1XHGA

Crystal structure of a 40 kda signalling protein from porcine (spp-40) at 2.89a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPP-40
molecule tags Signaling protein
publication title Crystal structure of a 40 kDa signalling protein from Porcine (SPP-40) at 2.89A resolution.
rcsb
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xhgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xhgA01
3T08A 4UFJA 1LG1A 4QP0A 1J0KA 2XFRA 4DUWA 1BAGA 1JIBA 3W27A 1JFXA 5IFPA 3RO8A 3VPLA 2GVYA 2VC9A 2BVYA 1ODUA 3VMPA 2E8YA 4M8UA 2G3NA 1JYWA 3SIMA 3F5JA 2V3EA 1MW3A 3FNDA 4KRUA 5M3WA 5E6YA 3WDHA 3CTTA 1UKPA 5A3HA 2C8NA 5DMYA 1VBUA 2J75A 3ZMRA 2Y4SA 5E0CA 1JZ8A 2ZUMA 2PBOA 1DWAM 4D6EA 1US3A 1UA7A 4U3AA 3VDBA 5IFTA 4UQ9A 1W1PA 1TVPA 2NT1A 2F8QA 1OT1A 1SR0A 2VVNA 2XWEA 5M03A 2VX4A 5FL1A 1BG9A 3CHDA 7CGTA 1VJSA 3UETA 3CUFA 3T0DA 2O9RA 3OIHA 1CGWA 3UR8A 4UZUA 1FHDA 3NDYA 5E09A 3RDKA 3ZSTA 1NP0A 3OGRA 2WHMA 3A47A 5M5DA 1H1NA 2ZX7A 4WKAA 2Q8XA 1DWJM 2DIJA 3PZIA 4TX8A 1HKKA 3FW6A 2EJ1A 1E4MM 2WCSA 2WNWA 3CZLA 4MPKA 4H04A 1J0JA 2ZUUA 2PBGA 2DH2A 5E6ZA 1KR1A 1W3HA 3OZOA 1GOMA 6TAAA 3I3DA 3I3BA 2VMFA 3VX0A 3F5LA 4ATWA 1KXVA 1GHRA 3LPPA 3L4TA 2E3ZA 3WF1A 3ZJ7A 3UEQA 3PZGA 1FFRA 5AYBA 3OA5A 1UYQA 3AMGA 3W6MA 1JAEA 1V3LA 4MB3A 5A8NA 2XPKA 4GO8A 1WDSA 2DT1A 1E4IA 3NCOA 4M29A 4HOXA 3AMLA 1B9ZA 2J78A 2ZE0A 3GXMA 3T0BA 3ARVA 1JYNA 4JCMA 4XB3A 4HOZA 5IDIA 5EMYA 3WQ5A 1NWTA 1WZMA 1PX3A 1E71M 5DEZA 1QHZA 3EMZA 5BRPA 3ZO9A 1EDTA 2WSKA 4LPCA 1GOOA 2X0YA 2ZX9A 1V6UA 2A3CA 4W7VA 1ITXA 2J7EA 3CLWA 1VJZA 2VCCA 4A3YA 3MO4A 3WQWA 3GBDA 3CUJA 2DH3A 4PRWA 5LA1A 2OWCA 4CN4A 1JZ6A 3CUGA 1E1EA 4WJXA 3J7HA 3PZUA 1CXHA 3SCWA 2VR5A 2BHUA 3ALGA 3BCFA 4D6FA 4CU7A 1HKJA 4MNKA 2EPOA 3GNRA 4AY1A 1G1YA 3BCDA 1V0NA 1PEZA 2XSAA 3AXIA 1K9DA 2VVSA 4PMDA 2J7DA 5IHSA 3WEZA 1XSKA 3O6AA 2J77A 4OZOA 3QGVA 5I79A 3VD3A 4F9DA 1HVQA 1PX8A 1QI3A 2DGAA 1WZAA 3GZAA 2CBJA 1EO5A 4P8XA 4YN5A 3AIWA 2VX5A 4W5UA 1G94A 2RGMA 1GCYA 5JBDA 1ZBKA 2XFFA 3CZJA 1GJUA 4AZGA 4ACZB 1UWRA 3VD9A 1UQYA 3KEHA 4P7RA 1CGVA 1W1TA 3CZ8A 3GYCA 3IJ7A 2G4FA 7A3HA 1CZ1A 4DWSC 2VNCA 1Q6FA 5DT5A 4UFMA 5CPTA 3VUPA 4PMXA 3FXYA 3T2QA 3LMYA 4QAWA 1QHPA 2VL4A 3IJ9A 1MXDA 4FF5A 1LLOA 5CJ5A 1FA2A 4JCLA 3AFBA 3VMOA 1JNEA 1E6PA 3BMVA 4PMVA 3FAXA 3TP4A 1TA3B 2IXUA 4EANA 3TOPA 3S2CA 2F61A 2WZHA 5CGTA 3EBVA 1E3ZA 1GJWA 1JZ3A 2C0HA 2FHFA 5HPOA 4MAZA 3BAWA 5I23A 2YDQA 2WMGA 3AIBA 2TAAA 3WH8A 2WANA 1BHGA 5ABHA 1EDGA 5CZKA 1WB0A 1CDGA 3GBEA 3WH5A 1B3ZA 1JF5A 5AY7A 3WUBA 3TTSA 4AD5A 1FFQA 1OWQA 4MB1A 3BC9A 4OKDA 4AMCA 4CVUA 4M81A 3AISA 3WUEA 4M82A 1WPCA 4BQ3A 1HJQA 3N9KA 1JXKA 1QI0A 3WH7A 3ARYA 3FHAA 1LWHA 1XHGA 1PJ9A 2FGZA 1ZS2A 4MB4A 1QPKA 2WMKA 3U7VA 5I78A 2EPLX 4W84A 2XVLA 1HL9A 1M53A 2QF8A 1BYDA 2Y5EA 1EHNA 3T09A 4GXPA 3VD7A 3AIRA 1IV8A 1HJWA 3POCA 1OGSA 1X1NA 7TAAA 1HKIA 1XCXA 1GPFA 1KWGA 2J4GA 1UOKA 5EBAA 1M03A 4FMVA 1UR1A 1UD6A 5FCZA 3AI0A 5GNYA 2D0HA 3AHVA 2A3BA 4PMOA 3SURA 4BS0A 2WMHA 4PMQA 4FLOA 4UQBA 3VDCA 1HJVA 5KEZA 4WKFA 4TX6A 2WVVB 4S3JA 1E3XA 1BF2A 2CYGA 1OM0A 1JGIA 1C8QA 4FLRA 4GI8A 2XVKA 1DP0A 4D71A 4R5EA 4JKMA 3SUTA 2WC7A 3PZQA 1V6VA 3GNOA 1MFVA 4JZ5A 1MWOA 1VB9A 1EO7A 2E40A 2CBUA 1Q6DA 2JEQA 2YL9A 5CSYA 1H41A 1W2VA 1F4HA 3CHEA 4UZSA 3BXWA 1B3YA 4AYSA 1B3WA 2OWXA 1M7XA 4HMDA 1OSEA 1K9EA 4PUDA 3OGSA 1BTCA 1UR4A 1E55A 3HU7A 1GQLA 4TVCA 3VNYA 3ZOAA 5AC4A 1MQQA 3L4WA 1OGGA 9CGTA 2D3LA 3KE0A 4AEEA 2DSWA 3B9DA 1IZJA 5ABGA 2AMGA 4E2OA 4M24A 1XH2A 4AZ5A 4D6CA 3A4WA 1JFHA 2EBNA 3OLIA 2OYKA 4JL2A 3NDZA 1B30A 4MTVA 3RPMA 3AYRA 3T2PA 1Q6CA 1LL7A 2W66A 3AIUA 3WD0A 1OB0A 1HT6A 4OJYA 2VO5A 2YOCA 3VGFA 1UH4A 2YBUA 3VIPA 4Z2GA 4AXNA 1WNOA 4B15A 3M6DA 3UG3A 1BYAA 4CUCA 3GDBA 2J7GA 2ZWYA 1M04A 2E9BA 4OIFA 4X0VA 4C7FA 4CVWA 4E8DA 1VFUA 3SUSA 2YKKA 1E0WA 3WF0A 4D1JA 1O7AA 2J62A 4CD7A 1TMQA 3PTKA 2VQTA 1XCWA 3BLKA 1CWYA 1P6WA 2ZUVA 1VEPA 4NI3A 2WMJA 2WC4A 4ML4A 5I0DA 3WD2A 1GOWA 5I77A 2W91A 4J3WA 3WFZA 5LA0A 2J7CA 2VCAA 2W92A 2ZXBA 1H0GA 1J11A 3SCNA 5IXEA 4BZYA 1GORA 1UWQA 1ISYA 2MANA 3L2MA 1ZBVA 1VF8A 1DWFM 3B8SA 3CHCA 4UQEA 1J18A 2WYSA 4HP5A 1CXEA 4HPGA 1WE5A 3VILA 4A3HA 3IJ8A 1KGWA 1HN1A 5CPSA 1D2KA 4M1RA 4D6DA 4W86A 5JIWA 3UERA 3WMSA 4OBRA 1W9UA 4Z2HA 2VURA 4AIOA 1UR2A 4RE3A 1E70M 2A3EA 1TZ7A 2XGBA 1E9LA 3AIQA 3AS0A 4CD6A 4LQ1A 3CZEA 3EDJA 3NYDA 4HA4A 4RL3A 2EPKX 2ZX8A 3U7BA 1V02A 2GSJA 2EPNA 1SMDA 1NP2A 1C8XA 1L8NA 4WSKA 5BXTA 5FD0A 4BQ4A 4UOQA 1CLVA 3WIJA 4X0NA 3VIMA 3ZT5A 1UD4A 4AZ7A 4QLLA 3VIFA 1QVBA 1Q6EA 1ODZA 1LQ0A 2VUYA 2DPEA 4AD1A 2G3JA 3U57A 1SFSA 2BHYA 4V28A 3LPGA 4JHZA 3UR7A 5A6LA 4B9ZA 3BAKA 4MJ4A 1R87A 3BAJA 1GZJA 2DDXA 4PMYA 3VKKA 5A2AA 1G5AA 4QLKA 3QHMA 1W9XA 3RM9A 4J3SA 3VM5A 2O92A 2WMIA 1QBBA 4AZIA 5A6SA 3BH4A 5DF0A 3JUGA 1CIUA 4GKLA 3WDJA 4CD4A 4JFWA 4M80A 1B3XA 2VRQA 3ARPA 5BYWA 2D20A 4D6JA 3NSXA 4JKKA 2QHAA 3WNKA 1DTUA 1UWIA 4PEEA 4W7UA 1GQJA 4WK9A 3AS3A 1W32A 3TONA 3RJXA 3EDFA 4AC1X 5A6JA 4BCEA 3CIVA 4JHOA 1LF1A 4NSBA 1HX0A 1JNDA 3ARSA 4J3TA 3VIIA 2PWGA 5JUVA 5HOSA 3N11A 3IAQA 3ZJ6A 1Q4NX 1KXTA 5GQBA 2NT0A 3DHPA 3EDKA 4ACYA 2BS9A 2E8ZA 2ZXQA 4AD2A 1UKTA 1G0CA 5CPQA 2YIHA 2X05A 3GM8A 3B9AA 1OCQA 1W9BM 5A8MA 3VIOA 4DWSD 2WBKA 4TTUA 3M07A 1U33A 1BGAA 5F7UA 5I2UA 2GJRA 3WEOA 3WDPP 1YHTA 2X2YA 4Z2IA 3VGGA 4R27A 1PZ3A 1Z32X 4JFTA 3UG4A 2V5DA 1VIWA 3CMGA 4ZEPA 2E0PA 3OZPA 3SCSA 2O9OA 4JIEA 3AHXA 4WKHA 1WP6A 2XJ7A 1WZKA 2CBVA 3SCOA 1UR0A 1CEOA 4E4PA 2FHBA 1H49A 4L4OA 4AIUA 1C7TA 2J7FA 3WQ6A 2ZUSA 4PMNA 1ISVA 3VTRA 3ECQA 1WCGA 4PTWA 2XTKA 3CZKA 1IT0A 2WKGA 2WCAA 3II1A 1MW2A 5A2BA 5A69A 1UR9A 3LPFA 3W24A 4AEFA 4J27A 3HMCA 1DWIM 3BAXA 2UY4A 4J3XA 5HDRA 1V3IA 1KGXA 5BROA 3TTQA 5C70A 1JL8A 1OBAA 2BHZA 4W5ZA 3AYSA 3WMBA 3L4ZA 1FH9A 1TG7A 2D1ZA 3FAWA 3WBAA 1GNXA 1MW0A 1UWUA 2ZXDA 2YA1A 2E9MA 3N1AA 1NM9A 3WNMA 3GH7A 2ZIDA 1UR8A 4DUXA 3AIEA 1HXJA 1JD7A 3L4VA 2D22A 1CXKA 1TCMA 4UFHA 3KL5A 5EFFA 4U33A 1UWSA 1TE1A 1JD9A 1W9PA 3CPUA 1V08A 2YLLA 1CENA 1PZ2A 3WBEA 1VEMA 4UOJA 2JF6A 5HNNA 4F9JA 1US2A 4LGXA 5E70A 1GQIA 3N18A 4P7LA 5A6AA 4PBGA 4CN1A 4BF7A 4NRSA 1U2YA 1MW1A 1S46A 1G01A 4PSRA 3WDRA 3NIYA 4GZJA 2JIEA 4CD5A 1E72M 3F4VA 3W4RA 1XV8A 3WUFA 4J28A 2ZX5A 1FH7A 1VEOA 2X0HA 3QR3A 3ARRA 3B9EA 3OB8A 4JKLA 1V3KA 5D9NA 5BWFA 1JAKA 4ZE4A 3RILA 4IUGA 4IPLA 1DWGM 3QHOA 2D2OA 2G3IA 1JYVA 5A2CA 4AISA 2VCBA 4PMZA 1E6RA 2NSXA 2WXDM 1EDQA 1GVIA 2D0GA 1KFWA 5DO8A 1BQCA 4UQDA 4Q7NA 4WLCA 1V6YA 1V6XA 5A6BA 4HOWA 1BLIA 2FDMA 2GK1B 3PTQA 1C8YA 3WD4A 1I1WA 3NSMA 4H2CA 2CHOA 4Q22A 3O9NA 5BRQA 3G6MA 3MUZ1 1N82A 5FKYA 2YL8A 2WK2A 1QI4A 4PTMA 4U5IA 4WIWA 5AYIA 4AW7A 3N17A 4TUFA 3KWXA 4F79A 1TA3A 1OD8A 1R8LA 1H11A 3CHFA 4ZXLA 3ZJKA 1E6SM 2YL6A 1BYBA 4PCTA 3BSHA 1QW8A 2J7BA 1R86A 3SUWA 4EAMA 2QLYA 2VOTA 3M7SA 3RM4A 1HF6A 3VO0A 4B3LA 1V3JA 2V3GA 2O9TA 1UHVA 2PC8A 4W8BA 3VGEA 4D1IA 3I3EA 3K1DA 3WF4A 3WUGA 5D9PA 2W67A 3NUKA 1E6XM 1HJUA 3A4XA 4NRRA 1H0IA 3ARXA 3GNPA 1RP8A 3D3AA 3VU2A 3WY1A 5I5RA 3EMQA 4P8VA 5D8WA 2XUCA 2HVMA 2J8GA 1VFMA 3W53A 2FH8A 1BGGA 4U5KA 3NJ3A 1QHOA 3ZT6A 4MJ2A 1XRVA 4GQQA 3VIJA 3VD5A 1J12A 1XYZA 2WC3A 5D9MA 1KGUA 1PAMA 3W81A 1UD8A 2VRKA 1PPIA 6CGTA 3VNZA 2DT2A 2WLZA 1MVYA 3RMEA 1GVYA 1W9DM 3T0AA 3THCA 4ATLA 3SEPA 4P8WA 2YA0A 3THDA 2G3MA 2WWDA 5D4YA 1PX4A 4GINA 4W87A 1JYXA 4PMRA 1J0HA 1CXLA 1VFOA 2DSVA 1CECA 2Y2WA 1VENA 1GW1A 3IAPA 4B3KA 2PWFA 4GZIA 3ZQ9A 4GPNA 1JF6A 4P8UA 3OLEA 3EDEA 2GJXB 4P7OA 4PTVA 4AIEA 4ZFMA 1XD0A 4FLSA 3S6TA 4YPJA 3W29A 1AQHA 3GH5A 5EB8A 2BFGA 3MSDA 1UH2A 3MMUA 2D24A 4H7VA 4CCDA 1NQ6A 1UA3A 2WVTA 1BG4A 1E15A 4GI6A 2WZIA 1JZ5A 1FP8A 4MDOA 4HU0A 2FHCA 1XH0A 4MADA 4U2YA 4CD8A 3CZGA 1C92A 4URIA 2WB5A 4H41A 2DQXA 4L4PA 1DEDA 4JFUA 3AICA 1W1VA 4H8UA 3MUY1 1B0IA 1UD2A 3QOMA 3AOFA 5EFDA 3MMDA 4BQ5A 4RE2A 2UY5A 4MNMA 3IANA 3OBAA 4UCFA 4NF7A 1B3VA 1PIGA 2WMIB 2C7FA 4UR9A 1W1YA 2BVDA 4TTGA 1VAHA 1ZBCA 3WN6A 5CLTA 3W82A 1QW9A 5DT7A 1FHLA 3CUIA 4AZBA 3MV01 2WM0A 1R85A 5A6MA 3GXIA 2VRJA 4IISA 1R7AA 2XYLA 2A3AA 4KGJA 4CU8A 5A94A 4AWEA 1IZKA 2GJXA 1RP9A 4MB5A 2YBTA 2V3FA 3K4AA 1JXJA 2ZUWA 1FOBA 2XIBA 1JZ4A 1MXGA 4XUYA 5I24A 3NSNA 3WMCA 1KCLA 2BXZA 2DSUA 1E4LA 2PI6A 1LG2A 2W63A 3ZR5A 1WZLA 2W5FA 3EYPA 1LJYA 5FIPA 2W61A 5FL0A 5D8ZA 1DHKA 2ZXAA 1KQYA 3OLGA 2DT0A 2DSZA 4AZCA 4JFVA 3ARUA 4DM1A 4J7RA 4CKQA 1X6NA 4A4AA 4U31A 4YHGA 2GK1A 3WDQA 5BXPA 1XSJA 2E9LA 3M46A 2CHNA 1UH3A 1OGBA 2UY3A 2PWEA 1XYFA 1CGTA 2X1IA 1EXPA 4ZE5A 1CNVA 2XM2A 4W89A 3BSGA 5HXMA 3PZOA 2UWFA 1QI2A 2VZUA 3K8LA 2CITA 2W4XA 1QNRA 4BA0A 1Y7VA 4MNJA 4TXEA 3WD1A 3RIKA 2WVVA 1JZ7A 3W38A 3ALFA 1XD1A 1J0YA 2ZUTA 4AZ6A 4CU6A 1ZBWA 3UG5A 5ABFB 1E6ZA 3VGDA 4DUVA 1CLXA 1B31A 1B90A 4Z2KA 2IXVA 4ZENA 4HU8A 5LYRA 3K8KA 2QPUA 4UOZA 2XGIA 1LL6A 3VGBA 2EQDA 1EH9A 2CKSA 2V38A 2EEXA 4U3CA 1KBKA 2QMJA 2VX7A 1J01A 4D6IA 1ZJBA 1ZL1A 2A3HA 1V0KA 3ARQA 1E6NA 1FH8A 2UY2A 2WHKA 1EA9C 1XGZA 3CGTA 4EE9A 1UQZA 4W8LA 5A6KA 1MQPA 5I6SA 2GFTA 4PYSA 1QNOA 2XVPA 4LYQA 2XWDA 4NZCA 3K4DA 2WPGA 3MS8A 3HJEA 3PZVA 1C90A 4CGTA 1VRXA 1OINA 1JDDA 3GH4A 5IHRA 4P7QA 1E40A 1OT2A 4XV0A 1UD5A 3WQ4A 3PN8A 2ESCA 2HISA 3BLPX 5E9AA 3ZJ8A 3A4AA 4V2XA 4OOUA 2X09A 2XHYA 3FN9A 5I3DA 2XM1A 1GONA 2JFEX 4QLJA 1UWTA 5BXSA 2JIWA 3PZMA 2CKRA 1WKYA 3W25A 3VM7A 1LL4A 1E0XA 3GXFA 1KBBA 2BY1A 5JIPA 1RD6A 4HA3A 3FY1A 2VJXA 3L4YA 2OLHA 2OSYA 3WENA 1RPKA 3MU7A 4FLQA 4XZBA 5ABEA 2WVSA 1NOWA 1ECEA 4KH2A 3WNLA 1GOIA 1OIFA 3CH9A 2YA2A 4W93A 2OYLA 3SCRA 3A3HA 3LPOA 4EK7A 3DC0A 4TOQA 1TR1A 2PWDA 2Y24A 4PN2A 3WKZA 1D3CA 5ABFA 1ESWA 3PTMA 2OWWA 1HL8A 1C93A 1UKOA 1E56A 3AS2A 2DIEA 2J79A 1NARA 1MQRA 3CBWA 3PZ9A 1QBAA 3BMWA 1AQMA 4MNLA 3L4UA 1C91A 1TUXA 2BXYA 2CETA 5JBEA 2YDRA 3AHYA 1M01A 1CGUA 1YQ2A 4KGLA 3VIHA 1OD0A 3DECA 3AMKA 4X9YA 5BXRA 4W7WA 2XG9A 4HTYA 4GQRA 4XX6A 3WELA 3N04A 3OGVA 4UTFA 1D7FA 1HJXA 2WKLA 2Z1KA 3N13A 4B9YA 1HP5A 2D0FA 4CN6A 1KB3A 4HMEA 3WQVA 5CSUA 2VZTA 3AJ7A 3FHQA 2D3NA 1K9TA 1KR0A 3L2LA 2V3DA 1NWSA 4UQAA 3SCVA 2DSKA 1UUQA 3WNOA 1CTNA 2F2HA 3AQUA 4JL1A 3WSUA 3GXDA 4D6GA 2XSBA 2BY3A 4UFLA 3DYMA 3PBGA 1ZU8A 2VTFA 3N15A 3O2LA 2OSXA 1WDRA 1KXHA 2CNCA 1V6WA 3WF2A 3VDAA 3PZNA 1CGXA 3AXXA 1GOKA 1GHSA 1UZ1A 1E73M 2PF0A 8CGTA 3WH9A 3IK2A 4B16A 3E1F1 1CBGA 4Z2JA 2O9PA 4GO9A 4FK9A 1W91A 1RH9A 1W3JA 2YL5A 3PHAA 4PTXA 1JZ2A 4PCSA 1KQZA 4LYPA 2JALA 4XZWA 2VZSA 2JF7A 1ISZA 1ITCA 1BYCA 2XVGA 3W6LA 3WNPA 4C7DA 4JAWA 1V0MA 2VI0A 3WEMA 4UFIA 1EOKA 1R7OA 1J9YA 2GJPA 4S3KA 4QCFA 4ATDA 4Y7EA 4D72A 2ZWZA 3EMCA 1HNYA 4QFUA 1JI1A 4DM2A 3WL0A 1QOXA 3QOKA 3ARZA 1EQPA 2QV4A 1QI5A 3AROA 2EO7A 3AHZA 5C8BB 1QNPA 3CMJA 2WWCA 3VD4A 1W3KA 2BY2A 3ZIZA 1XC6A 3RM8A 4MAVA 3W26A 2CERA 1NWRA 3CUHA 2PWHA 4OUEA 1W2PA 2RGLA 1MFUA 2VQUA 3RCNA 1LWJA 1TFVA 4IPNB 1I75A 2CBIA 3DYPA 2XFYA 4HZ7A 1QNSA 3AMDA 4DWSB 1W3LA 2WBGA 4OBSA 3WD3A 1HKMA 1UKQA 1I1XA 2YLAA 3AXHA 1E43A 2WW5A 4N42A 1GUVA 1EQCA 2QMKA 2OYMA 4OOZA 2BY0A 2GUYA 2W62A 4ZXOA 1H5VA 1UZ4A 4HZ6A 1HVXA 3WH6A 2J8FA 2XIIA 3AZTA 4IM4A 1V0LA 2GDUA 1QNQA 3VGHA 1CYGA 1HJSA 3ZT7A 5JBFA 1U30A 3APGA 1A3HA 5TD4A 2G8ZA 4QDMA 2JEPA 5DFAA 1H2JA 5CG0A 5M17A 1WO2A 2J74A 3SCQA 1CXFA 2J25A 4PUEA 1WDQA 5CXPA 1HP4A 2PB1A 2BVTA 3VIKA 2NW0A 3U5UA 2CXGA 1E1FA 4U2ZA 4AD0A 2CESA 1J0ZA 1L0PA 1VFFA 1H4PA 3MMWA 4HPHA 1HIZA 3VVGA 2Y8KA 3MANA 4BQ2A 1GOQA 2GDVA 1E0VA 1BPLB 3VX1A 2EPMX 1UG6A 3DYOA 2VX6A 5A8PA 2QPSA 1MYRA 1NOUA 5JH8A 2DT3A 3TTYA 3BAYA 1ZB5A 3W0KA 2VZOA 1EOMA 1KXQA 2B31A 1J0IA 3MUAA 1CGYA 2WHJA 5A95A 5A1AA 2WHLA 2AOSA 2CEQA 1H3GA 3SCUA 1AMYA 3VINA 3ARTA 4F8XA 1AQ0A 2Z1SA 1EHAA 1K9FA 2WVUA 4HMCA 4MDPA 1E4NA 3WDIA 1FP9A 4ACZA 1NWUA 4GIAA 1V03A 1WAWA 4QCEA 4EKJA 4H8HA 3AMCA 1C7SA 1PBGA 1VBRA 1BVZA 4KMQA 3VMNA 3F5KA 3RJYA 1EIBA 1KCKA 4GI9A 2OSWA 4J3VA 4CCEA 3SCTA 5FOOA 1W9VA 1NH6A 2Y8VA 3VDHA 1SMAA 4F66A 2VR4A 3ZR6A 3ZSSA 2VT0A 4LXFA 3VOCA 2VZVA 3WNNA 3DHUA 2WAGA 3TA9A 3WF3A 2XVNA 3A6OA 3OG2A 4PMUA 2FH6A 2WMFA 5CGMA 1GQKA 2EXOA 3WL1A 1BFNA 1J10A 1V3MA 2YJQA 3MKKA 4YHEA 3VIGA 2V5CA 5GNZA 1CXIA 3OLDA 1X6LA 3W28A 1BVNP 2BV9A 2CCRA 3UCQA 1OIMA 3MV11 4UQCA 3PZTA 1UKSA 1E5JA 2CPUA 1E6QM 3AIVA 3K8MA 3BAIA 5GPRA 3D5HA 4WSJA 4E8CA 3SCPA 3ZM8A 1AVAA 4PSPA 3SUVA 1DWHM 5CLWA 1TVNA 3L4XA 3WFLA 3W37A 2DEPA 2G41A 1C3FA 1G9HA 5HBFA 5GNXA 5AC5A 5CQ1A 4W8AA 1XSIA 3MUIA 4HA1A 1B1YA 4N0RA 3BGAA 4AD4A 5KZ6A 2X8RA 3HN3A 1E5NA 3U5YA 3SUUA 5A6BD 1XH1A 4WF7A 1JI2A 3G6LA 3AZRA 4AZHA 2E4TA 1ISWA 1SYTA 2JE8A 5E0FA 3GTNA 4W85A 3POHA 5A8OA 2ZICA 2CIPA 1KWKA 1ISXA 4M56A 2J7HA 5A8QA 4RE4A 1WDPA 4LYRA 4HZ8A 3KZSA 1PIFA 4H8VA 1A47A 2YDSA 4LX4A 1V3HA 5D9OA 4D6HA 3N12A 5LA2A 3EDDA 2ZX6A 4J3UA 2WCGA 3QHNA 1JDAA 1F4AA 4KWUA 4UNIA 2WSPA 2J47A 2WZEA 4Z2LA 2FGLA 4C7GA 4TVUA 1JDCA 4CCCA 3T2OA 4JFSA 3KL0A 3AHTA 4AD3A 1O6IA 1UD3A 4KRTA 1EGZA 4V27A 3UESA 8A3HA 1K6AA 4UFKA 5ECUA 5BCAA 1H09A 2D23A 4AZCB 2AAAA 2ZOXA 3CO4A 3AZSA 3TTOA 4W88A 4TVDA 3AS1A 3WQ8A 3ARWA 4DWSA 2BNJA 6A3HA 3K46A 4GZEA 2WLYA 5HPCA 1NOFA 3MSGA 3KL3A 1V02E 2ZUNA 1JG9A 1CPUA 4P7NA 5C71A 1Q6GA 1ZJAA 4K68A 2IUZA 1B2YA 1BSIA
chains in the Genus database with same CATH superfamily
1OX4A 1LG1A 3V5OA 3G8RA 2AKMA 4YS1A 3ENLA 4DJEC 5IFPA 3RO8A 1ODUA 3VMPA 4M8UA 4G50A 1JYWA 3TLQA 5D03A 3SIMA 1MDLA 2Y0FA 3VC6A 2V3EA 3SRFA 3R8GA 2QIWA 3WDHA 3CTTA 2MLYA 3GG1A 2I5QA 2C8NA 3ZMRA 5E0CA 2NVAA 3UXAA 3R8HA 3QLDA 1E1CB 1TR9A 2ZVRA 1JCYA 1OYBA 4G7EB 2VEFA 1J2BA 1X98A 5AFDA 1ADSA 4FXFA 4AY8A 1H5YA 3NXFA 4D6EA 3N3TA 4U3AA 5C0QA 3B8VA 2B7PA 1S5TA 4LUSA 4HNUA 5IFTA 1W1PA 3PR9A 1TVPA 1OT1A 4Y8EA 1SR0A 4HCLA 2NV2A 4DRIA 5FL1A 4ECLA 7CGTA 2QCCA 3T0DA 2O9RA 1RAKA 1P0DA 3OIHA 4UZUA 1TQJA 3IV8A 2J13A 3M4HA 4QHRA 4B2DA 2PWVA 1FWSA 3I6TA 4TMBA 1JGMA 2PV3A 3A47A 2ZX7A 4WKAA 2Q8XA 4PA8A 3S1VA 1FWNA 1J93A 1EGMA 4TX8A 1HKKA 3WLTA 1QNVA 4EPDC 3USBA 3LCXA 2RUQA 3O0KA 1WQ5A 5G1TA 2EJ1A 2Z1BA 4H6RA 5DIUA 4C1LA 2WCSA 2WNWA 4PB3A 3SQSA 2NQZA 3VKAA 3SSJA 2G95A 1J0JA 1FX6A 3MWAA 4O54A 4LOCA 2C1IA 2VC5A 4XUGA 3L0NA 1H61A 1VFSA 1AUSL 5D2WA 3UBPC 1F3WA 2VMFA 3H6OA 1GHRA 3L4TA 4UTHA 3UEQA 3PZGA 4GUJA 2ZQTA 2JGYA 3OA5A 1YDNA 2W3ZA 4ITZA 3WK0A 4C1NA 1LLZA 5CBJA 4HPJA 2R82A 3HG4A 3G8EA 5A8NA 3L2IA 3MP4A 3V4BA 3Q2DA 4O1FA 2YZRA 5DBUA 3AMLA 2J78A 1S5MA 4JCMA 2DORA 2X1RA 4Q8QA 3R8RA 5EMYA 1FWEC 1NWTA 1WZMA 2DV0A 3ITLA 1E71M 1BWVA 3PPCA 3EMZA 1UJQA 4JX6A 3ZO9A 2QAPA 4QJ5B 5KZDA 3F2CA 2ZQ0A 4O11A 5C9XA 4LPCA 3SRHA 1XGEA 4GMEA 1GVOA 1ZRQA 4S3FA 1PUDA 4FNSA 2GGEA 1VJZA 2NXIA 3GDKA 5K4XA 4ODQA 1THFD 4YVPA 4YNGA 2DH3A 4BEUA 4DXKA 5LA1A 2HPMA 4Q32A 4XK2A 3NQEA 2Z27A 3NQAA 1R3RA 2J9XA 3OO2A 4GUHA 4S3DA 3ALGA 2EPOA 1G1YA 4FXSA 1JDEA 3W3OA 4IPIA 3LHUA 2P5NA 3LERA 3DENA 4JTFA 1K9DA 2VVSA 4B5TA 2J7DA 3L23A 2ATSA 1XIHA 3IVTA 1FDJA 4OZOA 2R1MA 1XJBA 5I79A 2ZTKA 5D75A 1PX8A 4H2HA 3IIPA 2HE5A 1RA0A 3H12A 1EX5A 4C6QA 1G94A 4FXRA 4KS0A 3E0WA 1GCYA 2CFFA 2XFFA 1ZPTA 4AZGA 3CQKA 3ISIX 1UWRA 3VD9A 4RR4A 1UQYA 1ICSA 3GYCA 4GNJA 1NELA 2HDJA 4NZ4A 2VNCA 5DT5A 4ODLA 5I00A 4UFMA 5CPTA 3VUPA 5GVJA 3RCMA 2ACSA 4NY2A 3LMYA 4QAWA 1VR6A 2Q8ZA 3CHVA 5CJ5A 2PCQA 4JCLA 3RFAA 1LP6A 2QDGA 1Q2SA 1XGDA 1O5KA 4I7UA 1FKDA 2NQLA 4PMVA 4NNAA 3RGCA 1YBQA 4V33A 2NUYA 1GQNA 4EANA 1QCWA 5CAKA 3WLJA 1PKLA 2GGIA 4ODPA 5CGTA 3EBVA 3RYSA 1ZZMA 3R89A 2FHFA 3MB9A 5HPOA 4MAZA 4LUJA 2YW3A 4KFNA 5I23A 4Q4OA 1C9DA 3AIBA 1XYLA 3DCPA 1UW9A 2AAMA 5G4WA 2WQDA 2OOFA 1K8YA 3GO2A 1B3ZA 3IJIA 4LB3A 1V93A 3UXIA 4XISA 1J6OA 1OWQA 2P10A 2XP8A 4MB1A 4C6LA 4OKDA 4XAKA 3M0LA 4CVUA 5CPNA 4M81A 3PB0A 4BQ3A 1HJQA 2QCHA 3ARYA 1LWHA 1PJ9A 1YPXA 3PWAA 2UV8G 1QPKA 3NPUA 5I78A 2PDNA 4H3DA 1G67A 2VEPA 3NZ1A 4W84A 1VLWA 4QJ1A 1M53A 2Y5EA 1J5SA 4HNCA 4QJ3B 4GXPA 3AIRA 4O10A 3S6DA 3FJNA 1JPKA 2Y62A 5K9DA 1EEPA 2PDUA 3TK7A 3S9YA 3O5PA 1M03A 1VHCA 3CAKA 4OHQA 1UR1A 5FCZA 1LOQA 2D0HA 2Y7FA 3S2NA 4PMQA 4FLOA 4DJFA 1QPNA 4O53A 3VDCA 5KEZA 3W85A 2ZCGA 3KZ7A 3NA8A 1JGIA 4WDXA 3EX2A 5D32A 2Y89A 4AC7C 4GGQA 1KFBA 4D71A 4R5EA 3EX3A 2A6NA 1DXEA 1KTNA 1V6VA 3THAA 1RALA 4JZ5A 2NV1A 1EO7A 4XTDA 1EJVC 2CBUA 4ZTXA 3MJYA 1OG6A 2BOEX 5AYZA 4E2VA 1VCGA 3QTGA 1F4HA 2WJFA 3CHEA 3STEA 1B3WA 2OWXA 1MDRA 5F4WA 1AW2A 4Y6GA 3HU7A 1R9ZA 1B3OA 1BRLB 1P0KA 3W1NA 1Q85A 3ZOAA 3KABA 2A7NA 1OGGA 3WQPA 2D3LA 2PPOA 3DUGA 4N9CA 3PRBA 2YCKX 1TCOC 1ONEA 3SN4A 4E2OA 1PV8A 2PUZA 1ZGDA 3GC4A 3A4WA 5KSWA 3GVQA 4FEZA 4P2VA 2OYKA 1Z89A 2XDFA 4IJRA 4DELA 5BWAA 4JNMA 3NPWA 4XD3A 2W66A 1QTWA 3WD0A 4TQTA 3MCNA 1DJHA 4AXNA 4CNNA 3R43A 3M6DA 3GDBA 2Z7GA 2E9BA 1Q1CA 4OIFA 4K8EA 4X0VA 2EKCA 3TIMA 3T7VA 1VFUA 2YKKA 2PDGA 4D1JA 3PTKA 4JXCA 1CWYA 1P6WA 2ZUVA 5LNSA 1FKSA 1VEPA 4NI3A 1OZQA 2AWGA 1TTQA 3GG7A 5I0DA 3WD2A 5CZJA 5I77A 1VH7A 5LA0A 3LRLA 2J7CA 4L6OA 1NU5A 2ZXBA 4BJHA 4MVAA 3S5ZA 3UNDA 3TH6A 1SFJA 4MZ1A 3GD6A 1UWQA 2KO7A 1VF8A 3B8SA 3CHCA 5LIKX 5TIMA 4UQEA 1J18A 4M0XA 3RG6A 1CXEA 4HPGA 1FY6A 1WE5A 1F07A 3VILA 4ALDA 1EEXA 1HW6A 5DRIA 4LAWA 4O1BA 2DG3A 2BWGA 3HG3A 3LM7A 4M6PA 3TYUA 4OBRA 3P8JA 1W9UA 5HUOA 4Z2HA 3NZRA 2Y5JA 3PPGA 1FHVA 1SW3A 2J24A 1KM1A 1QUMA 4WGHA 5EA9A 4L9XA 3EDJA 3NYDA 5D2XA 4E5TA 4QRNA 4KCWA 3PUGA 2ZX8A 1V02A 4WSKA 1VFTA 5FD0A 2Z6JA 3M0MA 4A6GA 3VIMA 4UTLA 1TWIA 4X0NA 1UD4A 4JNYA 5DXXA 4RNIA 3UCCA 1NIUA 7REQB 4DJED 2RDUA 1ODZA 1TX0A 5AHFA 1K7EA 4KCTA 2VUYA 2DPEA 4GYFA 7ODCA 2ACQA 4DRKA 2HS6A 1BL4A 1OG0A 3LCWA 4L9YA 3T40A 1A7XA 5A2AA 3PBVA 5LGXA 1DJYA 1G5AA 4OQVA 1YE4A 3GYEA 4NAFB 3W7GA 3RM9A 3GFXA 2OJPA 2O92A 4MKVA 4AZIA 1Z9AA 3PPFA 2BVWA 4XKYB 1RXOB 1U79A 2D2JA 4NJGA 3LXAA 1CIUA 2B7NA 3W2MA 1X7FA 4M80A 2WV8A 2OZTA 1JQVA 5BYWA 2D20A 4D6JA 4M6UA 2NZLA 5TAOA 1SGJA 1DTUA 3KBNA 4W7UA 3AS3A 3TONA 3UNTA 3EDFA 4AC1X 3NQGA 2YB4A 4JHOA 4CEXC 1HX0A 1JNDA 5G1YA 3ARSA 3B06A 1VBJA 1KRBC 2PGEA 1MXSA 4DHGA 1SO3A 4UTUA 2ZADA 4X61A 3EDKA 3DHPA 5I3IA 4NNCA 1J4IA 4ODOA 3RPDA 5H8MA 3FXGA 1OVDA 3V16A 2ZTJA 4A3UA 2ZA3A 5CPQA 4B5NA 4L4LA 1OK6A 2WBKA 1I2QA 3KBJA 3M07A 4RZ4A 3O63A 3BJFA 1ZAHA 3GXTA 3VGGA 2FKPA 3E5BA 3MW7A 1Z32X 3CMGA 4ZEPA 3SCSA 2XH7A 2O9OA 3BG5A 1QW7A 4FNUA 3AHXA 5FSDC 3RU8X 1WZKA 2CBVA 5T26A 4E4PA 5BNKA 1VFLA 3GAYA 1J5TA 4AIUA 3UJEA 4U84A 4I9TA 2ZUSA 1ISVA 1S1RA 4L1GA 4A8IA 3CZKA 1IT0A 3QV8A 2RJGA 3WZ0E 2A1YA 1GOXA 1RD5A 4DXVA 4AEFA 2Z24A 1FVPA 3QYQA 2EGZA 4BI5A 4J3XA 1MNSA 1PS9A 4K39A 3FGCA 1KGXA 3ABRA 2QDEA 2P0OA 3LHTA 2EHHA 1ZCNA 3C2OA 3DKJA 2RAGA 1GNXA 1UWUA 1S3HA 2FPYA 1G7VA 3N1AA 4UTWC 1JD7A 2RQSA 3L4VA 1K70A 2D22A 2JZVA 1EZWA 2TPSA 4P61A 1C9WA 1CXKA 3AUJA 3ATYA 4U33A 5EFFA 1W9PA 1V08A 1PBKA 1SPQA 2YLLA 1PZ2A 5D33A 1RK5A 3VAVA 1TELA 3P14A 5FF4A 1S2CA 5D30A 3VNLA 5C2GA 5HNNA 1M7OA 1GKPA 1US2A 4HCDA 3SADA 1FWWA 3N18A 5A6AA 4H6KA 4CN1A 2G96A 4NRSA 3HPSA 1F05A 4ZSTA 4HJFA 1BKFA 4MUZA 2JIEA 2PGRA 1NY1A 4QAIA 2E28A 4J28A 4LAOA 2ZX5A 3W7PA 3QR3A 2X0HA 1A3WA 2W27A 5HINA 4JKLA 1V3KA 3RFWA 5BWFA 1JAKA 1D9EA 4ZE4A 4IUGA 2REQA 3WJXA 4Z1YA 4W4QA 5FJIA 2D2OA 5GJPA 2QCLA 4B2DD 2OGYA 4DVOA 5A2CA 1YDVA 1FDZA 1OC7A 2VUNA 4PMZA 2DZSA 1GGOA 3WLMA 1XLCA 4R9OA 2D0GA 5DO8A 2PDLA 2V9DA 4U86A 4WLCA 5FEPA 1XLMA 2FDMA 3SRDA 3O6YX 1RBLA 4DBUA 1C8YA 3TC7A 5G4HC 4IP5A 4RZBA 4DPQA 3O9NA 5BRQA 5RUBA 3MUZ1 1CX9A 3S1XA 1SZNA 4CQ8A 2WK2A 1FHUA 1QI4A 5G2HA 3NQ6A 3PNUA 4JDBA 5KTLA 3UQNA 3KWXA 3C4UA 1JNTA 4NJJA 1OD8A 1K6WA 4WJ8A 3C2FA 5IRPA 1H11A 3CHFA 4OV4A 1E6SM 4BF9A 1E51A 3U2ZA 3DGRA 3F4DA 2QGHA 3IJLA 3M47A 2QLYA 5FJRA 2X1TA 3M7SA 4XAFA 3EA3A 4PL2A 1HF6A 4HSNA 1V3JA 2V3GA 2YPIA 1CB2A 2PC8A 3G18A 4H01A 1E6XM 1HJUA 4AMAA 1H0IA 3ARXA 3CQJA 4JFLA 3NL5A 4C6BA 2I9UA 3CAWA 2J8GA 3KOXA 4WCJA 3UJRA 3PM6A 3EOSA 1UPMB 2FH8A 4ZSUA 1QHOA 3R7MA 1PZ1A 5DN1A 3VIJA 3W23A 2E6YA 3S2JA 3W1TA 3N4EA 1QK2A 3A23A 3EIPA 2H3DA 2QDHA 4LAVA 1V8EA 4G1NA 2HNHA 1PINA 1PE1A 2N87A 3LYEA 1MVYA 3C5QA 3SEPA 1RQEA 2WWDA 4X22A 1PX4A 4GINA 1R2TA 4W87A 5L9FA 4PMRA 1RJQA 4Y9AA 2DSVA 4NZ3A 2Y2WA 1VENA 1GW1A 1WX0A 3IAPA 4B3KA 2Q8LA 4GPNA 5BW6A 1JF6A 4P8UA 1DJZA 4JYSA 1D6OA 2JGQA 4ODRA 4AIEA 4BK9A 4ZFMA 3D47A 2O4QA 4DRPA 3LHVA 1W37A 2ZDRA 4NYYA 4S2CA 4YPJA 3W29A 4GXWA 3F2DA 3EB4A 1JDFA 3VE7A 5EKYA 1U5HA 3ABQA 4S3GA 4RXGA 1BG4A 2A6LA 1E15A 1FP8A 3GHRA 3GFZA 2DZPA 3FV9A 2WM1A 1YNQA 4WOQA 1UB3A 2ZZ5A 4CD8A 3ONBA 1A5MC 3L21A 4REQB 2WB5A 2WOQA 5CBIA 1DEDA 5C2XA 2BDQA 1W1VA 4NJIA 1U5VA 3NVDA 1UD2A 1M5YA 2DP3A 4I7WA 2O7SA 1QXLA 2WJEA 3WCZA 3UFYA 4JTJA 2IKGA 3GDMA 1XYCA 4BI6A 1B3VA 3CIXA 2C7FA 4ADUA 4LF2A 3SQMA 3EZ4A 1VAHA 1KV8A 3EGJA 3BVJA 3WN6A 5CLTA 3V35A 1YYAA 2ZRUA 1FHLA 2H3BA 5I3HA 3MV01 2WM0A 4C90A 3GXIA 3EXSA 4O4VA 3CUXA 1KRMA 4C02B 4CU8A 1XG3A 3FYYA 5A94A 3HA1A 4LSBA 5MKGB 3KFTA 2GJXA 1RP9A 4FALA 1XLGA 2OCZA 2QCEA 3K4AA 3VCCA 1FKLA 4B92A 2CWNA 2PBCA 2XIBA 5AHLA 1Q13A 3NSNA 4PRTA 3PJXA 1FWTA 3TAOA 2BXZA 2DSUA 4UMAA 2PI6A 1LG2A 5F1UA 3ZR5A 1A0DA 3LN3A 5I03A 5FIPA 2W61A 3E2QA 2PZNA 3O15A 1DHKA 3TYCA 3QY8A 3S8HA 1YNPA 4JFVA 4DM1A 4DJEA 4CKQA 3TNBA 4YHGA 4LU0A 2VWSA 1UUMA 4Z1BA 5BXPA 4HJWA 3M46A 2CHNA 1G4SA 1OGBA 3W2UA 2X1IA 1CNVA 4A35A 4LY4A 4LAYA 4W89A 4HK6A 3T78A 1SO6A 1LBFA 5ENLA 3W00A 3G1HA 3BSGA 5HXMA 2FZBA 3PZOA 4KCVA 3I4KA 1L6WA 1QI2A 2PU0A 4L1XA 2FPTA 4BA0A 4MNJA 2OT0A 3G5EA 4RXFA 3ZVHA 1JZ7A 3W38A 3NAVA 3ALFA 1XD1A 3IRSA 4LCQA 2YB1A 4MYXA 4ZENA 2PLJA 3NEVA 3VABA 2XGIA 4W9TA 3TC3A 2XP9A 1EH9A 1AG1O 2C16A 2PFHA 4PH6A 3K13A 4GNVA 3WBWA 2VX7A 1J01A 3KWSA 1ZL1A 4H83A 2A3HA 4IQLA 2XP6A 4IFRA 2YXXA 3QF0A 3DU0A 2DZWA 1DV7A 2FIQA 3I6RA 2AMXA 3VC5A 4DIAA 1W8GA 4V1XA 2HS8A 2BG5A 2GFTA 4LF1A 5G5IA 3NQMA 4GIRA 1W0MA 1QNOA 2XVPA 3MUXA 3V1HA 4LYQA 3TUUA 3PTDA 4CGTA 2QCNA 1JDDA 3W83A 4DNMA 1WXJA 4LYKA 4XV0A 4IIDA 1O95A 4Q6XA 3BLPX 4IUOA 4ZPTR 5I3DA 1KA9F 2XM1A 3B97A 4QLJA 2PDWA 1EB3A 1Q7QA 2CKRA 1AH0A 4D8LA 3VM7A 2FKEA 1XLAA 4NQ1A 4PUJA 2VJXA 4R7OA 5K9CA 1JPHA 2YBVA 4Y96A 2OLHA 2R1KA 1DJWA 3WENA 3B4YA 3QFEA 3TEVA 1NOWA 4AF0A 1XIFA 5AC8A 4KH2A 4NNBA 2EG8A 3LX9A 4K7VA 1OIFA 1PWLA 1HQTA 3W70A 1F3TA 3R5EA 3MCMA 2PWDA 2ZRVA 1D3CA 3PTMA 2RUCA 2CLKA 4EPBC 1S3TC 3RO6A 1T6MA 3W9ZA 1L6GA 1BSLA 2OX4A 3AS2A 2DIEA 2J79A 3MPGA 5F2MA 1MQRA 3CBWA 3KCLA 2E7FA 3MZNA 1ZHAA 1TJ0A 3DERA 1EQ3A 2A79A 4GLEA 1TUXA 4JIQA 1ME9A 2BXYA 2ISWA 2CETA 3IJQA 2B0MA 2ZR6A 5JBEA 2FZNA 4FX8A 4RDYA 2FAPA 3VIHA 4S3CA 3C0QA 3O6CA 4PBEA 3TZNA 1R46A 4QZVB 2YGYA 1EXBA 1XLJA 2H6RA 2ON3A 1QATA 4AYGA 3S2MA 1I4NA 3W2JA 1OFPA 3RMJA 5M1TA 3W88A 3OGVA 1V7AA 1D7FA 2QJNA 2XP3A 2Z26A 3N13A 4B9YA 3UZWA 4HMEA 3LQLA 3FHQA 2D3NA 1K9TA 3NOEA 2ISVA 4JGDA 4C91A 1NWSA 4UQAA 1ZQ5A 2DSKA 1N8FA 4M6VA 4JL1A 5I98A 3LNPA 2XSBA 2MPHA 2BY3A 4UFLA 3V0TA 3DYMA 3TW7A 1ZU8A 4H9ZA 4O28A 1QT1A 4TW8A 3O2LA 4ZOCA 2OSXA 1WDRA 1HGWA 3QTPA 1H7XA 1NJJA 3TNOA 3AXXA 4QTGA 4AUBA 2PF0A 3C0SA 2OFJA 3IK2A 1CBGA 4Z2JA 2WNZA 1WDWA 2YCIX 2G50A 3T1GA 2YL5A 2P3ZA 2O56A 1JZ2A 3VNMA 3GG8A 3BOLA 4PCSA 3BPWA 2VZSA 4NX0A 1UP3A 1EWDA 9XIMA 1YPIA 4B4FA 1ITCA 2PDFA 3BOXA 3C61A 4XKYA 1YTDA 2VI0A 1A5BA 4HU3A 1EOKA 4QCFA 4AVNA 2FGBA 4D72A 3BV4A 4DWDA 4QFUA 1JI1A 1DE5A 3CYVA 1SJCA 5CJMA 4IICA 2EO7A 3UWWA 1B57A 1QNPA 3CMJA 3HPAA 4GQBA 2P3EA 3ZIZA 1XC6A 3HQPA 3W26A 1BD0A 3LCIA 3CUHA 3CV7A 2IMRA 3H4WA 4DPPA 3S2LA 1RUSA 4JQ2A 4GGBA 3AMDA 1LBLA 2PDBA 4OBSA 3GTYX 1E43A 2CWXA 1GUVA 3P62A 5EMMA 1W6TA 2A21A 2YYUA 2I17A 5REQA 2A7RA 4HZ6A 2GQ3A 3NQVA 4ZGYA 4ODNA 3E49A 2XN2A 1FD9A 2XIIA 3AZTA 4H9YA 4RNHA 2GDUA 3PF3A 3VGHA 1EWEA 1KNWA 2Y85A 1XBZA 4IGMA 2G8ZA 4HYVA 2E5CA 1LT7A 4C6EA 1YMYA 3L5LA 4M3PA 4DI9A 4O57A 4PUEA 5BMXA 2PB1A 4RCXA 1REQA 3SY1A 1M3UA 4S2BA 4X63A 1E1FA 4U2ZA 4F0KA 4AD0A 2OO0A 3DG7A 2B7OA 5HUPA 3HPXA 3T4CA 1L0PA 1VFFA 4K3ZA 3MJMA 3L12A 3E74A 6XIMA 3VVGA 1GOQA 2GDVA 3MZ2A 3N2OA 1OHLA 2EPMX 1MYRA 2C14A 3WQGA 5JH8A 4MSSA 3U2EA 1ZB5A 1FCUA 3BLLA 1EOMA 2VZOA 1KXQA 4C6MA 3O5RA 3MUAA 1XWYA 2QEZA 2VYOA 4EP8C 4G2DA 1AMYA 4LRTA 1JQXA 3MVIA 2WVUA 4HMCA 2WZMA 3SRKA 1FP9A 4ACZA 3NI6A 2Z29A 3F7JA 3H53A 1K03A 1C7SA 1VBRA 3VZXA 3IHZA 3R0KA 2FVLA 4GI9A 4I9JA 4QQ3A 4YTQA 3SCTA 1N8WA 4AVFA 4CNTA 1NH6A 2Y8VA 1CW2A 1DXFA 4F66A 3ZSSA 3W7CA 5F1VA 3WNNA 3S1WA 2WAGA 3SR7A 3DFPA 1TZZA 2DVUA 3WL1A 4L80A 2V5CA 4DUOA 1MI3A 3W28A 1BVNP 2RH9A 3R10A 3T0TA 1EF3A 4UQCA 3E38A 1JCNA 5CJNA 1E5JA 2CPUA 4XVDA 2ZZ7A 3AIVA 3W7HA 5GPRA 3PP7A 3D5HA 4ZVJA 1AVAA 4PSPA 3W7IA 3TYAA 2FZ9A 1DWHM 3WLOA 1RCOB 2DEPA 2YCEA 1G9HA 3RX4A 2IF4A 3JZEA 2YR1A 2NWRA 5CQ1A 4W8AA 2C1HA 3N4FA 2X8RA 1VC4A 3HN3A 3U5YA 1P6BA 2C15A 3IGXA 1XH1A 4H6QA 3G6LA 3TA6A 1OZMA 2HRWA 4P5UA 4AZHA 2JE8A 1A3XA 1O60A 4FR1A 5HJYA 1RLCL 2PV2A 3CS2A 4W9QA 4MYAA 4O1EA 1AL7A 4E3VA 4HNTA 3W86A 4HZ8A 4IMEA 1F2JA 4BWLC 4GBDA 4KRZA 1KLYA 1YDOA 2E25A 3N12A 1RCXB 4C60A 3UXKA 1F76A 2Y8UA 4K8GA 3O5JA 4UNIA 2FGLA 3LV5A 5HR6A 3CAVA 2NWSA 4CCCA 1Y8BA 4FAMA 1RV8A 1GEQA 6PTDA 4KWWA 4WOZA 1VGAA 3QMRA 3LUOA 3VOIA 1UD3A 1KD0A 1K6AA 5ECUA 1H09A 5HTGA 4DF2A 4U10A 2ZOXA 1P6CA 3TTOA 3O16A 1NFPA 1EPVA 3ARWA 6A3HA 3CC1A 1IQ8A 3U6WA 2YZ5A 1K77A 3GIYA 2QCMA 1KM5A 2XPAA 3MSGA 1AA1B 8RUCA 3JVAA 1CPUA 2X2GA 3QH2A 1ZJAA 1DBTA 3A64A 1Y5VA 2HNEA 2NXGA 4QP0A 1K4HA 1S39A 1J0KA 2XFRA 1VJIA 3QPYA 4WVXA 1BAGA 4GG9A 4DUWA 1JIBA 1JFXA 4O12A 3VPLA 4KWVA 3LCLA 1FBAA 4JX5A 3MY9A 3R11A 1H7OA 4N19A 1UKPA 3D46A 3CB8A 2Y1HA 2J75A 4DO6A 2Y4SA 3S6OA 4K2SA 1PKYA 1AQFA 2BGSA 3GXPA 2PBOA 2FTPA 1DWAM 2G4JA 1M1BA 1KFCA 4ZZ9A 1UA7A 1KM2A 3EOEA 3VDBA 1XDLA 2NT1A 2XP4A 2F8QA 3HOJA 3WK2A 2INFA 1AH3A 2VVNA 2VFDA 1D3HA 1ICPA 3UETA 2P76A 5IOBA 1CGWA 1GEHA 2JBMA 3UR8A 2V68A 3BLDA 2CZ5A 3GKFA 5KMYA 1XW8A 3OGRA 2Q6ZA 2WHMA 1J6YA 1H1NA 3H2NA 1TWZA 1UROA 3FW6A 3V75A 4B5UA 4H04A 2ACRA 3SECA 4DJDA 3GRIA 3DAQA 2ZUUA 2PBGA 3HGJA 1IWBA 1LQ2A 1BXNA 3CJPA 2ANUA 4LAZA 5FF0A 4DJFD 2P4VA 4UCGA 5E6ZA 2DW7A 1GOMA 6TAAA 3F5LA 3UI4A 2E3ZA 3ORWA 3WF1A 4EX4A 5EMKA 1FFRA 4MSPA 5AYBA 4DBWA 3G22A 3CLMA 4NILA 1VZWA 4JIHA 1UYQA 4IFOA 2LKNA 3W6MA 1JAEA 1V3LA 4PTNA 2XH2A 2Y7EA 4G6CA 4I8YA 1ROUA 1E44A 4J2PA 4CNUA 1E1CA 1E4IA 4G7EA 3NCOA 4M29A 3M5XA 4HOXA 2R9RA 4ZB2A 3P61A 3KRSA 2R14A 3GXMA 4US5D 3ARVA 3PS7A 5IDIA 4DO5A 2B7QA 2V69A 1QHZA 4ZQNA 3GTXA 4A3QA 4GJJA 4HHMA 3TFXA 5LXEA 1ZJIA 1IXQA 2X0YA 4DZ3A 3H8AA 4X2RA 1TTPA 2IKJA 3SSZA 3N2TA 1V6UA 3UGVA 3CLWA 4XO7A 3ATZA 4XTIA 4A3YA 3MO4A 2DZXA 4K37A 3WQWA 3MDYB 1I2OA 1S2TA 2OWCA 4CN4A 3RGTA 3R6IA 3CUGA 2QCDA 1OQFA 5BZAA 1EX1A 2BHUA 4D6FA 3OQEA 2PCEA 3DXIA 3N34A 3KP0A 4Z1CA 4JYDA 4JIRA 3T8LA 1KT1A 2PDPA 4AHQA 4PMDA 5IHSA 1K02A 3O6AA 2J77A 2HXTA 1FWGC 2I7GA 2JKAA 3VD3A 5HJLA 1QK0A 2EAWA 3F4CA 4C1NB 2HK1A 1QI3A 4M5PA 3VKJA 4YN5A 3BL3A 4LVDA 1QPRA 3AIWA 3QSTA 5JBDA 3QYSA 3CZJA 4BFAA 2QT3A 3DG6A 3MKCA 4DRNA 4YJ5A 3H2MA 1W1TA 3IJ7A 4KR0B 1CZ1A 4DWSC 1Q6IA 4DN1A 3PVFA 3HTWA 4PMXA 1DIOA 4LVFA 1J4RA 3T2QA 1QHPA 2VL4A 3H70A 1NAL1 1SJDA 1MXDA 3AC0A 1P1MA 4C6OA 3P6LA 2I14A 1E6PA 3E9AA 5LNRA 3BMVA 2V67A 3TP4A 1TA3B 3O07A 3UZZA 3GX9A 5HNUA 3EWCA 5DMMA 3S2CA 4TYOA 1P7TA 2PEVA 1ZP3A 1X7IA 1K1DA 3JR2A 3I6EA 1GJWA 4MY1A 5AC7A 1W56A 4BWLA 1FKRA 4EF9A 3FJ6A 4YIWA 2Z00A 2TAAA 3WH8A 2WANA 1BHGA 4DO7A 5CZKA 1CDGA 2DUZA 4I9AA 3WH5A 1FDYA 4XAZA 1RSCA 3VOGA 3WUBA 2FVKA 5FJPA 3KTCA 1EJRC 4FR6A 4O19A 2VEIA 1B9BA 1EYEA 1I2RA 1Z69A 1JXKA 1QI0A 5B7YA 3H23A 3FHAA 3MBFA 1XHGA 1VBHA 5FJUA 1N55A 1GYLA 1AL8A 2Y7GA 2XVLA 3KACA 1HL9A 1VYSX 1BYDA 1EHNA 3T09A 5D2TA 1IV8A 3CWOX 1KRCC 4PEKA 1JVNA 3POCA 3IVSA 3LI0A 1XIGA 1C29A 1X1NA 3QGAC 3B7XA 3PY2A 3CTLA 1XCXA 1GPFA 2J4GA 2C1GA 1UOKA 3HO8A 4FMVA 3Q37A 4IJCA 4J1OA 4J3ZA 5T9CE 3LRKA 4QROA 4GXMA 3AI0A 3V0SA 3SURA 4BS0A 1HUVA 4UQBA 3PAJA 2V82A 5IBXA 1EKOA 4IP4A 1DJNA 1HJVA 2AL2A 1LTDA 2GLKA 4TX6A 4ZOAA 1E3XA 2CXEA 3QKZA 2CYGA 2QGYA 4GI8A 2XVKA 1XLEA 1TJPA 4JKMA 3SUTA 2WC7A 4EXAA 4I3GA 1QDSA 1MWOA 1LCOA 1VB9A 3GQYA 3WQDA 3M0ZA 3KS5A 1O1HA 4XZMX 1QOPA 4HBOA 3BICA 3CT2A 1QU4A 2GOKA 4B91A 4IG2A 1GVFA 2QUVA 3IRDA 3LHWA 5GJMA 2E1DA 2QJGA 1OABA 1SVDA 4GIVA 5AC4A 3M0XA 3H26A 3L4WA 1WOBA 1V79A 3LG3A 3KE0A 4NZ1A 2DSWA 3B9DA 1EF2A 3STPA 1J2WA 2AMGA 1CT5A 1LZOA 4KEZA 2VDHA 1JVWA 3NDZA 1B30A 4MTVA 1XISA 3H21A 2XP5A 3AYRA 3QSRA 2HVNA 1BTMA 2V2CA 1C8VA 3ITYA 3TSDA 1HT6A 4OJYA 6XIAA 4UWMA 2YOCA 1UH4A 2YBUA 3DC8A 1WNOA 3T0CA 4HHPA 2WZTA 1CLKA 4B15A 3UG3A 4CUCA 4ZO7A 3FEMA 4JNZA 3SUSA 3WJYA 1KTCA 3GNXA 1NF0A 3WYZA 3SO7A 3BG3A 2JKPA 3BLKA 3ZFHA 1XIIA 3PBYA 4EIVA 2WMJA 1Y5XA 2WC4A 5U7SA 4ML4A 1GOWA 3MI6A 2M1IA 1X1ZA 1LORA 1S2VA 2NX3A 4NXSA 4JTGA 4GIEA 4KFPA 2MANA 3DFOA 5EMUA 2XSXA 1DWFM 3UR5A 4HP5A 1IIHA 4ZODA 4GI4A 3IJ8A 1KGWA 5HA7A 4M1RA 4MJZA 4D6DA 1V6TA 4G9PA 2VURA 3B8TA 4ADTA 4RE3A 1A5KC 3R25A 4LNYA 3HGSA 4LQ1A 4Q4SA 2PLMA 1EJXC 2QIIA 4DLMA 3U7BA 3ANUA 2EPNA 1L8NA 1RK6A 2PPNA 3N2MA 1H7NA 1CLVA 4J2MA 4RX0A 3WIJA 3ZT5A 3VIFA 5BOOA 4KFOA 1LQ0A 2G3JA 4A22A 3U57A 1SFSA 3U9IA 3IK8A 2RJHA 4O8AA 1Q6UA 3UGRA 4HT3A 1B54A 3TZFA 4AX7A 1VIZA 4J3SA 3CL6A 1FKXA 2GSHA 1RPXA 1EBHA 2Q02A 1YX1A 3BH4A 2KGJA 5DF0A 3EX6A 3VZYA 3E0IA 2PDHA 3TR9A 4GKLA 4JFWA 2ZKMX 3NWRA 4BF5A 5EYWA 2BOFX 1KM6A 4HHLA 3NVTA 3WNKA 3QW4B 2XIMA 1UWIA 4PEEA 1GQJA 3QKEA 5U4NA 1XDJA 3RJXA 1SW0A 5A6JA 4BCEA 4XKMA 4DBEA 3Q4DA 4NSBA 2F21A 3GSMA 4JTAA 4NZFA 3SN1A 1WOAA 3B05A 3VUSA 1KXTA 5GQBA 2XGZA 2ABBA 2BS9A 2XN1A 2ZXQA 4AD2A 3LBMA 3C2RA 4FNPA 3B9AA 4EPKA 1W9BM 3O7UA 3AJXA 1DJGA 3VIOA 1R30A 3B8WA 2EPHA 4DEFA 4DWSD 1GZ1A 2DZBA 3G1VA 2GJRA 3WEOA 2INZA 3GXNA 3EWBX 1XI3A 3UA3A 4R27A 2WSYA 3W2LA 3UG4A 5PTDA 1VIWA 1A4LA 1OY0A 1EP1A 4WKHA 3QEZA 3VOFA 5K9XA 1JCXA 4ZL1A 1XYMA 3QJAA 3SCOA 3R0UA 1UR0A 4HSOA 3EWZA 3QC0A 3EWUA 4ICCX 2VGGA 4PMNA 3ECQA 2BBFA 4MKNA 4PTWA 2XTKA 3SY5A 4V15A 3RRAA 1MW2A 4EACA 1CB7B 1L1PA 1LRNA 3LPFA 3LS9A 4QR6A 3W24A 4J27A 4TU1A 3HMCA 4FNRA 4PBFA 5HDRA 1DHPA 4IGHA 5C70A 3P8IA 1OBAA 4X9SA 1B4KA 3GR7A 4GUIA 1H60A 3O5KA 3BUVA 4RDZA 1WAUA 1RBAA 1XUUA 4WJEA 3WMBA 3JW7A 3L4ZA 4NASA 2ZXDA 2E9MA 3CPGA 2ZIDA 2ZQVA 3M5VA 3VFLA 1DL3A 3QV6A 3RCYA 2G5WA 1UWSA 1TE1A 1DIEA 3F03K 1CENA 4QIUA 3WBEA 1VEMA 4OV9A 2FFIA 1KT0A 4L5ZA 4CQCA 4LGXA 5E70A 1FKKA 3N9SA 4JX4A 2DG9A 2J9YA 4QE1A 3NM1A 1U2YA 3PSWA 3WDRA 4AXKA 3NIYA 4GZJA 1FCVA 3D6NA 3PUOA 3RN6A 4GC4A 1E72M 4IZGA 3F4VA 3WUFA 4KPLA 2WKJA 3TC6A 1FH7A 3MP5A 3B9EA 5LKYA 4IMAA 4L6DA 5CSSA 4IHCA 3RILA 2VOMA 3QHOA 3TJ4A 4IMCA 4DZHA 1Q63A 3W22A 2XN0A 1E6RA 2NSXA 1EDQA 4QISA 2GJNA 1OCNA 4Q7NA 3UQIA 4Q6JA 4KKXA 1KBIA 3TYBA 1BLIA 2WJZA 1PKNA 4HNLA 2BTMA 2JKEA 3IS4A 3WD4A 3PULA 4H2CA 3G1DA 1OC5A 4XSMA 3G6MA 2ZYFA 3LZ5A 1FWCC 5B8IC 1WBHA 2YL8A 3FJLA 2J88A 2P1FA 1TA3A 4LBUA 4QBXA 4CNSA 2CLOA 3C3UA 2XFWA 2YL6A 1BYBA 4PCTA 1QW8A 1R86A 3B04A 4IPJA 1F3XA 2VOTA 3KHDA 4B3ZA 1HO1A 1LUCA 3VO0A 4B3LA 2OOGA 1RCQA 4W8BA 5I09A 4R34A 4ZQCA 3VGEA 5FEWA 3VA8A 3I3EA 4GFSA 3A9IA 3WF4A 3WUGA 2ZC1A 5KZEA 5HWNA 3HV8A 1IEVA 3WY1A 5I5RA 2XUCA 2GUUA 3W53A 3SM0A 1BGGA 3NJ3A 4Q8OA 1F73A 4YTTA 4GQQA 3KUMA 1XPYA 3VD5A 3LUTA 3DBNA 5LHFA 1KGUA 4GQ0A 4UTJA 4KQNA 3KXQA 4F3HA 3CUZA 2VRKA 1PPIA 4QG6A 2DT2A 2WLZA 3RMEA 2PDIA 1W9DM 3UF8A 1DJIA 3FCPA 4P8WA 4IL0A 1B4EA 4KEVA 3O3RA 4MWAD 4YXGA 1A5NC 1ZCCA 2PWFA 4UBPC 4H9MA 1UBSA 3ZQ9A 4NZ5A 3OLEA 2Z0IA 3EPMA 3EDEA 3STFA 4W9OA 3QM3A 1G6CA 1RQBA 4FLSA 4Z0SA 3LCFA 3GDRA 2X0SA 5T91A 4RW5A 4BI7A 1UH2A 2D24A 9RUBA 1MNZA 4NYUA 1UA3A 3GVVA 5IBXC 3NRKA 4GI6A 2DZTA 1TPFA 2VD9A 2WZIA 2ZZ1A 4MDOA 1SZRA 3DFNA 1FCBA 4CEUC 1XL9A 4DROA 3CK5A 4HU0A 4RV3A 1NVMA 4HYRA 4YWSA 2FHCA 1XH0A 1C92A 1XXXA 4URIA 2WSQA 4H41A 4L4PA 3AICA 1S2UA 3UJFA 4NJKA 3MUY1 4Y8FA 2F9RA 2GUBA 3TN3A 1A5AA 5EFDA 1W1ZA 3MMDA 1CCWB 4BQ5A 3ME3A 4MNMA 1LROA 3URBA 1DQWA 1I9CB 3L0KA 4I5UA 4HN4A 3N29A 4UTIA 1OCJA 2VM8A 5HATA 1R85A 3UJSA 1R7AA 5HT1A 1XP3A 3HURA 2AGKA 5L6UA 1H1ZA 3BZGA 4F0RA 3CMFA 4Q4RA 2VP8A 3N19B 1XLKA 1NDVA 4KIRA 4J35A 1T11A 1JXJA 4D2JA 3OOBA 4FI4A 1UP0A 4JBRA 4O13A 5I24A 3WMCA 2X40A 4WZHA 1E4LA 1F74A 3U0HA 2Y7DA 3B8UA 2W5FA 2VFEA 3EYPA 5FF2A 4DF0A 4S39A 5FL0A 5DY3A 5D8ZA 1R3SA 2ZXAA 2DT0A 3WLQA 3R58A 4AZCA 3GUWA 4A4AA 4RDWA 4NL1A 5E1QA 2GK1A 4WY0A 1P0NA 1XQKA 1FKHA 3LBCA 1UH3A 4TIMA 3BQ6A 3GS6A 3R79A 2RDWA 2V5JA 1CGTA 4ZE5A 2QZRA 4RPPA 3REQA 4A8NA 4MY8A 3EX4A 3KVMA 1UR3M 3DG3A 2Q01A 1QNRA 1QAPA 5K3VA 5D05A 2HJPA 2ZUTA 4AZ6A 3E6EA 1ZBWA 5H91A 3UG5A 3NGFA 4DUVA 4X60A 1FWHC 4LV4A 5LYRA 4L65A 3UVIA 2XZ7A 1LL6A 5CC5A 3P5YA 2YSWA 2V38A 2EEXA 4U3CA 1KBKA 2BASA 5HUAA 4RKAA 3O5OA 4IFKA 3C0JA 1ZJBA 4PB5A 1SSDA 3ARQA 1E6NA 5HQLA 4PZVA 4NJHA 1L2QA 1K7XA 2VEMA 4K6AA 3CGTA 3ZS4A 4EE9A 5HWCA 3EX1A 3BV7A 4AHOA 2XH4A 1MQPA 4GE8A 2PS2A 1XIDA 1L8PA 3G1FA 1SW7A 3NM3A 3MA8A 4NZCA 3H7UA 3FIGA 2WPGA 3LCGA 1FKGA 3MS8A 1A5OC 3DKLA 5EU9A 3HMJG 3TXZA 2OELA 2PRMA 2QULA 2C13A 4HKPA 3QXBA 4IXXA 1OT2A 4Y9PA 3WQ4A 4AFYA 3ELFA 3A4AA 4JEJA 1FXQA 4IT1A 1Y5WA 2XHYA 1EIXA 3M44A 2JFEX 5BXSA 3M64A 1VQTA 3PZMA 1WKYA 4Q8TA 1E0XA 4HQVA 2Q3OA 1RD6A 2QJIA 2A0NA 3TVAA 1YTEA 2Z25A 5J5DA 1YBQB 2CU0A 2OSYA 3MU7A 4FLQA 2GYIA 4Y9OA 1ECEA 3WNLA 1GOIA 5HW8A 3CH9A 4W93A 1K4GA 3SCRA 3A3HA 3E96A 2KI3A 3DC0A 3BJTA 1Q66A 5ABFA 1ESWA 4GC3A 3EAUA 2AQOA 2BP1A 2OWWA 2I16A 1PTDA 3B9NA 4FX7A 4PUMA 4PULA 3BW2A 1UKOA 1E56A 3AYTA 3U2OA 3UCDA 5HQEA 3UVAA 4K7YA 1U5JA 1XCFA 1OF6A 2C6QA 3L4UA 3LEPA 3HFYA 2HPIA 2YDRA 2YFNA 1XUZA 2OZ3A 4YCPA 3TJLA 1ZUAX 4H9UA 3CL8A 3I4EA 2Z28A 4QSHA 4ZQOA 3G1SA 4UTFA 5FA5A 3N4AA 2ATMA 4GD0A 2D0FA 4QS6A 5CSUA 1U1HA 3AJ7A 2VR2A 4UXDA 3UWZA 4LJ3A 4DX3A 1R3QA 3L2LA 4MIMA 3GU1A 4TO8A 1P0EA 4FIQA 3SCVA 1UUQA 3WNOA 3WSUA 4LAXA 2CHRA 3B0XA 3PBGA 1JCHB 5J8LA 2ZRXA 2LPVA 2CNCA 1F3EA 4IMDA 1XLLA 2OPJA 3PZNA 4KF1A 3ABZA 3D0CA 1GHSA 3SW6A 3WH9A 2O9PA 4Q33A 1JUKA 2F23A 1R9XA 4GO9A 4FK9A 1X96A 3P5ZA 1RH9A 3PHAA 2VGBA 3P74A 4XAPA 3N14A 1KQZA 4LYPA 4Q8PA 2RSEA 4DJDC 2JF7A 2VDGA 3KDNA 5I06A 3RRXA 2R94A 1EZ2A 1BYCA 4HNOA 2XVGA 4ROQA 3WNPA 4C7DA 3E2VA 1F8AB 3UWEA 1R7OA 4MHBA 1L6YA 4EWJA 1KV5A 2ZWZA 3EMCA 1HNYA 4DM2A 4OT7A 5DELA 1QOXA 5CG7A 1JRCA 3CQHA 2QUMA 1QI5A 5C8BB 1GJPA 4FP1A 3PSVA 5JH2A 1W3KA 2BY2A 3VCNA 2CERA 3QVQA 1VYRA 1PDYA 2QDDA 2QJJA 1NWRA 4A2RA 3NGJA 4WXZA 2PWHA 4OUEA 3GB6A 2PMQA 1S5VA 4DBSA 3A22A 4YVVA 4PE8A 1LWJA 1TFVA 4H9TA 2XFYA 3TW6A 1VS1A 1OEPA 2YLAA 3AXHA 2WW5A 4N42A 4WEVX 1EQCA 2QMKA 2BY0A 2GUYA 4ZXOA 1UZ4A 1I6NA 1HVXA 1L2UA 4E4UA 2CLHA 1IXOA 3WLNA 3KADA 5JBFA 4O0KA 1I0DA 2YXGA 2JEPA 2J74A 1JPIA 2J25A 5CXPA 1HP4A 1IEWA 1XLBA 3VIKA 3A21A 2CXGA 1LUCB 5EPDA 2IPWA 2QQ6A 3WO8A 5HNTA 3FYOA 1QRQA 2CESA 1J0ZA 1H4PA 3Q67A 1XM3A 2Y8KA 4OTKA 4BQ2A 1NTHA 1E0VA 5LIWX 1BPLB 1UG6A 2VX6A 1NOUA 3GG0A 4ODMA 4JQAA 4DI8A 3W0KA 2GGJA 3KOWA 1YW5A 4KEUA 3OQ8A 1J0IA 2R1PA 1Q6RA 3VINA 3ARTA 3SY8A 4R85A 4LC8A 2Z1SA 1EHAA 4MDPA 4RJEA 3M16A 3VE9A 1NWUA 4GIAA 2X42A 5I3KA 4QCEA 5FESA 2WQPA 4QNWA 4H8HA 1ZLPA 1BVZA 1RA5A 3VMNA 2QVNA 2ABAA 1EIBA 4F48A 2OSWA 4DZAA 4L4MA 4CCEA 1TWSA 2ACUA 1W9VA 3OZMA 3VDHA 1NMVA 3MHUA 1TQXA 3ZLGA 2ZRWA 2VT0A 4FA3A 3VOCA 3TA9A 3KCEA 2FMOA 4PMUA 3APYA 1TTJA 3DOPA 3P2VA 3HF3A 2FH6A 1GQKA 1V3MA 4YHEA 3P67A 2G0WA 1H7WA 3IKGA 3OLDA 3AALA 3QLLA 4UB9A 3I10A 4F0LA 1NDZA 4DYJA 4CQDA 2PP1A 3TQVA 1AW1A 1ECQA 1AW5A 1M5WA 4YWIA 2WO5A 4IQJA 4E8CA 3SCPA 3E02A 3MBDA 1WUEA 5CZTA 3ZM8A 5CLWA 5JXQA 1FKJA 4J5NA 1C3FA 2BZNA 3NXLA 5HBFA 5AC5A 5F4XA 3EOLA 1B1YA 4IT6A 4BR1A 1Q8AA 2ZA2A 4WF7A 2E4TA 5E0FA 1LDCA 4E4FA 3POHA 5A8OA 2ZICA 3TYEA 2CIPA 5CSRA 1X1OA 1KWKA 3OG3A 1LLWA 1UWAA 5A8QA 4RE4A 1GK8A 4AX6A 4LYRA 4YL2A 7ENLA 3STGA 3PUEA 3E5PA 1A47A 2YDSA 1V3HA 3DX5A 3VKCA 3ZR4A 3TU9A 3CNYA 3O8AA 1H63A 2WCGA 1JDAA 4C5YA 1F4AA 3O5QA 2RUDA 2WSPA 2J47A 3UWUA 3G0SA 3PB2A 2DJXA 4N02A 1RBOB 3CYJA 3AHTA 1TPB1 1NMWA 3W7QA 4EWND 1O6IA 2RKXA 1EGZA 3NL2A 2OEMA 3T6CA 1PZ0A 4UFKA 3M5ZA 3R0DA 2EKGA 2ZC8A 3P0XA 4ZQRA 4AZCB 3WQ8A 4DWSA 4ZA0A 4WY0B 4GZEA 1HTIA 2WLYA 1NOFA 5JMUA 5DRCA 2GVJA 4NUWA 1YW1A 2ZUNA 1JG9A 3UWVA 5C71A 1Q6GA 4K68A 2IUZA 3T08A 4UFJA 2WSRA 4TMCA 3QY7A 4D8AA 3LCHA 2OZ8A 4DAIA 3QRHA 2GVYA 2VC9A 2BVYA 2E8YA 4M7TA 2G3NA 2OKOA 3M0HA 5C9ZA 3F5JA 1MW3A 4TX0A 4N4QA 1X39A 5E6YA 3L67A 5A3HA 5DMYA 5HW7A 3LZ3A 5DMNA 2UBPC 2VXNA 1JZ8A 4V1YA 2ZUMA 2GPTA 2WNQA 1O12A 3WLKX 3LLDA 4XBSA 4IFKB 4XD5A 2NUWA 4LALA 3KOZA 2IQDA 4B90A 5J6EA 4UQ9A 4NAEA 1EUNA 2Y63A 2FB3A 3MI3A 2XWEA 4YYCA 4ZO8A 4O18A 3CHDA 1VJSA 1JEZA 2P53A 3SB0A 1FHDA 5E09A 3ZSTA 1NP0A 2NXHA 1LBMA 2F38A 3QR0A 3M0JA 4XZNX 4Z1AA 5M5DA 1QPFA 1G7UA 2DVXA 4QITA 1DWJM 3CT7A 4IIBA 3WLSA 3CGMA 3PZIA 3RAOA 3F1QA 5B80A 2PU1A 1VLIA 1E4MM 1PHWA 3BG9A 1NFBA 5C7VA 3RXZA 3CGNA 4DJFC 5G1MA 1YKWA 2DH2A 4YYFA 2QPXA 4J4NA 4JFMA 3EB2A 3H2OA 1W3HA 1TE6A 2Y61A 3OZOA 3KVLA 3W1PA 3I3DA 3I3BA 2PDQA 3VX0A 3H24A 2IPJA 1KXVA 2GWGA 3LPPA 4GVIA 3ZJ7A 3XISA 3V7PA 1ELSA 3CWHA 1YXYA 3HG2A 5HMDA 3N3MA 4MB3A 5CPLA 1HFBA 3THUA 2XPKA 4GO8A 1WDSA 3IACA 3KOFA 2DT1A 4HGXA 3H7RA 3FOKA 3W76A 1D8WA 3V1PA 2HQAA 2ZE0A 3EPOA 3T0BA 5F2GA 1JYNA 4H6EA 2XIOA 5TQLA 1AZ1A 5DEZA 1EC8A 3RX3A 1F61A 5BRPA 1A0EA 1EDTA 1O5QA 1JCJA 1QPQA 4O1AA 1W5MA 1XBVA 2GVLA 1GVSA 1UZDA 1GOOA 2ZX9A 3UZ5A 4GACA 3SGUA 1ITXA 3DDMA 1T96A 2VCCA 3QQ1A 3GBDA 7XIMA 2Y78A 2YYTA 3M0VA 1PB0A 1A5SA 4DYEA 1Q8JA 4WJXA 3J7HA 3GVGA 3PZUA 1CXHA 4C6DA 2VR5A 4B5XA 4N2YA 3BCFA 4CU7A 2W9MA 1HKJA 4MNKA 3GNRA 1R3WA 3DFYA 3BCDA 1V0NA 1J4HA 3NTPA 4GOAA 2XINA 1F6PA 3WFAA 2R1NA 2GWNA 3WEZA 1XSKA 3E2RA 2OQHA 4U85A 4B5WA 2BMBA 2A5HA 4FHAA 4RNJA 1WZAA 3GZAA 2CBJA 2VX5A 2FB2A 3LU2A 1HZYA 4W5UA 4JTKA 2RGMA 4AY7A 4L72B 3SBFA 2NVDA 4ACZB 4H4IA 4RE0A 1KM0A 3KEHA 4P7RA 2J9ZA 1V7YA 4MUPA 1TO3A 5AECA 2OVLA 4FNQA 3MWCA 5FSEC 3RK8A 3FXYA 2V63A 3KAFA 5CPOA 1H62A 3HG5A 4HSHA 1W5NA 1KLZA 2GGGA 1FA2A 3AFBA 1DPMA 3VMOA 4X2PA 1VBGA 2PDMA 3FAXA 3NYZA 3T9PA 3MDWA 1A53A 4S38A 2IXUA 3G0XA 2NQ9A 3TTEA 4KWSA 5EBUA 4WRHA 1E3ZA 2ZA1A 2C0HA 1LWIA 3SQLA 1XRTA 2WMGA 3OBEA 4XZLX 2QCDB 4OBTA 1I2PA 2O55A 5HMFA 3UD6A 1EDGA 1TYGA 3GBEA 2TYSA 2DU2A 4IQEA 3UWYA 1BWKA 4XO6A 1JF5A 5HANA 3TTSA 4AD5A 3LRMA 1FFQA 5C55A 4AMCA 5E0KA 1AJZA 1LRQA 3WUEA 4LWWA 3W1QA 3WH7A 4MB4A 5D2YA 2WMKA 3U7VA 4PGLA 3W7MA 3S47A 1C9HA 1VD6A 1ZNNA 4HARA 3MUCA 4A3RA 1K7FA 1OGSA 4Y9NA 2XPBA 1UJPA 4I90A 1PTAA 4MWAE 2ITKA 3KBSA 1HKIA 2R8WA 4LAMA 5EBAA 3H7VA 1UD6A 3QN3A 3UPBA 4US6A 3SN0A 1RVKA 2KE0A 2D9FA 3AHVA 2A3BA 4IX0A 2QJMA 2WMHA 4JTHA 1SM9A 3W84A 2OG9A 3TYZA 3OVQA 3TDBA 8XIMA 4S3JA 1BF2A 2PD5A 1OM0A 2P8CA 1ZSXA 2IQTA 3LTYA 3GDTA 1DP0A 4QXIA 2OTDA 2SFPA 3PZQA 4AHPA 2NQJA 2V6AA 1N1AA 1YXCA 2E40A 1DORA 2ZQUA 1PHQA 1DIDA 2ISFA 5CSYA 1ENUA 4UZSA 3BXWA 4AYSA 4KWOA 1M7XA 5DCDA 3FS2A 2DQWA 3NO5A 2OQLA 1UR4A 4LCRA 1E55A 1WA3A 3FKKA 5XIMA 1GQLA 3VNYA 1KC7A 1Q3NA 3TQKA 3UQAA 4PCPA 1IZJA 4M24A 4AZ5A 1OX5A 3OLIA 3XINA 3WQCA 2OEJA 4JL2A 1OFRA 4NU7A 3SI9A 3WLRA 1Q6CA 4GY7A 1LL7A 1M6JA 4ERGA 4DRQA 1OCBA 1ADOA 3S1GA 3AIUA 4ORIA 1OB0A 1SO4A 3DFHA 5C2CA 3VIPA 2PODA 1WKEA 4ROPA 5GJNA 2IW0A 2J7GA 1M04A 3A3WA 3WQEA 4CVWA 4OECA 4E8DA 1Y65A 3U4AA 5HULA 1FKIA 3UXDA 3WF0A 1O7AA 3MP3A 1G4PA 4CD7A 5CCZA 1TMQA 2VQTA 4N9DA 4ONVA 4CNOA 2DG4A 4UC5A 3S5YA 2ETNA 2EF9A 2GVEA 1XR2A 3B8DA 3W7OA 1EP2A 4J3WA 3TFCA 2AQVA 3NG3A 4DRMA 5CBBA 2W92A 1BVWA 4JN6A 1H0GA 1XDMA 4BEQA 1J11A 3SCNA 5IXEA 4BZYA 3BZJA 1ISYA 3L2MA 1YLVA 3S3GA 4NNRA 3GVWA 3OPSA 4F2UA 1DYSA 2PD9A 4MZYA 4DT4A 4DLFA 8TIMA 4Q4KA 4QGCA 1F6YA 3W74A 3MC5A 3INPA 5CPSA 4W86A 3UERA 1OF8A 3DGBA 3L5MA 4AIOA 1E70M 3L9CA 2A3EA 1TZ7A 2XGBA 3W2KA 3ZVHB 3AIQA 3AS0A 4CD6A 1DJQA 3CB3A 3BCJA 1P43A 1KKOA 4HA4A 2OFNA 4RL3A 3UPMA 2EPKX 1Q6LA 3IVUA 4TW7A 3AWOA 1R47A 2GSJA 1SMDA 1C8XA 3WQOA 3D3FA 4BQ4A 1IGWA 1AFSA 4GGHA 4AZ7A 2BODX 2G97A 4QLLA 1QVBA 3OA3A 4GVHA 4H9XA 3WLHA 3QZEA 4AD1A 1VCFA 4E8GA 3RR4A 1OX4B 3S42A 3LPGA 4JHZA 4Q4QA 3UR7A 3A12A 4MJ4A 4GYPC 1CI1A 3BAJA 4GX9A 4PMYA 4TW6A 3VKKA 2CLLA 4ZPVR 3QHMA 1AJ2A 1W9XA 5CEWA 4F4RA 1WV2A 3P81A 2A7PA 1Q5MA 3P60A 1G4EA 5EMLA 3QPZA 4JTEA 3EA1A 1M68A 1KFKA 3WDJA 4CD4A 3ARPA 1UMLA 1W54A 3BW4A 4R9XA 4O1CA 3EXTA 3NSXA 3OIXA 3FK4A 4JKKA 2QHAA 3GNNA 2C79A 1W32A 1A49A 2TSYA 3CIVA 2RUSA 2F2DA 2X7VA 3EB3A 4J3TA 6TIMA 4OFCA 2H9AB 2BGQA 5HOSA 3N11A 3IAQA 1M9HA 3ZJ6A 1Q4NX 2PTYA 2NT0A 3B03A 2EULA 4DZ5A 3T55A 4M1BA 5GPGA 4MM1A 1G0CA 3LTSA 5A8GA 1NSGA 2X05A 5A8MA 4XBJA 3EWXA 4TTUA 4UNKA 4S1FA 2CZVA 3WDPP 2XIJA 1PZ3A 1EFZA 4MZ8A 3QZAA 2OQYA 2V5DA 2E0PA 1L9WA 2E77A 2VFHA 3BK0A 1GPWA 3C2EA 3C2YA 3TSMA 1VCVA 1CEOA 4RW3A 2FHBA 2OB3A 3IUDA 4L4OA 4PODA 3BDKA 2ISDA 1PDZA 1C7TA 3MT1A 2J7FA 3PWGA 3WQ6A 1HGYA 2GSEA 1WCGA 1IR1A 3N6JA 3ITGA 3II1A 3EOOA 1RY8A 3CL7A 3G0UA 4QT2A 1UR9A 2QS8A 5A69A 4FIRA 5AB3A 3P80A 3T4WA 1P1XA 1DWIM 2PA6A 2ICSA 5C5YA 1V3IA 5BROA 3TTQA 1JR1A 2VD8A 4IGNA 1R5YA 6REQA 4JTRA 1T40A 4Z1DA 2FJUB 2QUUA 1FH9A 2D1ZA 1EP3A 1K8CA 3FDGA 4LUTA 4XD4A 3WBAA 1MW0A 4K8HA 5KINA 3TQPA 3WNMA 4HZMA 4IPXA 4H7ZA 3GH7A 4Q8NA 3EY6A 4DUXA 3AIEA 1KBJA 2FPVA 2NSOA 5HWMA 3IIZA 2GGHA 3GW0A 1IXNA 2PC4A 3L7RA 1JPMA 2I57A 3VK5A 2O7QA 2JF6A 1O66A 3FJ4A 4F9JA 4GY1A 4NT0A 1GRJA 2INEA 1YIXA 4KCUA 4O50A 1AMKA 4PBGA 4H19A 4C6IA 4BF7A 4EF8A 1MW1A 1S46A 2VFFA 3LMZA 4HN8A 3F4WA 2J27A 4I5RA 1S5WA 2VDIA 1WKFA 2AL2B 3IK4A 3O05A 4WGXA 1A50A 3O5IA 2CW6A