1XHDA

X-ray crystal structure of putative acetyltransferase, product of bc4754 gene [bacillus cereus]
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
172
structure length
172
Chain Sequence
SNAMIYPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQYPLILEDDVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYYKSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative acetyltransferase/acyltransferase
publication title X-ray crystal structure of putative acetyltransferase, product of BC4754 gene from Bacillus cereus.
rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 71
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1xhdA00
2ICYA 2FKOA 3OUPA 4N6BA 1KRRA 5E3QA 1KK4A 2RIJA 2V0KA 2V0LA 4EA8A 5E3RA 4G3QA 2AQ9A 3KWEA 1J2ZA 1HM0A 3FSXA 3FSCA 1XHDA 1V3WA 4IHGA 2GGQA 3HSQA 1G97A 1MR9A 3OW5A 4ISXA 3BSYA 4E79A 3P47A 5ADXV 4M2AA 3D98A 3OU9A 3MC4A 3VBKA 3TK8A 1OCXA 2IU8A 2NPOA 2QKXA 3FS8A 3C8VA 3DJ4A 3R3RA 1KRUA 1KGQA 3FTTA 1FWYA 3EEVA 1SSMA 1HV9A 1KK5A 3NZ2A 4IHHA 3TV0A 3VBLA 3GUEA 3SRTA 4M98A 1V67A 2GGOA 2V0IA 4FCEA 4G3PA 5ADXU 1THJA 3CJ8A 4N27A 3FOQA 1YP3A 3P1BA 4E1KA 2VHEA 2QIAA 3OTMA 5F42A 4EGGA 3I3AA 5U2KA 3IGJA 3R5BA 1HM9A 3IXCA 2WLEA 1QRFA 4DCLA 3TDTA 3TISA 4K6RA 3EH0A 2OEGA 3GVDA 4HURA 2IU9A 2V0HA 2IUAA 4AC3A 4KQLA 3VBJA 2OI6A 2VD4A 1G95A 4HZDA 3DHOA 1KGTA 4N69A 4KNXA 1QQ0A 3R2WA 3BSSA 3FWWA 3HJJA 4EA9A 3BRKX 1QRMA 2OI7A 3DK5A 4H7OA 3MQHA 4J09A 3TIOA 2V0JA 5DG3A 3V4EA 1YP2A 1T3DA 3JQYA 1S80A 4KPZA 4M28A 1TDTA 4MFGA 3T57A 4EA7A 1QRLA 2JF3A 3VBPA 4E6UA 2I5KA 1KK6A 3FSYA 4R37A 2Q4JA 2TDTA 1MRLA 2IC7A 3BSWA 3ECTA 3EG4A 1YP4A 2W0WA 3R5DA 4IHFA 5AFUV 3GOSA 2WLDA 1KHRA 4KNRA 4EAAA 2OEFA 4G3SA 4EQYA 4E6TA 1SSQA 3R3IA 3FSBA 4AAWA 3I3XA 4M99A 4R7PA 3KWCA 4KPXA 4MZUA 5AFUU 3SPTA 4AA7A 3BFPA 5L6VA 3R5CA 2WLCA 3KWDA 2OI5A 2QIVX 3Q1XA 4G87A 3TWDA 3VBMA 5L6SA 1HM8A 4M2BA 4EABA 1KQAA 2JF2A 4MYOA 3VBIA 1SSTA 2WLGA 1LXAA 3D8VA 3MQGA 2ICXA 4HZCA 5E3PA 1XATA 2P2OA 3OTZA 1MR7A 3R0SA 4HUSA 5DEPA 3R8YA 3F1XA 1QREA 3BXYA 2W0VA 4E75A 1FXJA 1QRGA 1Z90A 4M9CA 4N6AA 4HCQA 1KRVA 3PMOA 4R36A 5DEMA 3R5AA 2XATA 3R1WA 3ST8A 3VBNA 3VNPA 4J18A 2WLFA
chains in the Genus database with same CATH superfamily
1EWWA 2ICYA 2FKOA 3OUPA 4N6BA 1KRRA 5E3QA 1KK4A 2RIJA 2V0KA 2V0LA 4EA8A 5E3RA 4G3QA 2AQ9A 3KWEA 1J2ZA 1HM0A 3FSXA 3FSCA 1XHDA 1V3WA 4IHGA 2GGQA 3HSQA 1G97A 1MR9A 3OW5A 4ISXA 3BSYA 4E79A 3P47A 5ADXV 4M2AA 3D98A 3OU9A 3MC4A 3VBKA 3TK8A 1OCXA 2IU8A 2NPOA 2QKXA 3FS8A 3C8VA 3GQAA 3DJ4A 3R3RA 1KRUA 1KGQA 3FTTA 3OH4A 1FWYA 3EEVA 1SSMA 3OH3A 1HV9A 1KK5A 3NZ2A 4IHHA 3TV0A 3VBLA 3GUEA 3SRTA 4M98A 1V67A 2GGOA 2V0IA 4FCEA 4G3PA 5ADXU 1THJA 3CJ8A 4N27A 3FOQA 1YP3A 3P1BA 4E1KA 2VHEA 2QIAA 3OTMA 5F42A 3OGZA 4EGGA 3GQ7A 3I3AA 5U2KA 1L0SA 3GQ9A 3IGJA 3R5BA 1HM9A 3IXCA 2WLEA 1QRFA 4DCLA 3TDTA 3TISA 4K6RA 3EH0A 2OEGA 3GVDA 4HURA 2IU9A 2V0HA 2IUAA 4AC3A 4KQLA 3VBJA 2OI6A 2VD4A 1G95A 4HZDA 3DHOA 1KGTA 4N69A 4KNXA 1QQ0A 3R2WA 3BSSA 3FWWA 3HJJA 4EA9A 3BRKX 1QRMA 2OI7A 1N4IA 3DK5A 3MQHA 4H7OA 4J09A 3TIOA 2V0JA 5DG3A 3V4EA 1YP2A 1T3DA 3JQYA 1S80A 4KPZA 4M28A 1TDTA 4MFGA 3T57A 4EA7A 1QRLA 2JF3A 3VBPA 4E6UA 2I5KA 1KK6A 3FSYA 4R37A 2Q4JA 2TDTA 1MRLA 2IC7A 3BSWA 3ECTA 3EG4A 1YP4A 2W0WA 3OH0A 3R5DA 4IHFA 5AFUV 3GOSA 2WLDA 1KHRA 4KNRA 4EAAA 2OEFA 4G3SA 4EQYA 4E6TA 1SSQA 3R3IA 3FSBA 3OH1A 4AAWA 3I3XA 4M99A 4R7PA 3KWCA 4KPXA 4MZUA 5AFUU 3SPTA 4AA7A 3BFPA 1M8NA 5L6VA 3R5CA 2WLCA 3KWDA 2OI5A 2QIVX 3Q1XA 4G87A 3TWDA 3VBMA 5L6SA 1HM8A 4M2BA 4EABA 1KQAA 2JF2A 4MYOA 3VBIA 1SSTA 2WLGA 1LXAA 3D8VA 3MQGA 3OH2A 2ICXA 4HZCA 5E3PA 1XATA 2P2OA 3OTZA 1MR7A 3R0SA 4HUSA 5DEPA 3R8YA 3F1XA 1QREA 3BXYA 2W0VA 4E75A 3GQ8A 1FXJA 1QRGA 1Z90A 4M9CA 4N6AA 4HCQA 1KRVA 3PMOA 4R36A 5DEMA 3R5AA 1Z2FA 2XATA 3R1WA 3ST8A 3VBNA 3VNPA 4J18A 2WLFA 3SUCA
chains in the Genus database with same CATH topology
2ICYA 2FKOA 3OUPA 4N6BA 1KRRA 5E3QA 1KK4A 2RIJA 2V0KA 2V0LA 4EA8A 5E3RA 4G3QA 2AQ9A 3KWEA 1J2ZA 1HM0A 3FSXA 3FSCA 1XHDA 1V3WA 4IHGA 2GGQA 3HSQA 1G97A 1MR9A 3OW5A 4ISXA 3BSYA 4E79A 3P47A 5ADXV 4M2AA 3D98A 3OU9A 3MC4A 3VBKA 3TK8A 1OCXA 2IU8A 2NPOA 2QKXA 3FS8A 3C8VA 3DJ4A 3R3RA 1KRUA 1KGQA 3FTTA 1FWYA 3EEVA 1SSMA 1HV9A 1KK5A 3NZ2A 4IHHA 3TV0A 3VBLA 3GUEA 3SRTA 4M98A 1V67A 2GGOA 2V0IA 4FCEA 4G3PA 5ADXU 1THJA 3CJ8A 4N27A 3FOQA 1YP3A 3P1BA 4E1KA 2VHEA 2QIAA 3OTMA 5F42A 4EGGA 3I3AA 5U2KA 3IGJA 3R5BA 1HM9A 3IXCA 2WLEA 1QRFA 4DCLA 3TDTA 3TISA 4K6RA 3EH0A 2OEGA 3GVDA 4HURA 2IU9A 2V0HA 2IUAA 4AC3A 4KQLA 3VBJA 2OI6A 2VD4A 1G95A 4HZDA 3DHOA 1KGTA 4N69A 4KNXA 1QQ0A 3R2WA 3BSSA 3FWWA 3HJJA 4EA9A 3BRKX 1QRMA 2OI7A 3DK5A 4H7OA 3MQHA 4J09A 3TIOA 2V0JA 5DG3A 3V4EA 1YP2A 1T3DA 3JQYA 1S80A 4KPZA 4M28A 1TDTA 4MFGA 3T57A 4EA7A 1QRLA 2JF3A 3VBPA 4E6UA 2I5KA 1KK6A 3FSYA 4R37A 2Q4JA 2TDTA 1MRLA 2IC7A 3BSWA 3ECTA 3EG4A 1YP4A 2W0WA 3R5DA 4IHFA 5AFUV 3GOSA 2WLDA 1KHRA 4KNRA 4EAAA 2OEFA 4G3SA 4EQYA 4E6TA 1SSQA 3R3IA 3FSBA 4AAWA 3I3XA 4M99A 4R7PA 3KWCA 4KPXA 4MZUA 5AFUU 3SPTA 4AA7A 3BFPA 5L6VA 3R5CA 2WLCA 3KWDA 2OI5A 2QIVX 3Q1XA 4G87A 3TWDA 3VBMA 5L6SA 1HM8A 4M2BA 4EABA 1KQAA 2JF2A 4MYOA 3VBIA 1SSTA 2WLGA 1LXAA 3D8VA 3MQGA 2ICXA 4HZCA 5E3PA 1XATA 2P2OA 3OTZA 1MR7A 3R0SA 4HUSA 5DEPA 3R8YA 3F1XA 1QREA 3BXYA 2W0VA 4E75A 1FXJA 1QRGA 1Z90A 4M9CA 4N6AA 4HCQA 1KRVA 3PMOA 4R36A 5DEMA 3R5AA 2XATA 3R1WA 3ST8A 3VBNA 3VNPA 4J18A 2WLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICY A;  2FKO A;  3OUP A;  4N6B A;  1KRR A;  5E3Q A;  1KK4 A;  2RIJ A;  2V0K A;  2V0L A;  4EA8 A;  5E3R A;  4G3Q A;  2AQ9 A;  3KWE A;  1J2Z A;  1HM0 A;  3FSX A;  3FSC A;  1XHD A;  1V3W A;  4IHG A;  2GGQ A;  3HSQ A;  1G97 A;  1MR9 A;  3OW5 A;  4ISX A;  3BSY A;  4E79 A;  3P47 A;  5ADX V;  4M2A A;  3D98 A;  3OU9 A;  3MC4 A;  3VBK A;  3TK8 A;  1OCX A;  2IU8 A;  2NPO A;  2QKX A;  3FS8 A;  3C8V A;  3DJ4 A;  3R3R A;  1KRU A;  1KGQ A;  3FTT A;  1FWY A;  3EEV A;  1SSM A;  1HV9 A;  1KK5 A;  3NZ2 A;  4IHH A;  3TV0 A;  3VBL A;  3GUE A;  3SRT A;  4M98 A;  1V67 A;  2GGO A;  2V0I A;  4FCE A;  4G3P A;  5ADX U;  1THJ A;  3CJ8 A;  4N27 A;  3FOQ A;  1YP3 A;  3P1B A;  4E1K A;  2VHE A;  2QIA A;  3OTM A;  5F42 A;  4EGG A;  3I3A A;  5U2K A;  3IGJ A;  3R5B A;  1HM9 A;  3IXC A;  2WLE A;  1QRF A;  4DCL A;  3TDT A;  3TIS A;  4K6R A;  3EH0 A;  2OEG A;  3GVD A;  4HUR A;  2IU9 A;  2V0H A;  2IUA A;  4AC3 A;  4KQL A;  3VBJ A;  2OI6 A;  2VD4 A;  1G95 A;  4HZD A;  3DHO A;  1KGT A;  4N69 A;  4KNX A;  1QQ0 A;  3R2W A;  3BSS A;  3FWW A;  3HJJ A;  4EA9 A;  3BRK X;  1QRM A;  2OI7 A;  3DK5 A;  4H7O A;  3MQH A;  4J09 A;  3TIO A;  2V0J A;  5DG3 A;  3V4E A;  1YP2 A;  1T3D A;  3JQY A;  1S80 A;  4KPZ A;  4M28 A;  1TDT A;  4MFG A;  3T57 A;  4EA7 A;  1QRL A;  2JF3 A;  3VBP A;  4E6U A;  2I5K A;  1KK6 A;  3FSY A;  4R37 A;  2Q4J A;  2TDT A;  1MRL A;  2IC7 A;  3BSW A;  3ECT A;  3EG4 A;  1YP4 A;  2W0W A;  3R5D A;  4IHF A;  5AFU V;  3GOS A;  2WLD A;  1KHR A;  4KNR A;  4EAA A;  2OEF A;  4G3S A;  4EQY A;  4E6T A;  1SSQ A;  3R3I A;  3FSB A;  4AAW A;  3I3X A;  4M99 A;  4R7P A;  3KWC A;  4KPX A;  4MZU A;  5AFU U;  3SPT A;  4AA7 A;  3BFP A;  5L6V A;  3R5C A;  2WLC A;  3KWD A;  2OI5 A;  2QIV X;  3Q1X A;  4G87 A;  3TWD A;  3VBM A;  5L6S A;  1HM8 A;  4M2B A;  4EAB A;  1KQA A;  2JF2 A;  4MYO A;  3VBI A;  1SST A;  2WLG A;  1LXA A;  3D8V A;  3MQG A;  2ICX A;  4HZC A;  5E3P A;  1XAT A;  2P2O A;  3OTZ A;  1MR7 A;  3R0S A;  4HUS A;  5DEP A;  3R8Y A;  3F1X A;  1QRE A;  3BXY A;  2W0V A;  4E75 A;  1FXJ A;  1QRG A;  1Z90 A;  4M9C A;  4N6A A;  4HCQ A;  1KRV A;  3PMO A;  4R36 A;  5DEM A;  3R5A A;  2XAT A;  3R1W A;  3ST8 A;  3VBN A;  3VNP A;  4J18 A;  2WLF A; 
#chains in the Genus database with same CATH topology
 1EWW A;  2ICY A;  2FKO A;  3OUP A;  4N6B A;  1KRR A;  5E3Q A;  1KK4 A;  2RIJ A;  2V0K A;  2V0L A;  4EA8 A;  5E3R A;  4G3Q A;  2AQ9 A;  3KWE A;  1J2Z A;  1HM0 A;  3FSX A;  3FSC A;  1XHD A;  1V3W A;  4IHG A;  2GGQ A;  3HSQ A;  1G97 A;  1MR9 A;  3OW5 A;  4ISX A;  3BSY A;  4E79 A;  3P47 A;  5ADX V;  4M2A A;  3D98 A;  3OU9 A;  3MC4 A;  3VBK A;  3TK8 A;  1OCX A;  2IU8 A;  2NPO A;  2QKX A;  3FS8 A;  3C8V A;  3GQA A;  3DJ4 A;  3R3R A;  1KRU A;  1KGQ A;  3FTT A;  3OH4 A;  1FWY A;  3EEV A;  1SSM A;  3OH3 A;  1HV9 A;  1KK5 A;  3NZ2 A;  4IHH A;  3TV0 A;  3VBL A;  3GUE A;  3SRT A;  4M98 A;  1V67 A;  2GGO A;  2V0I A;  4FCE A;  4G3P A;  5ADX U;  1THJ A;  3CJ8 A;  4N27 A;  3FOQ A;  1YP3 A;  3P1B A;  4E1K A;  2VHE A;  2QIA A;  3OTM A;  5F42 A;  3OGZ A;  4EGG A;  3GQ7 A;  3I3A A;  5U2K A;  1L0S A;  3GQ9 A;  3IGJ A;  3R5B A;  1HM9 A;  3IXC A;  2WLE A;  1QRF A;  4DCL A;  3TDT A;  3TIS A;  4K6R A;  3EH0 A;  2OEG A;  3GVD A;  4HUR A;  2IU9 A;  2V0H A;  2IUA A;  4AC3 A;  4KQL A;  3VBJ A;  2OI6 A;  2VD4 A;  1G95 A;  4HZD A;  3DHO A;  1KGT A;  4N69 A;  4KNX A;  1QQ0 A;  3R2W A;  3BSS A;  3FWW A;  3HJJ A;  4EA9 A;  3BRK X;  1QRM A;  2OI7 A;  1N4I A;  3DK5 A;  3MQH A;  4H7O A;  4J09 A;  3TIO A;  2V0J A;  5DG3 A;  3V4E A;  1YP2 A;  1T3D A;  3JQY A;  1S80 A;  4KPZ A;  4M28 A;  1TDT A;  4MFG A;  3T57 A;  4EA7 A;  1QRL A;  2JF3 A;  3VBP A;  4E6U A;  2I5K A;  1KK6 A;  3FSY A;  4R37 A;  2Q4J A;  2TDT A;  1MRL A;  2IC7 A;  3BSW A;  3ECT A;  3EG4 A;  1YP4 A;  2W0W A;  3OH0 A;  3R5D A;  4IHF A;  5AFU V;  3GOS A;  2WLD A;  1KHR A;  4KNR A;  4EAA A;  2OEF A;  4G3S A;  4EQY A;  4E6T A;  1SSQ A;  3R3I A;  3FSB A;  3OH1 A;  4AAW A;  3I3X A;  4M99 A;  4R7P A;  3KWC A;  4KPX A;  4MZU A;  5AFU U;  3SPT A;  4AA7 A;  3BFP A;  1M8N A;  5L6V A;  3R5C A;  2WLC A;  3KWD A;  2OI5 A;  2QIV X;  3Q1X A;  4G87 A;  3TWD A;  3VBM A;  5L6S A;  1HM8 A;  4M2B A;  4EAB A;  1KQA A;  2JF2 A;  4MYO A;  3VBI A;  1SST A;  2WLG A;  1LXA A;  3D8V A;  3MQG A;  3OH2 A;  2ICX A;  4HZC A;  5E3P A;  1XAT A;  2P2O A;  3OTZ A;  1MR7 A;  3R0S A;  4HUS A;  5DEP A;  3R8Y A;  3F1X A;  1QRE A;  3BXY A;  2W0V A;  4E75 A;  3GQ8 A;  1FXJ A;  1QRG A;  1Z90 A;  4M9C A;  4N6A A;  4HCQ A;  1KRV A;  3PMO A;  4R36 A;  5DEM A;  3R5A A;  1Z2F A;  2XAT A;  3R1W A;  3ST8 A;  3VBN A;  3VNP A;  4J18 A;  2WLF A;  3SUC A; 
#chains in the Genus database with same CATH homology
 2ICY A;  2FKO A;  3OUP A;  4N6B A;  1KRR A;  5E3Q A;  1KK4 A;  2RIJ A;  2V0K A;  2V0L A;  4EA8 A;  5E3R A;  4G3Q A;  2AQ9 A;  3KWE A;  1J2Z A;  1HM0 A;  3FSX A;  3FSC A;  1XHD A;  1V3W A;  4IHG A;  2GGQ A;  3HSQ A;  1G97 A;  1MR9 A;  3OW5 A;  4ISX A;  3BSY A;  4E79 A;  3P47 A;  5ADX V;  4M2A A;  3D98 A;  3OU9 A;  3MC4 A;  3VBK A;  3TK8 A;  1OCX A;  2IU8 A;  2NPO A;  2QKX A;  3FS8 A;  3C8V A;  3DJ4 A;  3R3R A;  1KRU A;  1KGQ A;  3FTT A;  1FWY A;  3EEV A;  1SSM A;  1HV9 A;  1KK5 A;  3NZ2 A;  4IHH A;  3TV0 A;  3VBL A;  3GUE A;  3SRT A;  4M98 A;  1V67 A;  2GGO A;  2V0I A;  4FCE A;  4G3P A;  5ADX U;  1THJ A;  3CJ8 A;  4N27 A;  3FOQ A;  1YP3 A;  3P1B A;  4E1K A;  2VHE A;  2QIA A;  3OTM A;  5F42 A;  4EGG A;  3I3A A;  5U2K A;  3IGJ A;  3R5B A;  1HM9 A;  3IXC A;  2WLE A;  1QRF A;  4DCL A;  3TDT A;  3TIS A;  4K6R A;  3EH0 A;  2OEG A;  3GVD A;  4HUR A;  2IU9 A;  2V0H A;  2IUA A;  4AC3 A;  4KQL A;  3VBJ A;  2OI6 A;  2VD4 A;  1G95 A;  4HZD A;  3DHO A;  1KGT A;  4N69 A;  4KNX A;  1QQ0 A;  3R2W A;  3BSS A;  3FWW A;  3HJJ A;  4EA9 A;  3BRK X;  1QRM A;  2OI7 A;  3DK5 A;  4H7O A;  3MQH A;  4J09 A;  3TIO A;  2V0J A;  5DG3 A;  3V4E A;  1YP2 A;  1T3D A;  3JQY A;  1S80 A;  4KPZ A;  4M28 A;  1TDT A;  4MFG A;  3T57 A;  4EA7 A;  1QRL A;  2JF3 A;  3VBP A;  4E6U A;  2I5K A;  1KK6 A;  3FSY A;  4R37 A;  2Q4J A;  2TDT A;  1MRL A;  2IC7 A;  3BSW A;  3ECT A;  3EG4 A;  1YP4 A;  2W0W A;  3R5D A;  4IHF A;  5AFU V;  3GOS A;  2WLD A;  1KHR A;  4KNR A;  4EAA A;  2OEF A;  4G3S A;  4EQY A;  4E6T A;  1SSQ A;  3R3I A;  3FSB A;  4AAW A;  3I3X A;  4M99 A;  4R7P A;  3KWC A;  4KPX A;  4MZU A;  5AFU U;  3SPT A;  4AA7 A;  3BFP A;  5L6V A;  3R5C A;  2WLC A;  3KWD A;  2OI5 A;  2QIV X;  3Q1X A;  4G87 A;  3TWD A;  3VBM A;  5L6S A;  1HM8 A;  4M2B A;  4EAB A;  1KQA A;  2JF2 A;  4MYO A;  3VBI A;  1SST A;  2WLG A;  1LXA A;  3D8V A;  3MQG A;  2ICX A;  4HZC A;  5E3P A;  1XAT A;  2P2O A;  3OTZ A;  1MR7 A;  3R0S A;  4HUS A;  5DEP A;  3R8Y A;  3F1X A;  1QRE A;  3BXY A;  2W0V A;  4E75 A;  1FXJ A;  1QRG A;  1Z90 A;  4M9C A;  4N6A A;  4HCQ A;  1KRV A;  3PMO A;  4R36 A;  5DEM A;  3R5A A;  2XAT A;  3R1W A;  3ST8 A;  3VBN A;  3VNP A;  4J18 A;  2WLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...