9M 4LZZA 4NRVA 3CRIA 3PNVA 2RJ6A 3LMMA 4JRAA 3BAVA 4JI3M 1L2CA 1FRWA 2Y4KA 1S0CA 2XFTA 3I0IX 2P23A 4X38A 4AYLA 1N36M 3WO2A 3IM6A 3M7GA 3GPPA 4D8HA 2VFZA 5G00A 3AH1A 1I94M 1OFHA 3BA4A 2W0WA 3VFDA 3BRGC 3T1HM 1TGUA 3IOIA 4EKXB 3U6OA 3U6SA 1WD3A 1OMXA 1GQCA 1MC9A 3HHXA 4JYAM 1TWEA 4QC4A 5FSWA 4LRSA 1ZCYA 4P16A 3V0MA 2XZUA 1DIWA 1QWJA 1ZDFA 1ISYA 2Q9XA 4NALA 2K8RA 3RMXA 5FTJA 1VZUA 3K92A 1H5SA 2Q4JA 4TUWA 4X66M 3OH2A 4DV6M 1TW1A 4DCKC 3U0XA 4QBCA 2ZBKB 1HNZM 2KRUA 1NJFA 3CU1B 2AAIB 3SAUA 2D7EA 3U6EA 4B3TM 2VIIA 1JTCA 1DGHB 4NSRA 5CQNX 5BXPA 3FJ9A 4IHZA 2D24A 3NBNA 2FGFA 1S3SA 5CMHA 1E32A 2D1ZA 3I0LA 2F2FC 3JR5A 3GLIB 1DJSB 2HZ9A 3O4OA 5L6VA 2MC2A 1G4AE 2FNAA 3FUQA 4QD2B 4CISA 2OI5A 3IM7A 4MIXA 1IHKA 1TZFA 2Z7JA 1YXWA 1R7YA 2K47A 4Y64A 4B7HA 1R7XA 3J81S 2Q2EB 4FRPA 2ZR1B 2WAWA 4LO0A 2XMHA 1FQ9A 1TFMB 1IBKM 4PCZA 1OMZA 2D7HA 2VXRA 2X49A 1Z4SA 4MZHA 1Q3BA 2DZNB 3TL4X 1VZXA 5EC5A 3LW6A 3PUBA 1W77A 4QD2C 3I0EA 3B9PA 1Z90A 4OW4A 2JA2A 3KOWE 1AF9A 1Z5AA 4FIYA 2YR0A 4AYJA 1SS9A 4L41C 3O4CA 3I51A 3VT0A 2GZBA 2HWMA 2F8XC 1HM9A 1TDHA 3VT2A 2UXDM 1XXHB 2ZAOA 3AH4A 1G9AA 1HJLA 2Z48A 2D7GA 5EP3A 4PDGA 2J7OA 4ZA3B 4LO8B 1M2TB 3HU3A 3U2TA 4MGZE 1HQYE 4JI7M 4ISRA 3J27B 1ZIZA 3EE5A 1IN4A 4AAWA 2AM5A 3SX7A 1R7RA 4QALA 2VK9A 5BPVA 4Q7CA 2FE8A 2Z4RA 1ON6A 4KBBA 4DV7M 2P6WA 2GGOA 1IY0A 1FV2A 1E0OA 2DXIA 3CRHA 3RFWA 1QQWA 3OH3A 2FYBA 3JUKA 1GX0A 2VUAA 1FN0A 8I1BA 3JRRA 3NBDA 1HWPB 4JI2M 2UUSA 4DR1M 3HN1A 2R62A 2Y4MA 1S0DA 2XOAA 3VK8A 3N7MA 3SX3A 4F34A 1IXSB 3ZGFA 3GPYA 3Q7UA 1MC3A 2NM1A 2D43A 4DENA 3JAMS 3KW6A 1WT2A 4I96A 2QN4A 2DPWA 2BJVA 4FCTA 1FXJA 1W5SA 2WBCA 1S4OA 3UJNA 1DFQA 1JY0A 3PFIA 2XWLA 4LG2A 3ILKA 1N77A 2AM4A 4G6ZA 4I4YA 3GP1A 2XWNA 2LIQA 3V0AB 3VLFB 3U5ZB 4E1KA 2M60A 4EIWA 3BB2A 2I5EA 3DK5A 3KMVA 5DUYA 4MZFB 4DV5M 2R4JA 3IM5A 3V90A 1MX0A 4M9ZA 4GRIA 2DWZB 3GPUA 2UXCM 4XFUA 4G3PA 1HCDA 2APCA 4FCUA 2ZAMA 1W3GA 3F62B 4CJMA 2A8WA 4KRVA 1S4NA 4EEAA 4I4LA 3ZC9A 4B42A 2FFUA 2YFQA 2P39A 4J23B 1Z2VA 4KC2A 2F4VM 1VH3A 5CMFX 2OEFA 1TDZA 1JQJC 1JLYA 4RF1A 3CRGA 2WVLA 3AOEA 2CV2A 3GRYA 1DLLA 4GIPA 4B2XA 1L1ZA 1O0RA 3OBRA 2J0BA 3K1JA 3PKPA 4GH9A 4CJCA 5F90A 1INJA 1FMZA 1BASA 4XBOA 1BARA 4FCVA 2ICXA 4L4HA 4D48A 1G59A 4P0LA 3AKIA 3L25A 3CF2A 3GQ4A 4GHLA 3SHGB 4NAKA 4FD2A 4J2SA 1WD4A 1JT5A 3IG5A 2QENA 5I1BA 1EV2A 3FUUA 2RKOA 5KQ8A 3L2AA 5ITTA 1ZAEA 1WVCA 4GP0A 3FOQA 2V1CA 3CU0A 1L1TA 1VM8A 2VD4A 1QXMA 2Y21A 3QWLA 1ZJPA 1NHGC 4HOCA 1PUUB 4D81A 3VKGA 4D0ZA 1GWVA 4LW6A 2YESA 1PZYB 1LZ7A 4KQLA 3U6PA 4IQPA 2RIYA 2J3PA 1IIMA 3AV0A 3H6RB 3GLHB 2KH2A 1IY1A 1LL3A 5C38A 3U6DA 1HWOB 2P72A 3S8JA 1QANA 3WHLA 1XZZA 4NANA 4IBBA 2FFJA 1SXJC 4O6NA 1K3XA 1DGBA 2V1UA 1ZHJA 4I3NA 4Y7TA 1O7QA 4B5BA 2YC5A 5C3DA 1N33M 1P63A 5IZ7D 2IHOA 5I1FA 1HKNA 2AECA 4IONA 3A21A 2XFSA 2HL7A 2D7RA 5KQDA 4B2WA 3UK6A 3O3QA 3DFZA 1ISZA 1IXZA 4MGHA 3HBWA 4NXMM 4JI5M 41BIA 5CMGX 4I4RA 3KS4A 2C9CA 1Q03A 3UZUA 4R6UB 3UD8A 1TP0A 1IBMM 1AVWB 4UY4A 2L7IA 2L09A 3CTWB 4X64M 2ERMA 5EXXA 4AZFA 2ZANA 2MLLB 4MGIE 1W3AA 5DVHA 3J2PB 3HHWA 3ZGGA 4KNRA 1DZDA 3PKQA 3FYCA 2Y4JA 1ORYB 2QKXA 3CA0A 4G1RA 4X3AA 5CMJA 2WRYA 2QP9X 1WSZA 4P0KA 1AFCA 1PZZA 4L78A 3WO3A 3HJQA 3V0PA 4CVHA 4YOLA 6I1BA 2DHRA 4PT5A 1EPWA 4IY8A 4ARWA 4LO3C 3O49A 1IQPA 4ENDA 5D63A 3SPTA 5CMIA 5GKNA 3PMEA 4HO8A 1GA8A 4I8OA 1ZJ3A 3W0FA 3WINC 5AJNA 1O7OA 5EXTA 2RJ1A 2NYYA 2I1BA 4M4KA 3P6IA 2NTDA 1OJLA 3UJ0A 4XWIA 3A98B 4LJ5A 2E3DA 4KLNA 2ZM6M 5EP4A 3ILAA 5F8WA 3U6QA 4QOSA 4KC1A 1JQZA 1JR3D 1OFIA 1VGZA 4JISA 4G9NA 21BIA 2QPAA 4I4UA 4B4MA 1GQ9A 3UD7A 3BRKX 3POLA 3ZF8A 3FD9A 4D82A 1G93A 2F2FA 3V0QA 3KFUG 4OU7A 1K3WA 1INIA 4ZDQA 2LWXA 1IXRC 4B7FA 3R4SA 4FCWA 1VCLA 1I4WA 4FRQA 4ISQA 1H7TA 1PZTA 3CA5A 2RJ7A 1JYLA 4NL4H 1EVTA 4REZA 1PJJA 5L6SA 5HS2A 4I4PA 1YROB 1HIBA 8CATA 3NBEA 1ZI1A 1DGHA 1NNUC 1AVXB 4M9SA 1WT3A 1W3FA 1QZMA 4AG6A 4B4GA 1IOBA 3SX8A 2RIZA 1GL6A 1JT3A 2UU9M 1YUBA 1DQOA 1TH2A 3GLIA 2QBYB 3OH1A 2O5RA 2UX8A 4FRHA 4PC4A 2Y6PA 1S4PA 4X62M 2V0LA 3SNVA 2NZ9A 3FJFA 3Q8XA 3RE8A 1R8NA 2P73A 2CU2A 3AFHA 3BTAA 1H3MA 4ZGRB 1QGSA 1J09A 3FYDA 3J7AS 4KODA 1VH1A 4ASJA 4Y6UA 2ET2A 1G9BA 2VSEA 2KW0A 1LZIA 2BEAA 2NVHA 4MZGB 4FVMA 4L16A 3OGGA 1HT2E 4KXOA 1ISXA 4IRPA 4DV1M 5FZUA 3GUEA 1BA7A 5GAQA 3I0DA 3R3IA 1N75A 1FWYA 5ITXE 1H4EA 3DA1A 1SZ6B 4BMAA 2DZOB 1KWSA 1FG5N 4EVWA 5C36A 4M0WA 4PD2A 1HV9A 3NWLA 4KEIA 3GPXA 4JI8M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YP3 A;  4I2S A;  4KC3 A;  3V0L A;  5AJP A;  3VEQ A;  4DDZ A;  1FV2 A;  4IY9 A;  1E0O A;  4FRB A;  5C4D A;  1BFC A;  2JCO A;  3CRH A;  1RZO B;  2VSA A;  4JPZ A;  3VUO A;  5C3B A;  1MP5 A;  3OH3 A;  1NWG B;  2FYB A;  3JUK A;  1ISV A;  1GX0 A;  2NXV A;  2VUA A;  4G6J A;  3VWC A;  4KPZ A;  1FN0 A;  1H7F A;  5E24 E;  3F1C A;  8I1B A;  3JRR A;  4X39 A;  1H5T B;  2JCK A;  1AVA C;  3F1R A;  4GOY A;  3MAL A;  5BOW A;  5FU0 A;  1K4V A;  3NBD A;  1HWP B;  5C4F A;  1IIN A;  2UUS A;  3HN1 A;  5FNW A;  2A8U A;  3R4U A;  4I4V A;  2Y4M A;  3SXG A;  2E8B A;  1T9F A;  4F83 A;  2AXM A;  2BO4 A;  1S0D A;  1M16 A;  1S0G A;  3FGM A;  1G23 A;  2QGI A;  5FUH A;  1QQK A;  5L6S A;  1MP4 A;  2X2S A;  2XOA A;  5DDV A;  1H4C A;  4JAW A;  2AES A;  1F31 A;  3N7M A;  3OJM A;  3SX3 A;  2VS3 A;  4UEG A;  2Y4L A;  1FWV A;  4F34 A;  3BAG A;  4FRD A;  1FWU A;  1ZI5 A;  3USQ A;  4GOV A;  3ZGF A;  1V6V A;  5FTV A;  4G6M A;  4EFR A;  3Q7U A;  1MC3 A;  5FYE A;  1VGW A;  4I0Y A;  1TW5 A;  4EB2 B;  4HA2 A;  2NM1 A;  3N0K A;  2Z86 A;  4ZBV B;  2D43 A;  4DEN A;  1VPA A;  2BEB A;  1K5V A;  4ZFU B;  1LL2 A;  3AH2 A;  1WT2 A;  2FYC B;  4I96 A;  2QN4 A;  1QGQ A;  3RMW A;  2DPW A;  1ONK B;  4KEJ A;  4EEE B;  1FXJ A;  4FRE A;  1D0H A;  2WBC A;  3AKF A;  4A7K A;  2VLC A;  3I2A A;  5JMC A;  4IYB A;  1S4O A;  4CJ8 A;  4Q9P A;  1DFQ A;  4HO2 A;  1SR4 C;  1JY0 A;  1JT7 A;  4HG6 A;  5C1G A;  3WMV A;  1JVG A;  1V6X A;  2PA4 A;  2XWL A;  3N7K A;  1H7Q A;  3I0K A;  4ECM A;  4R7P A;  3LTQ A;  3CKJ A;  3P6J A;  2D44 A;  3K8D A;  2AM4 A;  4HJJ A;  2E4M C;  1V6U A;  3BCV A;  1LZJ A;  4GAI A;  4I4Y A;  1R7U A;  2OI7 A;  3JTJ A;  1H7H A;  4P00 A;  1BFG A;  1G0R A;  3V8Z A;  5JLV A;  2DS0 A;  4IZE A;  4LO7 B;  4M2A A;  3D7W B;  1JYK A;  3ST8 A;  3AKG A;  2XWN A;  4JKX B;  3I0J A;  2LIQ A;  3V0A B;  1TVY A;  3TZT A;  2MZB A;  2ZU7 A;  1IIL A;  2E4M A;  1JV1 A;  3V91 A;  4E1K A;  2DRY A;  3BAD A;  3QR5 A;  2GGQ A;  3OJV A;  2X5Z A;  3BA5 A;  3I0H A;  3JUJ A;  4OEF A;  3ZXD A;  4WBC A;  3O44 A;  1JLX A;  3BB2 A;  5FTS A;  5BP5 C;  4I4X A;  2I5E A;  3DK5 A;  4Y7G A;  1JVD A;  3KMV A;  3N9W A;  5DUY A;  3VT1 A;  3IIR A;  3O4D A;  4KEK A;  3IAG C;  3IOJ A;  2KLL A;  1NKH B;  4J2X A;  1NZK A;  3IM5 A;  3V90 A;  2GO2 A;  1ISW A;  4XFT A;  1G9C A;  4X37 A;  4XFU A;  3WO4 A;  2HW9 A;  1G9D A;  4G3P A;  2Z49 A;  4KC4 A;  3ZLK A;  1HCD A;  3B9U A;  2APC A;  5CQO A;  4FCU A;  1W3G A;  3OBT A;  3F62 B;  1GX4 A;  4CJM A;  2A8W A;  4KRV A;  1S4N A;  1FR9 A;  1YYN A;  5D61 A;  3ZC9 A;  2YQJ A;  4EEA A;  2RJ0 A;  2RG9 B;  4B42 A;  1NUN A;  1N4K A;  2FFU A;  4LO7 C;  2P39 A;  1I1B A;  3CA3 A;  4J23 B;  3SXB A;  1Z2V A;  1TWM A;  3K1X A;  1VH3 A;  4KC2 A;  2Y9F A;  4I37 A;  4DEP A;  4IRQ A;  5CMF X;  1H7E A;  2OEF A;  2ZU9 A;  5JQQ A;  4I8M A;  4EEG A;  3A22 A;  1G8O A;  1I52 A;  2X2T A;  1Q1U A;  4LO2 C;  1JLY A;  1ZI4 A;  3V0A A;  1ZJO A;  4Y6N A;  1JT4 A;  1O23 B;  3CRG A;  2Y7A A;  2WVL A;  3U2W A;  3PHZ A;  3USR A;  1S0F A;  4ZKT B;  4ASY A;  1DLL A;  3UDA A;  3FWW A;  4EEO A;  5C49 A;  3TC2 A;  3UD9 A;  4EEM A;  1PC8 B;  1LVW A;  2YQC A;  4B2X A;  1O0R A;  1XYF A;  2V0K A;  3CA1 A;  3OBR A;  2YQH A;  3O3P A;  4GP3 A;  2AQZ A;  3AZV A;  3BA7 A;  4XFS A;  2VSH A;  3PKP A;  4CJC A;  5F90 A;  1INJ A;  2ZQO A;  2MIB A;  4K6R A;  2V0H A;  2R9K B;  5EIY A;  1FMZ A;  1H4D A;  2DRE A;  3FJI A;  1J0S A;  1BAS A;  1NMM B;  3SXE A;  5CQM X;  3O5W B;  3OGZ A;  4G3Q A;  1BAR A;  1CVS A;  2RIX A;  1XHB A;  2AM3 A;  4ZFW B;  2ICX A;  5CQP A;  4II0 A;  2ICY A;  1PUM B;  4L4H A;  4D48 A;  1IJT A;  1HM8 A;  4I4S A;  4P0L A;  2GGO A;  2V0J A;  3OKR A;  4B3U A;  3AKI A;  3V8Y A;  3T7N A;  4ZLB B;  4QO3 A;  4AN7 B;  1G1L A;  4J18 A;  5IDT A;  4HCQ A;  1FMM S;  3SXC A;  3W9T A;  4BQH A;  2DRZ A;  5BXC A;  4NAK A;  3BAU A;  3FJK A;  4J2S A;  1HJJ A;  4USP A;  3ZXG A;  3PNN A;  4QKS A;  1HWN B;  4G9M A;  2RJ9 A;  4EFQ A;  2YCM A;  3FJC A;  3FJ8 A;  1ITB A;  1WD4 A;  4L4I A;  1Z0H A;  2KI6 B;  1JT5 A;  4OEE A;  3AJ5 A;  3I29 B;  3VSF A;  2BO7 A;  4FRO A;  5C3A A;  4FCE A;  1V6W A;  3FJB A;  3VSZ A;  5I1B A;  3BRF A;  3FJH A;  3Q80 A;  3SXA A;  1EV2 A;  3CQA A;  3E26 A;  3LLP A;  3FUO A;  4LO1 C;  4DEC A;  5AJO A;  2LIE A;  4HO9 A;  1DFC A;  4M2B A;  3EF2 A;  1R8O A;  2WVM A;  2JCJ A;  1R81 A;  1CE7 B;  1G95 A;  4JP0 A;  1WVC A;  1IRA X;  1HCE A;  4GP0 A;  2WVK A;  1FV3 A;  3OJ2 A;  4Z8S B;  3JUT A;  1H5R B;  1S0E A;  3FOQ A;  4LO1 A;  2Y9W C;  1ZJ1 A;  3CU0 A;  1IT0 A;  1VM8 A;  2VD4 A;  3V79 C;  1QXM A;  3PG0 A;  3Q7X A;  2KI4 A;  2I7B A;  2YQS A;  2ZU8 A;  1ZCU A;  1ZJP A;  4QBV A;  4HOC A;  4CJB A;  1HM0 A;  2X60 A;  2AE7 A;  2VSI A;  3V0B B;  4G3S A;  1PUU B;  1GWV A;  1H5S D;  4D0Z A;  1YP4 A;  3QVB A;  4JQ0 A;  4EE4 A;  4LW6 A;  3BRD A;  3FFZ A;  4OWJ A;  1PZY B;  2YES A;  1II4 A;  4D0T A;  2BO8 A;  1LZ7 A;  4KQL A;  1W57 A;  4IQP A;  3RSB A;  2RIY A;  3RTI B;  2J3P A;  1IIM A;  4EE3 A;  5C1H A;  4FRM A;  1H5T A;  1FR8 A;  1WT1 A;  3H6R B;  3N7J A;  2KH2 A;  1LL3 A;  5FU8 A;  5C38 A;  1SR4 A;  3KIA A;  2I5K A;  1HWO B;  9ILB A;  1ZI3 A;  2P72 A;  1AXM A;  3S8J A;  4ZFY B;  2XME A;  3DUV A;  4LW3 A;  1FOA A;  1XZZ A;  4NAN A;  3E25 A;  2BFH A;  4D11 C;  1ON8 A;  2AGD A;  3OC9 A;  3SXD A;  1IRP A;  3DJ4 A;  4FGF A;  1FZW A;  1JV3 A;  1VIC A;  4J2Y A;  3WMU A;  2XWM A;  3U2U A;  4KT7 A;  3TQD A;  1ZHJ A;  1E5K A;  3CKQ A;  4D11 A;  2O1G A;  4I3N A;  2RIT A;  1O7Q A;  4Y7T A;  4B5B A;  3NJ5 A;  4FVV A;  2YC5 A;  5F8Y A;  5C3D A;  5FNX A;  4HR6 C;  1H5R A;  1ZDG A;  1I1E A;  3AJ6 A;  1ABR B;  1P63 A;  2D20 A;  2VXT I;  1ILR 1;  2IHO A;  2Q3N B;  2WE9 A;  1HKN A;  5BP5 A;  4ION A;  2AEC A;  2FYA A;  2ESU A;  4ZOT A;  2QH5 A;  3CGX A;  3A21 A;  4MND A;  4Y7F A;  1EZI A;  4Y62 A;  3T7O A;  4AC3 A;  1BFF A;  4DE7 A;  2D7R A;  3HMY A;  3V0B A;  1FXO A;  7I1B A;  4P02 A;  4I6I A;  1V84 A;  4B2W A;  3RMY A;  1PWA A;  4OWL A;  4I1B A;  2YUG A;  3N7L A;  2FY7 A;  2K4A B;  3I2X A;  2X65 A;  5CQL X;  3O3Q A;  4IZX A;  1ISZ A;  3CRI A;  4KPX A;  2ZQN A;  3I0F A;  1YF8 B;  1UPS A;  2RJ6 A;  3D8V A;  3HBW A;  3RTJ B;  4J2K A;  4JRA A;  31BI A;  41BI A;  3H6R A;  3BAV A;  2NP0 A;  2BO6 A;  3HL3 A;  5CMG X;  4I4R A;  2D22 A;  1FRW A;  2Y4K A;  3HSM A;  1H5S B;  2VU9 A;  1S0C A;  3I0I X;  2P23 A;  1Q03 A;  4X38 A;  3CKV A;  4AYL A;  4R6U B;  4H9W A;  3UD8 A;  1G2V A;  1TP0 A;  1AVW B;  3CA6 A;  3WO2 A;  2RJ8 A;  1ZCV A;  1G82 A;  1Q04 A;  3CAH A;  1FGA A;  2L5X A;  3IM6 A;  4I1E A;  4D8H A;  1FO8 A;  1R80 A;  3Q4S A;  1TTU A;  2ERM A;  1EYR A;  4LO2 A;  1NQI B;  2VFZ A;  3E8L C;  1G97 A;  2MLL B;  1W3A A;  5DVH A;  5G00 A;  4FRL A;  3AH1 A;  3ZGG A;  1YP2 A;  5C8R A;  1DZC A;  1ZJ0 A;  4JKQ A;  1DZD A;  2FDB M;  4KNR A;  3BA4 A;  3PKQ A;  1AVU A;  3CA4 A;  2W0W A;  3BRG C;  2RJ4 A;  2QKX A;  2Y4J A;  4XKI A;  2VXL A;  3CA0 A;  5HPZ A;  3FJE A;  4G1R A;  4X3A A;  4EKX B;  2WRY A;  3IOI A;  5CMJ A;  1WD3 A;  1OMX A;  1WSZ A;  4P0K A;  1AFC A;  1PZZ A;  3WO3 A;  3V0P A;  1GQC A;  4CVH A;  1MC9 A;  4YOL A;  3T7M A;  1TWE A;  6I1B A;  1TOO A;  4QC4 A;  2D23 A;  5IDS A;  1ZCY A;  1EPW A;  1H7L A;  3Q7Y A;  4HO3 A;  3V0M A;  1QWJ A;  1DIW A;  4IY8 A;  1ZDF A;  4LO3 C;  1H5S C;  1ISY A;  2JCL A;  3O49 A;  4ARW A;  2Q9X A;  4END A;  2K43 A;  2RJ5 A;  3D5N A;  5D63 A;  3SPT A;  4NAL A;  5CMI A;  2K8R A;  3RMX A;  1S0L A;  3PME A;  3QYD A;  1VZU A;  3IOH A;  1GA8 A;  4HO8 A;  5C48 A;  1ZJ3 A;  3WA1 A;  3S8K A;  4C2S A;  4LO3 A;  1H5S A;  3WIN C;  2Q4J A;  4QKR A;  5BXR A;  1WBC A;  1O7O A;  5AJN A;  1BLD A;  3OH2 A;  1TW1 A;  2RJ1 A;  4DCK C;  4Q91 A;  3U0X A;  3P53 A;  4P6A A;  4QBC A;  1V83 A;  1WT0 A;  2NYY A;  1R7V A;  1NF5 B;  2O1F A;  2I1B A;  1MP3 A;  2OEG A;  4M4K A;  3RMV A;  3P6I A;  2NTD A;  3HAL A;  3UJ0 A;  3WIN A;  4XWI A;  3CU1 B;  3V0N A;  1H7G A;  2AAI B;  2Y9X E;  3AZW A;  5EHA A;  3U2V A;  3POK A;  2E3D A;  1JTC A;  2YC3 A;  1GGP B;  2PX7 A;  2IWT B;  3CKO A;  3U2X A;  3AKH A;  5IFY A;  4FQW A;  3ILA A;  5CQN X;  5F8W A;  5BQU C;  5BXP A;  2VS5 A;  5D62 A;  3FJ9 A;  3HOM A;  2PGY A;  2Z87 A;  4IHZ A;  5C4B A;  2D24 A;  3NBN A;  4KC1 A;  2FGF A;  1ZCT A;  1JQZ A;  2O1H A;  3ZC8 A;  5CMH A;  4M28 A;  4Z9W B;  2D1Z A;  1VGZ A;  4JIS A;  4G9N A;  21BI A;  1VGT A;  4B4B A;  3RSJ A;  4I4U A;  3I0L A;  4B4M A;  5BQU A;  2F2F C;  1GQ9 A;  3UD7 A;  3FJD A;  1TIE A;  2X5S A;  3BRK X;  4MYB A;  3T8S A;  1DJS B;  3BX1 C;  2FYD B;  3BAO A;  2D7I A;  3ZLL A;  3H6Q A;  2HZ9 A;  3POL A;  1NHE B;  4YS8 A;  1G9R A;  3ZF8 A;  1QG8 A;  3O4O A;  2V0I A;  1G93 A;  5L6V A;  2MC2 A;  1G3L A;  4A7Y A;  3C9Z A;  2F2F A;  1RY7 A;  4OEG A;  3FUQ A;  2FO1 A;  4QD2 B;  1BLA A;  2WGZ A;  3V0Q A;  4GAF A;  1INI A;  2OI5 A;  4ZDQ A;  5EJZ A;  1OQL B;  3IM7 A;  1IHK A;  3F1Y A;  1TZF A;  3SX5 A;  1YXW A;  4OWK A;  1R7Y A;  3R4S A;  3OAM A;  5B2H A;  4HO4 A;  1VCL A;  4LO0 C;  4Y64 A;  4FRQ A;  4ISQ A;  1H7T A;  5DSS B;  1R7X A;  1PZT A;  1R82 A;  1K5U A;  3CA5 A;  2RJ7 A;  1JYL A;  1KNM A;  3H6S E;  1YBI A;  4FRP A;  5J49 A;  4OUJ A;  1EVT A;  2ZR1 B;  1V82 A;  2WAW A;  5HS2 A;  2RST A;  4I4P A;  1HIB A;  1FQ9 A;  1TFM B;  4LO0 A;  1YRO B;  2XMH A;  3NBE A;  1FO9 A;  1ZI1 A;  3D98 A;  4A7Z A;  3V0O A;  5F8S A;  5C4C A;  1AVX B;  1OMZ A;  3A23 A;  1WT3 A;  5BVP I;  4GBP A;  1W3F A;  3UJ4 A;  4Y9X A;  2VXR A;  3U0Y A;  2AH9 A;  1Z4S A;  2RQ9 A;  4B4G A;  1IOB A;  1R7T A;  2VXM A;  4FRA A;  5FV9 A;  1VZX A;  2FFV A;  5EC5 A;  3SX8 A;  1WBA A;  2RIZ A;  3O4B A;  3LW6 A;  2AFG A;  3R2W A;  3OH4 A;  1DQG A;  1JT3 A;  3NBC A;  3PUB A;  4Q9G A;  5DZU A;  1W77 A;  1DQO A;  4QD2 C;  2D0J A;  3I0E A;  1LL0 A;  4NAI A;  4HO6 A;  3OH1 A;  4H04 A;  5BXS A;  1Z90 A;  2UX8 A;  2M49 A;  4PC4 A;  4OW4 A;  4TLP A;  2Y6P A;  4FRH A;  4EE5 A;  1S4P A;  2V0L A;  4USO A;  1HWM B;  1RML A;  1VZT A;  1AF9 A;  3SNV A;  1LZ0 A;  3CKN A;  2NZ9 A;  3FJF A;  3Q7W A;  1ZJ2 A;  1R8N A;  1L2H A;  5DDT A;  2HWA A;  1XG6 A;  2VS4 A;  2P73 A;  2CU2 A;  1MD6 A;  1YTO A;  5FZY A;  1FGG A;  4AYJ A;  1SS9 A;  5C1L A;  1QQL A;  4L41 C;  2Y9G A;  3O4C A;  3BTA A;  4EFP A;  1H3M A;  3VT0 A;  2GZB A;  2HWM A;  4AN6 A;  4ZGR B;  2F8X C;  1HM9 A;  4KNX A;  1QGS A;  1OQM B;  3I0G A;  3OH0 A;  1RG8 A;  1GWW A;  3VT2 A;  4HO5 A;  4JD0 A;  1VH1 A;  2PGV A;  4ASJ A;  1HJL A;  3AH4 A;  3BAH A;  1A8D A;  3FJA A;  1G9A A;  4I7I A;  4P0J A;  4Y6U A;  2Z48 A;  3O4A A;  3OGF A;  2ET2 A;  1G9B A;  3FJJ A;  1XZ6 A;  1W55 A;  2VSE A;  2OI6 A;  4Y63 A;  4I4Q A;  5I1F A;  1LZI A;  2BEA A;  2NVH A;  4Y7U A;  1VGU A;  3I0C A;  5C4E A;  4HO0 A;  4ZA3 B;  4LO8 B;  3K8E A;  1M2T B;  3ZX7 A;  3U2T A;  3OGG A;  4KXO A;  1ISX A;  4IRP A;  5FZU A;  3GUE A;  1BA7 A;  5GAQ A;  3I0D A;  4ISR A;  3R3I A;  5EJ1 A;  2QYI B;  1ZIZ A;  2W0V A;  3EE5 A;  4AAW A;  1EYL A;  1FWY A;  2AM5 A;  4G87 A;  1H4E A;  4BMA A;  1SZ6 B;  3SX7 A;  1S0B A;  3MPP G;  4QAL A;  3A07 A;  1KWS A;  5C47 A;  1ON6 A;  5EG6 C;  1FG5 N;  4KBB A;  4Y7V A;  4EVW A;  3BAQ A;  3NGW A;  5C36 A;  2KKI A;  5BXT A;  5FZZ A;  1FGX A;  1T4Q A;  2P6W A;  2WEE A;  1HV9 A;  1BFB A;  4KEI A;  4I4O A; 
#chains in the Genus database with same CATH topology
 5AJP A;  3VEQ A;  4WW0 A;  4JPZ A;  5C3B A;  1MP5 A;  1NWG B;  4DR4 M;  4IIW A;  4ITQ A;  5E24 E;  2JY8 A;  1H5T B;  3F1R A;  5BOW A;  3RGP A;  1K4V A;  5C4F A;  1IIN A;  3SC3 A;  4UN2 B;  3R4U A;  4F83 A;  2AXM A;  5C18 A;  1QQK A;  1MP4 A;  5DDV A;  2R65 A;  1FWV A;  2JZ0 A;  4FRD A;  3KXE C;  5FYE A;  1KYI A;  3E9S A;  2G5G X;  1QAQ A;  1VPA A;  2BEB A;  2DAG A;  1K5V A;  4ZFU B;  1LL2 A;  3AH2 A;  1QGQ A;  4DV0 M;  1GL7 A;  3A46 A;  3SAW A;  4BBA A;  4CJ8 A;  4HL4 A;  4IYB A;  1N78 A;  4HO2 A;  1SR4 C;  2DEN A;  3WMV A;  2EA0 A;  3N7K A;  3LTQ A;  5E6J A;  2D44 A;  3BCV A;  1OQY A;  1V6U A;  4GAI A;  1H7H A;  1T3T A;  4IZE A;  2LH0 A;  3D7W B;  1JYK A;  5EXS A;  3I0J A;  1TVY A;  1IIL A;  1NVM A;  1PJT A;  1Q39 A;  3QR5 A;  2YNM D;  3TPZ A;  2X5Z A;  3I0H A;  3JUJ A;  4OEF A;  3ZXD A;  1G8P A;  1JLX A;  5FTS A;  4I4X A;  1IXS A;  1JVD A;  4LF9 M;  3O4D A;  3IOJ A;  1NZK A;  3E4R A;  3AL0 C;  2OOA A;  4X37 A;  2ERC A;  3TQS A;  4KC4 A;  4MH0 E;  4O6M A;  1D2N A;  4AKH A;  3D8L A;  4LF6 M;  2RG9 B;  2OQ4 A;  2VQF M;  3SXB A;  2H1R A;  2Y9F A;  4DEP A;  4IRQ A;  1EE8 A;  5JQQ A;  2MH8 A;  4R7G A;  3SAR A;  1G8O A;  1JR3 E;  1QZE A;  1I52 A;  1Q1U A;  1ZI4 A;  3H4M A;  3V0A A;  4ANR A;  3V76 A;  4Y6N A;  3U5Z A;  1IN5 A;  2Y7A A;  1Q3C A;  2APL A;  1XNR M;  3FUV A;  2CV1 A;  1YE9 A;  1S0F A;  3PHZ A;  4ZKT B;  2JZ1 A;  3UD9 A;  2JXN A;  2YQH A;  3CA1 A;  4IBG A;  4S12 A;  2AQZ A;  2KZS A;  3FUX A;  4NXN M;  4LGM A;  2MIB A;  2ZQO A;  4K6R A;  4MGY E;  2DRE A;  1NMM B;  4FWH A;  3I4V A;  1XHB A;  4ZFW B;  5CQP A;  4II0 A;  1XNQ M;  4W5W A;  3L29 A;  3AJI B;  3V8Y A;  4AN7 B;  3W9T A;  4BQH A;  1QUS A;  4QOZ C;  5BXC A;  3M0E A;  2J0A A;  3PNN A;  1Q02 A;  4QKS A;  1HWN B;  4G9M A;  5A2Q S;  2YCM A;  2I7P A;  3FJ8 A;  1ITB A;  4L4I A;  1Z0H A;  2KI6 B;  1N32 M;  2BO7 A;  4FRO A;  1V6W A;  4IBC A;  3BRF A;  4JV5 M;  3Q80 A;  3FJH A;  4I5S A;  5AJO A;  1DFC A;  4M2B A;  2WVM A;  2JCJ A;  3SHF A;  4K0K M;  1LTM A;  1HCE A;  4LJ7 A;  1FV3 A;  3OJ2 A;  4G4N A;  2F5Q A;  3J80 S;  3V79 C;  2BWB A;  1IN8 A;  2VSI A;  3FTD A;  1R2Y A;  3FTE A;  1YP4 A;  4JQ0 A;  2K9D A;  1II4 A;  2F5O A;  4L4U A;  1W57 A;  2KRK A;  2NQ8 C;  3KS8 A;  2HKJ A;  4FRM A;  5FU8 A;  3KIA A;  3A45 A;  1ZI3 A;  2XME A;  4LW3 A;  1FOA A;  3FTC A;  4D11 C;  3SXD A;  2RGO A;  2V6Z M;  2FH0 A;  4J2Y A;  3WMU A;  3U2U A;  4LCB A;  4KT7 A;  3KSJ A;  4LF5 M;  5EJC A;  2C96 A;  2RIT A;  3NJ5 A;  4FVV A;  2EUC A;  3Q8G A;  1ZDG A;  4IBJ A;  2D20 A;  2VXT I;  3EIH A;  3DUV A;  5BP5 A;  2ESU A;  3MHV C;  3CGX A;  4MND A;  4AC3 A;  4DE7 A;  1BFF A;  3HMY A;  1FXO A;  1OIZ A;  1QAM A;  3RMY A;  2FY7 A;  5CQL X;  1VDD A;  2C5R A;  2ZQN A;  2C0N A;  3I0F A;  1UPS A;  3D8V A;  3U6C A;  4OVZ B;  3RTJ B;  2KXE A;  3H6R A;  3HL3 A;  4IBI A;  2LNH C;  3HSM A;  1IN7 A;  4LJ4 A;  4H9W A;  2G8L A;  2RJ8 A;  1OAO C;  1ZCV A;  1SXJ D;  3CAH A;  1Q04 A;  1FO8 A;  1ZMU A;  3Q4S A;  1TTU A;  4IBF A;  4LO2 A;  1NQI B;  4FRL A;  4GHA A;  1XC8 A;  1YP2 A;  1DZC A;  1ZJ0 A;  4JKQ A;  1AVU A;  1HNX M;  2RJ4 A;  1XXH E;  1MJG M;  5HPZ A;  4II7 A;  3HY5 A;  3C58 A;  1WJ7 A;  1QVR A;  3NBX X;  5IDS A;  3PXG A;  2OPF A;  3Q7Y A;  3W67 A;  2WSF F;  2XSZ D;  1NSF A;  4YY3 M;  4DBG B;  4AKG A;  1S0L A;  4PDI A;  4JN6 A;  3WA1 A;  4LO3 A;  1WBC A;  1OAI A;  4AQY M;  4AG5 A;  4Q91 A;  4DR2 M;  3P53 A;  4P6A A;  1WT0 A;  1V83 A;  2VDB B;  1R7V A;  3RMV A;  1MP3 A;  5ITX A;  3WIN A;  3HJ8 A;  4A3V B;  3DOA A;  1IN6 A;  2Y9X E;  3AZW A;  3U2V A;  3GLF B;  3RGS A;  1GGP B;  2PX7 A;  2IWT B;  3CKO A;  3U2X A;  3AKH A;  4FQW A;  5BQU C;  2Z87 A;  2ZTD A;  5C4B A;  3HOM A;  1SXJ B;  1J5E M;  2O1H A;  3ZC8 A;  3VDP A;  2VQE M;  4B3M M;  1VGT A;  4B4B A;  3RSJ A;  2XF3 A;  3I4Y A;  5FLX S;  3T8S A;  2FYD B;  3BX1 C;  3H4J A;  3BAO A;  3GLG A;  4LZJ A;  1QG8 A;  2V0I A;  4A7Y A;  1OKS A;  3C9Z A;  5EP1 A;  4OEG A;  2FO1 A;  1BLA A;  2WGZ A;  4GAF A;  5JI3 E;  3SX5 A;  4OWK A;  2DAM A;  5B2H A;  1Z6T A;  3U60 B;  4LJ6 A;  5IWA M;  1R82 A;  1K5U A;  3FUT A;  4DR5 M;  4XK8 F;  3H6S E;  2LXE A;  1TH3 A;  3B7Q A;  4OUJ A;  5J49 A;  1V82 A;  3D98 A;  2KA6 B;  3V0O A;  1FO9 A;  2HCB A;  3A23 A;  5BVP I;  4Y9X A;  3UJ4 A;  4F2L A;  2AH9 A;  4WUR A;  2RQ9 A;  4CIZ A;  4FRA A;  3KOX E;  3OTO M;  2AFG A;  3AOG A;  2H5X A;  3R2W A;  4RF0 A;  3OH4 A;  1DQG A;  4Q9G A;  4LRT A;  3IHP A;  2D0J A;  4NAI A;  4LGY A;  2JP7 A;  4HO6 A;  4NRW A;  4H04 A;  5BXS A;  2M49 A;  1XWI A;  4TLP A;  4FW9 A;  1HQC A;  2QQ8 A;  1HWM B;  4Z6Y A;  1LZ0 A;  1ZJ2 A;  4AI6 A;  1L2H A;  5DDT A;  2VS4 A;  1MD6 A;  2BWE A;  5FZY A;  1FGG A;  1ZQ9 A;  3TWM A;  1QQL A;  4EFP A;  1TF0 B;  4AN6 A;  4KNX A;  1OQM B;  3TWK A;  3FKE A;  3I0G A;  4HO5 A;  4JD0 A;  2PGV A;  5JI2 E;  3U61 A;  3BAH A;  1A8D A;  3FJA A;  4DV2 M;  4I7I A;  4P0J A;  5FU0 A;  3O4A A;  3FJJ A;  3SYL A;  2OO9 A;  1WXQ A;  3ZQJ A;  1N34 M;  4JI1 M;  5DYI A;  4HO0 A;  2KNV A;  3ZX7 A;  5EJ1 A;  4LFC M;  2CUZ A;  3MPP G;  1JR3 A;  1NNJ A;  4Y7V A;  3BAQ A;  4D80 A;  3NGW A;  5BXT A;  5FZZ A;  1NY6 A;  1Y8G A;  1FGX A;  2WEE A;  2C9O A;  2M5Z A;  3I04 M;  3MJ5 A;  4YS8 A;  3GRR A;  4I4O A;  4I2S A;  4KC3 A;  3V0L A;  2XLJ A;  4DDZ A;  1CUK A;  2VSA A;  2RRU A;  3C3E A;  1DV0 A;  1ISV A;  4B3S M;  2K0B X;  2NXV A;  3F1C A;  4X39 A;  3THG A;  1AVA C;  1XMO M;  3MAL A;  1KFV A;  2KDL A;  4RNA A;  5FNW A;  3T38 A;  4G4Q A;  2A8U A;  1R4G A;  4I4V A;  4JI0 M;  4GKJ M;  2E8B A;  1T9F A;  1L8Q A;  3FGM A;  2QGI A;  3HU2 A;  1UFZ A;  1H4C A;  2AES A;  1X37 A;  3OJM A;  2VS3 A;  1ZMV A;  2Y4L A;  2NS2 A;  1PJQ A;  3BAG A;  3USQ A;  5FTV A;  4G6M A;  4EFR A;  4I0Y A;  1TW5 A;  4EB2 B;  4HA2 A;  3GLF E;  4ZBV B;  1GAB A;  1OIP A;  4P17 A;  1GKI A;  3U6L A;  3RMW A;  1W5T A;  1SXJ E;  4KO8 A;  1ONK B;  4KEJ A;  3C3D A;  3AKF A;  2DVW B;  3T15 A;  5JMC A;  3HGI A;  3M6A A;  1JT7 A;  1JVG A;  3LQR A;  1H7Q A;  4R7P A;  3P6J A;  1C1K A;  2DAI A;  4HJJ A;  2E4M C;  1LZJ A;  2JY6 B;  3KDS E;  1R2Z A;  1R7U A;  2OI7 A;  3JTJ A;  3V8Z A;  1BFG A;  1G0R A;  5JLV A;  2R4E A;  2DS0 A;  4M2A A;  4LO7 B;  3GLH E;  3ST8 A;  3AKG A;  3TZT A;  2X4A A;  2MZB A;  3TE6 A;  5D91 A;  3V91 A;  3BAD A;  3OJV A;  3NBI A;  1VQ1 A;  3BA5 A;  4WBC A;  3O44 A;  2O25 A;  3KOZ E;  4Y7G A;  4AKI A;  3N9W A;  4GIT A;  3VT1 A;  3IIR A;  4IBD A;  3IAG C;  2KLL A;  1NKH B;  5ITR A;  4M0D A;  1G9C A;  3WO4 A;  1G9D A;  2Z49 A;  3ZLK A;  3B9U A;  1J7K A;  3OBT A;  1GX4 A;  2YQJ A;  2RJ0 A;  4BB9 A;  4LO7 C;  3CA3 A;  4NC6 A;  3K1X A;  3ZCB B;  1D0M A;  4DUZ M;  3GQ5 A;  1H7E A;  1XMQ M;  4R3D A;  2E5L M;  4EEG A;  3A22 A;  2X2T A;  1ZJO A;  3MMP A;  1JT4 A;  3SMP A;  4ASY A;  1V33 A;  3TC2 A;  4EEM A;  4LY6 A;  1PC8 B;  5IT9 S;  2UUA M;  1NY5 A;  3O3P A;  4MB7 A;  4GP3 A;  2VSH A;  3SYK A;  2V0H A;  4DUY M;  3QYB A;  1H4D A;  3GQ3 A;  1LV7 A;  1J0S A;  3SXE A;  2AHM A;  3OGZ A;  3E21 A;  3D8B A;  3L28 A;  1MU5 A;  2AM3 A;  3HWS A;  1PUM B;  3WHK A;  1IJT A;  4I4S A;  3OKR A;  1G41 A;  4IBE A;  4WP2 A;  4QO3 A;  3KVW A;  4ZLB B;  1XXH A;  3E46 A;  5IDT A;  2DRZ A;  3BAU A;  3FJK A;  1HJJ A;  4USP A;  3FJC A;  4BLC A;  2ZTC A;  1QYR A;  3AJ5 A;  5C3A A;  2CHG A;  3CQA A;  3FUO A;  4LO1 C;  3I01 M;  2LIE A;  2RGH A;  1VEK A;  4FWG A;  1R8O A;  4DR3 M;  3K2L A;  3ZC7 B;  1G95 A;  3T6P A;  4JI6 M;  1H5R B;  1S0E A;  2Y9W C;  4CGY B;  1IT0 A;  1GLN A;  3PG0 A;  2ZU8 A;  2KI4 A;  2I7B A;  1DGG A;  4LFA M;  1HM0 A;  2X60 A;  2KEB A;  2AE7 A;  3V0B B;  1H5S D;  5FTM A;  3BRD A;  4LF4 M;  3FFZ A;  3K9P A;  2BO8 A;  1UM8 A;  4LJ9 A;  4AW4 A;  3L26 A;  3RSB A;  4GKK M;  1VEG A;  5C1H A;  1WT1 A;  3N7J A;  2C98 A;  2CWB A;  2MRO B;  4DR6 M;  9ILB A;  4ZFY B;  4DR7 M;  2X8A A;  3E25 A;  1ON8 A;  2HHH M;  3OC9 A;  1NJG A;  4G4R A;  4FGF A;  3CF6 E;  4KEI A;  1Z5B A;  3CKQ A;  4D11 A;  5F8Y A;  5FNX A;  1I1E A;  3AJ6 A;  2WE9 A;  3TWL A;  5C1G A;  2B3T A;  1FJG M;  5IRE B;  3VK7 A;  4Y7F A;  1IY2 A;  1EZI A;  4Y62 A;  3T7O A;  3KP1 E;  4MGK E;  4P02 A;  4I6I A;  1V84 A;  3PNY A;  1PWA A;  4OWL A;  2X65 A;  2K4A B;  3I2X A;  1P3Q Q;  4IZX A;  2F5N A;  4KPX A;  2QZ4 A;  1YF8 B;  3VDU A;  4J2K A;  31BI A;  2BO6 A;  2NP0 A;  3A42 A;  2R45 A;  2D22 A;  1H5S B;  2VU9 A;  3CKV A;  1G2V A;  3CA6 A;  2WSE F;  1G82 A;  4I1E A;  2L5X A;  1FGA A;  1F4I A;  1R80 A;  4LJ8 A;  1EYR A;  3E8L C;  1G97 A;  4X65 M;  5C8R A;  2DZL A;  2FDB M;  3CA4 A;  4XKI A;  2VXL A;  3FJE A;  2F5S A;  1TOO A;  2VF8 A;  5ITU A;  2D23 A;  4B08 A;  3R8F A;  1H7L A;  4HO3 A;  5H37 D;  2JCL A;  1H5S C;  1QDR A;  2RJ5 A;  2K43 A;  3D5N A;  2UUB M;  4OVZ A;  2UUC M;  4Z8X A;  5FTK A;  3QYD A;  3IOH A;  5C48 A;  3DZD A;  4C2S A;  3S8K A;  4QKR A;  5BXR A;  4GC5 A;  4KT0 F;  1BLD A;  5EP2 A;  4HLQ A;  1HR0 M;  2VS5 A;  2O1F A;  2OEG A;  1NF5 B;  3CF0 A;  3HAL A;  2FOI C;  4CHT B;  3V0N A;  1H7G A;  2CHQ A;  5EHA A;  5C1B A;  3POK A;  2BNK A;  2YC3 A;  5E26 A;  4R71 A;  2XEP A;  4FWD A;  5IFY A;  4ZPX A;  2LVA A;  3HJS A;  5LMN M;  5D62 A;  2PGY A;  1DGF A;  1ZCT A;  2DWM A;  4M28 A;  4Z9W B;  4B3R M;  1YSY A;  5BQU A;  3KP0 E;  4NOO B;  3FJD A;  1TIE A;  2X5S A;  4MYB A;  1E9R A;  3SFZ A;  3ZLL A;  2D7I A;  1NO1 A;  3H6Q A;  1NHE B;  1G9R A;  3UGJ A;  1FNN A;  1G3L A;  1T6O A;  2MR9 A;  2J7N A;  2QCU A;  1RY7 A;  3ZH9 B;  5EJZ A;  1OQL B;  3HU1 A;  3F1Y A;  4FIX A;  3OAM A;  4HO4 A;  4LO0 C;  3R9X B;  5FTN A;  5DSS B;  1TR8 A;  3HHY A;  1E9S A;  1KNM A;  1YBI A;  3GLF A;  2RST A;  3T7M A;  5C4C A;  4A7Z A;  3IG8 A;  5F8S A;  3FTF A;  4GBP A;  3U0Y A;  1SXJ A;  1R7T A;  2VXM A;  5FV9 A;  2FFV A;  1WBA A;  3O4B A;  2CHV A;  3SAV A;  4H75 A;  3NBC A;  5DZU A;  1LL0 A;  4CJ6 A;  4EE5 A;  4I81 A;  4USO A;  1RML A;  1VZT A;  3GLH A;  3CKN A;  3Q7W A;  1ZMW A;  5DNY A;  2CE7 A;  2CRU A;  2HWA A;  1XG6 A;  2Z3X A;  2XSZ A;  1YTO A;  3U60 A;  5C1L A;  2JNH A;  2P5T A;  2Y9G A;  2A5Y B;  4LF7 M;  1JB0 F;  3OH0 A;  1RG8 A;  1GWW A;  5D92 A;  2XH9 A;  3LVV A;  4M9X A;  4LF8 M;  3PVS A;  3OGF A;  3B7Z A;  1XZ6 A;  7CAT A;  1W55 A;  4GEW A;  1HT1 E;  4QHS A;  2OI6 A;  4Y63 A;  1MN3 A;  4I4Q A;  3BOS A;  4Y7U A;  1DO2 A;  1VGU A;  3I0C A;  2R0I A;  5C4E A;  3HHZ A;  3K8E A;  3EIE A;  3FUW A;  1PJS A;  5BR8 M;  4L15 A;  2QYI B;  2W0V A;  2XZF A;  1WHC A;  1EYL A;  4G87 A;  1Z59 A;  1S0B A;  2I7N A;  3A07 A;  3SAT A;  5C47 A;  5KPT A;  5EG6 C;  2KKI A;  1T4Q A;  1BFB A;  3B74 A;  1YP3 A;  2KNA A;  4IY9 A;  5C4D A;  1BFC A;  3JR4 A;  2JCO A;  2BJW A;  1RZO B;  3VUO A;  5ITQ A;  1PM5 A;  4G6J A;  3VWC A;  4KPZ A;  1H7F A;  4JXJ A;  2JCK A;  4IJF A;  4GOY A;  3GRV A;  3SXG A;  1IM2 A;  2BO4 A;  1S0G A;  1M16 A;  1G23 A;  5FUH A;  3W0L B;  1V92 A;  2X2S A;  2F5P A;  4LFB M;  4JAW A;  1F31 A;  4UEG A;  1FWU A;  4MM3 B;  1ZI5 A;  4GOV A;  1V6V A;  2XGN A;  1VGW A;  3N0K A;  3U6M A;  2Z86 A;  4GC9 A;  2L4F A;  2FYC B;  4L8R C;  4EEE B;  4FRE A;  1D0H A;  4A7K A;  2VLC A;  3I2A A;  3FRI A;  4Q9P A;  4G3O A;  4HG6 A;  1V6X A;  2PA4 A;  4ECM A;  3I0K A;  3CKJ A;  3K8D A;  4HO9 A;  4P00 A;  3SMS A;  2KZU A;  4YHH M;  3K8Z A;  1K82 A;  4JKX B;  2HAK A;  2ZU7 A;  2E4M A;  4XGI A;  1JV1 A;  2DRY A;  1DO0 A;  2GGQ A;  1WIV A;  4GMQ A;  5BP5 C;  4B7G A;  4KEK A;  4J2X A;  4G4O A;  1SG9 A;  2GO2 A;  1NHW C;  1ISW A;  4XFT A;  2DWN A;  2R46 A;  2HW9 A;  4JI4 M;  5CQO A;  3GRU A;  1FR9 A;  1YYN A;  5D61 A;  1NUN A;  1N4K A;  1VEJ A;  3HKP A;  1KSF X;  1I1B A;  1Z5C A;  1L2D A;  1TWM A;  4I37 A;  2Z8Y M;  3MK6 A;  1VG5 A;  3BXW A;  3L27 A;  1TH4 A;  3AOE C;  2ZU9 A;  4I8M A;  4NSO B;  1WGN A;  4LO2 C;  2R18 A;  1O23 B;  1PJI A;  3U2W A;  3VKH A;  1VDL A;  3USR A;  1R6B X;  3UDA A;  3FWW A;  4EEO A;  5C49 A;  2QBY A;  3SAS A;  1LVW A;  2YQC A;  1XYF A;  2V0K A;  4LJA A;  3AZV A;  3BA7 A;  4XFS A;  4Y28 F;  2R9K B;  5EIY A;  3B7N A;  5FTL A;  3FJI A;  3SBJ A;  5CQM X;  3O5W B;  4G3Q A;  1CVS A;  2RIX A;  4OW0 A;  5KPZ A;  2EKF A;  3LQQ A;  1L2B A;  2ICY A;  1QAO A;  4KHP M;  1HM8 A;  4B3U A;  2V0J A;  5ITY A;  3T7N A;  1G1L A;  4J18 A;  4HCQ A;  3GLG B;  1FMM S;  3SXC A;  5KO3 A;  4DV4 M;  3J7B A;  2Y0T A;  3FRH A;  2HWJ A;  3ZXG A;  4DV3 M;  2RJ9 A;  2W82 A;  4EFQ A;  2YQZ A;  4QHT A;  3QAU A;  4IJE A;  4OEE A;  3I29 B;  1IBL M;  3VSF A;  4FCE A;  2C99 A;  3FJB A;  3VSZ A;  3SXA A;  2L7H A;  3E26 A;  2LVN C;  3LLP A;  4DEC A;  1GJS A;  4QNR A;  3EF2 A;  2EO2 A;  2Z4S A;  5KPR A;  2CFO A;  3UMM A;  1R81 A;  1CE7 B;  2L2D A;  2CV0 A;  4JP0 A;  1IRA X;  2WVK A;  4Z8S B;  2DNA A;  3B89 A;  3JUT A;  1GVN A;  4LO1 A;  1ZJ1 A;  3Q7X A;  2YQS A;  1ZCU A;  4QBV A;  4CJB A;  4G3S A;  2DWL A;  3QVB A;  4EE4 A;  3LVW A;  4OWJ A;  4D0T A;  1E94 E;  5DYG A;  3RTI B;  2Y0Q A;  4QNM A;  4EE3 A;  2L4E A;  3AKZ A;  1H5T A;  1FR8 A;  1SR4 A;  1HNW M;  1GJT A;  2I5K A;  2L6O A;  1AXM A;  2DAK A;  2Y20 A;  2BFH A;  2CEA A;  2AGD A;  1AUA A;  5LMU M;  1IRP A;  2UXB M;  3DJ4 A;  1H6U A;  1FZW A;  1JV3 A;  1VIC A;  2XWM A;  3TQD A;  1E5K A;  3T1Y M;  2O1G A;  3U61 B;  3KSX A;  2CP8 A;  1G3I A;  4HR6 C;  1H5R A;  4FRB A;  5EXP A;  1PGY A;  1ABR B;  1ILR 1;  2Q3N B;  2FYA A;  2QH5 A;  4ZOT A;  5EQT A;  5F3W A;  2LVQ D;  3V0B A;  4IBK A;  7I1B A;  1QUT A;  2G3Q A;  3KOY E;  2LHC A;  4I1B A;  2OOB A;  2YUG A;  3N7L A;  4OX9 M;  4LZZ A;  4NRV A;  3CRI A;  3PNV A;  2RJ6 A;  3LMM A;  4JRA A;  3BAV A;  4JI3 M;  1L2C A;  1FRW A;  2Y4K A;  1S0C A;  2XFT A;  3I0I X;  2P23 A;  4X38 A;  4AYL A;  1N36 M;  3LW5 F;  3WO2 A;  2R44 A;  3IM6 A;  3M7G A;  3GPP A;  4D8H A;  1NV9 A;  2VFZ A;  5G00 A;  3AH1 A;  1I94 M;  1OFH A;  3BA4 A;  2W0W A;  3VFD A;  3BRG C;  3T1H M;  1TGU A;  3IOI A;  4EKX B;  3U6O A;  3U6S A;  1WD3 A;  1OMX A;  1GQC A;  1MC9 A;  3HHX A;  2LTU A;  1TWE A;  2WZJ A;  4JYA M;  4QC4 A;  5FSW A;  4LRS A;  1ZCY A;  4P16 A;  3V0M A;  2XZU A;  1DIW A;  1QWJ A;  1ZDF A;  1ISY A;  2Q9X A;  2DHY A;  4NAL A;  2K8R A;  3RMX A;  5FTJ A;  1VZU A;  3K92 A;  1H5S A;  2Q4J A;  4TUW A;  4X66 M;  3OH2 A;  4DV6 M;  1TW1 A;  4DCK C;  3U0X A;  4QBC A;  2ZBK B;  1HNZ M;  2KRU A;  1NJF A;  3CU1 B;  2AAI B;  3SAU A;  2D7E A;  1JTC A;  3U6E A;  2VII A;  4B3T M;  1DGH B;  4NSR A;  3GLG E;  5CQN X;  5BXP A;  3FJ9 A;  4IHZ A;  2D24 A;  3NBN A;  2FGF A;  1S3S A;  5CMH A;  1E32 A;  2D1Z A;  3I0L A;  2EKK A;  2F2F C;  3JR5 A;  1BVS A;  3GLI B;  1DJS B;  1NV8 A;  2HZ9 A;  3O4O A;  5L6V A;  2MC2 A;  1G4A E;  2FNA A;  3FUQ A;  4QD2 B;  2DKL A;  4CIS A;  2OI5 A;  3IM7 A;  4MIX A;  1IHK A;  1TZF A;  2Z7J A;  1YXW A;  1R7Y A;  2K47 A;  4Y64 A;  4B7H A;  3IEC A;  1R7X A;  4Q7J A;  2Q2E B;  3J81 S;  4FRP A;  2ZR1 B;  2WAW A;  1G71 A;  2VF7 A;  4LO0 A;  1FQ9 A;  1TFM B;  2XMH A;  1IBK M;  2LHG A;  4PCZ A;  1OMZ A;  2D7H A;  2VXR A;  2X49 A;  1Z4S A;  4MZH A;  1Q3B A;  2DZN B;  3K9O A;  3TL4 X;  1VZX A;  5EC5 A;  3LW6 A;  3PUB A;  3LCV B;  1W77 A;  4QD2 C;  3I0E A;  3B9P A;  2DAE A;  1Z90 A;  2EJS A;  4OW4 A;  1ZV1 A;  2JA2 A;  3KOW E;  1AF9 A;  1Z5A A;  4FIY A;  1D0L A;  2YR0 A;  4AYJ A;  1SS9 A;  4L41 C;  3O4C A;  3I51 A;  3VT0 A;  2GZB A;  2HWM A;  2N35 A;  2F8X C;  1HM9 A;  1TDH A;  3VT2 A;  2UXD M;  1XXH B;  2ZAO A;  3AH4 A;  1G9A A;  1HJL A;  2Z48 A;  2D7G A;  2O01 F;  5EP3 A;  4PDG A;  1HJP A;  2J7O A;  4ZA3 B;  4LO8 B;  1M2T B;  3HU3 A;  3U2T A;  4MGZ E;  1HQY E;  4JI7 M;  4ISR A;  3J27 B;  1ZIZ A;  3EE5 A;  1IN4 A;  4AAW A;  2AM5 A;  3SX7 A;  1R7R A;  4QAL A;  2VK9 A;  5BPV A;  4Q7C A;  2FE8 A;  2Z4R A;  1ON6 A;  4KBB A;  3HZJ A;  4DV7 M;  1D0K A;  2P6W A;  1EFU B;  2GGO A;  1IY0 A;  5L8R F;  1FV2 A;  1E0O A;  2LVP C;  2DXI A;  3CRH A;  3RFW A;  1QQW A;  3OH3 A;  2FYB A;  3JUK A;  1GX0 A;  2VUA A;  1FN0 A;  8I1B A;  3JRR A;  2DI0 A;  5DFL A;  3NBD A;  1HWP B;  4JI2 M;  2UUS A;  4DR1 M;  3HN1 A;  2R62 A;  2Y4M A;  1S0D A;  2XOA A;  3VK8 A;  3N7M A;  3SX3 A;  4F34 A;  1IXS B;  3ZGF A;  3GPY A;  3Q7U A;  1MC3 A;  2NM1 A;  2D43 A;  2JWS A;  4DEN A;  3JAM S;  3KW6 A;  4RKU F;  1WT2 A;  4I96 A;  2QN4 A;  2DPW A;  2BJV A;  4FCT A;  4HEO A;  1FXJ A;  1W5S A;  2WBC A;  1S4O A;  3UJN A;  1DFQ A;  1JY0 A;  2R6F A;  3PFI A;  2XWL A;  4LG2 A;  3GLI E;  3ILK A;  1N77 A;  2AM4 A;  4G6Z A;  4I4Y A;  3GP1 A;  2XWN A;  2LIQ A;  3V0A B;  3VLF B;  3BBZ A;  3U5Z B;  4E1K A;  2M60 A;  4EIW A;  3BB2 A;  2I5E A;  3DK5 A;  3KMV A;  5DUY A;  4MZF B;  4DV5 M;  2R4J A;  3IM5 A;  3V90 A;  1MX0 A;  4M9Z A;  4GRI A;  2DWZ B;  3GPU A;  2UXC M;  4XFU A;  4G3P A;  1HCD A;  2APC A;  4FCU A;  2ZAM A;  1W3G A;  3F62 B;  4CJM A;  2A8W A;  4KRV A;  1S4N A;  4EEA A;  3CGW A;  2FS1 A;  4I4L A;  3ZC9 A;  4B42 A;  2FFU A;  2YFQ A;  2P39 A;  3LCU A;  4J23 B;  1Z2V A;  4KC2 A;  2F4V M;  1VH3 A;  5CMF X;  2OEF A;  1TDZ A;  1JQJ C;  1JLY A;  4RF1 A;  3CRG A;  2WVL A;  3AOE A;  2CV2 A;  3GRY A;  1DLL A;  4GIP A;  3C9P A;  4B2X A;  1L1Z A;  1O0R A;  3OBR A;  2J0B A;  3K1J A;  3PKP A;  4GH9 A;  4CJC A;  5F90 A;  1INJ A;  1FMZ A;  3HX3 A;  1BAS A;  4XBO A;  1BAR A;  4FCV A;  1IFY A;  2ICX A;  4L4H A;  4D48 A;  1G59 A;  4P0L A;  3AKI A;  3L25 A;  3CF2 A;  3GQ4 A;  4GHL A;  3SHG B;  4NAK A;  4FD2 A;  4J2S A;  4F1I A;  1WD4 A;  1JT5 A;  3IG5 A;  2QEN A;  2MGW A;  5I1B A;  2K6B A;  1EV2 A;  3FUU A;  2RKO A;  5KQ8 A;  3L2A A;  5ITT A;  1ZAE A;  2JY5 A;  1WVC A;  4GP0 A;  3FOQ A;  1AIP C;  2V1C A;  1QDT A;  3CU0 A;  1L1T A;  1VM8 A;  2MJ5 B;  2VD4 A;  1QXM A;  2Y21 A;  3QWL A;  1ZJP A;  1NHG C;  4HOC A;  1PUU B;  4D81 A;  3VKG A;  4D0Z A;  1GWV A;  4LW6 A;  2YES A;  1PZY B;  1LZ7 A;  4KQL A;  3U6P A;  4IQP A;  2RIY A;  2J3P A;  1IIM A;  3AV0 A;  3H6R B;  3GLH B;  2KH2 A;  1IY1 A;  1LL3 A;  5C38 A;  3U6D A;  1HWO B;  2P72 A;  3S8J A;  1QAN A;  3WHL A;  1XZZ A;  4NAN A;  1C7Y A;  4IBB A;  2FFJ A;  2KNZ A;  1SXJ C;  4O6N A;  1K3X A;  1DGB A;  2V1U A;  1ZHJ A;  4I3N A;  4Y7T A;  1O7Q A;  4B5B A;  2YC5 A;  5C3D A;  1N33 M;  1P63 A;  5IZ7 D;  2IHO A;  5I1F A;  1HKN A;  2AEC A;  4ION A;  3A21 A;  2XFS A;  2HL7 A;  2D7R A;  5KQD A;  4B2W A;  3UK6 A;  3O3Q A;  3DFZ A;  1ISZ A;  2LVO C;  1IXZ A;  4MGH A;  3HBW A;  4NXM M;  4JI5 M;  41BI A;  1YLA A;  5CMG X;  4I4R A;  3KS4 A;  2C9C A;  1Q03 A;  3UZU A;  4R6U B;  3UD8 A;  1TP0 A;  1IBM M;  1AVW B;  2JUJ A;  4UY4 A;  2L7I A;  2L09 A;  3CTW B;  4X64 M;  2ERM A;  5EXX A;  4AZF A;  2ZAN A;  2MLL B;  4MGI E;  1W3A A;  5DVH A;  3J2P B;  3HHW A;  3ZGG A;  4KNR A;  1DZD A;  3PKQ A;  2QHO B;  3FYC A;  2Y4J A;  1ORY B;  2QKX A;  3CA0 A;  4G1R A;  4X3A A;  5CMJ A;  2WRY A;  2QP9 X;  1WSZ A;  4P0K A;  1AFC A;  1PZZ A;  4L78 A;  3WO3 A;  3HJQ A;  3V0P A;  4CVH A;  4YOL A;  6I1B A;  2DHR A;  4L6V 6;  4PT5 A;  1EPW A;  4IY8 A;  4ARW A;  4LO3 C;  3O49 A;  1IQP A;  4END A;  5D63 A;  3SPT A;  5CMI A;  5GKN A;  3PME A;  4HO8 A;  1GA8 A;  4I8O A;  1ZJ3 A;  3W0F A;  3WIN C;  5AJN A;  1O7O A;  5EXT A;  2RJ1 A;  2NYY A;  1WR1 B;  2I1B A;  4M4K A;  3P6I A;  2NTD A;  1OJL A;  3UJ0 A;  4XWI A;  3A98 B;  1PRB A;  4LJ5 A;  1GO5 A;  2E3D A;  4KLN A;  1T43 A;  2ZM6 M;  5EP4 A;  3ILA A;  5F8W A;  1EIJ A;  3U6Q A;  4QOS A;  4KC1 A;  1JQZ A;  1JR3 D;  1OFI A;  1VGZ A;  4JIS A;  4G9N A;  21BI A;  2QPA A;  4I4U A;  4B4M A;  1V34 A;  1GQ9 A;  3UD7 A;  3BRK X;  3F92 A;  2QSF X;  3POL A;  3ZF8 A;  3FD9 A;  1OTR A;  4D82 A;  1G93 A;  2F2F A;  3V0Q A;  3KFU G;  4OU7 A;  1K3W A;  1INI A;  4ZDQ A;  2LWX A;  2GQF A;  1IXR C;  4B7F A;  3R4S A;  4FCW A;  1VCL A;  1I4W A;  4FRQ A;  4ISQ A;  1H7T A;  1PZT A;  3CA5 A;  2RJ7 A;  1JYL A;  4NL4 H;  1EVT A;  4REZ A;  2LBC A;  1PJJ A;  5L6S A;  5HS2 A;  4I4P A;  1YRO B;  1HIB A;  8CAT A;  3NBE A;  1ZI1 A;  1DGH A;  1NNU C;  2GNO A;  1AVX B;  4M9S A;  1WT3 A;  1W3F A;  1QZM A;  4AG6 A;  4B4G A;  1IOB A;  1XB2 B;  3SX8 A;  2RIZ A;  1GL6 A;  1JT3 A;  2UU9 M;  1YUB A;  1DQO A;  1TH2 A;  2J5Y A;  3GLI A;  2QBY B;  3OH1 A;  2O5R A;  2UX8 A;  4FRH A;  4PC4 A;  2Y6P A;  2KHH A;  3FE3 A;  1S4P A;  4X62 M;  2V0L A;  3SNV A;  2NZ9 A;  3FJF A;  3Q8X A;  3RE8 A;  1R8N A;  2P73 A;  2CU2 A;  1WGL A;  3AFH A;  3BTA A;  1H3M A;  2QNJ A;  4ZGR B;  1QGS A;  1J09 A;  3FYD A;  1R5L A;  3J7A S;  4KOD A;  1VH1 A;  4ASJ A;  4Y6U A;  2ET2 A;  1G9B A;  2VSE A;  2WSC F;  2KW0 A;  1TTE A;  1LZI A;  2BEA A;  2NVH A;  4MZG B;  4FVM A;  4L16 A;  2JY7 A;  3OGG A;  1HT2 E;  4KXO A;  1ISX A;  4IRP A;  4DV1 M;  5FZU A;  3GUE A;  1BA7 A;  5GAQ A;  3I0D A;  3R3I A;  1N75 A;  1FWY A;  5ITX E;  1H4E A;  3DA1 A;  1SZ6 B;  4BMA A;  2DZO B;  1KWS A;  1A5T A;  1FG5 N;  4EVW A;  5C36 A;  4M0W A;  3QYE A;  4PD2 A;  1HV9 A;  1RU3 A;  3NWL A;  3GO8 A;  3W68 A;  3GPX A;  4JI8 M; 
#chains in the Genus database with same CATH homology
 5AJP A;  3VEQ A;  4WW0 A;  4JPZ A;  5C3B A;  1MP5 A;  1NWG B;  4DR4 M;  4IIW A;  4ITQ A;  5E24 E;  1H5T B;  3F1R A;  5BOW A;  3RGP A;  1K4V A;  5C4F A;  1IIN A;  3SC3 A;  3R4U A;  4F83 A;  2AXM A;  5C18 A;  1QQK A;  1MP4 A;  5DDV A;  2R65 A;  1FWV A;  4FRD A;  3KXE C;  5FYE A;  1KYI A;  3E9S A;  2G5G X;  1QAQ A;  1VPA A;  2BEB A;  1K5V A;  4ZFU B;  1LL2 A;  3AH2 A;  1QGQ A;  4DV0 M;  1GL7 A;  3A46 A;  3SAW A;  4BBA A;  4CJ8 A;  4HL4 A;  4IYB A;  1N78 A;  4HO2 A;  1SR4 C;  3WMV A;  2EA0 A;  3N7K A;  3LTQ A;  5E6J A;  2D44 A;  3BCV A;  1V6U A;  4GAI A;  1H7H A;  1T3T A;  4IZE A;  2LH0 A;  3D7W B;  1JYK A;  5EXS A;  3I0J A;  1TVY A;  1IIL A;  1NVM A;  3QR5 A;  1Q39 A;  2YNM D;  3TPZ A;  2X5Z A;  3I0H A;  3JUJ A;  4OEF A;  3ZXD A;  1G8P A;  1JLX A;  5FTS A;  4I4X A;  1JVD A;  4LF9 M;  3O4D A;  3IOJ A;  1NZK A;  3E4R A;  3AL0 C;  4X37 A;  2ERC A;  3TQS A;  4KC4 A;  4MH0 E;  4O6M A;  1D2N A;  4AKH A;  3D8L A;  4LF6 M;  2RG9 B;  2OQ4 A;  2VQF M;  3SXB A;  2H1R A;  2Y9F A;  4DEP A;  4IRQ A;  1EE8 A;  5JQQ A;  4R7G A;  3SAR A;  1G8O A;  1I52 A;  1Q1U A;  1ZI4 A;  3H4M A;  3V0A A;  4Y6N A;  3U5Z A;  1IN5 A;  2Y7A A;  1Q3C A;  3FUV A;  2CV1 A;  1XNR M;  1YE9 A;  1S0F A;  3PHZ A;  4ZKT B;  3UD9 A;  2YQH A;  3CA1 A;  4IBG A;  4S12 A;  2AQZ A;  2KZS A;  3FUX A;  4NXN M;  4LGM A;  2MIB A;  2ZQO A;  4K6R A;  4MGY E;  2DRE A;  1NMM B;  4FWH A;  3I4V A;  1XHB A;  4ZFW B;  5CQP A;  4II0 A;  1XNQ M;  4W5W A;  3L29 A;  3AJI B;  3V8Y A;  4AN7 B;  3W9T A;  4BQH A;  4QOZ C;  5BXC A;  3M0E A;  2J0A A;  3PNN A;  4QKS A;  1HWN B;  4G9M A;  5A2Q S;  2YCM A;  2I7P A;  3FJ8 A;  1ITB A;  4L4I A;  1Z0H A;  2KI6 B;  1N32 M;  2BO7 A;  4FRO A;  1V6W A;  4IBC A;  3BRF A;  4JV5 M;  3Q80 A;  3FJH A;  4I5S A;  5AJO A;  1DFC A;  4M2B A;  2WVM A;  2JCJ A;  3SHF A;  4K0K M;  1HCE A;  4LJ7 A;  1FV3 A;  3OJ2 A;  4G4N A;  2F5Q A;  3J80 S;  3V79 C;  1IN8 A;  2VSI A;  3FTD A;  1R2Y A;  3FTE A;  1YP4 A;  4JQ0 A;  1II4 A;  2F5O A;  4L4U A;  1W57 A;  2KRK A;  2NQ8 C;  3KS8 A;  2HKJ A;  4FRM A;  5FU8 A;  3KIA A;  3A45 A;  1ZI3 A;  2XME A;  4LW3 A;  1FOA A;  3FTC A;  4D11 C;  3SXD A;  2RGO A;  2V6Z M;  3U2U A;  4J2Y A;  3WMU A;  4LCB A;  4KT7 A;  3KSJ A;  4LF5 M;  5EJC A;  2C96 A;  2RIT A;  3NJ5 A;  4FVV A;  2EUC A;  1ZDG A;  4IBJ A;  2D20 A;  2VXT I;  3EIH A;  3DUV A;  5BP5 A;  2ESU A;  3MHV C;  3CGX A;  4MND A;  4AC3 A;  4DE7 A;  1BFF A;  3HMY A;  1FXO A;  1QAM A;  3RMY A;  2FY7 A;  5CQL X;  1VDD A;  2C5R A;  2ZQN A;  2C0N A;  3I0F A;  1UPS A;  3D8V A;  3U6C A;  4OVZ B;  3RTJ B;  2KXE A;  3H6R A;  3HL3 A;  4IBI A;  2LNH C;  3HSM A;  1IN7 A;  4LJ4 A;  4H9W A;  2G8L A;  2RJ8 A;  1ZCV A;  1SXJ D;  3CAH A;  1Q04 A;  1FO8 A;  3Q4S A;  1TTU A;  4IBF A;  4LO2 A;  1NQI B;  4FRL A;  4GHA A;  1XC8 A;  1YP2 A;  1DZC A;  1ZJ0 A;  4JKQ A;  1AVU A;  1HNX M;  2RJ4 A;  5HPZ A;  4II7 A;  3C58 A;  1QVR A;  5IDS A;  3PXG A;  2OPF A;  3Q7Y A;  2XSZ D;  1NSF A;  4YY3 M;  4AKG A;  1S0L A;  4PDI A;  4JN6 A;  3WA1 A;  4LO3 A;  1WBC A;  4AQY M;  4AG5 A;  4Q91 A;  4DR2 M;  3P53 A;  4P6A A;  1WT0 A;  1V83 A;  1R7V A;  3RMV A;  1MP3 A;  5ITX A;  3WIN A;  3HJ8 A;  4A3V B;  3DOA A;  1IN6 A;  2Y9X E;  3AZW A;  3U2V A;  3GLF B;  3RGS A;  1GGP B;  2PX7 A;  2IWT B;  3CKO A;  3U2X A;  3AKH A;  4FQW A;  5BQU C;  2Z87 A;  5C4B A;  3HOM A;  1SXJ B;  1J5E M;  2O1H A;  3ZC8 A;  3VDP A;  2VQE M;  4B3M M;  1VGT A;  4B4B A;  3RSJ A;  2XF3 A;  3I4Y A;  5FLX S;  3T8S A;  2FYD B;  3BX1 C;  3BAO A;  3GLG A;  4LZJ A;  1QG8 A;  2V0I A;  4A7Y A;  3C9Z A;  5EP1 A;  4OEG A;  2FO1 A;  1BLA A;  2WGZ A;  4GAF A;  5JI3 E;  3SX5 A;  4OWK A;  5B2H A;  1Z6T A;  3U60 B;  4LJ6 A;  5IWA M;  1R82 A;  1K5U A;  3FUT A;  4DR5 M;  3H6S E;  2LXE A;  1TH3 A;  4OUJ A;  5J49 A;  1V82 A;  3D98 A;  2KA6 B;  3V0O A;  1FO9 A;  2HCB A;  3A23 A;  5BVP I;  4Y9X A;  3UJ4 A;  2AH9 A;  4WUR A;  2RQ9 A;  4FRA A;  3KOX E;  3OTO M;  2AFG A;  3AOG A;  3R2W A;  4RF0 A;  3OH4 A;  4Q9G A;  1DQG A;  4LRT A;  2D0J A;  4NAI A;  4LGY A;  4HO6 A;  4NRW A;  4H04 A;  5BXS A;  2M49 A;  1XWI A;  4TLP A;  4FW9 A;  1HQC A;  1HWM B;  4Z6Y A;  1LZ0 A;  1ZJ2 A;  4AI6 A;  1L2H A;  5DDT A;  2VS4 A;  1MD6 A;  5FZY A;  1FGG A;  1ZQ9 A;  3TWM A;  1QQL A;  4EFP A;  4AN6 A;  4KNX A;  1OQM B;  3TWK A;  3FKE A;  3I0G A;  4HO5 A;  4JD0 A;  2PGV A;  5JI2 E;  3U61 A;  3BAH A;  1A8D A;  3FJA A;  4DV2 M;  4I7I A;  4P0J A;  5FU0 A;  3O4A A;  3FJJ A;  3SYL A;  1WXQ A;  1N34 M;  4JI1 M;  5DYI A;  4HO0 A;  3ZX7 A;  5EJ1 A;  4LFC M;  2CUZ A;  3MPP G;  1JR3 A;  1NNJ A;  4Y7V A;  3BAQ A;  4D80 A;  3NGW A;  5BXT A;  5FZZ A;  1NY6 A;  3GO8 A;  1FGX A;  2WEE A;  2C9O A;  2M5Z A;  4YS8 A;  3MJ5 A;  3GRR A;  4I4O A;  4I2S A;  4KC3 A;  3V0L A;  2XLJ A;  4DDZ A;  2VSA A;  1ISV A;  4B3S M;  2NXV A;  3F1C A;  4X39 A;  3THG A;  1AVA C;  1XMO M;  3MAL A;  1KFV A;  4RNA A;  5FNW A;  3T38 A;  4G4Q A;  2A8U A;  4I4V A;  4JI0 M;  4GKJ M;  2E8B A;  1T9F A;  1L8Q A;  3FGM A;  2QGI A;  3HU2 A;  1H4C A;  2AES A;  1X37 A;  3OJM A;  2VS3 A;  2Y4L A;  2NS2 A;  3BAG A;  3USQ A;  5FTV A;  4G6M A;  4EFR A;  4I0Y A;  1TW5 A;  4EB2 B;  4HA2 A;  4ZBV B;  1GKI A;  3U6L A;  3RMW A;  1W5T A;  1SXJ E;  4KO8 A;  1ONK B;  4KEJ A;  3AKF A;  2DVW B;  3T15 A;  5JMC A;  3HGI A;  3M6A A;  1JT7 A;  1JVG A;  3LQR A;  1H7Q A;  4R7P A;  3P6J A;  1C1K A;  4HJJ A;  2E4M C;  1LZJ A;  3KDS E;  1R2Z A;  1R7U A;  2OI7 A;  3JTJ A;  3V8Z A;  1BFG A;  1G0R A;  5JLV A;  2R4E A;  2DS0 A;  4M2A A;  4LO7 B;  3ST8 A;  3AKG A;  3TZT A;  2X4A A;  2MZB A;  3TE6 A;  5D91 A;  3V91 A;  3BAD A;  3OJV A;  3NBI A;  3BA5 A;  4WBC A;  3O44 A;  3KOZ E;  4Y7G A;  4AKI A;  3N9W A;  4GIT A;  3VT1 A;  3IIR A;  4IBD A;  3IAG C;  2KLL A;  1NKH B;  5ITR A;  4M0D A;  1G9C A;  3WO4 A;  1G9D A;  2Z49 A;  3ZLK A;  3B9U A;  1J7K A;  3OBT A;  1GX4 A;  2YQJ A;  2RJ0 A;  4BB9 A;  4LO7 C;  3CA3 A;  3K1X A;  3ZCB B;  4DUZ M;  3GQ5 A;  1H7E A;  1XMQ M;  4R3D A;  2E5L M;  4EEG A;  3A22 A;  2X2T A;  1ZJO A;  1JT4 A;  3SMP A;  4ASY A;  3TC2 A;  4EEM A;  4LY6 A;  1PC8 B;  5IT9 S;  2UUA M;  1NY5 A;  3O3P A;  4MB7 A;  4GP3 A;  2VSH A;  3SYK A;  2V0H A;  4DUY M;  1H4D A;  3GQ3 A;  1LV7 A;  1J0S A;  3SXE A;  2AHM A;  3OGZ A;  3D8B A;  3L28 A;  1MU5 A;  2AM3 A;  3HWS A;  1PUM B;  3WHK A;  1IJT A;  4I4S A;  3OKR A;  1G41 A;  4IBE A;  4ZLB B;  4QO3 A;  3KVW A;  5IDT A;  1XXH A;  2DRZ A;  3BAU A;  3FJK A;  1HJJ A;  4USP A;  3FJC A;  4BLC A;  1QYR A;  3AJ5 A;  5C3A A;  2CHG A;  3CQA A;  3FUO A;  4LO1 C;  2LIE A;  2RGH A;  4FWG A;  1R8O A;  4DR3 M;  3K2L A;  3ZC7 B;  1G95 A;  4JI6 M;  1H5R B;  1S0E A;  2Y9W C;  4CGY B;  1IT0 A;  1GLN A;  3PG0 A;  2ZU8 A;  2KI4 A;  2I7B A;  1DGG A;  4LFA M;  1HM0 A;  2X60 A;  2KEB A;  2AE7 A;  3V0B B;  1H5S D;  5FTM A;  3BRD A;  4LF4 M;  3FFZ A;  2BO8 A;  1UM8 A;  4LJ9 A;  4AW4 A;  3L26 A;  3RSB A;  4GKK M;  5C1H A;  1WT1 A;  3N7J A;  2C98 A;  4DR6 M;  9ILB A;  4ZFY B;  4DR7 M;  2X8A A;  3E25 A;  1ON8 A;  2HHH M;  3OC9 A;  1NJG A;  4G4R A;  4FGF A;  3CF6 E;  1Z5B A;  3CKQ A;  4D11 A;  5F8Y A;  5FNX A;  1I1E A;  3AJ6 A;  2WE9 A;  3TWL A;  5C1G A;  1FJG M;  5IRE B;  3VK7 A;  4Y7F A;  1IY2 A;  1EZI A;  4Y62 A;  3T7O A;  3KP1 E;  4MGK E;  4P02 A;  4I6I A;  1V84 A;  3PNY A;  1PWA A;  4OWL A;  2X65 A;  2K4A B;  3I2X A;  4IZX A;  2F5N A;  4KPX A;  2QZ4 A;  1YF8 B;  3VDU A;  4J2K A;  31BI A;  2BO6 A;  2NP0 A;  3A42 A;  2R45 A;  2D22 A;  1H5S B;  2VU9 A;  3CKV A;  1G2V A;  3CA6 A;  1G82 A;  4I1E A;  1FGA A;  2L5X A;  1R80 A;  4LJ8 A;  1EYR A;  3E8L C;  1G97 A;  4X65 M;  5C8R A;  2FDB M;  3CA4 A;  4XKI A;  2VXL A;  3FJE A;  2F5S A;  1TOO A;  5ITU A;  2D23 A;  4B08 A;  3R8F A;  1H7L A;  4HO3 A;  5H37 D;  2JCL A;  1H5S C;  2RJ5 A;  2K43 A;  3D5N A;  2UUB M;  4OVZ A;  2UUC M;  4Z8X A;  5FTK A;  3QYD A;  3IOH A;  5C48 A;  3DZD A;  4C2S A;  3S8K A;  4QKR A;  5BXR A;  4GC5 A;  1BLD A;  5EP2 A;  4HLQ A;  1HR0 M;  2VS5 A;  2O1F A;  2OEG A;  1NF5 B;  3CF0 A;  3HAL A;  2FOI C;  4CHT B;  3V0N A;  1H7G A;  2CHQ A;  5EHA A;  5C1B A;  3POK A;  2BNK A;  2YC3 A;  5E26 A;  2XEP A;  4FWD A;  5IFY A;  4ZPX A;  3HJS A;  5LMN M;  5D62 A;  2PGY A;  1DGF A;  1ZCT A;  2DWM A;  4M28 A;  4Z9W B;  4B3R M;  1YSY A;  5BQU A;  3KP0 E;  4NOO B;  3FJD A;  1TIE A;  2X5S A;  4MYB A;  1E9R A;  3SFZ A;  3ZLL A;  2D7I A;  3H6Q A;  1NHE B;  1G9R A;  3UGJ A;  1FNN A;  1G3L A;  2J7N A;  2QCU A;  1RY7 A;  3ZH9 B;  5EJZ A;  1OQL B;  3HU1 A;  3F1Y A;  4FIX A;  3OAM A;  4HO4 A;  4LO0 C;  3R9X B;  5FTN A;  5DSS B;  3HHY A;  1E9S A;  1KNM A;  1YBI A;  3GLF A;  2RST A;  3T7M A;  5C4C A;  4A7Z A;  3IG8 A;  5F8S A;  3FTF A;  4GBP A;  3U0Y A;  1SXJ A;  1R7T A;  2VXM A;  5FV9 A;  2FFV A;  1WBA A;  3O4B A;  2CHV A;  3SAV A;  4H75 A;  3NBC A;  5DZU A;  1LL0 A;  4EE5 A;  4I81 A;  4USO A;  1RML A;  1VZT A;  3GLH A;  3CKN A;  3Q7W A;  5DNY A;  2CE7 A;  2HWA A;  1XG6 A;  2Z3X A;  2XSZ A;  1YTO A;  3U60 A;  5C1L A;  2P5T A;  2Y9G A;  2A5Y B;  4LF7 M;  3OH0 A;  1RG8 A;  1GWW A;  5D92 A;  2XH9 A;  3LVV A;  4M9X A;  4LF8 M;  3PVS A;  3OGF A;  1XZ6 A;  7CAT A;  1W55 A;  1HT1 E;  4QHS A;  2OI6 A;  4Y63 A;  4I4Q A;  3BOS A;  4Y7U A;  1DO2 A;  1VGU A;  3I0C A;  5C4E A;  3HHZ A;  3K8E A;  3EIE A;  3FUW A;  5BR8 M;  4L15 A;  2QYI B;  2W0V A;  2XZF A;  1EYL A;  4G87 A;  1Z59 A;  1S0B A;  2I7N A;  3A07 A;  3SAT A;  5C47 A;  5KPT A;  5EG6 C;  2KKI A;  1T4Q A;  1BFB A;  1YP3 A;  4IY9 A;  5C4D A;  1BFC A;  3JR4 A;  2JCO A;  2BJW A;  1RZO B;  3VUO A;  5ITQ A;  1PM5 A;  4G6J A;  3VWC A;  4KPZ A;  1H7F A;  4JXJ A;  2JCK A;  4IJF A;  4GOY A;  3GRV A;  3SXG A;  1IM2 A;  2BO4 A;  1S0G A;  1M16 A;  1G23 A;  5FUH A;  3W0L B;  2X2S A;  2F5P A;  4LFB M;  4JAW A;  1F31 A;  4UEG A;  1FWU A;  4MM3 B;  1ZI5 A;  4GOV A;  1V6V A;  2XGN A;  1VGW A;  3N0K A;  3U6M A;  2Z86 A;  4GC9 A;  2FYC B;  4L8R C;  4EEE B;  4FRE A;  1D0H A;  4A7K A;  2VLC A;  3I2A A;  4Q9P A;  4HG6 A;  1V6X A;  2PA4 A;  4ECM A;  3I0K A;  3CKJ A;  3K8D A;  4HO9 A;  4P00 A;  3SMS A;  2KZU A;  4YHH M;  3K8Z A;  1K82 A;  4JKX B;  2ZU7 A;  2E4M A;  4XGI A;  1JV1 A;  2DRY A;  1DO0 A;  2GGQ A;  4GMQ A;  5BP5 C;  4B7G A;  4KEK A;  4J2X A;  4G4O A;  2GO2 A;  1NHW C;  1ISW A;  4XFT A;  2DWN A;  2R46 A;  2HW9 A;  4JI4 M;  5CQO A;  3GRU A;  1FR9 A;  1YYN A;  5D61 A;  1NUN A;  1N4K A;  3HKP A;  1KSF X;  1I1B A;  1Z5C A;  1L2D A;  1TWM A;  4I37 A;  3MK6 A;  3L27 A;  1TH4 A;  3AOE C;  2ZU9 A;  4I8M A;  4NSO B;  4LO2 C;  2R18 A;  1O23 B;  1PJI A;  3U2W A;  3VKH A;  3USR A;  1R6B X;  3UDA A;  3FWW A;  4EEO A;  5C49 A;  2QBY A;  3SAS A;  1LVW A;  2YQC A;  1XYF A;  2V0K A;  4LJA A;  3AZV A;  3BA7 A;  4XFS A;  2R9K B;  5EIY A;  5FTL A;  3FJI A;  3SBJ A;  5CQM X;  3O5W B;  4G3Q A;  1CVS A;  2RIX A;  4OW0 A;  5KPZ A;  3LQQ A;  1L2B A;  2ICY A;  1QAO A;  4KHP M;  1HM8 A;  4B3U A;  2V0J A;  5ITY A;  3T7N A;  1G1L A;  4J18 A;  4HCQ A;  3GLG B;  1FMM S;  3SXC A;  5KO3 A;  4DV4 M;  3J7B A;  2Y0T A;  3ZXG A;  4DV3 M;  2RJ9 A;  2W82 A;  4EFQ A;  2YQZ A;  4QHT A;  3QAU A;  4IJE A;  4OEE A;  3I29 B;  1IBL M;  3VSF A;  4FCE A;  2C99 A;  3FJB A;  3VSZ A;  3SXA A;  2L7H A;  3E26 A;  4DEC A;  3LLP A;  4QNR A;  3EF2 A;  2EO2 A;  2Z4S A;  5KPR A;  2CFO A;  3UMM A;  1R81 A;  1CE7 B;  2CV0 A;  4JP0 A;  1IRA X;  2WVK A;  4Z8S B;  3JUT A;  1GVN A;  4LO1 A;  1ZJ1 A;  3Q7X A;  2YQS A;  1ZCU A;  4QBV A;  4CJB A;  4G3S A;  2DWL A;  3QVB A;  4EE4 A;  3LVW A;  4OWJ A;  4D0T A;  1E94 E;  5DYG A;  3RTI B;  2Y0Q A;  4QNM A;  4EE3 A;  3AKZ A;  1H5T A;  1FR8 A;  1SR4 A;  1HNW M;  2I5K A;  2L6O A;  1AXM A;  2Y20 A;  2BFH A;  2CEA A;  2AGD A;  5LMU M;  1IRP A;  2UXB M;  3DJ4 A;  1H6U A;  1FZW A;  1JV3 A;  1VIC A;  2XWM A;  3TQD A;  1E5K A;  3T1Y M;  2O1G A;  3U61 B;  3KSX A;  1G3I A;  4HR6 C;  1H5R A;  4FRB A;  5EXP A;  1ABR B;  1ILR 1;  2Q3N B;  2FYA A;  2QH5 A;  4ZOT A;  5EQT A;  5F3W A;  3V0B A;  4IBK A;  7I1B A;  3KOY E;  4I1B A;  2YUG A;  3N7L A;  4OX9 M;  4LZZ A;  4NRV A;  3CRI A;  3PNV A;  2RJ6 A;  3LMM A;  4JRA A;  3BAV A;  4JI3 M;  1L2C A;  1FRW A;  2Y4K A;  1S0C A;  2XFT A;  3I0I X;  2P23 A;  4X38 A;  4AYL A;  1N36 M;  3WO2 A;  3IM6 A;  3M7G A;  3GPP A;  4D8H A;  2VFZ A;  5G00 A;  3AH1 A;  1I94 M;  1OFH A;  3BA4 A;  2W0W A;  3VFD A;  3BRG C;  3T1H M;  1TGU A;  3IOI A;  4EKX B;  3U6O A;  3U6S A;  1WD3 A;  1OMX A;  1GQC A;  1MC9 A;  3HHX A;  4JYA M;  1TWE A;  4QC4 A;  5FSW A;  4LRS A;  1ZCY A;  4P16 A;  3V0M A;  2XZU A;  1DIW A;  1QWJ A;  1ZDF A;  1ISY A;  2Q9X A;  4NAL A;  2K8R A;  3RMX A;  5FTJ A;  1VZU A;  3K92 A;  1H5S A;  2Q4J A;  4TUW A;  4X66 M;  3OH2 A;  4DV6 M;  1TW1 A;  4DCK C;  3U0X A;  4QBC A;  2ZBK B;  1HNZ M;  2KRU A;  1NJF A;  3CU1 B;  2AAI B;  3SAU A;  2D7E A;  3U6E A;  4B3T M;  2VII A;  1JTC A;  1DGH B;  4NSR A;  5CQN X;  5BXP A;  3FJ9 A;  4IHZ A;  2D24 A;  3NBN A;  2FGF A;  1S3S A;  5CMH A;  1E32 A;  2D1Z A;  3I0L A;  2F2F C;  3JR5 A;  3GLI B;  1DJS B;  2HZ9 A;  3O4O A;  5L6V A;  2MC2 A;  1G4A E;  2FNA A;  3FUQ A;  4QD2 B;  4CIS A;  2OI5 A;  3IM7 A;  4MIX A;  1IHK A;  1TZF A;  2Z7J A;  1YXW A;  1R7Y A;  2K47 A;  4Y64 A;  4B7H A;  1R7X A;  3J81 S;  2Q2E B;  4FRP A;  2ZR1 B;  2WAW A;  4LO0 A;  2XMH A;  1FQ9 A;  1TFM B;  1IBK M;  4PCZ A;  1OMZ A;  2D7H A;  2VXR A;  2X49 A;  1Z4S A;  4MZH A;  1Q3B A;  2DZN B;  3TL4 X;  1VZX A;  5EC5 A;  3LW6 A;  3PUB A;  1W77 A;  4QD2 C;  3I0E A;  3B9P A;  1Z90 A;  4OW4 A;  2JA2 A;  3KOW E;  1AF9 A;  1Z5A A;  4FIY A;  2YR0 A;  4AYJ A;  1SS9 A;  4L41 C;  3O4C A;  3I51 A;  3VT0 A;  2GZB A;  2HWM A;  2F8X C;  1HM9 A;  1TDH A;  3VT2 A;  2UXD M;  1XXH B;  2ZAO A;  3AH4 A;  1G9A A;  1HJL A;  2Z48 A;  2D7G A;  5EP3 A;  4PDG A;  2J7O A;  4ZA3 B;  4LO8 B;  1M2T B;  3HU3 A;  3U2T A;  4MGZ E;  1HQY E;  4JI7 M;  4ISR A;  3J27 B;  1ZIZ A;  3EE5 A;  1IN4 A;  4AAW A;  2AM5 A;  3SX7 A;  1R7R A;  4QAL A;  2VK9 A;  5BPV A;  4Q7C A;  2FE8 A;  2Z4R A;  1ON6 A;  4KBB A;  4DV7 M;  2P6W A;  2GGO A;  1IY0 A;  1FV2 A;  1E0O A;  2DXI A;  3CRH A;  3RFW A;  1QQW A;  3OH3 A;  2FYB A;  3JUK A;  1GX0 A;  2VUA A;  1FN0 A;  8I1B A;  3JRR A;  3NBD A;  1HWP B;  4JI2 M;  2UUS A;  4DR1 M;  3HN1 A;  2R62 A;  2Y4M A;  1S0D A;  2XOA A;  3VK8 A;  3N7M A;  3SX3 A;  4F34 A;  1IXS B;  3ZGF A;  3GPY A;  3Q7U A;  1MC3 A;  2NM1 A;  2D43 A;  4DEN A;  3JAM S;  3KW6 A;  1WT2 A;  4I96 A;  2QN4 A;  2DPW A;  2BJV A;  4FCT A;  1FXJ A;  1W5S A;  2WBC A;  1S4O A;  3UJN A;  1DFQ A;  1JY0 A;  3PFI A;  2XWL A;  4LG2 A;  3ILK A;  1N77 A;  2AM4 A;  4G6Z A;  4I4Y A;  3GP1 A;  2XWN A;  2LIQ A;  3V0A B;  3VLF B;  3U5Z B;  4E1K A;  2M60 A;  4EIW A;  3BB2 A;  2I5E A;  3DK5 A;  3KMV A;  5DUY A;  4MZF B;  4DV5 M;  2R4J A;  3IM5 A;  3V90 A;  1MX0 A;  4M9Z A;  4GRI A;  2DWZ B;  3GPU A;  2UXC M;  4XFU A;  4G3P A;  1HCD A;  2APC A;  4FCU A;  2ZAM A;  1W3G A;  3F62 B;  4CJM A;  2A8W A;  4KRV A;  1S4N A;  4EEA A;  4I4L A;  3ZC9 A;  4B42 A;  2FFU A;  2YFQ A;  2P39 A;  4J23 B;  1Z2V A;  4KC2 A;  2F4V M;  1VH3 A;  5CMF X;  2OEF A;  1TDZ A;  1JQJ C;  1JLY A;  4RF1 A;  3CRG A;  2WVL A;  3AOE A;  2CV2 A;  3GRY A;  1DLL A;  4GIP A;  4B2X A;  1L1Z A;  1O0R A;  3OBR A;  2J0B A;  3K1J A;  3PKP A;  4GH9 A;  4CJC A;  5F90 A;  1INJ A;  1FMZ A;  1BAS A;  4XBO A;  1BAR A;  4FCV A;  2ICX A;  4L4H A;  4D48 A;  1G59 A;  4P0L A;  3AKI A;  3L25 A;  3CF2 A;  3GQ4 A;  4GHL A;  3SHG B;  4NAK A;  4FD2 A;  4J2S A;  1WD4 A;  1JT5 A;  3IG5 A;  2QEN A;  5I1B A;  1EV2 A;  3FUU A;  2RKO A;  5KQ8 A;  3L2A A;  5ITT A;  1ZAE A;  1WVC A;  4GP0 A;  3FOQ A;  2V1C A;  3CU0 A;  1L1T A;  1VM8 A;  2VD4 A;  1QXM A;  2Y21 A;  3QWL A;  1ZJP A;  1NHG C;  4HOC A;  1PUU B;  4D81 A;  3VKG A;  4D0Z A;  1GWV A;  4LW6 A;  2YES A;  1PZY B;  1LZ7 A;  4KQL A;  3U6P A;  4IQP A;  2RIY A;  2J3P A;  1IIM A;  3AV0 A;  3H6R B;  3GLH B;  2KH2 A;  1IY1 A;  1LL3 A;  5C38 A;  3U6D A;  1HWO B;  2P72 A;  3S8J A;  1QAN A;  3WHL A;  1XZZ A;  4NAN A;  4IBB A;  2FFJ A;  1SXJ C;  4O6N A;  1K3X A;  1DGB A;  2V1U A;  1ZHJ A;  4I3N A;  4Y7T A;  1O7Q A;  4B5B A;  2YC5 A;  5C3D A;  1N33 M;  1P63 A;  5IZ7 D;  2IHO A;  5I1F A;  1HKN A;  2AEC A;  4ION A;  3A21 A;  2XFS A;  2HL7 A;  2D7R A;  5KQD A;  4B2W A;  3UK6 A;  3O3Q A;  3DFZ A;  1ISZ A;  1IXZ A;  4MGH A;  3HBW A;  4NXM M;  4JI5 M;  41BI A;  5CMG X;  4I4R A;  3KS4 A;  2C9C A;  1Q03 A;  3UZU A;  4R6U B;  3UD8 A;  1TP0 A;  1IBM M;  1AVW B;  4UY4 A;  2L7I A;  2L09 A;  3CTW B;  4X64 M;  2ERM A;  5EXX A;  4AZF A;  2ZAN A;  2MLL B;  4MGI E;  1W3A A;  5DVH A;  3J2P B;  3HHW A;  3ZGG A;  4KNR A;  1DZD A;  3PKQ A;  3FYC A;  2Y4J A;  1ORY B;  2QKX A;  3CA0 A;  4G1R A;  4X3A A;  5CMJ A;  2WRY A;  2QP9 X;  1WSZ A;  4P0K A;  1AFC A;  1PZZ A;  4L78 A;  3WO3 A;  3HJQ A;  3V0P A;  4CVH A;  4YOL A;  6I1B A;  2DHR A;  4PT5 A;  1EPW A;  4IY8 A;  4ARW A;  4LO3 C;  3O49 A;  1IQP A;  4END A;  5D63 A;  3SPT A;  5CMI A;  5GKN A;  3PME A;  4HO8 A;  1GA8 A;  4I8O A;  1ZJ3 A;  3W0F A;  3WIN C;  5AJN A;  1O7O A;  5EXT A;  2RJ1 A;  2NYY A;  2I1B A;  4M4K A;  3P6I A;  2NTD A;  1OJL A;  3UJ0 A;  4XWI A;  3A98 B;  4LJ5 A;  2E3D A;  4KLN A;  2ZM6 M;  5EP4 A;  3ILA A;  5F8W A;  3U6Q A;  4QOS A;  4KC1 A;  1JQZ A;  1JR3 D;  1OFI A;  1VGZ A;  4JIS A;  4G9N A;  21BI A;  2QPA A;  4I4U A;  4B4M A;  1GQ9 A;  3UD7 A;  3BRK X;  3POL A;  3ZF8 A;  3FD9 A;  4D82 A;  1G93 A;  2F2F A;  3V0Q A;  3KFU G;  4OU7 A;  1K3W A;  1INI A;  4ZDQ A;  2LWX A;  1IXR C;  4B7F A;  3R4S A;  4FCW A;  1VCL A;  1I4W A;  4FRQ A;  4ISQ A;  1H7T A;  1PZT A;  3CA5 A;  2RJ7 A;  1JYL A;  4NL4 H;  1EVT A;  4REZ A;  1PJJ A;  5L6S A;  5HS2 A;  4I4P A;  1YRO B;  1HIB A;  8CAT A;  3NBE A;  1ZI1 A;  1DGH A;  1NNU C;  1AVX B;  4M9S A;  1WT3 A;  1W3F A;  1QZM A;  4AG6 A;  4B4G A;  1IOB A;  3SX8 A;  2RIZ A;  1GL6 A;  1JT3 A;  2UU9 M;  1YUB A;  1DQO A;  1TH2 A;  3GLI A;  2QBY B;  3OH1 A;  2O5R A;  2UX8 A;  4FRH A;  4PC4 A;  2Y6P A;  1S4P A;  4X62 M;  2V0L A;  3SNV A;  2NZ9 A;  3FJF A;  3Q8X A;  3RE8 A;  1R8N A;  2P73 A;  2CU2 A;  3AFH A;  3BTA A;  1H3M A;  4ZGR B;  1QGS A;  1J09 A;  3FYD A;  3J7A S;  4KOD A;  1VH1 A;  4ASJ A;  4Y6U A;  2ET2 A;  1G9B A;  2VSE A;  2KW0 A;  1LZI A;  2BEA A;  2NVH A;  4MZG B;  4FVM A;  4L16 A;  3OGG A;  1HT2 E;  4KXO A;  1ISX A;  4IRP A;  4DV1 M;  5FZU A;  3GUE A;  1BA7 A;  5GAQ A;  3I0D A;  3R3I A;  1N75 A;  1FWY A;  5ITX E;  1H4E A;  3DA1 A;  1SZ6 B;  4BMA A;  2DZO B;  1KWS A;  1FG5 N;  4EVW A;  5C36 A;  4M0W A;  4PD2 A;  1HV9 A;  3NWL A;  4KEI A;  3GPX A;  4JI8 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...