1XHGA

Crystal structure of a 40 kda signalling protein from porcine (spp-40) at 2.89a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 40 kDa signalling protein from Porcine (SPP-40) at 2.89A resolution.
rcsb
molecule tags Signaling protein
molecule keywords SPP-40
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xhgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xhgA01
4M8UA 1VFOA 1AQHA 3W81A 2OLHA 2J7HA 1DWGM 1H0IA 2CBUA 2XFFA 4A3HA 4H8UA 1HKJA 1OBAA 1UKPA 2WHLA 3MSGA 4GO9A 4U33A 2VQUA 3CZJA 2DH3A 1UQZA 1V3KA 1PIGA 3BSGA 3U5UA 3W24A 1QI3A 3WF0A 1MQQA 1W9BM 3IJ8A 5FOOA 1PX8A 2YOCA 4MB1A 4HA3A 4OBSA 1CWYA 1CXKA 1BF2A 3CMGA 2VC9A 4HOZA 5AC4A 4MNMA 3SCOA 2WNWA 3WBAA 5JIPA 3WMSA 1KWKA 3EBVA 1GZJA 3ARQA 1J9YA 1M03A 2VCBA 3CHEA 1V6UA 1V3LA 3SIMA 3TTOA 1VIWA 3SUTA 2XSAA 3AS0A 1RP8A 4KRUA 5LA2A 1QPKA 4CGTA 1BYCA 1D7FA 4J7RA 2WB5A 5GNZA 4NF7A 4LQ1A 5LA1A 4W8BA 2A3CA 1EOKA 3WN6A 2W4XA 1C8QA 2VVNA 2W92A 3ALGA 1BHGA 1GPFA 2XUCA 3F5KA 4KGLA 1GOIA 1W9DM 3N17A 3WDQA 4W86A 2G3IA 1PAMA 3RJYA 1XH1A 3W28A 2VO5A 3EDJA 2Y4SA 1LJYA 2WVSA 2J75A 1Q6CA 4AD0A 1ISYA 1RH9A 1R87A 1BPLB 4UQDA 2E9LA 2XVNA 1V6VA 3OLIA 1OGGA 1BG9A 5FD0A 1X6NA 3ZMRA 1TVPA 3CUHA 5A8PA 3NYDA 4W7UA 3M07A 1K6AA 3VNYA 5A8QA 5JUVA 1LL4A 1LL6A 4XUYA 3W29A 5A6SA 1YQ2A 3VTRA 4PMDA 2WANA 4Q7NA 3CUIA 4OIFA 1NARA 2YKKA 3L2LA 3NDZA 4GZJA 1TCMA 3O2LA 2QPSA 2VX6A 3WH8A 1KBKA 3PBGA 1G5AA 2OSXA 1QNOA 3I3DA 3VM7A 4QP0A 5JBFA 4D6CA 3GXFA 4D6EA 2WVVA 5HXMA 4UQBA 3SCTA 1UD6A 2CNCA 4PSPA 4AIOA 4TVDA 1DP0A 1M01A 2DIEA 1C7SA 5E0CA 3VGDA 1W9PA 4HP5A 1J11A 4ZXOA 5JH8A 3WY1A 2W63A 3VDBA 3AHYA 4CD5A 4HZ6A 2GUYA 3ZIZA 2CYGA 3CHDA 1HX0A 5FL0A 1GJUA 2YL5A 1NH6A 1JD9A 2VTFA 4C7FA 3WKZA 5EMYA 3VX0A 5I2UA 3VDCA 3A47A 1UZ1A 3MMDA 3OIHA 4UFIA 1XHGA 3WBEA 4JHZA 3PZMA 3VMPA 2CXGA 4EANA 4F9JA 5D9NA 3GZAA 1R8LA 3WH6A 1LLOA 1H49A 2PF0A 3WD1A 4Z2KA 3PZIA 1MQRA 4MNLA 1SR0A 3L4ZA 4W5ZA 4PTVA 4P8VA 2GJRA 4WSKA 5FKYA 1HP5A 2XSBA 3FAWA 1JXJA 2OWWA 2V3GA 3AXHA 2F61A 3II1A 4L4OA 2X05A 3ZM8A 4TVUA 4D6HA 1EIBA 4MAVA 3S6TA 3PZVA 4PSRA 3B9DA 3NIYA 2BVDA 2GJPA 3N15A 1UA7A 3BMWA 5I79A 2D1ZA 3UG3A 4P8WA 4CU6A 1JDDA 1V0NA 3BAJA 2G3NA 1BGGA 4PUEA 1GOQA 3TTQA 3ECQA 1M04A 1RP9A 5LYRA 3GYCA 4PRWA 1Q6FA 2C7FA 4GQQA 1XCWA 5AY7A 2VX4A 4UFJA 4J3XA 4UZSA 2D24A 4HA4A 3FY1A 2VZSA 1XCXA 4DM2A 1TE1A 5A8NA 5HDRA 1NP2A 1SYTA 2GFTA 1D3CA 1GOMA 3SCWA 2WSKA 2J7CA 3CZGA 1JZ3A 3GH4A 2X8RA 2DSVA 2VZTA 3CO4A 3DECA 2VRKA 1H0GA 1DTUA 2EBNA 3M6DA 4AZBA 3SUUA 1B30A 4JCMA 4PTXA 5CPTA 4PBGA 1WNOA 2OYLA 1E70M 2WHJA 1WDSA 3ZJ6A 2DIJA 1XYZA 1GHSA 3RJXA 3WQVA 4HPGA 1JDAA 3KEHA 3WNMA 1XGZA 1DWAM 3ARZA 2Y5EA 4HU8A 4H2CA 5KZ6A 2VJXA 1L0PA 1BTCA 3WQ8A 1HJVA 2WVUA 2Y8VA 1GCYA 2XYLA 4OOUA 1KFWA 5CGTA 1CIUA 4U3AA 1OM0A 2J74A 1CGXA 1ISXA 3WEZA 3N11A 1FH8A 1G1YA 1TMQA 5AYBA 4PCSA 1CXLA 5CSUA 1V3MA 3QHMA 2AMGA 2GJXA 3BC9A 2WMGA 2J7EA 1Q6GA 2WMKA 1UKOA 4TUFA 1JZ2A 3UG4A 2ZXDA 3EMQA 3WQ5A 1H4PA 3CPUA 4P7QA 1GJWA 4CCEA 2ZX5A 4AEFA 3AROA 1XSJA 1QNSA 4PTMA 1R85A 4CU8A 1FH7A 3SEPA 4OJYA 5IFTA 1LF1A 4QAWA 3WNOA 4MB3A 3K8LA 4GZEA 1CLXA 3J7HA 2J8GA 5I3DA 1E5NA 2PBGA 2XVGA 1ZJBA 3D3AA 1WO2A 3VINA 2UY2A 2WBGA 1OCQA 1JZ7A 1XC6A 1ZBCA 3VIMA 2WW5A 3ARRA 2JEQA 4V2XA 2BY1A 1ISVA 4D6DA 4KMQA 3MO4A 3WDRA 5EBAA 4B15A 1J0YA 4HU0A 4JCLA 4U3CA 3T08A 3WD2A 1WB0A 2OSYA 1JIBA 4UFLA 1W3LA 1HF6A 4JL2A 1QI2A 3L4VA 3N18A 5M17A 1JL8A 3O9NA 5DEZA 4W89A 4HZ8A 2FHFA 4W7VA 1ZS2A 3HJEA 3U57A 5I77A 1UZ4A 1BSIA 1W1PA 2Y2WA 3AHVA 3W38A 1CXEA 2E9MA 3DC0A 3AZSA 1F4AA 2Z1SA 4OUEA 2ZXAA 4J3UA 1E72M 5AC5A 3VIIA 4Z2IA 1ESWA 2HVMA 3A4XA 3SCQA 1E5JA 1EGZA 4AD4A 1P6WA 3AI0A 2ZOXA 3CZEA 3F5JA 4NSBA 2DQXA 2X09A 2FGZA 4CD6A 2QV4A 1W3HA 2ZX9A 3FHQA 1D2KA 3PTMA 2CERA 3E1F1 1KXQA 2QHAA 4WKAA 4JKLA 4PMXA 1V02A 5BYWA 1ZJAA 4PMQA 5D9PA 3SCSA 3T0DA 3W25A 4W88A 3KL0A 1VFUA 4AD5A 3M46A 1WKYA 2VI0A 1E9LA 1A47A 1GNXA 5A69A 3QGVA 4PMYA 5LA0A 3ZSTA 4WLCA 4AIEA 1UQYA 2ZUUA 4XB3A 3SCUA 4GQRA 3VUPA 1HKKA 3VVGA 3WUBA 2WMFA 2XJ7A 1QI4A 5ABEA 4IPNB 4LX4A 3AICA 3CBWA 1W9UA 3AFBA 4QFUA 3T09A 3ZR5A 1UD5A 4AEEA 5M03A 3VIFA 1MVYA 2G4FA 1TFVA 4ZE5A 1RPKA 1W1TA 1J0JA 1JAKA 3LPGA 4CCCA 1WAWA 5HNNA 1MFUA 2WAGA 4ZXLA 1J0ZA 2D0HA 2E3ZA 2E40A 5I78A 3UR8A 2YJQA 1J01A 4W87A 1JYVA 1AMYA 4XX6A 3B8SA 1VEPA 3B9AA 3AIBA 1WZKA 2OYKA 4ACZB 3WFLA 4W85A 5HPCA 1QHOA 3CZ8A 1CDGA 3G6MA 3DYPA 2WPGA 3VGFA 2QLYA 1KQZA 2ZUNA 5EB8A 3G6LA 4D71A 3K8MA 4HPHA 1KBBA 4AZHA 1KB3A 3S2CA 4D6GA 3IAQA 3SCNA 3JUGA 3OZPA 2NT0A 2YBUA 1K9FA 4ATLA 1C93A 4PMRA 3WD0A 2G3JA 4U5IA 2ZWYA 2ZUSA 5A94A 3QOMA 1JYXA 1CTNA 1FA2A 3CTTA 3ZSSA 3WD3A 1US3A 4QCFA 3SCPA 1JDCA 3DYOA 1CGVA 3OGRA 3QOKA 3IAPA 4B3LA 1OGSA 3AMCA 2WC7A 1US2A 1R7OA 4LGXA 2JIWA 4JZ5A 1KXTA 3WQWA 4PMOA 5I24A 1MW1A 4E2OA 2YLAA 3NSXA 3CZKA 2XIBA 4M82A 1V0KA 4MPKA 4P7NA 2XGIA 4MAZA 1UA3A 4AW7A 4JFTA 4W84A 7A3HA 5DMYA 4JL1A 1HJSA 4EE9A 1HKMA 4EKJA 1ZBWA 1EH9A 2J78A 2JFEX 2DPEA 1B9ZA 1E55A 2ZX6A 5BRPA 4BCEA 2VMFA 3WF3A 2DSWA 1W1YA 1UWRA 2O92A 5GPRA 2G8ZA 3U7BA 1BVZA 3AISA 3ZO9A 3O6AA 3WQ4A 2FHBA 1X6LA 2X0HA 4MTVA 3W26A 2VT0A 1XYFA 2XVKA 4B9ZA 3WNNA 2EO7A 4D1IA 1HVXA 4AZ5A 3BMVA 4P7LA 2WC4A 4AD3A 2YDQA 3PZGA 5A8MA 5A8OA 4N42A 1WZLA 1Q6DA 4KRTA 2XVLA 3U7VA 1IZJA 4W8AA 3MUZ1 3APGA 3ZJ8A 3ARVA 3CUJA 2BHZA 2D2OA 3EDDA 5CLTA 1ODZA 1OD8A 1EQPA 2WC3A 1B0IA 1XSKA 1QNRA 4AZCB 3AMLA 4X9YA 2A3BA 4QLJA 2VNCA 2E4TA 1SFSA 2NT1A 1DWHM 2A3HA 3WELA 1IZKA 5E6YA 3KL3A 2YBTA 4D1JA 5A95A 4EAMA 3VNZA 4Z2HA 4WSJA 2ZUWA 1CLVA 4C7GA 4UZUA 5IXEA 1UUQA 5D8WA 3CZLA 1W2PA 1K9DA 2QMKA 3OBAA 1FFRA 2IUZA 1E6PA 5D8ZA 2Y8KA 1UKQA 2Y24A 4FMVA 3VOCA 3WSUA 1VENA 4TTUA 3AS1A 3WMCA 4PMNA 1UH4A 1V02E 1DEDA 2W5FA 4UTFA 5A2CA 4A4AA 3ARTA 3WUGA 3K4DA 1J0KA 1NQ6A 2YA2A 1IV8A 2D0GA 1LWHA 1GVIA 1E40A 3BGAA 9CGTA 1HJWA 2Q8XA 2BY2A 1XH0A 3RO8A 2A3EA 5EFDA 4UFKA 4ACZA 5FCZA 3VX1A 4MDPA 3K46A 8A3HA 5M3WA 4R5EA 3PZNA 3TONA 4UQAA 4MADA 2CETA 3B9EA 4UFHA 8CGTA 1ECEA 5A6AA 4H41A 1O6IA 4ATDA 3ZT6A 3QR3A 1EHNA 4J3VA 1IT0A 2BHYA 3W6LA 1F4HA 3OG2A 1R7AA 1WDQA 3MMWA 1MFVA 1H2JA 3T0AA 4X0NA 3RDKA 1C91A 5I5RA 3MUIA 3AOFA 4FLOA 4OKDA 1VAHA 3EDEA 5HBFA 1YHTA 1X1NA 1BAGA 3PZUA 1PBGA 1I1WA 3UCQA 3AIEA 3LPOA 1CBGA 2VR4A 1JZ6A 1A3HA 1W9VA 3AIQA 1M7XA 1UG6A 5BRQA 3PTQA 4OOZA 5AYIA 3RPMA 3EMZA 4DM1A 1LQ0A 3BH4A 2JALA 2WVVB 2DT0A 3POCA 5I6SA 5BXRA 3BXWA 1PEZA 1VEOA 3HU7A 4D6FA 1BGAA 5C71A 3WUEA 3VIKA 1E6QM 3RCNA 1GORA 1VBRA 1E56A 2XGBA 3VIGA 4AZ7A 5ABGA 1U33A 3UERA 4M80A 3GH7A 4WKHA 5DT5A 1NWUA 1GW1A 1GVYA 1C92A 1LG2A 1GHRA 2WKLA 3NSNA 2D3NA 2ZWZA 5EFFA 3VU2A 1MW0A 3AIRA 4QLKA 1CGYA 3ZJ7A 3VD3A 2XM1A 1HNYA 1JYNA 1JYWA 1UR1A 3GXIA 1UKSA 1KXHA 2D20A 1MXDA 1CECA 3EDFA 4TXEA 2NSXA 1EXPA 5IHRA 3OA5A 5ABFA 3NSMA 4ZEPA 4CUCA 5CZKA 1MXGA 2BNJA 5JBEA 5A6BD 1B3WA 2CKSA 3SURA 1J18A 5A6LA 1VJSA 3ZT5A 3AMKA 1SMAA 4Y7EA 1LWJA 2BHUA 5KEZA 4AD1A 4IISA 1UR9A 1PPIA 2JEPA 4J28A 2B31A 3FHAA 3WNPA 2GK1A 2AOSA 3NDYA 1GONA 1W91A 1AQMA 1ISWA 3W27A 2WK2A 4AZ6A 2CBVA 1KGUA 3GNOA 3KWXA 1UWIA 2YL8A 2O9PA 2X2YA 1PX4A 1EDTA 2UY3A 1E4NA 4F79A 1KR0A 1B2YA 3GM8A 3MKKA 2WYSA 1W2VA 3VD9A 4DWSA 1MW2A 4WK9A 2C0HA 3KZSA 4ATWA 1UR0A 3SUWA 2BFGA 1XRVA 1KCKA 1VJZA 4HOWA 4NI3A 3T2OA 1QW9A 3W82A 3VIJA 1EOMA 4JKKA 1G01A 4JFWA 1KGWA 1KXVA 5A3HA 4UQ9A 1TA3A 4F8XA 4JFUA 1K9TA 7TAAA 1K9EA 2D0FA 1QHZA 2VCCA 3VMNA 3WDPP 4UOQA 1E6ZA 5BXPA 2Z1KA 4JHOA 2WMIB 3AMDA 4AZIA 1CEOA 1PJ9A 2WCSA 2VUYA 3NCOA 4TX8A 4QLLA 4KGJA 1NOWA 1JZ5A 2UWFA 4H7VA 1BFNA 1QNQA 5D9OA 2DT2A 1M53A 1C90A 4WF7A 3MU7A 2XTKA 4IM4A 4MJ2A 1HIZA 3RM4A 1QOXA 1JFHA 3CMJA 2WMJA 4GO8A 1JI1A 2AAAA 3RILA 4U2ZA 5D9MA 1SMDA 2W66A 3VGEA 1B3VA 4FK9A 4PYSA 3GH5A 2VVSA 2D23A 1XSIA 1TUXA 3CGTA 2DEPA 5A6KA 2WHMA 3AXIA 3WL0A 4QCEA 2E9BA 1UH2A 5GQBA 2VX7A 3KL5A 3N13A 2XVPA 3ARYA 4CD7A 4AWEA 1VF8A 3OZOA 1CGUA 2ESCA 2CESA 7CGTA 1ZL1A 4CVUA 1J0IA 2J7GA 2VZUA 3ZJKA 1E3ZA 2DT3A 1UD3A 5IHSA 5CGMA 3AZRA 4LPCA 5GNXA 2EPOA 2J7DA 3TP4A 3AIWA 3T2PA 4UOZA 4Q22A 2WCAA 2VZOA 4NZCA 4D72A 1CZ1A 4B16A 1FOBA 4MB5A 2G41A 1W1VA 2OYMA 2BVYA 1E6SM 1QBAA 1U2YA 2WKGA 4RE2A 4EK7A 6CGTA 2DSKA 5FL1A 4PMUA 3CHCA 1BVNP 1HJQA 1Z32X 3BAWA 4BQ3A 4MNKA 5E09A 4JFSA 1CXIA 3AS2A 5A6JA 1WZMA 2V38A 3LPFA 4BZYA 2GDVA 2C8NA 1AVAA 1E6XM 2YA0A 1EDQA 2PWEA 1CGTA 3AYSA 4XV0A 3DYMA 3MS8A 4HMEA 3MUAA 3WNLA 5BXSA 1DHKA 1GQKA 3EYPA 1VRXA 1PIFA 2CIPA 2DGAA 2WHKA 4C7DA 1UWUA 3FAXA 4F66A 3WH7A 2WMHA 1OT1A 1GQJA 3AJ7A 2J47A 1H41A 2IXUA 2GDUA 1HT6A 3WD4A 4WJXA 2DSUA 4UQCA 3VILA 3TA9A 3CUGA 1WZAA 1XD1A 3WH9A 3GDBA 3UEQA 2ZUVA 1U30A 2BS9A 4PEEA 5DFAA 1OIMA 3KE0A 2YL9A 1JGIA 2ZX7A 2OWXA 3VKKA 4E4PA 1O7AA 1CXFA 4F9DA 2OSWA 5CPSA 1E4MM 2VL4A 3WEOA 3FW6A 2XWEA 5E9AA 3POHA 3RM9A 1JG9A 3PZOA 1OSEA 4PMZA 5C70A 4ZE4A 1QVBA 4CN4A 1I75A 4E8DA 4QDMA 1UR8A 2YDRA 1L8NA 1TR1A 2NW0A 2YA1A 1NWTA 3L2MA 2GVYA 1H09A 2X0YA 3BCDA 1V0LA 1W9XA 4E8CA 4H04A 2FH6A 3K8KA 3FXYA 1V3JA 3LMYA 4MDOA 1XD0A 3VPLA 1Q4NX 3AHZA 5ABFB 3MSDA 2CBIA 3AIVA 1EDGA 2F8QA 1VB9A 1NOFA 1JD7A 3I3EA 4GPNA 5HPOA 3A6OA 1VFMA 3ARUA 4U2YA 5CSYA 1GOOA 1V3IA 4ZFMA 3VMOA 3ARSA 3VO0A 3AXXA 2W62A 3PZTA 4P8XA 2VR5A 4R27A 5BXTA 4UR9A 4Z2JA 3A3HA 3NJ3A 3OGSA 2WM0A 2V5CA 4TTGA 4TOQA 1OT2A 5JBDA 3N04A 2WBKA 1KQYA 2BVTA 1E15A 1TA3B 4BQ2A 3CUFA 3ARXA 5M5DA 2JF6A 2DT1A 2CKRA 3MANA 4GXPA 4PUDA 4HOXA 3AHXA 4CD4A 1VEMA 2BXZA 4V28A 1J10A 2PC8A 3PZ9A 1TG7A 2WMIA 4H8VA 2VZVA 1LG1A 1UKTA 3W6MA 1B1YA 1QI5A 2UY5A 2ZXBA 3AZTA 2BY0A 5CPQA 2PBOA 3OLEA 1FHDA 2GJXB 1CNVA 1XH2A 4ZENA 1OD0A 2XHYA 3A4AA 1R86A 2XFRA 3MV11 2ZICA 3AS3A 1HP4A 1VBUA 2J79A 3SCVA 1DWFM 3CH9A 2WWDA 1JXKA 3AHTA 2G3MA 5ECUA 2ZXQA 1MQPA 4Z2LA 3SCRA 3GNRA 3TOPA 4CN6A 2XWDA 4FF5A 2RGMA 5A6MA 3PN8A 4UOJA 1RD6A 2JE8A 3WQ6A 4CCDA 4BQ4A 1ISZA 2VX5A 2FGLA 1V08A 3THCA 4AXNA 3BCFA 2EPKX 2YLLA 3MUY1 1EHAA 1FHLA 5D4YA 4AMCA 1OWQA 1UWTA 5F7UA 2BY3A 3BLKA 5TD4A 2ZUTA 4GI8A 5I0DA 1KR1A 1E6NA 3W53A 1QW8A 1MYRA 1CGWA 1JFXA 4K68A 4BQ5A 2WSPA 2QMJA 1BLIA 1PX3A 2GK1B 2J7FA 1I1XA 1J0HA 5DT7A 2PWFA 2JIEA 2VRJA 4RE3A 3EDKA 4L4PA 1UOKA 4M56A 1V03A 3TTSA 1S46A 4AY1A 4U31A 4J27A 4YHEA 3VIOA 4J3TA 4S3JA 2WZEA 3OGVA 2J7BA 4BS0A 3ZQ9A 2E8ZA 3PHAA 4AZCA 4YHGA 3W0KA 4W5UA 3RMEA 4W93A 1C7TA 4OZOA 2F2HA 4MB4A 2PWDA 4LXFA 3T2QA 3PZQA 2OWCA 3K4AA 3WFZA 4AYSA 2JF7A 1JNDA 4HZ7A 1UD2A 1HKIA 2EQDA 3CLWA 4JIEA 4LYRA 3IJ7A 4HMDA 5BWFA 3WF4A 2J25A 1NP0A 3RM8A 1G0CA 1B90A 2XG9A 2EEXA 3HN3A 2PI6A 1E0XA 4DWSB 1V6WA 2D22A 1N82A 4M24A 3GXDA 3W37A 4PMVA 1PZ3A 1QI0A 1QNPA 4FLQA 4BA0A 1G9HA 1ODUA 3UETA 1FP8A 5CLWA 1B31A 3VD4A 1WDPA 1GOKA 4TVCA 2VOTA 2WZIA 1GUVA 5ABHA 2QPUA 3D5HA 3EMCA 5E6ZA 4CVWA 2QF8A 3UG5A 1KWGA 5A6BA 2CITA 1FFQA 2V3EA 4XZWA 2ZE0A 4GI6A 2WVTA 4IPLA 2IXVA 4NRSA 1V6XA 1JNEA 4M81A 5A2AA 1G94A 1ZU8A 3GBEA 2PB1A 3UESA 2EPMX 1CENA 1JAEA 2CHNA 4CD8A 4DUWA 6TAAA 1OB0A 1WCGA 3L4XA 1C8XA 1BG4A 1B3YA 2PWHA 4HMCA 1UR4A 4M1RA 1H1NA 3A4WA 3FN9A 4MNJA 5DF0A 2YIHA 3OB8A 4WKFA 2EPNA 5FIPA 3ZR6A 3VM5A 1BQCA 4NRRA 2CCRA 1E73M 1JF5A 3WF2A 3ZT7A 1NM9A 2XFYA 1E4LA 2MANA 1BYAA 1C3FA 1V6YA 3WMBA 1GOWA 1V3HA 3BAYA 1CXHA 4GIAA 3WDHA 1UWSA 3W4RA 2FDMA 3GXMA 3K1DA 3U5YA 6A3HA 3DHPA 4URIA 2FH8A 3WDJA 4DUXA 3L4YA 2DDXA 4UQEA 3WENA 1ITXA 1Y7VA 4J3WA 1NOUA 1DWJM 2YDSA 4GI9A 1WE5A 3ZOAA 2W91A 1XV8A 2GSJA 4ACYA 5IFPA 3WDIA 4DUVA 3LPPA 1UH3A 5BROA 2YL6A 3DHUA 1HJUA 4GKLA 1H11A 4Z2GA 4FLSA 2CEQA 1ITCA 1UD8A 4A3YA 3BAXA 3MV01 3L4WA 4FLRA 1E0VA 1UWQA 3WNKA 2BXYA 4KWUA 4KH2A 4P8UA 2ZUMA 5I23A 5HOSA 2ZIDA 1H3GA 3SUSA 2WXDM 4CKQA 2CPUA 3MMUA 3T0BA 1NWSA 3PTKA 1UYQA 1E71M 2WZHA 4RL3A 3BAKA 3UR7A 1JI2A 4DWSD 4GZIA 4ML4A 1KCLA 2VURA 4RE4A 4CU7A 1ZBVA 1ZB5A 1UR2A 3FNDA 1OINA 3ARWA 1H5VA 1UD4A 2W67A 3GBDA 5CJ5A 1EO5A 4X0VA 1E3XA 4UFMA 1CPUA 3QHNA 2VCAA 5IDIA 2V3DA 3ALFA 3NUKA 4UCFA 3THDA 2RGLA 1NWRA 4HTYA 4M29A 1B3XA 2EPLX 1HL8A 3GTNA 3F5LA 1W3JA 1MW3A 3N12A 2O9TA 3VIPA 2DH2A 2A3AA 5E0FA 1HVQA 1GQLA 5DO8A 4XZBA 5C8BB 5JIWA 1BYBA 5CXPA 3IJ9A 4N0RA 1OIFA 4BF7A 4MJ4A 5GNYA 4J3SA 1V0MA 3OLGA 4B9YA 2WLZA 4JFVA 3L4TA 1E1EA 3I3BA 1E1FA 4TX6A 1MWOA 2O9RA 3WEMA 1E43A 4PCTA 2XIIA 1HJXA 2O9OA 3VGGA 3WF1A 4YPJA 3AQUA 4P7OA 1CYGA 4PN2A 4B3KA 2HISA 1HN1A 4CN1A 1W3KA 4S3KA 2E0PA 4U5KA 3F4VA 2DSZA 3CHFA 1Q6EA 4GINA 4W8LA 3CIVA 1GQIA 1ZBKA 2CHOA 4JKMA 5A1AA 3VDHA 2XM2A 1FP9A 4H8HA 2EXOA 4D6IA 2E8YA 4AIUA 3ARPA 1B3ZA 1JF6A 3GNPA 3VDAA 3VIHA 1C8YA 1HL9A 4V27A 1TZ7A 3VD7A 1EQCA 2V3FA 1FH9A 2X1IA 1OGBA 3BSHA 2WCGA 4DWSC 3QHOA 3HMCA 1UHVA 2D3LA 3N1AA 3WH5A 4HA1A 2J77A 1KGXA 2WWCA 2FHCA 3RIKA 4P7RA 4IUGA 2J4GA 3AIUA 4AD2A 4OBRA 4AZGA 3WUFA 1E0WA 3OLDA 3VD5A 1PZ2A 1JZ4A 4AC1X 1JZ8A 1LL7A 3N9KA 2BV9A 1AQ0A 3IANA 3VGHA 2CBJA 2J62A 3L4UA 4UNIA 1TVNA 1DWIM 3IK2A 3VGBA 2EJ1A 1WPCA 1E6RA 2ZX8A 1EO7A 3AMGA 3BLPX 3M7SA 1QBBA 4JAWA 1WDRA 2VRQA 5CQ1A 2VQTA 2WLYA 3WL1A 2PWGA 2W61A 2XPKA 1EA9C 1E4IA 4LYQA 4PTWA 4D6JA 5A2BA 5CG0A 4AISA 3WIJA 1HXJA 1VFFA 3BAIA 4YN5A 2V5DA 1BYDA 4LYPA 2J8FA 3AYRA 3SUVA 1J12A 4W7WA 5BCAA 3TTYA 4WIWA 1W32A 1WP6A 2TAAA 5E70A 2UY4A 1QHPA
chains in the Genus database with same CATH superfamily
4S3DA 1ME9A 1POJA 3HV9A 1DTNA 4XISA 2YR1A 4OT7A 3RITA 4H8UA 2VOMA 1IHIA 2VN1A 3KCJA 1VJIA 4GO9A 1K03A 4CNOA 1UQZA 4B4FA 2P4VA 2ZQSA 3U5UA 3IK4A 1QI3A 5CZ0A 4I8YA 1X8FA 1VC4A 4Q32A 3IJ8A 4HA3A 4MWAE 3H26A 3RU8X 1O60A 1CWYA 3FK4A 2WNWA 3WBAA 2NZLA 1J96A 1QK0A 3MB9A 4X63A 1QOQA 3EBVA 2VCBA 2L5HA 3TTOA 4JXCA 2I14A 2XSAA 1EEPA 1VLIA 5FAGA 5LA2A 1WOAA 4NY2A 2Z25A 1L6GA 3UY8A 4J7RA 4IIBA 2WB5A 4KCWA 5GNZA 3IRSA 2V69A 1ZAIA 4YTUA 1DKWA 3W1QA 5K4ZA 2W4XA 1IEXA 2C14A 3WK2A 1M1BA 3W7CA 4DBEA 4DN1A 3U48A 4O17A 2E5BA 4PTNA 4NI8A 3WDQA 2G3IA 3TC3A 3BUVA 4Y8FA 1XH1A 2WVSA 2B7PA 2F23A 3T40A 2XH4A 2J75A 2Z29A 1RH9A 5D2TA 1R9XA 4UQDA 2NV1A 3OP2A 1XG4A 1TPEA 1P1MA 4LEQA 1NAL1 1XIIA 4FIRA 1TVPA 2INFA 2DG3A 4JTQA 3IRDA 1LL6A 3H8AA 2BASA 3VTRA 3IVUA 1H62A 1SFJA 1ZZMA 4OV4A 2OJPA 2YKKA 3TQVA 3L2LA 1IGSA 4DBWA 4UUIA 5HR6A 3PBGA 3TDFA 5TF0A 1TX2A 3GR8A 3WYZA 1K1DA 4NZJA 5HXMA 4KCVA 1T11A 1UD6A 2CNCA 3A13A 4TVDA 1M01A 2DIEA 2OX4A 3M5YA 2E1WA 1J11A 4ZXOA 5C6MA 5DN1A 2PTZA 3PC0A 3AHYA 4F0KA 5B7ZA 2E28A 1ADSA 2J6VA 2PDKA 2VD8A 4HN8A 5I3HA 3M0LA 3V0UA 1NSGA 3O16A 1GJUA 2GGIA 4DJEC 3WK1A 3KABA 4C6CA 2NQJA 4JNMA 4HNTA 3E2RA 3VDCA 1T6MA 2C1HA 3LK6A 4DF2A 3F2BA 3A47A 1QFEA 1EWEA 1ZAJA 2OEKA 4UFIA 3WBEA 4GFSA 3W2KA 4JHZA 2YW3A 4AHOA 4GYPC 3WMLA 3VNMA 3WH6A 2PF0A 2YB1A 1YADA 1OHLA 1F3WA 3G0UA 4MNLA 4NP7A 3BPWA 5AZ1A 3UQNA 1DOSA 1BVWA 3QPEA 1GKRA 4WSKA 4AY7A 4DAFA 1Q66A 1RJQA 1R3RA 2XSBA 1UP2A 3R0KA 2OWWA 3AXHA 3II1A 4L4OA 1F3TA 4D6HA 2ZR4A 2SFPA 4QE5A 4DLFA 1TTPA 1Q7QA 1NFGA 3GO2A 3B9DA 4C02B 3RLVA 4DJFD 3N15A 4XVEA 3BMWA 5BU9A 5DO2A 1YW1A 4P8WA 1VYPX 2VHLA 3C0SA 4CU6A 4PH6A 1SUXA 3MHGA 1LUCB 3BAJA 1AD1A 1WXYA 3GYCA 3S1XA 4PRWA 5AY7A 4Q8VA 4HA4A 4M7SA 4HBEA 1XCXA 5FJUA 3VCCA 5HDRA 3FVMA 3ATZA 4IFKB 3RG6A 2Q6ZA 4H9XA 3W72A 1W54A 3GH4A 4HHPA 3GU9A 4JIHA 4JDBA 4YIWA 4WSHA 2EBNA 3M6DA 3SDOA 3SUUA 1B30A 2OYLA 2ZDRA 2BB0A 3LUTA 1IWBA 1PIIA 3GVRA 2FFIA 4BI6A 4HPGA 1U5VA 1R3TA 1JDAA 3GPKA 4EP8C 2CXEA 2KZHA 3S5OA 4XAGA 5EMLA 4O0ZA 3GC4A 3WNMA 2QULA 3VZXA 4UTMA 2UBPC 3W83A 4NASA 1L0PA 2HTMA 3WQ8A 2WVUA 2Y8VA 3LLXA 4UNLA 4L61A 3O5FA 1VBGA 4LUYA 2J74A 4ZVJA 2MPHA 1FH8A 3L68A 3LGEA 5AYBA 4JEQA 4AWTA 2WZTA 4IL2A 9XIMA 4PUWA 1V3MA 3FJ6A 2PWVA 5CJNA 3WQ5A 3LM3A 4P7QA 5GPGA 3KCOA 3VZYA 4C60A 2FQIA 4I6KA 4Z0SA 5DCBA 2QUTA 2ZX5A 1BXBA 2PP3A 3MYOA 5BOEA 3AROA 3NQEA 3AWNA 1QNSA 4PTMA 4CEXC 1FH7A 5HK4A 3V35A 1FCUA 3SEPA 4OJYA 5CC6A 1UOZA 3O8AA 4MY9A 4QAWA 1IQ8A 3MP3A 1DJYA 3K8LA 4QSHA 1CLXA 3D3AA 5F4XA 1R30A 2OODA 3ENLA 3G0XA 5DCEA 4C6LA 1A50A 2WW5A 1AH4A 4XTIA 1UCWA 2BY1A 4KMQA 3DN5A 2XPAA 2I56A 2H90A 3CQ0A 4RDVA 3WD2A 2OSYA 1JIBA 2HXUA 4EX4A 3KLLA 4WD0A 4JL2A 1JL8A 1OFQA 3W87A 2O4MA 4W89A 4W7VA 3O5GA 3G22A 3ZYZA 4QNWA 3HJEA 3U57A 5I77A 4DO5A 5F4SA 1YX1A 1WOBA 2E9MA 4LEFA 3AZSA 3M0ZA 3P3BA 1F4AA 1Y5VA 3VCRA 4J3UA 5AN7A 3VIIA 1WYIA 3A4XA 2DVUA 3LXAA 2GLKA 3CZEA 4FNSA 3KDOA 4AMAA 4CD6A 5AVNA 3QW3A 3FHQA 5HUAA 3O0FA 1JCLA 1L1PA 1KXQA 4ZODA 1GWJA 2QHAA 2MLXA 2TSYA 4B5SA 4S3GA 4JYDA 1ZJAA 3QKEA 3CTLA 3SCSA 3T0DA 3N2MA 3BQ5A 1UZDA 4G8TA 3UCCA 2H9AA 2VI0A 4ERGA 5A69A 2F9RA 4UTHA 3CJPA 1UQYA 4HA0A 2PDUA 1I0DA 6TIMA 4IPNB 3AICA 3CBWA 2PEVA 3B8TA 3M0HA 3VAVA 3AFBA 2ISDA 2POTA 4MUPA 5M03A 3VIFA 2G4FA 3I6RA 7ENLA 3T1GA 1TFVA 3LQGA 4C6OA 1J0JA 1JAKA 1ONEA 3H2NA 4MPQA 1X98A 3CU2A 3A22A 3EXTA 1EF3A 4K7VA 4LBRA 1J0ZA 2D0HA 1EJTC 2E3ZA 2E40A 3CIXA 3UR8A 5HULA 2V9DA 1J01A 4W87A 2Q02A 4DJEA 4XX6A 4IMEA 4NJJA 3DG6A 3B8SA 1VEPA 3AIBA 2OYKA 2IQ0A 3S6OA 4W85A 1QHOA 3CZ8A 4GYFA 4QJ5B 3G6MA 1GYMA 2WPGA 3VGFA 3LI1A 3R11A 5EGRA 4MYAA 2VEIA 4HPHA 4D6GA 3SCNA 3JUGA 1MRAA 1RY8A 3OZPA 4L6HA 3W85A 2YBUA 3LUOA 4PMRA 3EWYA 2G3JA 3B8IA 2DORA 5LNUA 5JH2A 3U6WA 3B97A 4LVAA 1JYXA 4DYKA 5IRPA 3O5KA 3CTTA 2A0NA 3PSWA 1ZGDA 4PRTA 3B40A 1JDCA 1Y65A 4YCPA 2BGSA 4L6DA 1HQTA 3EWDA 3JR2A 4ZQOA 4L5ZA 1OGSA 1TIWA 5G1TA 1I2RA 4HNNA 5HMDA 3WQWA 4PMOA 2PBCA 2V5LA 3CZKA 5K9CA 4JTUA 4P7NA 4ZSTA 3N6HA 1UA3A 7TIMA 2J13A 2BOEX 4JFTA 2FGBA 3HTWA 1G7VA 5EY5A 7A3HA 5DMYA 3W1TA 3R94A 1S2AA 3I65A 3W7QA 4HNUA 5DITA 1KRBC 1V8EA 4UTWA 4G7EA 4BI7A 4KRZA 1JPHA 4BCEA 3UWQA 2DZBA 4DBSA 3TN5A 5ECVA 3TYBA 3TEVA 2ACUA 4IP7A 4DZHA 3ITVA 3WQ4A 1EJXC 2X0HA 3O5QA 2JZVA 2F4EA 3FXGA 5LXXA 1MZHA 4GIYA 2PPGA 3W7IA 4D1IA 3GAYA 2GSEA 4LAVA 3L5AA 1DQWA 3S0CA 2YDQA 2E77A 4LW7A 2W3ZA 4GVGA 3LNPA 4JFJA 3UWYA 3V4BA 2HDJA 4N42A 1Q6DA 3LHWA 3ZFHA 1PKMA 4B91A 1OJXA 3U0HA 3APGA 1J6PA 3NQBA 3NZ1A 5AHFA 3CUJA 5FJTA 3EDDA 5CLTA 3MDWA 1ODZA 3DI1A 5G4WA 2VWTA 4ZQPA 4LUTA 4H9TA 4O1BA 4I8DA 4ODMA 5D30A 2PP0A 3I4EA 1LUCA 2YZRA 3G1DA 4U10A 3CV7A 3WG6A 2A3HA 1IZKA 3H7RA 3ITGA 5EA9A 4D1JA 5A95A 1TVLA 3UCDA 3RU6A 1XYBA 2PUZA 3SN1A 4LS2A 3CZLA 2QMKA 1YATA 2ZE3A 4NNRA 3CQJA 3B0UX 1E6PA 4PMJA 1OF6A 2Y8KA 4IUOA 4H6RA 3GVGA 3AAMA 4XZHA 3GB6A 1DYSA 1TUFA 1VENA 1BTMA 4TTUA 2NQLA 3EWBX 1SO5A 2X40A 1DEDA 5A2CA 4FS9A 2M2AA 2PU1A 4K7YA 1GVIA 1Q6RA 3FKRA 3LN3A 4L1XA 2Q8XA 2V2CA 1ELSA 2Q3RA 1RZMA 2A3EA 3UXIA 1KKRA 4MDPA 2PA6A 9RUBA 3UI4A 5M3WA 3GDTA 1BWKA 3TONA 2CETA 3IV8A 5G2IA 4KWVA 4RLIA 5A6AA 1O6IA 3C56A 2CU0A 3UWEA 4IZGA 3W6LA 4AC7C 3OG2A 2Y5SA 3Q58A 4IMFA 1MFVA 2Q5AA 1GVQA 3UWVA 3EXRA 1C91A 2Y85A 4FLOA 5HTGA 1Q6OA 4A3UA 5H91A 3EOOA 3S2MA 4EIVA 4DJFC 1PBGA 2RFGA 3LPOA 3P7YA 2OOGA 1CBGA 4EACA 1JZ6A 1KLZA 3M6YA 3MZ2A 4K8EA 3UR2A 1T40A 5BRQA 1VPXA 4IHCA 1K8YA 3TJ4A 4RK8A 4RZ4A 4K2SA 3ZVHB 3DZ1A 4S3BA 2WVVB 1FDZA 1PSCA 5I6SA 4I5XA 3HPAA 4GABA 3O6CA 4H83A 2K8IA 1TR9A 3RCNA 3APTA 5ABGA 1U33A 3SRHA 3UERA 2GVJA 2PCQA 4GACA 2ZDSA 2NUXA 3LHTA 4CNTA 3E0VA 3QC0A 2P76A 3HOJA 4E4FA 2DJXA 1AA1B 1Q6HA 1GVYA 1G67A 1ZAHA 1G69A 2D3NA 4NJIA 3PR2A 2ZWZA 5EFFA 2Y0FA 2YBVA 3AIRA 3MWCA 1CGYA 4DEFA 3LSCA 5D09A 1A5BA 1DXFA 1HNYA 1JYNA 1TJ2A 3KVKA 1YYAA 4NILA 3LBOA 3DFTA 1KXHA 1Z7AA 3IJDA 1F2JA 3QZEA 1JQXA 3C0LA 1UUOA 3K4WA 1CECA 1RCOB 3EDFA 3LB0A 4TXEA 2NSXA 3UW6A 5ABFA 2FJKA 3BDKA 2BNJA 1TREA 2BZNA 1QNVA 5JBEA 4JTEA 2CKSA 3SURA 2XZ7A 3ERPA 1EXBA 3ZT5A 3PB2A 4Q4KA 5C2GA 4CQDA 2OR2A 1LWJA 3KP0A 2BHUA 5KEZA 1NMVA 1UR9A 3PR9A 1T99A 3N9RA 1FCVA 3URBA 4ZOBA 3G3DA 4K38A 2V30A 3OQEA 3IEBA 1ISWA 4LRTA 2CBVA 1KGUA 4FHAA 1UWIA 1E44A 3W70A 3TFXA 1TJ0A 1MXSA 3W7LA 3TCEA 1XFCA 1HZYA 3Q65A 4C6QA 3GU0A 3EEZA 4M19A 3S9IA 1B2YA 1P48A 3WLMA 1R6WA 3VD9A 1M5YA 1PHQA 4DWSA 1OX4B 2C0HA 3KZSA 4ATWA 1GJPA 2QJNA 1UR0A 2BFGA 3PP7A 3CV1A 5DMNA 4EPKA 1KCKA 4UTTC 2I5QA 4CQAA 1IEVA 3VDGA 1SJDA 1QW9A 3W82A 4LRSA 4JKKA 4JFWA 3E0WA 4FNUA 3TA6A 1KGWA 3SN0A 3S3GA 5SWUA 3W1XA 4F8XA 1Q4WA 7TAAA 1K9EA 2D0FA 4DRKA 4TU1A 4RNIA 4XAFA 3STGA 3WDPP 3EOEA 4UOQA 4JTDA 1XYCA 4WDWA 4JTRA 2WMIB 4AZIA 1CEOA 2VC6A 1R2TA 3PBUA 2NQ9A 4KGJA 3AYTA 1BFNA 1QNQA 3GG8A 1K70A 1FKGA 4GIEA 1HIZA 4FO4A 3RM4A 2VUNA 1QOXA 2WMJA 3GU2A 2H9AB 3NQMA 2P0OA 3RILA 2BOGX 1SMDA 1XKYA 2ICSA 1B3VA 1WUFA 3OOQA 3CGTA 3BLDA 4XKYB 2RDWA 1IWPA 4OGZA 4FR6A 3QFEA 2I17A 1JCXA 4F48A 4LANA 2OGYA 3M43A 4US5D 2XVPA 1Y5WA 3ARYA 4CD7A 1N55A 4YVXA 4X2PA 2PDYA 1CGUA 5HWCA 5HQLA 3TLLA 1EQ3A 1W26A 2DT3A 4C6KA 4GVIA 4UBPC 1Q65A 5B7YA 4LPCA 3T07A 2Q3OA 3TQ0A 5DQPA 3QTGA 2AL2B 3IVSA 3AIWA 1S38A 4UOZA 2PDJA 2VZOA 4NZCA 4D72A 1CZ1A 3BMBA 2YXGA 3SY1A 1NTHA 2OB3A 1FWSA 3H4XA 5CBIA 1XPYA 2BVYA 1AZ1A 3N29A 1Q6QA 2WKGA 3U2CA 1Q7MA 2BP1A 4RE2A 3IGUA 6CGTA 2V6AA 4PMUA 1HJQA 1BVNP 5FJJA 1Z32X 4NT0A 3BLIA 5G5IA 3EEGA 3C61A 3QSRA 4DPPA 1CXIA 2C8NA 1E6XM 1EDQA 4JS3A 4G2DA 5DELA 2AGTA 1UB3A 2YXXA 3P60A 2CIPA 3F2DA 1J5TA 2J88A 3MW7A 2X1SA 4WRHA 1OT1A 2G50A 3NQVA 5CBJA 2EG6A 1D9EA 1H41A 5DRIA 2F21A 3P67A 2GDUA 2I5IA 2ISVA 1XGEA 3WD4A 5HWMA 3KAGA 2JKEA 1XD1A 5K3VA 2ZUVA 4FX8A 3SGGA 3V5CA 3PS7A 2XIJA 1OC5A 2ZX7A 3VKKA 4E4PA 3IIOA 4LBSA 5CPSA 4WJ8A 2VL4A 3FW6A 4S39A 5E9AA 3POHA 4DH0A 4RW5A 3W2MA 3W75A 3TU9A 2Z26A 5HNUA 5C70A 1CB7B 1QVBA 3HG2A 4NXKA 1OCNA 3IUHA 4Y96A 4F0LA 4E8DA 2OX1A 4WXYA 2Z6JA 2YDRA 4Y2WA 3D3FA 2IPGA 4KQNA 3CMFA 2OLSA 2NW0A 1NWTA 2FPYA 1EPVA 1XLHA 3BVJA 3LLFA 4DNMA 2ON3A 3BCDA 2EGZA 2OFNA 4H04A 3K8KA 3LV5A 1V3JA 1W0MA 4ERIA 3LHUA 1XD0A 1Q4NX 3UWUA 2F8QA 4GE8A 1NOFA 3EXSA 4L64A 3NPVA 3A6OA 5HPOA 1XL9A 2IKGA 2E6DA 2X1RA 3WLTA 1V3IA 4ZFMA 5CJMA 3VMOA 2NXGA 3P8JA 2VR5A 2WPBA 1IXOA 3HURA 3W7MA 4NJKA 3NJ3A 2V5CA 1F3EA 4FALA 4S3EA 4DO6A 5JBDA 1KQYA 2BVTA 1TA3B 3NL5A 4BQ2A 5EMKA 3T42A 1VS1A 3O63A 2C15A 1KV8A 4PUDA 1H1ZA 1ICPA 4CD4A 2BXZA 4V28A 4ZS6A 2Z1BA 3NZPA 2QW5A 3NDOA 2VZVA 1AQFA 1PUDA 4DRQA 1LG1A 2J9YA 3OOBA 4LWWA 4YVVA 3W6MA 1QI5A 2UY5A 3AZTA 5CPQA 2MUCA 2XFWA 1FHDA 2QEZA 3G24A 2HNEA 4ZENA 3MVTA 4E38A 2ZICA 5AKQA 3SCVA 2WWDA 1JXKA 3D6NA 3FA5A 2BWGA 2G3MA 3CUXA 2H8ZA 2W9MA 2Q8ZA 1MEWA 4Z2LA 1B57A 1IIGA 1J6YA 1VBHA 1RD6A 8XIAA 4BQ4A 1ISZA 1R2SA 3N3TA 2FMOA 4I7UA 1C29A 2VENA 2EPKX 1Q8JA 1FQ0A 3OZMA 3MO7A 3P84A 1FHLA 1OWQA 1UWTA 1A3XA 4O1FA 4DBDA 4KEUA 4GA8A 2E6FA 4JX4A 2QMJA 3U2ZA 2PRMA 4YS1A 1J0HA 5DT7A 2FKEA 2JIEA 2ZZ5A 3RHGA 3EDKA 5CH9A 3BZGA 1S46A 4J27A 4GGHA 3VIOA 3BTNA 4BF8A 4E2BA 4GLEA 2FB2A 5DLCA 1GG0A 2V5KA 3CQHA 1P5QA 2J7BA 4QE1A 1JR1A 4YHGA 1F6YA 4W93A 1C7TA 4OZOA 2Y7GA 5DANA 3TMLA 2R82A 2OWCA 4AYSA 3PBMA 3MI3A 3HIJA 1HKIA 2ACSA 1K4GA 4JIEA 2YCEA 5BWFA 1EYWA 4EPDC 1Y5XA 3P5YA 2C18A 1EL3A 2EEXA 3HN3A 4LY4A 2PI6A 1AH0A 3RLGA 2BGNE 3A3XA 1KTCA 3CWOX 3ORWA 4GUHA 3UETA 4TX0A 4ZBCA 1C9HA 3TDBA 3B9NA 3N34A 1WDPA 5FF4A 4R0XA 2WZIA 3D5HA 1OYBA 4JOMA 3EMCA 5A6BA 2QJMA 4OHQA 3H2CA 2V3EA 4XZWA 2WVTA 3DCPA 2XP7A 2IXVA 1UC4A 4NNCA 2BG5A 4XD5A 3O07A 1ZU8A 3KZPA 2YX0A 5K2ZA 3UESA 3C52A 1JAEA 2J27A 3R2GA 5C2XA 1RV8A 1WCGA 1GVFA 3M9YA 5TAOA 1SM9A 3G1VA 2IKJA 4M1RA 1X8CA 5C9ZA 3A4WA 3GKAA 2GDQA 2FZ8A 3IGXA 2YIHA 3TC7A 3ANVA 3OB8A 2PV3A 4WKFA 2I16A 1LZOA 1E73M 2XFYA 1FKWA 1BYAA 4M7TA 3OJGA 3QVQA 4YMZA 1GOWA 4WVXA 3M0IA 4B2DD 1GPWA 3IGHX 1US0A 2NUYA 1YE6A 3WDJA 2DUAA 2HBVA 1MZRA 4UQEA 5BNKA 3T4CA 3A12A 5HA7A 4HARA 1QPFA 4OTKA 1R3VA 4IG2B 3WBYA 3L7RA 1G7UA 1DWJM 2Q01A 2YDSA 1OX6A 4ACYA 2W91A 1XV8A 4AIBA 3WDIA 3LPPA 2IW0A 1UH3A 5BROA 2Z28A 1S5WA 1H11A 4Z2GA 3HQ1A 2IKHA 3BAXA 1OX4A 4FLRA 1JCTA 2E67A 4KWUA 4P8UA 3NXLA 4M1BA 2Z6IA 3T0BA 1FHVA 1A0CA 5TQLA 5TBOA 3RF9A 4DRPA 3W1PA 3E49A 1X97A 4QAIA 2WZHA 4GGBA 3UR7A 4YU1A 5HATA 1JI2A 1KCLA 4NYYA 5JMUA 2VURA 4Q8WA 1VKFA 3MY9A 1LCOA 3TCSA 1W5MA 1X1ZA 2QJIA 2RSEA 4R33A 4Q4RA 1XLDA 3LRMA 1FDYA 1E1CA 1E3XA 5F2GA 4UFMA 1CPUA 1QO5A 2V3DA 2LGOA 2ZR5A 1DBTA 1NDZA 3UR5A 4KT2A 5CZTA 1MDRA 3HPXA 3RO6A 4P61A 1NWRA 4HTYA 4AY8A 4KWSA 2VDGA 2HEJA 3GTNA 2PDIA 1O1ZA 1MW3A 1W3JA 3MJYA 5I09A 3N14A 1PINA 1MUCA 2DH2A 3BLFA 1HL2A 4M5PA 2CLKA 2RQSA 4EPEC 3C4UA 4GBDA 5HMFA 1TPDA 1YDVA 1W8SA 5JIWA 3TFCA 2KE0A 2GYIA 4MJ4A 1OFRA 3FV9A 1EEXA 4FNQA 5GJPA 2PP1A 2WLZA 3TXVA 3L4TA 5HJYA 4RXGA 3I3BA 1E1FA 4C6FA 1LROA 1E43A 1HJXA 3VGGA 3WF1A 2P1FA 2QVNA 4XZMX 5LNWA 1RLDA 1IE7C 4CN1A 1NDVA 1S5VA 1WQ5A 2E0PA 4J2MA 2DSZA 4GINA 4W8LA 2AMXA 2CHOA 5A1AA 1T7LA 1W8GA 1AL8A 4EF8A 5AZ0A 1F40A 4ICNA 5FA5A 3EKLA 2E8YA 4AIUA 3ARPA 4QS6A 3HQPA 1C9DA 1RCXB 1JF6A 1OADA 3VIHA 1A49A 4V27A 4JNZA 1TZ7A 4HK5A 4RE0A 1FCBA 4LNCA 2I9UA 2X1IA 2ZZ1A 5AC8A 3BSHA 2WCGA 3QHOA 1VFLA 2D3LA 1FWTA 3WH0A 3G1HA 1OY0A 4P7RA 4IUGA 4FXFA 1H5YA 3HG5A 4AD2A 4OBRA 1F8MA 4AZGA 3LG3A 1XFBA 1SGJA 4I9JA 3R8RA 4L65A 3P81A 2C1IA 4AC1X 4H00A 4K3ZA 3W3OA 4BJHA 3L23A 4TMCA 3VGHA 5FF2A 2UZ5A 1V5XA 2J62A 3IK2A 1XIFA 3MZNA 3UQIA 3EAUA 4RZ6A 2EJ1A 3VGBA 5EBUA 2ZX8A 5D03A 1CX9A 1QBBA 2VRQA 2INZA 2VQTA 3WL1A 2XPKA 3FDKA 2ABBA 4PTWA 4D6JA 3SIZA 3LCIA 1Q2SA 3WIJA 3V18A 1RK6A 2V5DA 1BYDA 2Y63A 1XLMA 4NAEA 4WIWA 3R58A 1OFOA 5E70A 3CEPA 1QHPA 1I2OA 5C0QA 5FF3A 2OLHA 1NDWA 3M47A 1S2CA 1ROTA 4GUJA 5C54A 2XFFA 3L5MA 4LFYA 4C6DA 1QPQA 2ZA2A 7ODCA 4ZMGA 3CZJA 2DH3A 3BV7A 4FZIA 1XJBA 3W24A 3KBNA 4JQ3A 2FTYA 3TN4A 1V7AA 2W27A 1PX8A 2YOCA 4TV5A 1REQA 3S5NA 3W00A 1CXKA 4NZ4A 4K39A 5XIAA 5AC4A 3H6OA 4NXSA 1FCQA 5JIPA 3WMSA 3ZLHA 3M5VA 3JS3A 1KWKA 4BHYA 3UPBA 3QM3A 4LYKA 1IYXA 3SIMA 1VIWA 4GCXA 1HGYA 1KFCA 1RP8A 5EPDA 4KRUA 3I68A 4A22A 5LNSA 2EKCA 3NM1A 3LV6A 4CGTA 2OZTA 2PWUA 3RLUA 3UZWA 4LQ1A 3VOHA 2A1YA 4A35A 4Q8QA 3RAOA 2FJUB 5LA1A 2A3CA 2PN0A 2R1NA 2W92A 4JFIA 4FNTA 4UC5A 1GPFA 3F5KA 1KRMA 1GOIA 3N17A 4W86A 4JYFA 1PAMA 3W28A 2Y4SA 3SECA 1KCZA 7PTDA 4JNYA 3M1ZA 1BPLB 2ZADA 4TV6A 3GKFA 5DMMA 4UTWC 2XVNA 2ZZ3A 3OLIA 1BG9A 2Y62A 5FD0A 3AO0A 3GIQA 1X6NA 1OZMA 9XIAA 2OZ3A 1D8CA 5A8PA 1QK2A 2WNZA 4JQ2A 3VNYA 5A8QA 3QW4B 4OFCA 3TR2A 4FB7A 5A6SA 1YQ2A 2BX7A 1FKHA 4Q7NA 3CUIA 5G1YA 2FZDA 1AMKA 3NDZA 3UZZA 4GZJA 4QJ4B 4WUIA 3WH8A 1G5AA 1QNOA 2BSLA 4Q8TA 5JBFA 4GOAA 4LTSA 1PS9A 2NX3A 3H4GA 1EP1A 2HSAA 4HNVA 3MPGA 3UI5A 1EJWC 1BF6A 2NXHA 5HANA 3URQA 4AIOA 2VEPA 1DP0A 3SJNA 2OZ8A 3DXIA 5E0CA 1W9PA 2YXOA 5JH8A 3GAKA 3HPFA 3VDBA 1P0NA 4HZ6A 2GUYA 1DORA 3E02A 3CHDA 4QG8A 5FL0A 1IEQA 1E9YB 1JD9A 1WX0A 3L5LA 1XIMA 4DJED 4Z0JA 1HXVA 3WKZA 3HG4A 1JPDX 3KP1A 3L9CA 5EMYA 3VX0A 1DJHA 4O28A 5LIYX 4IJCA 3NVDA 3GVWA 1UZ1A 2WNQA 2HVNA 3WBXA 3MMDA 4QSFA 4NYUA 1NQKA 1QPLA 1D7JA 3VMPA 1XW8A 4F9JA 2OKOA 5D9NA 1WBHA 2RHGA 1H49A 3LX9A 3WD1A 2CLHA 4CNNA 2W0UA 3PZIA 4I5RA 1MQRA 1FUYA 2QCCA 1SR0A 1FWFC 2PZ0A 2GJRA 3I7RA 4O18A 4EPBC 4LCSA 2R14A 3FAWA 2ZZ6A 3B9OA 2X05A 3ZM8A 2X1UA 1RK5A 1SW3A 5CBBA 4E4UA 4O1DA 3NIYA 2DZVA 4Q4MA 2J9ZA 2HE5A 1ZJIA 4C1KA 4H6KA 3UG3A 4ZA0A 3T4WA 2G3NA 1BGGA 5F1UA 4PUEA 4GY0A 2CLMA 4KEZA 4GWEA 1A0EA 2V5BA 1ZCNA 2VX4A 2PURA 3GD6A 2D24A 4LT9A 3FY1A 2VZSA 2XN1A 4QITA 2GFTA 1P6BA 3SCWA 1FBAA 3FYOA 1G6CA 3CPGA 3B0XA 4F2TA 2KFWA 1JZ3A 2DSVA 3M0KA 3CO4A 1HG3A 4BWLA 1XIJA 3DECA 1DTUA 1LT8A 4O2TA 1KNWA 1W1A1 2BOFX 4PBGA 3KAOA 1QMLA 1E70M 4KETA 1YPFA 1KFKA 1XYZA 3SAZA 4IOTA 4C1LA 3PB0A 1XP3A 2DV0A 3SW6A 3TLQA 4Q8UA 5REQB 3VFLA 2CC0A 3KEHA 3I10A 2GJLA 1DWAM 4IPIA 4HU8A 1PBKA 5KZ6A 1KCXA 1XQKA 4JDYA 5AB3A 1TCOC 5GVJA 1TSIA 4OOUA 4IGMA 5CGTA 1CIUA 4U3AA 1ZFJA 1R3SA 4MGVA 3ZLFA 1ISXA 2X2GA 4LV4A 2R6OA 4YWIA 4PR4A 4JHMA 4LSBA 3L0NA 4Z1AA 1XRSA 3ISIX 2RKXA 1I60A 4GQBA 1QJWA 3M4HA 5LHFA 4TUFA 3FYPA 1KTBA 1H4PA 3CPUA 4HK7A 5H8MA 1EUAA 4CCEA 3HZ3A 4XAKA 1MMFA 4YJ5A 4WEVX 5EMUA 1KRCC 5J6EA 3U8GA 2W6RA 4X60A 2CZFA 1J79A 3VNIA 3QTPA 3W2LA 5IFTA 1LF1A 1JVWA 4MB3A 4GZEA 3J7HA 5I3DA 1ZJBA 4M51A 4LAWA 3TYDA 1WO2A 3K5XA 3MUXA 1OCQA 3KAHA 3QMSA 2NX9A 1ZBCA 2NLIA 2R1MA 1MEIA 1PWMA 1JUBA 3GDMA 4QRNA 2BMBA 3MO4A 3WDRA 5EBAA 4B15A 1J0YA 2NV2A 4U3CA 3RCYA 3UGRA 3O6DA 4JIRA 1IXNA 1SW7A 4GQGA 4UFLA 1W3LA 2I7GA 3UNDA 2XU2A 1HF6A 3L4VA 3T9PA 3O9NA 1H7XA 5DEZA 4IQDA 2ZC1A 3LZ3A 2WSQA 3APYA 1VPQA 2DW6A 4REQA 4LBUA 1UZ4A 3ANYA 5M1TA 3LRKA 4P5UA 1EUNA 5MKGA 2Y2WA 5AHEA 1CXEA 4ZFCA 3LHYA 4KW2A 4G56A 4FR1A 1V6TA 1E72M 3TK7A 4IJRA 4Z2IA 2OFJA 3SCQA 1A5MC 3GHSA 1E5JA 3C8FA 1DIEA 3S1WA 3AI0A 2CZVA 3UJRA 4K8HA 1HW6A 2B81A 1G4EA 1P7TB 3R79A 1KM5A 1RPXA 1EKOA 3WK0A 1ZJHA 3UWWA 4ODOA 2ZX9A 2P8CA 2CERA 3E1F1 4HPNA 4ONVA 2JGYA 4QNEA 3GVVA 1K8ZA 4MWAB 1TQJA 1SFTA 3A23A 5LIKX 1K7XA 2OO6A 5HJLA 3MJMA 1EX1A 4Q7BA 4QQ3A 2Z1VA 1VFUA 3M46A 1WKYA 3ZVHA 1SVDA 2PPPA 4PMYA 5LA0A 3ZSTA 2VFGA 5AFDA 3TYZA 3GUWA 4XB3A 2AQOA 1W5OA 3SCUA 1TQXA 3EX2A 2WMFA 2XJ7A 1QI4A 3BQ6A 1UUMA 3THAA 5ABEA 1W9UA 3W74A 2QCDB 3OO2A 4RR4A 3T09A 3ZR5A 2P3EA 2PC4A 3AJXA 2XH7A 1UD5A 2Z2AA 1MVYA 1J5SA 2FPVA 3G5EA 3O3RA 1XM3A 4CCCA 2ALDA 1XYLA 4QXIA 1O5QA 1VRDA 2WAGA 4ZXLA 3NZRA 3MHFA 4JN6A 3TH6A 3VUSA 1U1HA 4HQVA 1JYVA 1AMYA 1WZKA 3WFLA 3ZR4A 3S5ZA 5HPCA 2OKTA 4LAOA 1F61A 2QLYA 1KQZA 3TROA 3ICJA 5EB8A 3G6LA 4MIMA 4A8RA 3IARA 3B8UA 1KBBA 4XAPA 4AZHA 4R7WA 5AC6A 3S2CA 1K9FA 4ATLA 1C93A 3V5OA 1XLLA 3S6DA 2ZWYA 2ZUSA 1PO9A 1GKPA 3B8DA 1FA2A 3VYLA 1XS2A 5BZAA 2IKIA 4AXKA 4ZQMA 2PSNA 1US3A 4QCFA 2NSOA 4YTRA 1ONRA 1CGVA 3IV3A 3PRBA 3OGRA 3STEA 4R7OA 4B3LA 3MYPA 1US2A 1R7OA 4DJDD 1KXTA 3BG5A 2QIWA 1DHPA 4GUIA 4JTGA 3MMTA 2DG4A 1F9CA 4JL1A 1HJSA 1M7PA 2XN0A 4EE9A 1EH9A 2FFCA 2DPEA 1B9ZA 3O5DA 4XWUA 3AC0A 2XN2A 3QQWA 1E0UA 3PPGA 1TWWA 1W1YA 4L3NA 2TPSA 3QZAA 5GPRA 1L6YA 1BVZA 3O6AA 2FHBA 5BOOA 1TPH1 4JTJA 3W26A 5DIUA 2B5UB 1XYFA 3KBMA 3GDRA 1BD0A 2XVKA 3MI6A 4B9ZA 3WNNA 3T55A 3UZXA 3F2CA 4IPPA 1HVXA 3EB4A 2D2GA 4AZ5A 4P7LA 4PE8A 3QZ6A 2XZ9A 3JZEA 1GZ1A 4O1AA 2GVEA 3W7GA 5CEWA 5A8MA 3RRAA 3E38A 3IPWA 3WJZA 1WZLA 5I00A 2XVLA 4K1WA 4BF9A 2C13A 1XISA 3ARVA 1XXXA 2UZ9A 1LBLA 4IX2A 5I3KA 4LB4A 4ITZA 1EQPA 3O5MA 1B0IA 1XSKA 4AZCB 3AMLA 2A3BA 3T8LA 4QLJA 2HVOA 2E4TA 3PNUA 1SFSA 2NT1A 1O5KA 1DWHM 3MBDA 3KL3A 2NWRA 2YBTA 1W1IE 2ZUWA 4C7GA 4UZUA 4M6QA 3G1XA 5LHEA 1HUVA 1UUQA 1JPIA 1K9DA 1PDYA 2WJDA 3OBAA 1FFRA 2OT0A 2IUZA 5D8ZA 1L2QA 1UKQA 2WJEA 4FMVA 3S8HA 3GHUA 1RAKA 1RY0A 2W5FA 2YA2A 3K4DA 3G1AA 3BGGA 1V77A 1YXYA 1UJQA 2RJGA 9CGTA 3H2EA 4IICA 1JUKA 3C86A 4N9EA 3EY6A 2ZVRA 3PM6A 3RO8A 1A4LA 3RXZA 4NNAA 1KM4A 4UFKA 5I07A 3VX1A 4A6GA 1YLVA 4UQAA 3LCWA 4E3TA 1GRJA 1E9ZB 8CGTA 1ECEA 1TE6A 2XIOA 4XKYA 1Q6IA 1OFDA 4Q4PA 4ATDA 3ZT6A 2ZCGA 3LTYA 3QMTA 2BHYA 2R24A 1F4HA 4K6AA 4E2VA 1VYRA 1R7AA 2QDGA 4WQ6A 1OYCA 4DRIA 5I5RA 2XP6A 3LCLA 1YHTA 3GE7A 1OFBA 3QGAC 2KR7A 2QCMA 3STPA 3VOGA 4HSHA 1X96A 4GC3A 3SQLA 1U1UA 1I1WA 4IP5A 3UCQA 4KEVA 4EXAA 2YSWA 4PULA 4HU4A 1AJ0A 2VR4A 3AIQA 1GQNA 3RPMA 1WA3A 4GKTA 4YYFA 4HVXA 3BH4A 2PLCA 2Y5JA 3FYYA 3KADA 3G18A 1S5NA 2X1TA 2JALA 4XD6A 2CZ5A 3SN4A 3CV2A 2ZQTA 2E25A 2XIQA 1PEZA 3AYVA 1VEOA 3HU7A 1BGAA 5C71A 4IIEA 2OCZA 1VBRA 5EKYA 1IIHA 4X9SA 3GH7A 2AAMA 1UBPC 3KOFA 3P0XA 5IBXA 3CL8A 1NU5A 5DRCA 1PWLA 3R1ZA 1C92A 4C65A 1XDJA 3NOYA 3R89A 2DZUA 3VU2A 3COTA 1R5YA 4QLKA 3HM7A 5F4WA 3VD3A 4WZHA 2VFIA 3KOZA 3N4FA 1VFTA 3M0MA 5IHRA 3UXAA 5HKGA 2YYTA 3BLLA 1MXGA 4H01A 1Z8AA 3GXNA 1H7OA 4DI8A 5LKYA 1J18A 3RFAA 1VJSA 4DPQA 4C5YA 2AQVA 4C6IA 3UU0A 4PC8A 1SMAA 4G2PA 1D3GA 5EU9A 2PLJA 3VE9A 4AD1A 3PBWA 4NHVA 4JTSA 2BBFA 1KFEA 2ZKMX 4IIHA 3ONBA 5KZMA 3GTXA 1Q3NA 4N02A 1Z41A 5ABTA 3KWXA 4NG3A 4OECA 3TAOA 3C2EA 4GJJA 4YNGA 2PZNA 4GX9A 1EDTA 1E4NA 4F79A 1GTEA 2VGBA 5CC7A 4L4MA 3H21A 1Q6UA 3OHMB 5TIMA 1OCJA 1XGDA 1MW2A 3C2RA 3A9BA 4WK9A 1IR2A 2Y61A 5B8IC 2EJAA 3N73A 1KLYA 1XRVA 4NI3A 3WLHA 3CS2A 2GGEA 3ME3A 3T2OA 1TYGA 1YEYA 1ZRQA 3VIJA 1EOMA 1FWHC 4LAMA 2EG8A 1KXVA 3W7NA 3EPOA 1X6UA 3CWHA 3ZLGA 4HYRA 5AYZA 4XZNX 1EYEA 2VCCA 2V67A 2ODOA 3SY5A 5L6UA 2Z7KA 1S2TA 3S2NA 4HNCA 3KX6A 1QTWA 2PV2A 2BLEA 2NVCA 4LALA 2UWFA 4H7VA 4ZQRA 1EB3A 3ATYA 1KD0A 3NZGA 1V7YA 4IM4A 1J6OA 4MJ2A 3GNDA 1YPXA 3EPNA 3RPTA 1P7TA 3CMJA 4KF1A 4AVNA 2HCVA 1JI1A 2AAAA 3BL3A 2PGWA 4U2ZA 4F0SA 4PYSA 2PDMA 2GWGA 3E96A 1XSIA 4XIAA 2OU4A 2DEPA 1KV5A 2DZPA 2WHMA 4MWAA 3R13A 4HCDA 4IP4A 3BJTA 1JCYA 3TE9A 4QCEA 2E9BA 4ZSUA 5A8GA 4NJHA 3FOKA 3VAWA 3MI2A 3N13A 4IFOA 4MJZA 3TJLA 4AWEA 3REQB 2X42A 1L9WA 1IGWA 5HWJA 1VF8A 1IXQA 2ESCA 4QQUA 4RNFA 3QEZA 2ZC8A 3B0VC 4Q7IA 1E3ZA 1UD3A 3CYJA 3AUOA 5HQMA 4O13A 1JRCA 4MUZA 3SZ8A 5GNXA 2EPOA 2J7DA 1K02A 5D02A 2PS2A 3GR7A 4A3QA 1VIZA 4DO7A 1O68A 4X2RA 2WCAA 1QR7A 4ZOCA 4B16A 3C0QA 1R2RA 2OZ0A 1ECQA 3W1AA 1QBAA 1HTIA 4H9ZA 3LDVA 2DSKA 5FL1A 3NQ7A 3C3NA 4HN4A 4BQ3A 1TWDA 3DU0A 2F6UA 2F7FA 1CCWB 5I98A 2D2HA 3EX1A 3LPFA 4BZYA 1AVAA 4MZ1A 2PDNA 1PYMA 4J1OA 3WQGA 4S3CA 4XV0A 1R38A 1EX5A 3MS8A 1Z48A 5FJOA 1DHKA 3NQFA 5J04A 1DQXA 2CFFA 1J8VA 6ENLA 2FVMA 1UWUA 3FAXA 7REQA 2OMAA 3WH7A 3AJ7A 1ZK6A 5REQA 2OELA 2XPBA 4POCA 3GG7A 3W7RA 4NU7A 1HT6A 3KCLA 5DX7A 2OVLA 1KM0A 4Q8OA 4DYJA 4UQCA 2ACQA 1RA0A 4Y9PA 3VILA 2C3ZA 3WH9A 1B3OA 3B3DA 3HPSA 3LA4A 4PEEA 5DFAA 1OIMA 1OFPA 2JKAA 2YL9A 3KE0A 1YDYA 2OWXA 1R3WA 2XSXA 3EWUA 1QUMA 1REQB 3EX4A 1S1PA 5CPMA 4D8ZA 4PMZA 1J2WA 4XZIA 3V0SA 5RUBA 3SRKA 4CN4A 3EWZA 1ME8A 4QDMA 4AX7A 1I9CB 1XYMA 2RDTA 2QAFA 4R9OA 3SB0A 1JJKA 4DHGA 1EGVA 2GVYA 4AUBA 4CCZA 1UZHA 4M3PA 2X0YA 4Y6GA 1V0LA 4QEEA 4E8CA 3FXYA 3BANA 3VPLA 2R1KA 3AHZA 4Z42C 5ABFB 3QQ0A 5T9CE 2CBIA 1EDGA 2V0TA 3ARUA 2TODA 1YDNA 1GOOA 4ZOEA 4OBTA 3PJWA 4RNJA 4P8XA 4QJ1A 4Z2JA 1PYFA 3VC6A 3A3HA 3UZYA 1W56A 3OGSA 2WM0A 3TC6A 4TTGA 1LP6A 3DG7A 3E74A 3MHUA 5G1MA 4N4QA 2W79A 2PLKA 5CC3A 1KM3A 4KR0B 5AHNA 1BXNA 3ARXA 3IIVA 3N4AA 4QISA 3VOIA 2GQAA 3UNTA 4XKMA 3MANA 4GXPA 3AALA 1N8WA 2DUXA 2ETNA 2V8ZA 3W7HA 1TG7A 1W31A 2P0IA 4H8VA 4H2HA 1FTXA 4LS1A 1H60A 1B1YA 2ZXBA 4HSNA 5PTDA 2GJXB 2FZNA 4IL0A 3CAVA 1OD0A 2XHYA 2XFRA 4PFHA 3MV11 4G1KA 3AS3A 1HP4A 2J79A 3NQGA 3AHTA 2YCLA 3GNRA 4GCAA 3LCXA 4FF5A 3TQKA 3PN8A 3IK8A 2JE8A 2VX5A 2VC7A 4LAXA 1J2BA 4O10A 2V68A 3BCFA 3I4KA 5D4YA 4AMCA 5F7UA 2ZUTA 4L4LA 1XUUA 1E6NA 4DY1A 1CGWA 4ILSA 4K68A 2WJFA 3IKGA 4PBEA 1BLIA 4ZB0A 4MWAD 5K4XA 2DFAA 3BCJA 2IPFA 3KRBA 2C19A 4RE3A 4L4PA 3TIMA 6REQB 2OTDA 3VXGA 4S3JA 2WKJA 1GVSA 1MI3A 4QT2A 3T7VA 3B06A 1B4EA 1A5AA 1XLEA 2ZA3A 3LBMA 1B54A 4BS0A 1F3XA 3PHAA 3RMEA 1WV2A 4AX6A 4LXFA 3T2QA 3E5PA 1ML1A 4K37A 2JF7A 5FJRA 4HZ7A 4C91A 1L8PA 1RD5A 3IJ7A 4HMDA 2J25A 1E0TA 2IMRA 1E0XA 4CNSA 1FAPA 4DWSB 4KFPA 4R88A 3UG8A 4M24A 2O7SA 2XP4A 4EXBA 4PMVA 1EJUC 4ZR8A 1QI0A 1E1CB 3KVMA 4FEZA 1FP8A 4UTJA 1VFSA 3FLUA 4WX2A 3VD4A 1GOKA 1UPMB 3JZUA 2A7PA 5ABHA 3MA8A 2R1PA 1NIUA 1DIKA 3DBPA 4CVWA 1A5CA 2QF8A 1N7KA 1R9YA 1RXOB 2C1GA 2NWSA 5HWNA 5FF0A 4ROQA 1T8XA 1YNQA 2A5HA 2POZA 4FI4A 3H2OA 1ENUA 3GBEA 3TCZA 1RBOB 1XDLA 1OB0A 4ODQA 4IF2A 2YW4A 4KCUA 4QTGA 4DQWA 1C8XA 4B5WA 1B3YA 2LLEA 1ROUA 3FN9A 4GI4A 8TIMA 5DF0A 4Y9AA 5FIPA 1OFAA 3G3MA 3ZR6A 1BQCA 1ZCOA 5E5CA 1JF5A 3WF2A 1P6CA 3M7WA 4ZO6A 3WMBA 4B5UA 1CXHA 3D46A 2ZYFA 4ECLA 1XIGA 2V63A 4JTIA 3IJIA 6A3HA 5C9XA 4URIA 3HBLA 2FH8A 1F5ZA 1AG1O 1B4KA 2HRWA 3L4YA 3HFYA 2DDXA 2HK1A 1ITXA 1Y7VA 4OVXA 1NOUA 4A8IA 3LERA 4LVBA 4GI9A 3G1YA 4JTHA 4DI9A 2GSJA 1WKEA 4DUVA 1FKLA 3W02A 5LSMA 1YTKA 2YL6A 4MKNA 3AWOA 3DH7A 4JN7A 2NVDA 3PJXA 4FLSA 4WXZA 3BMXA 1UD8A 1AD4A 3MV01 1H7WA 1PHWA 3WNKA 2ZRWA 3M5XA 1AK5A 3SUSA 4CKQA 3OIXA 3LXBA 1O5XA 2OPJA 3BAKA 4DWSD 3S9YA 3LGDA 2FZMA 3CNYA 3O06A 4RE4A 3EX6A 3THUA 3FNDA 3CUZA 2ATMA 3HPZA 4KEMA 1UD4A 3C2OA 2W67A 4RV8A 3G8RA 1EO5A 4X0VA 3N2XA 3Q67A 1SO3A 3B7XA 4DT4A 1FWNA 3S47A 2VCAA 4DZAA 5IDIA 4GBUA 3WLSA 1UR3M 4HZMA 3NUKA 1QWGA 3KXQA 4U86A 2V2HA 1MNZA 3HO8A 2Z2BA 1PKLA 3LRLA 1IWAA 1QPRA 4J40A 4M29A 2Y7FA 4NNBA 3OPSA 1JEZA 2VCDA 4MGGA 3F5LA 1O94A 3N12A 3A3WA 3LYEA 4XZ9A 2ZZ4A 1HVQA 2F84A 2A6NA 5C8BB 7REQB 1DJZA 4UWMA 1ME7A 1S5MA 4J3SA 4XSLA 4IIDA 3SJ3A 1LORA 4B9YA 1E1EA 4QIBA 4GJ1A 1TV7A 1MWOA 4PCTA 4YPJA 3AQUA 4P7OA 4PN2A 1HN1A 4O1EA 2PTDA 3NQ2A 3C3UA 3XINA 3QLLA 2PDBA 2ANUA 4BEUA 2G37A 5M2FX 3C6CA 1M41A 4F0MA 1XIEA 4MKVA 3VDAA 4UTTA 3RK8A 4H19A 1UMYA 1ZSXA 2XP8A 2V3FA 1ZY9A 2YYUA 4IMDA 4F0RA 2X41A 1YIXA 5A6TC 5HR7A 3WH5A 4HA1A 4R9XA 5A5WA 2WWCA 1KA9F 3BOLA 3USBA 2QF7A 3SY8A 2XGZA 3R12A 3QMRA 2PD9A 5CKSA 3NURA 3WUFA 1E0WA 3OLDA 2FAPA 3F1QA 4G7EB 3CQIA 1JZ4A 5IOBA 1LOLA 2GVLA 1LL7A 3N9KA 2BV9A 4YCOA 3L4UA 1DWIM 4RDYA 3EWXA 4CQCA 3PPFA 1E6RA 1W5QA 4TW6A 3UXDA 1IT7A 2PWGA 3PWGA 2W61A 2VELA 3B03A 4CQ8A 3NRKA 3KW3A 4LYQA 4JICA 5CG0A 4AISA 5CPNA 3SSZA 4LNYA 1M9HA 2AGKA 4PUJA 3EOUA 4W7WA 2QCNA 3BURA 4MSSA 2EF9A 2UY4A 4M8UA 1WXZA 1VFOA 3FA4A 3W81A 4DRHA 3GYEA 3TZFA 1H0IA 3FSTA 2Y7EA 2CBUA 5HUOA 4A3HA 4HPJA 1HKJA 7XIMA 3AXMA 3JYMA 3R43A 1UKPA 2QUUA 4U33A 2VQUA 2V2DA 4GD0A 2HE8A 3WF0A 5I06A 1MQQA 3NYZA 3BWWA 5E9XA 4H8NA 4MB1A 2HBXA 3CMGA 1H7PA 2VC9A 4HOZA 1I45A 3ES8A 3SCOA 3UF8A 4WHBA 1AW2A 1T41A 1AJZA 1FWCC 3W9ZA 1G4PA 1IR1A 5B80A 5FEPA 1V3LA 1TRIA 2Y78A 4CNUA 3ABQA 3V3WA 1D7FA 5CPLA 1LRQA 1LYXA 4GC4A 4MZ8A 4LC8A 2ZR6A 3WN6A 4ADTA 1JULA 3V0TA 4DO4A 1L6WA 1BHGA 4RDZA 2XUCA 3H4WA 3P74A 5CAKA 3ES7A 3EPMA 3NL3A 4O50A 3UD6A 3SO7A 2RH9A 2Z1WA 4OE7A 3BSMA 4N4PA 4G9PA 3RJYA 4L6OA 1W1B1 1LJYA 3NPWA 4HU3A 4AD0A 1ISYA 2P50A 2E9LA 3KBSA 4O8AA 1V6VA 3CUHA 1K6AA 3QV8A 4TQTA 4JYEA 4XAYA 3W29A 3LTSA 5E93A 3W2NA 2WANA 4DIPA 2YB4A 3IIZA 1QXLA 4OIFA 1NARA 4QS5A 3WQOA 2REQA 2QPSA 3PRDA 2VX6A 1J4RA 2OSXA 2YZ5A 4L1GA 5AOUA 4QP0A 3DFYA 3GXFA 4HIBA 4D6EA 2WVVA 4XG1A 3IIXA 3SCTA 4KCTA 3NOEA 4FPSA 2PCEA 5I7GA 4B3ZA 1GGOA 1C7SA 3TN6A 3VGDA 1SO6A 4HP5A 1PVNA 2DUZA 3WY1A 2W63A 3DDMA 1F7BA 3ZIZA 4LAZA 2E6YA 4DWDA 1OX5A 2CYGA 3WJSA 4D9PA 3NTYA 1NH6A 3OEXA 2WZMA 3WZ0E 4ZL1A 4LVFA 2BVWA 2G3FA 5C7VA 2Q71A 3L0KA 1ZHAA 3G8EA 4IGSA 1G4SA 4QR6A 1KT1A 1F05A 4YXGA 2YCIX 3OIHA 2O55A 1UC5A 2J8TA 1I2QA 1L6SA 2DZTA 1R8LA 4GH1A 3SRDA 4Z2KA 4B5XA 3W88A 4EOUA 5LNVA 3S5SA 3L4ZA 4W5ZA 4PTVA 4P8VA 2EPHA 2GL5A 3I7QA 4IT1A 3DESA 4DX3A 3FS2A 4IG2A 1UBSA 1EIBA 4MAVA 3KRZA 3S6TA 2NUWA 2DZAA 4L9ZA 2BVDA 2GJPA 1EFZA 3OBKA 4BY3A 5I3FA 5I79A 2D1ZA 3KHJA 3LSBA 5FJPA 1TV3A 1JDDA 1V51A 1H51A 2HWGA 2NQZA 3NAVA 3ECQA 1RP9A 5LYRA 3WQFA 3QV7A 2C7FA 2PTWA 1XCWA 4V15A 5MKGB 4UFJA 1KBLA 3KTCA 3OZYA 4F3HA 4DM2A 1M68A 1Q85A 1TE1A 5A8NA 3LTPA 3DGBA 3A9IA 1SYTA 1D3CA 1XUZA 1TX0A 4IGHA 3CZGA 4Q4OA 2X8RA 4PB4A 1RQEA 1FKXA 2VZTA 5D75A 2VRKA 5LZLA 3W1RA 1QCWA 4IXXA 1KBJA 4AZBA 2MLYA 4LVGA 3FGCB 4R34A 4XD4A 5CPTA 3WFAA 1SJAA 1WNOA 1TPC1 3ZJ6A 3NA8A 2DIJA 1NFPA 4J5NA 1GHSA 3DC8A 3UJ2A 3KAIA 1EYMA 2PRHA 1MUWA 4U84A 3M0YA 3W73A 3PBYA 2XH0A 1XGZA 3ARZA 1SJBA 3LCHA 2WQPA 1BTCA 4O15A 1I0BA 4P2VA 5D2XA 2VD9A 1YW5A 2XYLA 1KFWA 1J93A 1OM0A 3R8HA 3RLHA 1CGXA 3WEZA 1DJWA 3LENA 4I9TA 3ABXA 1G1YA 1WAUA 4PCSA 3QXBA 1TMHA 2QT3A 3OG3A 1CXLA 1SZGA 5CSUA 3L12A 1R3QA 2AMGA 3QHMA 3R8GA 2GJXA 3BC9A 2WMGA 2J7EA 1Q6GA 2WMKA 4A21A 2GGGA 4DXVA 1JZ2A 1XICA 3QF0A 3UG4A 2ZXDA 3EMQA 3M5ZA 6XIAA 2RUQA 3PWAA 1GJWA 1S1RA 5XINA 4UR7A 5D2YA 4WCJA 4DBUA 3N25A 4AEFA 1XSJA 1H63A 2YPIA 2P10A 4D2JA 2Z27A 4AG0A 2ATSA 3T78A 3WNOA 5HINA 3NEHA 2J8GA 1E5NA 2PBGA 2G0WA 3RX4A 1QPNA 3PJTA 2WBGA 3QV9A 1LLZA 1U5JA 3ARRA 4G50A 4V2XA 1XINA 1QWKA 1TZZA 3PRAA 3CHVA 3CPRA 2KGJA 4G1NA 2LKNA 2ZZ2A 3GW0A 3T08A 4FOKA 3EKZA 4O0QA 1F76A 1KKOA 4LCQA 2TYSA 1NFBA 3KM8A 2VEMA 3FX4A 2FHFA 3T0TA 4DXXA 4AWSA 1BSIA 5K9DA 2Y7DA 3W38A 4JTTA 2JQXA 1VBJA 3E9AA 5F1VA 1FY6A 4I9MA 4NAEB 4UCGA 4XSMA 2Z1SA 2CLOA 5KETA 3QR1A 2ZXAA 5AC5A 4O16A 1ESWA 3GTHA 1EGZA 4AD4A 1FD9A 2ZOXA 2PGEA 4ODKA 3F5JA 3C2YA 4MYXA 2QV4A 2Z4GA 4PCFA 4U4MA 4Q4SA 3LU2A 2PTXA 3GIYA 4C90A 1PTDA 4WKAA 4JKLA 2QUMA 4PMXA 2RURA 3UA3A 1V02A 4E8GA 5BYWA 5D9PA 3W25A 6ALDA 5D2WA 3KL0A 4IGNA 4RUBA 4H6QA 1E9LA 1GNXA 3QGVA 2P53A 2IQTA 4FN2A 2VFDA 2MNTA 2CZDA 3JW7A 2ZUUA 1TRDA 3VUPA 3WUBA 3TJXA 3TWAA 5BMWA 4MY8A 4ODNA 4LX4A 5G2WA 1DJIA 4WOZA 5IM51 4QFUA 4NAFB 1VD6A 2J6XA 4IMAA 3UP8A 3B4YA 1JPKA 4UB9A 4TMBA 4YTTA 5AVHA 4A2SA 1IZCA 3N9SA 4JQ4A 1WAWA 5U7SA 3KFTA 1MFUA 2AQWA 1RBLA 1EIXA 4RPPA 4PEKA 3R7MA 3HA1A 3EOSA 1YNYA 3ABRA 3QYSA 4LVDA 2PODA 1CDGA 1XKJA 3DYPA 3GC5A 4KERA 3W71A 4LB3A 3TOYA 4ZZ9A 4D71A 1F6PA 1LBMA 1S2UA 1W3TA 1KB3A 2QDHA 1R9HA 3WD0A 3T0CA 4U5IA 1WDWA 3BLEA 5KSWA 1CTNA 2Y89A 3WD3A 3VOFA 4JGDA 4W9PA 3VNKA 1PTGA 4GZ7A 5AECA 3DYOA 2WOQA 3O7UA 4QGCA 2GUBA 3IAPA 1SQ7A 3IS4A 2PDGA 5C9RA 3IUIA 4EAYA 4XBJA 2I1OA 1GVOA 2V81A 1I8JA 1MRQA 1MW1A 4E2OA 4MKSA 2QUNA 2GQ8A 3CC1A 5DCDA 3EGJA 2YLAA 4JTAA 4LF2A 1ZPTA 1YBQA 2VDIA 4M82A 3H23A 1FRBA 2QJJA 3CL6A 1TTIA 4W84A 3VOJA 1N2VA 3H54A 3NQAA 1QT1A 3DX5A 1ZBWA 1HGWA 2J78A 5BRPA 2VMFA 2ZTKA 1OZQA 1TZ9A 1UWRA 2G5WA 2O92A 3U7BA 4QHRA 1BRLB 1W5PA 1CT5A 3R4IA 1X6LA 1KM6A 4L9XA 2AKZA 2VT0A 1V4YA 3O6YX 3MWAA 3EX3A 2FIQA 2OGJA 2LJ4A 5DMLA 3WBWA 4ML9A 3W7KA 1Y8BA 3HV8A 3UXLA 1FWIC 4AD3A 3PZGA 3T81A 3N2BA 3W01A 5A8OA 4W9QA 3UJEA 1OF8A 1ITQA 3VNLA 4KRTA 2HS6A 2HPMA 4ZQNA 4AB4A 3MUZ1 3LCGA 5DY2A 3GTIA 1LM1A 2HQAA 4ZO9A 2BHZA 2D2OA 2VGIA 4X61A 2CHRA 3UZ5A 2WC3A 1L2UA 2O56A 1QNRA 4X9YA 3QV6A 2VNCA 4KFNA 4UIOA 1ZTVA 3WX7A 1DQUA 3WELA 5E6YA 1TWIA 2CLLA 2OO0A 4EAMA 4WSJA 5D8WA 4JFKA 3C5QA 4X3ZA 2ZTJA 1K3UA 1UROA 3TYCA 4E3VA 4NAFA 2H6RA 3VOCA 3WSUA 1QASA 1YTEA 1EJ7L 4NKCA 3AS1A 3WMCA 4DVOA 1H61A 4FAPA 4R85A 4A4AA 1P0BA 3EB3A 1VLWA 1IV8A 3GZ3A 1E40A 1HJWA 1XCFA 3IUDA 3SGZA 4MF4A 2BY2A 1ALDA 1XH0A 3NO1A 2F6KA 4ACZA 5FCZA 3P6LA 2GPTA 3K46A