1XHGA

Crystal structure of a 40 kda signalling protein from porcine (spp-40) at 2.89a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 40 kDa signalling protein from Porcine (SPP-40) at 2.89A resolution.
rcsb
molecule tags Signaling protein
molecule keywords SPP-40
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xhgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xhgA01
4HOZA 1J10A 4ZXLA 1G1YA 2DSZA 4A3YA 4TOQA 2G3JA 4ATWA 1D3CA 2WVVA 2VX7A 4YPJA 1W2PA 4GQRA 4AD2A 1W9UA 3WMBA 4PMDA 4CUCA 4HOWA 1KXTA 4KRUA 2D23A 1TA3A 2XVKA 4WK9A 4TVDA 1JZ6A 1AMYA 3WH5A 1BLIA 1JIBA 3VIFA 4MDPA 5I78A 5I6SA 1EHAA 4CU6A 4AYSA 4J27A 1JFXA 3AYRA 3AS1A 2EQDA 1OWQA 3UERA 4CD8A 4W89A 1UUQA 3N11A 2E0PA 3CHFA 4D6GA 4JL2A 3GH5A 4AW7A 4XZWA 1EQPA 1JYWA 5BRPA 2PWFA 4U33A 2TAAA 4PMUA 3N13A 3U5YA 1ZBWA 2XSBA 1UH2A 4U3CA 4B9ZA 1X1NA 4EANA 2ZX5A 5A8QA 1CTNA 2CHOA 2YDSA 4AISA 1V0MA 3W81A 2QPSA 1ECEA 4Q7NA 1TR1A 3ZSSA 3VIMA 5JBDA 4P7OA 5HDRA 4WSJA 4CCEA 2W91A 2XVPA 1J0IA 1ESWA 5E6ZA 1IZJA 1PX4A 2Y24A 5ABHA 2WMFA 1GNXA 2PBOA 3W24A 4WIWA 2G4FA 4DWSD 1MYRA 1UOKA 1FHDA 3WF2A 1VIWA 4AD3A 1UG6A 4CD4A 3PTQA 4W93A 1NWTA 3LMYA 3CZJA 3SCVA 4MB1A 3LPPA 1UR4A 1FFQA 5E09A 1K9FA 1QHPA 3WL0A 2VMFA 3T0AA 4U5IA 1OINA 3UG5A 4B3LA 4R27A 3ARVA 2CKSA 2VURA 1VEPA 2WCSA 2ZX6A 3K1DA 4OKDA 3QR3A 4MB5A 2GDUA 3CMGA 2AMGA 1VAHA 1Q6EA 2O9TA 3UG3A 1GHSA 2EPKX 2X05A 2VQUA 2UY2A 2CETA 3VOCA 2XM2A 2V3GA 4CCCA 3TTSA 2Q8XA 1CECA 1KXVA 4P7QA 5JBFA 3WKZA 1WDQA 2FH8A 3ZR5A 1QW8A 1EA9C 1RP9A 2VNCA 2EPMX 2J8GA 1ITXA 5EB8A 3QHNA 2CERA 3FAWA 2E8ZA 3J7HA 2BHYA 2D24A 2YL6A 5A95A 3POCA 2J7GA 4HPHA 4ATLA 2DGAA 4JZ5A 2DIJA 4PTWA 2ZXQA 3FXYA 3VNZA 4MNMA 5A8MA 1PX3A 1NP0A 1PPIA 2VZTA 2XFYA 4W7VA 2QMKA 2CIPA 4Z2GA 3GXMA 2VX4A 3PZQA 3PZUA 4AZCB 2ZE0A 3N15A 5A8OA 2O92A 1UH4A 3W26A 1WB0A 3FAXA 2WMHA 3MKKA 1E0VA 3D3AA 4RL3A 2J7BA 1GQKA 4PMOA 5IHSA 1D2KA 3THDA 1BHGA 1NWRA 5M3WA 2ZOXA 3PHAA 4W87A 1XHGA 3VDAA 1FHLA 4TTGA 5CJ5A 1KCLA 2CESA 1V6YA 4DM2A 1KGWA 4HU8A 4MNKA 4WKHA 1ITCA 2V3FA 1VEMA 4MNJA 5TD4A 1EOMA 1VBRA 1ISZA 3CIVA 3SCUA 4JCMA 3VM5A 3AHZA 3FHAA 2YOCA 3OBAA 4PBGA 1W1PA 4MPKA 3HU7A 1E6PA 5EBAA 3RJXA 2XWDA 1KQZA 1J11A 5E0CA 4F9JA 1H5VA 3AIRA 2XIIA 2ZUMA 8A3HA 1V0LA 2RGLA 1WZKA 4DWSA 2XGBA 3VX1A 3KWXA 2VRKA 3F5KA 2D1ZA 4LX4A 4MB3A 1M53A 3MV11 1UZ1A 1OCQA 3F5LA 2W61A 1W3LA 3OLIA 1E40A 1XV8A 4MDOA 4UCFA 1EO7A 1O6IA 5D9NA 3GXFA 3WD2A 2GVYA 1UD3A 3WD1A 1UQYA 1R85A 2XVGA 3W0KA 2BHZA 3LPOA 2BVTA 3IJ9A 1GJWA 3AHTA 4B9YA 1LJYA 2JALA 3ZIZA 1MXDA 2G3IA 4S3JA 3BMVA 2ZUVA 4JHZA 4AZGA 3OIHA 1KXQA 5A6MA 1EGZA 4HZ8A 1JI2A 1KQYA 1VFOA 3PZIA 3GNOA 2GFTA 1TCMA 2J78A 4P8UA 4GI6A 2WK2A 2WHJA 1UWQA 3AMKA 3BAJA 4V2XA 4WKFA 1HXJA 1E71M 5IFPA 3W25A 5HXMA 3UR7A 5LA0A 4AC1X 1E70M 2A3BA 3MMWA 1CWYA 5A1AA 3ZJ7A 2OSWA 1E4IA 2EEXA 3UESA 2D0FA 5EFFA 1W9XA 1HP4A 2G3NA 2E40A 2ZICA 5E6YA 4UFIA 3PTMA 1LWHA 2W4XA 3ALFA 3VNYA 3EDEA 5M5DA 1R7OA 2GK1A 1HL9A 2DSWA 1B3XA 1CGWA 1HF6A 1W1YA 5KZ6A 2VRQA 5I3DA 1B3WA 4AZIA 2Z1SA 5A6JA 4W8LA 4YHEA 5EMYA 4RE2A 1CENA 4OBSA 1EO5A 1KR1A 1C92A 1AQMA 4F9DA 1SMAA 2EXOA 4GPNA 1GOWA 1JXKA 2VL4A 4PTMA 1E6ZA 1JYXA 2XFFA 5JH8A 2J7EA 3JUGA 1KWGA 1BVNP 5HPOA 1E5NA 4AEEA 2PC8A 2A3HA 3ZJ6A 5A6LA 3AHVA 4F8XA 3W53A 3W6LA 3TA9A 1E55A 2DT3A 4JL1A 3I3EA 1M7XA 4UQBA 3WD3A 2ZUUA 4B15A 3B9EA 1GOOA 4ZE4A 4AY1A 1OT2A 2BY0A 3MS8A 3CLWA 2W67A 1ISYA 1UD5A 1ZB5A 3CMJA 2O9PA 4AXNA 5CSUA 4JKLA 3K4AA 2ZXBA 4M29A 1N82A 3BAXA 1JFHA 7TAAA 1KWKA 4X0NA 3QHOA 4TUFA 1J01A 4M24A 2VZOA 1ISXA 4UQEA 1GVIA 3N9KA 1GJUA 2YDQA 4PCSA 6TAAA 1E3ZA 4QDMA 2A3EA 2ZUTA 4H04A 3W38A 5C70A 3MU7A 3BXWA 1C7TA 2X0HA 1LLOA 3BGAA 2CYGA 3B9DA 4H8VA 3W28A 4PMYA 4C7FA 5DT5A 1G0CA 4D6EA 4X9YA 1OM0A 4H7VA 1SFSA 3L2LA 1LWJA 4NRSA 3ZR6A 3ZT6A 1QW9A 1BG9A 4C7GA 3BSGA 1AQHA 2D3LA 3BAKA 4UFKA 2DSUA 4F66A 3BAWA 4JFUA 4DWSB 2WZIA 1NWUA 4TX8A 4HA4A 2WC4A 1ISWA 2J47A 3WSUA 5FOOA 5HPCA 2XTKA 4FK9A 7A3HA 1TMQA 5CG0A 4YN5A 4A3HA 1BTCA 3CZEA 3K46A 1CGTA 1MWOA 3IJ7A 5HBFA 2BY3A 2WB5A 3WQVA 3DC0A 3VVGA 4AIUA 3A4WA 2PBGA 1LG2A 4E8DA 1US3A 1V02A 4D6IA 4GO9A 3GNPA 3EYPA 3RM4A 3ARYA 5AC5A 5D8ZA 4PUDA 3AXIA 1HJUA 4KGJA 1BSIA 4JKMA 3VIHA 2VCBA 3GYCA 1GOQA 2WZHA 4HP5A 1VEOA 3OLEA 2EBNA 5AC4A 2X0YA 3AIEA 1UR1A 2GJPA 1CZ1A 5LA1A 3G6MA 2ZIDA 1W1VA 3HJEA 5JBEA 1CXLA 2ZX7A 2WWCA 4GQQA 1BG4A 5IDIA 2E4TA 4DUXA 2VI0A 3W27A 3VGBA 4CU8A 3CO4A 1KR0A 3MSGA 4PMZA 4UZUA 5CZKA 4CU7A 4Z2IA 2Z1KA 4ZE5A 3RDKA 1JAEA 4M56A 1K6AA 3FY1A 3ARTA 1MQQA 5D9PA 5IFTA 3MUIA 2NT0A 3WDRA 4Y7EA 2OSXA 4TX6A 4AZ5A 1OT1A 1CGUA 1OB0A 2Y2WA 3ARZA 1W32A 1OIFA 1A47A 3ZQ9A 1V6WA 4AIEA 2DT2A 3TTYA 1KGXA 2Y8VA 1R7AA 1BYBA 4ZENA 3O6AA 4HOXA 1XCXA 1DWIM 4KMQA 9CGTA 2WVVB 4RE3A 1V08A 1R8LA 1XD1A 3VUPA 5BYWA 4OBRA 1HJQA 1MQPA 3WENA 1EOKA 4CD7A 2EPNA 3SCWA 3WH6A 1V3HA 4UZSA 1UWSA 3CZGA 2J7DA 2VT0A 4MJ4A 1BVZA 3BLKA 1W3KA 4MJ2A 1Z32X 3SEPA 3NJ3A 3PZOA 1W9VA 1VJSA 3VGHA 4Z2KA 3QHMA 3WNLA 1W91A 2J4GA 2WHKA 1GVYA 5C71A 1W3JA 3SCRA 1MFUA 2W66A 2VX5A 1VB9A 2GDVA 4Q22A 3WH7A 3N04A 1ZJAA 2V5DA 1A3HA 2YL9A 4JFTA 5DFAA 1BQCA 3OZOA 2PB1A 4GXPA 4P8WA 3WFLA 1J0ZA 3VIOA 1E73M 1XC6A 3PZ9A 4GI9A 1RPKA 1UWRA 3WD0A 3ARSA 1QI3A 4AZ7A 3CZKA 1WP6A 2Y4SA 4MAVA 2QF8A 5BRQA 1HNYA 3O9NA 3VDHA 3VMNA 3TTOA 1E6NA 2VOTA 1WCGA 2EPLX 2XGIA 3N12A 4CN4A 3SIMA 4W5ZA 2E3ZA 5ABFA 1WO2A 1GUVA 5A6SA 4HZ7A 1J0JA 4P8XA 1CGVA 1K9TA 1UKQA 3W4RA 1I1WA 4E8CA 3MMUA 1ZU8A 2YDRA 3M6DA 3AIBA 2VCCA 1UZ4A 1V03A 2XPKA 2XIBA 1NOUA 5BXPA 4FLOA 3POHA 1ZS2A 4JAWA 1JD9A 5A3HA 2W92A 2XG9A 1VRXA 4JIEA 1RD6A 5D9MA 3T2PA 2ZXDA 1CXFA 3ARQA 3UCQA 1YHTA 4M1RA 2BXZA 3VKKA 3QOMA 2G41A 1GPFA 1GORA 1E4LA 1LF1A 3U7VA 3VIJA 3CPUA 2D0HA 4HZ6A 4UTFA 3WUFA 2QHAA 3ZT7A 1JZ3A 3WBAA 4BQ5A 1G5AA 1E4NA 1CEOA 3GXDA 2FHFA 4P7NA 1UD4A 2DPEA 3VPLA 4KRTA 1DWHM 3VMOA 4CD5A 4XV0A 2VX6A 4AWEA 4AD4A 3W37A 1PIGA 5DMYA 1LL6A 3DYPA 3VD7A 2A3CA 3A6OA 2ZUSA 1P6WA 5A69A 1HJSA 4GI8A 1XSIA 3M07A 4CKQA 2CKRA 4OJYA 5BXTA 4NSBA 1CXKA 3VD9A 3AICA 1DTUA 3ZT5A 5D4YA 5I79A 4L4PA 4LYPA 3S2CA 1JG9A 3RM9A 1FH8A 1CXHA 3VDCA 1EDQA 3BCDA 1TA3B 3A47A 3RCNA 4QLJA 4BA0A 3B8SA 4ACYA 1DWJM 1M04A 4FLRA 2WPGA 1YQ2A 2YL5A 4LYQA 5I24A 3AS0A 5KEZA 5ECUA 3M46A 3VGEA 2FGZA 4YHGA 2WNWA 1CDGA 4PMNA 1JI1A 1ODUA 2X8RA 2WMGA 1GOMA 2XFRA 1XSJA 1V3JA 4HPGA 2WANA 1H0IA 2YBUA 3DYMA 4P7LA 2IXVA 3AROA 2VZSA 3U57A 4BS0A 2AAAA 3K8LA 1V6VA 4AD5A 3WMCA 4W8AA 1H0GA 3F5JA 3WF0A 5FL1A 1EXPA 2E9LA 4MB4A 1V6XA 2XHYA 4U31A 1H4PA 4GO8A 2IXUA 1HN1A 1JNDA 3NSNA 1WPCA 1UD8A 2YLAA 3AFBA 1QNRA 1E1FA 1G9HA 3VO0A 3WDIA 1VBUA 2BY2A 1WAWA 1CGYA 3APGA 5A8NA 1QBAA 3BCFA 1DWFM 1W2VA 1LL7A 2WVUA 1FFRA 2WZEA 1E6SM 1WDSA 2VC9A 4IUGA 3N1AA 1CNVA 1LQ0A 4BZYA 5A8PA 2B31A 1OGSA 4GKLA 1NP2A 4J3XA 1CBGA 2MANA 1KCKA 5CPQA 4W8BA 4WJXA 1HIZA 1GQIA 4QCFA 4D1JA 5AYIA 5ABFB 4FLSA 3VGGA 1JD7A 1HKJA 3WDHA 2X2YA 2WKLA 1XSKA 2PI6A 1DEDA 3MUZ1 1JNEA 4DM1A 3TOPA 3AIQA 4PMVA 3WDJA 4B3KA 3KL3A 4EAMA 4BF7A 1RP8A 3EDKA 4UFJA 2Y5EA 2C8NA 4H8UA 4OIFA 3L4VA 1WNOA 3ARUA 2J7HA 5FCZA 1UHVA 3A3HA 3PZVA 1KB3A 3KL0A 1XGZA 2JF7A 4J3UA 1HJVA 1GQLA 4W7UA 4PEEA 2WW5A 1UWTA 2BHUA 3MSDA 5DT7A 4JKKA 2CNCA 3UETA 2JFEX 5M17A 4B16A 1Q6CA 3NDZA 1BYDA 2VRJA 4CN6A 4NI3A 4D6CA 4UOZA 4V27A 1FH9A 3RIKA 1W9PA 4N0RA 1UA3A 4QLKA 1B2YA 2GJXB 2CBUA 4F79A 1KGUA 1NM9A 4WSKA 2C0HA 3NIYA 4QAWA 3WDQA 3EDDA 3HN3A 1GOKA 3OG2A 2JIEA 2OLHA 2XJ7A 5BXSA 1W3HA 3OGVA 2YBTA 3QOKA 1CLXA 2VZUA 2WMJA 3BAIA 3AHXA 2Y8KA 4QLLA 2F2HA 3N17A 1VFUA 4IPLA 3VD4A 2WSPA 2D20A 4PMXA 3W82A 5BCAA 3CHEA 1H3GA 4PRWA 3NDYA 1TE1A 1E43A 2CEQA 2UY5A 3AMCA 1M03A 3CZLA 1SYTA 3VM7A 1OSEA 3I3BA 4GINA 1J12A 2CBJA 2VR5A 1E9LA 1ZBVA 2DSKA 1AVAA 3L4TA 4N42A 4CD6A 3T0DA 4EE9A 3E1F1 3EMQA 2XVLA 2UY4A 3ZO9A 1UH3A 1Q6GA 2E9BA 1R87A 1L0PA 2WHLA 4CGTA 5LYRA 1OGBA 3VX0A 4XX6A 1E6XM 2VQTA 3AIUA 3SCOA 4OUEA 4JFWA 1V02E 8CGTA 1GOIA 1Y7VA 1HKIA 1JZ2A 4GIAA 1EDTA 3WF1A 3THCA 1H09A 3SUVA 1CXEA 2WHMA 1K9EA 3ECQA 5GPRA 4BCEA 3NCOA 2XYLA 4AD0A 4ML4A 4M81A 2VUYA 2XM1A 2OYLA 2OYMA 2WBGA 2WLYA 3CUHA 5CQ1A 3VGFA 1ZL1A 2J77A 3WQ4A 3SUWA 4OZOA 3GM8A 4PMRA 3WEMA 3RMEA 1HX0A 5AYBA 3ZM8A 4M82A 1KBKA 3VD5A 3L4XA 2OWWA 1H49A 5E70A 1DWAM 3WNKA 5GQBA 1XYFA 2QMJA 2YL8A 2XWEA 1UQZA 4EKJA 1V3IA 1MW1A 1JDAA 3ARWA 3CH9A 2AOSA 4MADA 1QI2A 3LPFA 4U2ZA 1B31A 3OZPA 1XRVA 3PN8A 1VF8A 1SR0A 3L4WA 1MQRA 1QNQA 2D2OA 2QLYA 3GZAA 1F4AA 1HT6A 2VO5A 3GNRA 3WH9A 3AMDA 4BQ4A 1B90A 1F4HA 2OWCA 3AIWA 4JCLA 2CBIA 2XSAA 2DH2A 4LXFA 3SCSA 2DSVA 4QP0A 4XZBA 1E6QM 2W62A 3AMGA 1D7FA 3SUSA 3AXXA 1HL8A 1V0KA 2OWXA 5A6AA 4TVCA 1EIBA 3B9AA 1UWUA 2VTFA 2W63A 2VR4A 4E4PA 1QI0A 3RILA 1CPUA 4AZ6A 3K8MA 4TTUA 1PJ9A 2WYSA 1EDGA 1JXJA 1E6RA 1GCYA 4EK7A 2PWHA 2VVSA 1UKTA 2DEPA 3L4YA 1FH7A 1TG7A 1HKKA 3IAPA 3AHYA 2WLZA 1VENA 4M80A 4NRRA 4HMEA 1TVPA 3VMPA 1WDPA 3KL5A 1CIUA 3IJ8A 3VIIA 1OBAA 4U3AA 3FW6A 3WUGA 2DH3A 1VFFA 2G8ZA 4D71A 4S3KA 2D3NA 4H2CA 2FGLA 4DWSC 3TONA 3W6MA 5IHRA 4PTVA 3BSHA 1W1TA 3VILA 4W86A 3BMWA 5FD0A 5CPTA 2WWDA 2FH6A 2CBVA 4FMVA 3SCPA 3RO8A 3CBWA 5DO8A 4GZIA 4X0VA 3N18A 3PTKA 3DECA 1PEZA 3EDFA 1H1NA 5C8BB 4D6DA 2WCGA 1C93A 5D8WA 2J8FA 1UKOA 3PZNA 1UR0A 2J79A 4W85A 1OD8A 4UQAA 3HMCA 2V3DA 1H2JA 2CXGA 1JZ8A 4CN1A 1US2A 3AXHA 2D22A 1JAKA 3CHDA 4UFLA 2GJRA 2DT1A 3D5HA 2X09A 2X1IA 3LPGA 1QBBA 2F61A 1UA7A 3GH7A 3OGRA 4LGXA 1H41A 3AS2A 2CPUA 3T2QA 2JIWA 4J7RA 5EFDA 1VJZA 5DF0A 4CVUA 3A4AA 4TXEA 4WLCA 2D0GA 1V6UA 2BNJA 3WNNA 2HISA 1DP0A 4XB3A 3OLDA 1FA2A 4NZCA 2PWGA 1J18A 7CGTA 2DQXA 1JF6A 3WY1A 1R86A 4JFSA 1XH0A 3SUTA 3VTRA 4UQ9A 1FP8A 1GZJA 5FKYA 4BQ2A 1E5JA 1CXIA 4CCDA 1V3KA 1JYVA 1XYZA 5DEZA 1TZ7A 3QGVA 5HOSA 3T08A 3RJYA 3FN9A 3PZGA 3WNMA 1BYCA 2BVDA 4R5EA 1X6LA 3PBGA 5A6BD 1GONA 3WQ8A 4KWUA 1JZ4A 1HKMA 1QNSA 2JF6A 1C7SA 4MNLA 1UD6A 1DHKA 1XCWA 1G94A 3K4DA 4QFUA 1MFVA 2J75A 4HA1A 2BY1A 1QPKA 5AY7A 3L4ZA 1NQ6A 4PN2A 4ZFMA 1DWGM 3NSXA 1NOWA 2DIEA 5A2AA 3ZOAA 2GK1B 3K8KA 2PF0A 5BXRA 2OSYA 3IK2A 2F8QA 1IZKA 1BPLB 1UD2A 4LPCA 5GNZA 2WC7A 1TFVA 4RE4A 3CUFA 4D1IA 3TP4A 1W9BM 3WN6A 1ODZA 1Q6DA 1C8YA 1MVYA 3EMZA 1C8XA 2YA2A 1VFMA 1IT0A 3ARPA 1QHOA 2ZUWA 1KXHA 3EBVA 2QPUA 1B3YA 3T09A 1EQCA 1QI4A 2BVYA 3WEZA 3L4UA 1BGAA 4TVUA 5JIWA 5M03A 1PZ3A 3G6LA 3AYSA 3UEQA 1Q6FA 2V5CA 1HP5A 1JYNA 3T2OA 5GNYA 1GW1A 1WE5A 3VIKA 2JE8A 4ACZB 4BQ3A 1QVBA 1C90A 4AZHA 4OOUA 4OOZA 4D72A 3A4XA 5CXPA 2RGMA 1JZ7A 3U5UA 2BFGA 1Q4NX 3CUJA 2JEQA 1NH6A 1QI5A 5ABEA 4PSRA 3WDPP 4V28A 5I23A 3VD3A 1TVNA 4UQDA 3ZSTA 1BF2A 2J7CA 3GTNA 1MW3A 4IPNB 4AIOA 4J3VA 1NOFA 3IAQA 1V3LA 4HMCA 3SCNA 2W5FA 4PSPA 4H41A 4QCEA 2CHNA 3WUEA 3OA5A 3M7SA 5A6BA 2YA0A 2ZWZA 6CGTA 1JDCA 1S46A 3WUBA 3AQUA 1G01A 4J3SA 3AOFA 4ATDA 2WVTA 2WSKA 5BROA 3WF4A 4HMDA 5FIPA 1QHZA 4M8UA 1LG1A 6A3HA 3WL1A 3WELA 4PCTA 4PMQA 3WQ5A 2FHBA 3DYOA 4W84A 3U7BA 4DUVA 4Z2LA 4JHOA 1UKSA 3O2LA 2E9MA 4IISA 1C8QA 4IM4A 1U33A 1E1EA 4LQ1A 3RPMA 1ZJBA 3EDJA 3RM8A 4U2YA 1JGIA 5JIPA 3PZMA 2V3EA 2WAGA 3AJ7A 3WEOA 2OYKA 2PWDA 1B3ZA 1IV8A 1ISVA 3OGSA 3UG4A 3MMDA 4D6HA 3VDBA 5E0FA 3GDBA 3ZJKA 1J0YA 2J7FA 2J62A 2EO7A 1E4MM 1I75A 3WQ6A 4AEFA 2YLLA 3AZSA 3VIPA 2A3AA 4UFHA 1M01A 1H11A 1UR9A 3CGTA 1J0KA 2WKGA 5BWFA 2UWFA 3FHQA 1B0IA 2WMIB 2PWEA 4HTYA 1O7AA 4UOJA 2XVNA 1B1YA 1WZLA 1KFWA 2WM0A 2NSXA 2GJXA 2C7FA 4CVWA 1AQ0A 5CGMA 1OD0A 5F7UA 4UQCA 4UNIA 3ALGA 2EJ1A 4AD1A 1EHNA 4W88A 3FNDA 1FOBA 5CLTA 4NF7A 2YIHA 3EMCA 1U2YA 3VINA 3CZ8A 1K9DA 3ARRA 3VIGA 4WF7A 3GXIA 1FP9A 1NARA 1NWSA 1LL4A 4GZEA 5E9AA 4GZJA 2YKKA 2YA1A 5FL0A 1XH2A 1TUXA 1HJWA 1L8NA 5CGTA 4W7WA 1MW2A 1E15A 4PUEA 3II1A 3AISA 4FLQA 2YJQA 2UY3A 4ZXOA 5A2CA 4H8HA 5LA2A 1E72M 1J0HA 3WD4A 4JFVA 2DT0A 1B30A 1I1XA 2NT1A 2VJXA 3WNOA 1ZBKA 1X6NA 2O9RA 1E0WA 2VCAA 1UWIA 3DHPA 4A4AA 3WQWA 1XH1A 3OLGA 1CLVA 3WH8A 4AMCA 3WFZA 4UFMA 2J25A 3CTTA 2J74A 2WVSA 3VU2A 4DUWA 2HVMA 2VVNA 3S6TA 3SCQA 3ZMRA 2BS9A 1PIFA 4P7RA 4U5KA 3AS3A 3PZTA 1V0NA 2BV9A 2O9OA 4PYSA 4UR9A 1OIMA 1PX8A 1PZ2A 3WBEA 4KH2A 3NUKA 1GHRA 4MAZA 3AZTA 2CITA 3BAYA 1UR2A 1UKPA 5HNNA 1CGXA 4L4OA 5A2BA 2E8YA 4K68A 3KE0A 3CUGA 3SURA 1PAMA 2BXYA 1B3VA 2ZX8A 1HJXA 4KGLA 4HA3A 5JUVA 2WMIA 2FDMA 4D6JA 1C91A 1KBBA 1SMDA 3GBDA 2FHCA 1JZ5A 1HVXA 4W5UA 2V38A 1HVQA 1QOXA 4C7DA 5I0DA 3WMSA 3MANA 1UR8A 4PTXA 1ZBCA 3WNPA 3AIVA 1C3FA 2XUCA 3NSMA 3AI0A 2IUZA 3MV01 3SUUA 4D6FA 4E2OA 3DHUA 4J28A 4ZEPA 3ZJ8A 1OGGA 3OB8A 4AZBA 1PBGA 3WF3A 2QV4A 3T0BA 1WZMA 3W29A 3BLPX 4Z2JA 5IXEA 1UYQA 5D9OA 1JDDA 5A6KA 1U30A 3UR8A 3BH4A 2VZVA 1B9ZA 2ZX9A 2DDXA 1EH9A 2G3MA 4URIA 2WXDM 1W9DM 2WMKA 3NYDA 2GUYA 3F4VA 3CUIA 5A94A 3AZRA 4UOQA 1E3XA 5I2UA 4HU0A 3KEHA 4ACZA 4LYRA 1BGGA 1J9YA 2ESCA 3VGDA 1MW0A 5I77A 3WIJA 3IANA 3I3DA 3MO4A 4P8VA 2NW0A 4Z2HA 1BYAA 1QNOA 5CSYA 5I5RA 4J3TA 2ZXAA 3GBEA 1JF5A 3BC9A 4MTVA 2JEPA 2ZUNA 1JL8A 3TTQA 1E56A 1WKYA 2EPOA 3ARXA 5CPSA 3MUY1 3SCTA 1BFNA 4XUYA 4AZCA 1QNPA 2CCRA 3AMLA 2WBKA 1V3MA 1RH9A 5GNXA 2WCAA 1WDRA 1XD0A 1BAGA 4J3WA 3GH4A 5CLWA 4WKAA 1GQJA 3MUAA 3CHCA 1CYGA 2ZWYA 2GSJA 1WZAA 1E0XA 1MXGA 3KZSA 3L2MA 2WC3A 4FF5A 5ABGA
chains in the Genus database with same CATH superfamily
1EZ2A 1QW7A 4KWSA 3S46A 4LAZA 3ENLA 1EJSC 1LOQA 2JK2A 3WQCA 1XC4A 4O1CA 4KCVA 4ATWA 2EG6A 4H19A 2VX7A 4CUCA 4HOWA 1KXTA 4KRUA 1OFPA 2XVKA 4G56A 4WK9A 1RR2A 1X38A 4Q8NA 1LROA 5I6SA 3QV6A 4AYSA 3SQSA 4HK5A 4H6EA 3AYRA 3N11A 3UQAA 2PLKA 2H8ZA 4Q8TA 3CWOX 4A6GA 1H50A 1THFD 1EQPA 1JYWA 1W5MA 2G3FA 1EC7A 3C8NA 4HD5A 2INZA 1V7YA 2TAAA 3U5YA 3LCHA 4WOZA 1ML1A 1UPPA 4JQ3A 2X1TA 1OK4A 3RU8X 1CTNA 2NUYA 4AISA 4G8TA 2OZ0A 5JBDA 3FXGA 3AU6A 4CCEA 3JZUA 1J0IA 1JCJA 5E6ZA 7TIMA 2PBOA 3H2CA 2RUDA 3OEXA 2R1MA 3O5QA 1A5MC 1A5OC 1UOKA 2P10A 1XBXA 1FHDA 3A9IA 1HG3A 4AD3A 1VH7A 1G6CA 4CD4A 3CS2A 1XIBA 3K1GA 1XIGA 3ONCA 1R3TA 3GNXA 1DIKA 1K9FA 4HBEA 1EGMA 1EJRC 2WPBA 5D03A 2QZRA 4CQBA 3TYEA 3ARVA 2CKSA 1WXJA 2WCSA 2ZX6A 3CL6A 2NXIA 3SBFA 3OZMA 4IIDA 1XRTA 3N2XA 1BKFA 1GYMA 1TRDA 2Z6JA 3BWWA 1JRBA 1Q6EA 3UG3A 1SJBA 4DJDC 1TMHA 2EPKX 2VQUA 3BOFA 4TV6A 3LN3A 3CUZA 4CCCA 1WKEA 1PS9A 1F8AB 3HPFA 3SO7A 1Z3NA 1KXVA 3U4AA 2GUUA 2OXNA 2R1KA 1WDQA 2PV2A 1Y5XA 1RP9A 2VNCA 7REQB 1NFGA 2A7RA 3FAWA 3J7HA 1OABA 2YL6A 1VP5A 4PUUA 5LIWX 3A5VA 4ATLA 4QISA 4FS9A 4RW3A 3VNZA 1P0NA 4U4MA 4C6DA 1W1IE 1NP0A 2XFYA 3OJGA 3VZXA 2RUCA 2ICSA 1UJQA 3PZQA 3LK6A 3PZUA 3N15A 4LVGA 4GNVA 1ZP3A 2NLYA 4PMOA 1IGSA 3PJXA 3THDA 3U9IA 4W87A 1XHGA 4JQAA 1FHLA 2OLAA 4QT3A 1KGWA 1VEMA 3CIVA 4WXYA 3DUGA 3QC3A 4XSMA 5I00A 3CQJA 2YOCA 1F3EA 3HU7A 1FTXA 4DJFC 2CLFA 1LDCA 4GGBA 4DYJA 1SW3A 3KZPA 5DMLA 5K2ZA 1R3YA 8A3HA 2ZUMA 5AHLA 1V0LA 5HJXA 2XGBA 1EF2A 3KWXA 3VX1A 4M5PA 3F5KA 2NQZA 1VPQA 3F2CA 4IFOA 3MV11 1L6GA 2VFEA 2W61A 4I7UA 1W3LA 3OLIA 3INPA 4ONVA 4MDOA 5DMNA 3HQPA 1NFBA 4FIRA 4FF7A 2C14A 1ADDA 3GXFA 3WD2A 3WD1A 2Z28A 1R85A 1RUSA 4GWEA 3UZ5A 3W0KA 4G6CA 1GJWA 4IXHA 1Z69A 4XISA 2MUCA 3UGVA 1MXDA 3BMVA 3F7JA 3QPYA 1Q4WA 2ZUVA 3UJEA 3WLQA 4JHZA 3OIHA 1KXQA 4RNJA 4NZFA 1CCWB 1VFOA 4UWMA 4ODKA 4ZOAA 4QG8A 1WDDA 2R24A 2WHJA 1UWQA 3AMKA 1KD0A 1RVGA 4N02A 3SJNA 1HQTA 2JQXA 3IWPA 1TPVA 6REQA 5IFPA 3R79A 3W25A 1XP3A 5BWAA 3UR7A 5HXMA 4UTTA 1MRAA 3FGCA 5AZ1A 2QUNA 3W73A 2OSWA 3KOFA 3UESA 3LCFA 2AL2A 4PMJA 3PG8A 1RD5A 2E40A 1JJKA 1F5ZA 2NXGA 1SFLA 4JGDA 3EDEA 3K2GA 3EWXA 1HL9A 1CGWA 1JNTA 4FI4A 2VRQA 1B3WA 2KX9A 4AZIA 5A6JA 4W8LA 4YHEA 3H4XA 4RE2A 1YKWA 5H2ZA 1EO5A 4F9DA 5I3FA 3KAFA 2QVNA 4IX2A 1SMAA 1ZCNA 2EXOA 3S5SA 4JNZA 1JXKA 1YPFA 3WQGA 1A5SA 3TEVA 5JH8A 1P5BA 3ZJ6A 1OFOA 3AHVA 4F0HA 4X63A 3W53A 1PYFA 3W6LA 1E55A 1JR1A 3I3EA 3IV8A 4C6BA 3XINA 4UQBA 5M2FX 5B8IC 3L5MA 3L67A 1PL9A 4B15A 1C8VA 4AY1A 3E0FA 1V4YA 4IJRA 4O2TA 2BY0A 3EOOA 3QQWA 2W67A 1ZB5A 5CSUA 4HVXA 1A0DA 1N82A 1GT8A 1B54A 1AD1A 3UR2A 2J13A 7TAAA 1FD9A 4X0NA 1W5NA 4M24A 1T0OA 2NQJA 1ISXA 1GVIA 3SSZA 4L56A 1H1ZA 4A8NA 2I5QA 1GVSA 2ZUTA 1NU5A 1K8ZA 1SFTA 4C1KA 5LGZA 3BXWA 2MPHA 1S2CA 3BGAA 3NZPA 3E02A 3W28A 4H8VA 5D2WA 4X9YA 1GKPA 1HUVA 3STGA 3TQPA 3B8TA 2XH4A 4LC8A 2XFWA 4L4MA 2PTDA 3S9YA 4BFAA 5HJYA 1AQHA 4GYFA 3TC6A 3R8RA 1VFHA 3PNUA 3T55A 1RCXB 4DWSB 1NWUA 4TX8A 3M0XA 3H70A 3ZFHA 2HBXA 1G69A 4Q8PA 4A3UA 2BOGX 7A3HA 5CG0A 3PBYA 7PTDA 5D05A 1PCKA 3THUA 1I0BA 2AQOA 1XYCA 3BLOA 2IPGA 2CXEA 2BY3A 4AIUA 2EGZA 3SGZA 2FZMA 3G5EA 4DNMA 2PBGA 5H91A 1US3A 2M08A 3M0KA 3W74A 5DX7A 1V02A 3JW7A 4FHAA 4O14A 4ODNA 5D8ZA 3ES7A 4PUDA 4XBKA 4KGJA 1GOQA 1K8CA 4AMAA 1IZCA 3DFQA 2Q8ZA 2EBNA 4HCLA 3AIEA 2FZBA 1WV2A 5FJIA 5G2IA 4CEXC 5JBEA 2PTXA 1CXLA 2WWCA 5IDIA 2F2DA 1P0DA 3SR7A 4ML9A 8XIAA 1WBHA 3WLKX 3UF8A 4IX0A 4CU7A 5CZKA 4PEKA 2IW0A 4Z2IA 4ZE5A 4HU4A 3G24A 4LEFA 3PNZA 3QMSA 4WVXA 4M56A 3HPAA 2PP3A 3BJSA 4JTIA 1F2JA 3O5KA 4Z1BA 2QIIA 4TX6A 3QTPA 1OT1A 3T1GA 1DHPA 3WFAA 2RAGA 3B0VC 2E7FA 4BI5A 1TZ9A 4ZSUA 2DT2A 4DAIA 4IFKA 2Y8VA 1C9WA 1R7AA 4PTDA 1BYBA 1S2VA 3Q58A 4ZENA 2NVDA 1PTGA 2WVVB 2J8TA 4IP4A 1V08A 2OEKA 1GVRA 3VUPA 3EWDA 4K36A 1LORA 1FWNA 2PD5A 4IGMA 1EOKA 2Z27A 4WY0B 4R0XA 3DDMA 4RPQA 3KZ7A 1L1PA 3CZGA 2V82A 3IVTA 3JS3A 2XSXA 1FWJC 4MJ4A 4MMWA 3EA2A 5CJNA 3NL6A 1TV4A 4JX6A 3UZYA 5TNVA 3PZOA 3O5RA 3SDOA 3WNLA 1TZZA 3WBWA 3CM4A 3H4WA 5C71A 1MFUA 3QQ0A 2CZ5A 3TYDA 4DELA 2OVLA 1VB9A 2P4VA 2Z4GA 4Q22A 1ZJAA 3IGHX 3NPWA 4RK8A 2RQSA 4JFTA 1GEHA 1BQCA 4GXPA 4WDUA 3UI6A 1XLLA 3EX1A 1JVNA 3ARSA 4GFIA 4UDMA 1D7KA 1QI3A 2Q71A 4AZ7A 4DB7A 3S9ZA 1MEHA 4IHCA 5BRQA 3LUOA 3VDHA 1Q6RA 3TTOA 4IMCA 1QDSA 1SGJA 2VOTA 1WCGA 3KXQA 4LALA 3SIMA 4WXZA 2HSAA 3E9AA 2C1HA 3Q45A 4P8XA 5DCEA 3MMUA 1F8MA 2YDRA 2WNNA 1M65A 1XG4A 3RHGA 3SRDA 2ACQA 3S5OA 4HNUA 4FLOA 1ZS2A 3G3MA 3LHTA 4S3EA 5LXXA 2OZ3A 4CQDA 2NX9A 1YHTA 4M1RA 2BXZA 4KWOA 3QR1A 1GPFA 2ETNA 1E4LA 4WJEA 1TREA 3T07A 2D0HA 3O5IA 3O05A 4UTFA 6XIAA 4C6JA 1X6UA 1TV5A 1G5AA 4P2VA 5REQA 3H7RA 1BTMA 1XDLA 3RN6A 1G4TA 3HA1A 5U7SA 5K9XA 2IKHA 2Y5SA 2I16A 3VPLA 4XZMX 1BEUA 1KBJA 3GS6A 4X22A 4XV0A 1KRMA 4DBEA 4MGVA 2QF7A 3DYPA 3PBUA 1ZP4A 1XIMA 1VCFA 4I6KA 4YJ5A 1Y5VA 2CKRA 4LAYA 1ICQA 2Z1WA 2ACRA 1CXKA 3TN3A 4DJDA 4LB3A 2CZEA 3PFMA 3ITTA 4L4PA 4LYPA 1EQ3A 3RM9A 4XSLA 2YXOA 1VPYA 3VDCA 2DY3A 3B8SA 2OX4A 1DWJM 4PUNA 3L21A 2WPGA 2YL5A 4JPGA 3AS0A 2PU1A 3UCDA 4YHGA 4DZ3A 2Q3OA 2TRSA 1ODUA 4S3CA 2ACSA 2WMGA 1GOMA 4Q8OA 1XSJA 3ABOA 1AW2A 1TWWA 1Z41A 4FX7A 2I9EA 4HPGA 2WANA 5HJLA 3VNKA 2YBUA 2XGZA 5HUAA 3USZA 2VZSA 2XH7A 4EAYA 4OV9A 3UQIA 3R43A 2C1IA 4RPPA 3WMCA 3GB6A 3KM8A 1AODA 3LXCA 4NKCA 2E9LA 4MB4A 1H4PA 4AIBA 4GX8A 1IYXA 2PDIA 5KINA 3NSNA 3U2OA 3SRHA 2Y5JA 1EC9A 1ZY9A 3AFBA 1HW6A 5K7JA 4FP1A 3MY9A 1L2QA 2VEFA 1M7PA 1A0CA 4L65A 1DWFM 1W2VA 3LTYA 1LL7A 4IUGA 3CV6A 4V1YA 3A12A 2DVTA 5A8PA 4DJDD 2B31A 2HS8A 4GKLA 1NF7A 1NP2A 3UXLA 2C13A 4AC7C 1UR3M 4XKYB 4UNLA 1X8FA 1FCUA 4D1JA 4ZO9A 1DJNA 3MCOA 3VGGA 3QMTA 3AYVA 1VD6A 2RDXA 3NTPA 1FDZA 1XUZA 2X2YA 3VE9A 3NL3A 1LBFA 2WKLA 3G1HA 4B5VA 4IIFA 2PI6A 1JNEA 2V68A 1P4CA 3WLSA 3KLKA 4O1BA 4BEQA 1U1HA 1XI3A 2C8NA 3L4VA 1WNOA 4JN8A 3EX3A 2J7HA 5FCZA 2PDCA 1UHVA 4MFDA 3PZVA 1XGZA 1PTDA 2JF7A 3FSUA 1HJVA 4Z17A 4PEEA 3CUXA 5BMWA 2PDGA 2XU2A 3NQEA 5FF0A 4IT4A 1IGWA 1PIIA 4FOUA 1Q6CA 4BWLC 1M5WA 4HPNA 4IQEA 6REQB 4UOZA 2PGEA 1XLGA 4FNTA 4N0RA 1DJQA 1UA3A 1F40A 3EEGA 4QAWA 3WDQA 4E4FA 4PL1A 3U2EA 3TJXA 3HN3A 1KTBA 1GOKA 3OG2A 4DJFD 4MVAA 1QPOA 2HWGA 1PWMA 4OQVA 4IPPA 1Q6QA 4LH8A 1V79A 4YTUA 3TNOA 1JVWA 3BW4A 4O0KA 2WSPA 4I5XA 2HPIA 3AU2A 3W82A 3HIJA 3RO6A 3N4AA 1TE1A 1TJRA 4ODMA 1XLEA 1T41A 5FJOA 2CEQA 3UXKA 3UWZA 1M03A 1R3VA 1DORA 1Q7QA 2CBJA 2VR5A 1E9LA 2DSKA 4DEFA 2RUQA 4RZ6A 2PC4A 4N42A 3F4DA 2E6FA 1V77A 3E12A 2I5GA 2XPBA 3EMQA 4JY8A 2Y78A 2A2IA 1UH3A 4DZHA 2V63A 2WHLA 4M7TA 1E6XM 1H61A 1OFRA 1NQKA 1TMLA 2VDHA 4OUEA 1L6YA 3MVTA 2HROA 3A4JA 2FIQA 3EPMA 1JZ2A 3GG8A 3EX4A 1EDTA 2PU0A 4ZR8A 4ITZA 3THCA 1CXEA 1IF2A 2PPNA 3SY5A 3RX3A 3NCOA 2XYLA 4JIHA 4WDTA 1NF0A 2OYLA 1BXBA 2OYMA 1ZL1A 5G4EA 3SUWA 4HN8A 2DV0A 4PMRA 3WEMA 3DI1A 1RV8A 1KBKA 3VD5A 4O12A 2OWWA 3H2NA 5E70A 4NG3A 4O4VA 2CWNA 4Z0SA 4QG6A 3WNKA 4U86A 1UQZA 2HQAA 1G7VA 1V3IA 1WYIA 4NAFA 1NELA 1MW1A 2W3ZA 3ARWA 1D9EA 1QI2A 4U2ZA 1W17A 4TR9A 1MNSA 3W7JA 1XRVA 3PN8A 4ZB2A 4JTRA 3A13A 1SR0A 4UTMA 1RXOB 2E25A 2PP1A 2QLYA 1TJ1A 3GZAA 1F4AA 4LEQA 3WH9A 3DFNA 4E0CA 1F4HA 4GYJA 3MW7A 2DH2A 3DGRA 3SCSA 3IKGA 4NZ3A 3BGJA 3UF9A 4XZBA 6ALDA 3SUSA 3ID7A 2PGFA 1V0KA 4LVDA 2OWXA 5A6AA 1AJ0A 1EIBA 1AK5A 3PS7A 3OOQA 4EPDC 2W63A 4G5DA 1IT8A 3MP3A 4JTGA 1PXGA 4DLMA 1QFEA 4O1EA 1EX1A 3GIYA 4TNSA 3L4YA 3HTWA 1HKKA 3IAPA 1V5XA 1A80A 3R2GA 2GLKA 3M43A 4PFMA 3UYIA 3VMPA 3WZ0E 2VFIA 2ZVRA 3TH6A 1CIUA 3EXRA 3W2UA 3RR4A 1TQXA 2DH3A 1VFFA 3DFSA 4S3BA 4D71A 4DWSC 3TONA 1VIZA 4UMCA 2CZFA 3RCMA 5IHRA 4WOQA 5I3JA 4Q32A 4W86A 4AVOA 5F2MA 5C6MA 3FJNA 4LU0A 1OG0A 4Y9PA 1VZWA 4I8YA 2WJZA 4EWJA 2RDUA 4K8GA 3N18A 4PE8A 3B8WA 4F0RA 1X96A 3DECA 2YYTA 1X97A 1H1NA 3W71A 3VOGA 4XZLX 3LD5A 3CV2A 1C93A 5D8WA 4ZGYA 4RXFA 1GKQA 3NQFA 4GJ1A 3HFTA 4UQAA 3W7EA 5DITA 1XFCA 1JAKA 5FF4A 3CHDA 4UFLA 2DZBA 3MI2A 4FA3A 4Q4OA 1UA7A 5L9FA 3TW7A 2V81A 4F0MA 3TWAA 3STCA 3AS2A 2J27A 3NQBA 1XIDA 2EG7A 4J7RA 1HXVA 2PWUA 2P3ZA 3W1NA 4HHHA 5HNTA 4X61A 3PTDA 1V6UA 2CW6A 2FLIA 1WXZA 4NZCA 3M47A 4Q6XA 4PRTA 2X16A 3IHZA 4QEEA 1FWSA 1IT7A 1R86A 5CAHA 2YCLA 1R2SA 1ZFJA 3I7RA 4H4IA 1EUAA 4GI4A 3P67A 4AX7A 3URAA 3NRKA 2PBCA 1SW0A 3TW6A 3QGVA 5HUPA 1IXQA 3CK5A 3T08A 4ICNA 4R5EA 3LHVA 2NWSA 3PBGA 4W9PA 2OU4A 3VC6A 1A3XA 2FFIA 5DO2A 1C7SA 1DIEA 4AY7A 2CWXA 2ZC1A 1DHKA 1IEXA 1XCWA 2FPYA 3UNDA 3I65A 4QNWA 1H7OA 1B4KA 3W2KA 4QIUA 3BURA 3F4NA 2BY1A 3HQ1A 4G9PA 5J6EA 4PN2A 1DWGM 3T81A 3NSXA 2DIEA 2XINA 3IK2A 2H9AB 3PWIA 3EXTA 1UD2A 5GNZA 3VA8A 4DJEC 4RE4A 4MUZA 3WN6A 1Q6DA 4Q7BA 5CPOA 1JQXA 3GU9A 3WBXA 3ARPA 1KXHA 1Q6LA 2B7QA 4IIEA 1QI4A 3LM7A 3W76A 2PPOA 1BGAA 4GQ0A 4TVUA 5T9CE 4U85A 1LWIA 4FNUA 3AUJA 4XTDA 2QUVA 1OX5A 1BWLA 2C71A 4R9XA 3VCNA 4G7EA 2ZC8A 3CQIA 2YCEA 4BF8A 5FEXA 3CT7A 1C90A 2KE0A 3AJXA 2NQ5A 1SU5A 2PZNA 3FYOA 3NWRA 3CUJA 2JEQA 3MO7A 1QI5A 3LB0A 4IUOA 4V28A 5AHEA 4C6FA 1TVNA 4IIGA 1K7FA 3GTNA 1MW3A 1NOFA 1ZAHA 1V3LA 2FYMA 1CB7B 2W5FA 3MSYA 3B9NA 5G5IA 4IMGA 1GOXA 4GACA 3GTIA 5LIXX 3WUEA 2DU2A 2Y7FA 2ISVA 3PBMA 3WUBA 1G01A 1S5NA 1OC7A 4ATDA 5G4HC 3EB2A 4TMCA 3F2DA 4HMDA 1QHZA 3EPOA 3MWCA 1ZNNA 2WZMA 3PF3A 4M8UA 2X7WA 1QXLA 4E3VA 1P0KA 3WL1A 3WELA 3WQFA 4PCTA 5LHFA 1KNWA 3S1UA 3LG3A 2FPVA 4UMAA 2DZUA 3NQAA 2E9MA 3CEPA 4RV8A 1OYBA 4IM4A 2YFNA 3BW2A 3P81A 4E3TA 4U2YA 5DIUA 4YTSA 1TIWA 3AJ7A 3W86A 2PWDA 3C6CA 3W1XA 1B3ZA 1IV8A 1W5OA 3UG4A 4ZQRA 3KCOA 2YCKX 2QVHA 3DGBA 1VS1A 1F9CA 1N55A 2V69A 3MMDA 4O50A 1FKXA 4UBPC 3HPZA 2KGJA 3SJ3A 3HG4A 2XIJA 4NJGA 5BOEA 5K4XA 2J62A 2A7NA 2A3AA 4QE5A 3KABA 1H11A 1KCZA 1UR9A 3IJ6A 1U79A 2WKGA 4D8LA 1J4IA 3M5VA 3BE7A 1WKDA 4UOJA 5FF2A 1ZQ5A 2HMCA 4Q4RA 1WZLA 2DZXA 5AYYA 3FYYA 2GJXA 1WAUA 3FYPA 1K1DA 5F7UA 1JPHA 4ZBCA 3VYLA 1JCMP 3S8HA 1EBGA 4GIEA 5CSSA 4AD1A 2VWSA 4JYSA 4JTHA 4J9JA 1R9ZA 3CL8A 3VIGA 1NWSA 1DJYA 4WEVX 2YKKA 2YA1A 3DEQA 3QTGA 3GDTA 5CGTA 2E09A 3II1A 3AISA 1V8EA 3HQOA 2UY3A 4ZXOA 4H6RA 1J0HA 3M0MA 2WSYA 4LUJA 5F2LA 2RKXA 5CGQA 3IJIA 2J9YA 3WCZA 3DHPA 1ZPTA 1XH1A 4B3ZA 4DROA 3WH8A 3RLHA 2J74A 2HVMA 1KT0A 4PBFA 3ZMRA 3PZTA 3RCYA 2CLKA 1W5PA 4EPBC 1OIMA 4PZVA 1PZ2A 3WBEA 4W9OA 3RU6A 1NFPA 1AZ1A 5KITA 5A2BA 4H3DA 4K68A 3NXLA 1WKFA 4S38A 4LBRA 1HJXA 1I2QA 3PC0A 3VC5A 3D47A 3CH0A 3C4UA 1KBBA 1JNSA 1XUUA 1OFEA 2V38A 3NQVA 5HQEA 3TYAA 5MF5A 4M19A 3MANA 2GJLA 4N19A 3VOHA 1ZBCA 3KOWA 5F1UA 3ZYZA 3SUUA 1JCYA 4WX2A 1MEWA 4QE4A 3ZJ8A 1BQGA 4ICCX 3VKBA 2NQHA 2QJIA 1OGGA 3OB8A 2A3LA 1RPXA 4Y9MA 1SSGA 2QV4A 1FVPA 3TIMA 1WZMA 3BZJA 4XD3A 5D9OA 1JDDA 2V2DA 5D2XA 3U8GA 5DY2A 2PAJA 4ICMA 2DDXA 2X7VA 2AWGA 3PP7A 4DYEA 2NWRA 4L9YA 1EA0A 3MCNA 5G2HA 1T6MA 4Q8WA 3I4EA 2QDEA 3VGDA 1E0UA 5I77A 4LVBA 3MO4A 2NW0A 4Z2HA 5I5RA 4DRSA 3G1FA 2XP5A 3PULA 4L1GA 3GBEA 4MTVA 2ZUNA 1JL8A 1E56A 1WKYA 2EPOA 4JFLA 1A4LA 3S6OA 2F38A 4MSPA 4AZCA 1EJ7L 4N9CA 1J4RA 1Q6HA 2CLPA 2PMQA 4J1OA 2ZVIA 4YVXA 1V3MA 3WK3A 1RH9A 5GNXA 4Z08A 1XD0A 1BAGA 2VHLA 4J3WA 1K02A 1OJXA 1GQJA 2ZQ0A 2ZWYA 3NR0A 4LAKA 2ZRWA 3PUOA 4DJED 1YRRA 5C7HA 3L2MA 2WC3A 4KWVA 4REQA 4HPXA 4HOZA 3RRXA 1J10A 1G1YA 4PH6A 2YB1A 2DJXA 1D3CA 1M1BA 4GQRA 1W9UA 1VYRA 1PZ0A 5D2TA 2QAFA 4JX5A 4S1FA 4NZJA 1TA3A 3P80A 4W9TA 3WH5A 2HTMA 1JFXA 2OR2A 1OWQA 3CHFA 2P1FA 4AW7A 3S42A 4IMEA 1UC5A 2PWFA 3WLRA 4OT7A 1R2TA 2XSBA 2GZXA 3KVLA 1UH2A 4U3CA 2IF4A 1X1NA 3B03A 3DOPA 2QPSA 2OZ8A 1TR1A 3ZSSA 3FAPA 3MP5A 5HDRA 3V0TA 3UFYA 4I7WA 1HO1A 4WQ6A 3TC7A 2BLEA 3LDVA 3LX9A 3IARA 1YDNA 2ZZ1A 2W91A 2DZSA 1KT1A 3TC5A 4NL1A 3FKRA 1IZJA 3LCLA 5ABHA 2WMFA 1GNXA 3W24A 4JQ2A 2PTWA 4Y6GA 3TKFA 4WIWA 2G4FA 4DWSD 1MYRA 1VIWA 3VI2A 3GNNA 3PRBA 1NWTA 3DKLA 3CZJA 1LRNA 3Q37A 4B5XA 5E09A 4MFEA 3ERPA 2CC0A 1B4EA 3GW3A 2BG5A 4JTLA 3M0HA 2AL2B 3T0AA 4GMEA 3KRUA 4KEVA 3UG5A 4DLFA 4R27A 1I2PA 4HBOA 5B7ZA 1SW7A 3CMGA 4W9QA 4F40A 2AMGA 3E3HA 4Q4MA 1GHSA 4FX6M 4JN6A 3PJUA 1UP0A 1QR7A 3VOCA 2XM2A 1RAKA 1ZAIA 3EXSA 4TO8A 4CQAA 2PDPA 1TTIA 5BU6A 3QXBA 4L6OA 5JBFA 4Q4PA 4UMBA 4CNTA 3WLLA 1NDVA 3ZR5A 3FK4A 1GVOA 4GISA 1QW8A 2J8GA 4S3FA 2QT3A 2JKAA 5HWMA 1W3IA 4ZTXA 3QHNA 3WX7A 2E8ZA 5A95A 2D24A 2P0IA 3LENA 2WJDA 3C0LA 1HZYA 1SJAA 2ZXQA 4HMNA 4MNMA 4KRZA 3W1TA 2VZTA 4QTGA 1PZ1A 5AC8A 2CIPA 4Z2GA 3K13A 3V4BA 2VX4A 4AZCB 2O92A 1WB0A 3DN5A 2G50A 3D3AA 4KETA 2J7BA 2C6QA 4RL3A 2ZRXA 1PUDA 4FNPA 4E8GA 1FHUA 3MT1A 4TTGA 3IEBA 5CJ5A 1KTNA 4QITA 5CZJA 2CESA 4DM2A 2NV1A 2VGFA 5KTLA 3SCUA 4JCMA 1GG0A 3R0KA 3CGNA 3FHAA 3ZWTA 3OBAA 4NP7A 3HGJA 3QEZA 4XZ9A 5BW6A 4AVFA 1E6PA 3BJFA 4HKPA 2C15A 5EBAA 4HYVA 5E0CA 2RGLA 2VRKA 1P0EA 3CAVA 5T91A 3B8DA 1OCQA 3F5LA 4YTRA 1JPMA 3HGOA 3FA3A 2XP3A 4B92A 4JD4A 5D9NA 1DQUA 5F2IA 1O1HA 1UQYA 5HWCA 4HNLA 4UXDA 3G1RA 2BHZA 3IJ9A 2BASA 4B9YA 2JALA 3VCRA 1G7UA 8XIMA 1Q1CA 4MUPA 1O68A 1VYSX 5IRPA 2X41A 4YU1A 4GX9A 4HZ8A 1D8CA 1KQYA 3PZIA 1XLBA 3EWUA 2D2HA 5A5WA 4P8UA 4GI6A 4DBSA 2WK2A 2IKGA 3M0YA 2OT1A 3BAJA 3ZVIA 5FI8A 4IMDA 3DIPA 3OO2A 3Q67A 1EUNA 5LA0A 4KCTA 4LUTB 1WA3A 1XINA 2A3BA 2EKCA 1ZCCA 5A1AA 2EEXA 4ASTA 3F1QA 2D0FA 5EFFA 1SO4A 2ZICA 4O17A 5E6YA 3LHZA 1LWHA 3LBMA 3ALFA 3EY6A 1EBHA 3P0WA 4XK2A 5KZ6A 1R3QA 2Z1SA 2WQPA 3UGRA 2PCEA 2I7GA 2GWNA 1KR1A 1NVMA 1C92A 1P1MA 1AQMA 3W7KA 2Z1BA 3W7OA 1IQ8A 2GGJA 1EEPA 1UROA 2PDXA 3KCEA 1KFLA 1GOWA 3DX5A 2FAPA 2VL4A 2HPMA 4PTMA 5AHMA 1ONRA 1E6ZA 1DQXA 1BRLB 1E5NA 2PC8A 2PEVA 4HNTA 3TA9A 2DT3A 2CZDA 2VGBA 3QFWA 1YPXA 4J4OA 3MJYA 2A7PA 2GQ8A 4QJ4B 1FWGC 4L5ZA 1M7XA 1XIIA 5LNWA 4ADTA 1Q65A 2G0WA 3B9EA 3ITGA 3S1XA 1GOOA 1OT2A 4IMFA 3CLWA 3LI0A 2RHGA 4M7SA 1ISYA 1EYMA 1UD5A 2O9PA 3K5XA 1XLHA 4JKLA 4D8ZA 1O60A 5CPLA 5KSWA 4M29A 5CC7A 1KV5A 2Z29A 1KWKA 2YB4A 2QCMA 3QHOA 4TUFA 4ZA0A 4EACA 1J01A 3P60A 3GLCA 3QKZA 4UQEA 3VAWA 1GJUA 3H9RB 4CNOA 3RITA 1E3ZA 4ZQCA 4ZO8A 5CG7A 3W38A 5C70A 5HR6A 2P5NA 2X0HA 4RZ4A 1LLOA 4AFYA 3VOIA 2VN1A 4JDYA 1JUKA 2ZCGA 3S1WA 3NEHA 4D6EA 3TJLA 3W87A 1OM0A 3L2LA 3ZT6A 1AMKA 3ABRA 1QW9A 2JGYA 1BG9A 4J2PA 2A4AA 3BSGA 1XQKA 1QPFA 3TMLA 3FJ4A 3BAWA 2P3EA 3W1QA 2KI3A 3KHJA 4HA4A 2WC4A 1Q85A 1TVLA 5FOOA 2DUAA 1SJCA 4FK9A 1TMQA 4L1WA 4XAZA 4A3HA 4KESA 3K46A 4YNGA 1CGTA 1MWOA 3IJ7A 3W1AA 1KFKA 1E44A 1AH3A 4IGHA 4GC4A 3VVGA 3OHIA 3VOFA 4NNRA 4GO9A 1J79A 5HTGA 2J6VA 3FX4A 3EYPA 5AC5A 2XN2A 3FCPA 3AXIA 3W7CA 4JKMA 3VIHA 2WZHA 4MYAA 4R7JA 3KADA 3OLEA 5DMMA 4K1WA 1F74A 2X0YA 5B80A 2QUMA 1ZJHA 3G6MA 1D7IA 1BG4A 2MNTA 1J6OA 3IK4A 3I6EA 4TQTA 2QCNA 3VK5A 5BMXA 1FWCC 2KFWA 2F23A 4GNJA 3MDYB 4PMZA 1ALDA 2PV3A 1S39A 4RDZA 2IQ0A 1SUXA 1FKJA 4KPLA 3P5ZA 2F4EA 2UZ9A 4AX6A 4CNNA 4F48A 4Y9OA 1IXNA 3FY1A 3MYPA 2DIKA 4B4FA 4XIMA 3WDRA 1OB0A 1A49A 3ARZA 1W32A 3HF3A 2QCFA 4Y2WA 1A47A 4B5TA 1V6WA 4AIEA 1VHNA 1L8PA 2XPAA 4HOXA 1XCXA 4UTWC 1U1UA 3UZZA 4L9ZA 4RE3A 2NUXA 2YBVA 1TV7A 3KOZA 5BYWA 2JZVA 2ZA2A 4QR6A 1HJQA 1MQPA 3WENA 1DKWA 2EPNA 4S2BA 1V3HA 1UWSA 3LTPA 3OBEA 2XN0A 3WO8A 4XAGA 3NVTA 1UJPA 4PRRA 1TJ0A 1FWHC 1Z32X 4MJ2A 3C3UA 4LSBA 4QSFA 3VGHA 2OLSA 3QHMA 1TB3A 4DWDA 4DZAA 2J4GA 4UIOA 5HNRA 1ONXA 3SCRA 4QIBA 3S2MA 1N2VA 4GXWA 2QJGA 3JVAA 4LUTA 4I7VA 2YL9A 4RUBA 3OZOA 3TAOA 3UD6A 4P8WA 3WFLA 2ODOA 4JXCA 4GI9A 3TV8A 1UWRA 3DKJA 1TTQA 3OBKA 3CZKA 4BI6A 2Y4SA 1S5WA 3R10A 4GY7A 4TMBA 3A21A 5A8GA 2EPLX 2XGIA 4RNFA 1RJRA 2FZNA 4GLEA 2E3ZA 5ABFA 1WO2A 1EGVA 3V18A 1J0JA 1OCJA 1H60A 4IL0A 1K9TA 1UKQA 1BWVA 4Q8VA 1ZU8A 1XWYA 1V03A 3O6CA 2XPKA 4FPSA 2XIBA 3A23A 1XCFA 2CLHA 1NOUA 3KBMA 5BXPA 4JAWA 1XR2A 1KV8A 3FA4A 3R0UA 3SGGA 4JIEA 1TTPA 2R82A 2RH9A 3ARQA 1GTEA 1Q6OA 3VKKA 4OVXA 4R53A 3V7PA 5CC6A 4JTJA 1D3HA 2G41A 1XIFA 4LRSA 4Q3MA 3U7VA 2M1IA 3CPUA 4PBEA 1DPMA 2P8CA 4HZ6A 2GGIA 3GXTA 4KR0B 2QHAA 3NDOA 1PDZA 4LS1A 3W3OA 1JZ3A 4UTIA 3NYZA 1F6YA 1CI1A 3B06A 5IM51 1SO5A 1C9DA 3TQKA 1NJJA 3O5JA 5HNUA 1FKLA 4U10A 1YXCA 4V15A 1UD4A 2G96A 4LWWA 1BL4A 1DWHM 4CD5A 3R58A 2VX6A 1W8GA 5C9ZA 3A6OA 4ZOBA 3RK8A 5LIUX 1HJSA 4HHMA 3GRIA 4MZ8A 3TSMA 2YPIA 3VD9A 3E5BA 1DTUA 4XZNX 3BPWA 2ZR6A 2TYSA 3P8IA 3RLVA 3DHDA 1JG9A 3GXNA 4JN7A 2DZTA 3PJTA 3BCDA 3NGFA 4BA0A 2NLIA 3LCXA 1M04A 5DXXA 2GJNA 4JNYA 3C0QA 4GA8A 3R0DA 5KEZA 3BOXA 1XLFA 2RFGA 1NMWA 2PDJA 2FGZA 4EPKA 5ABTA 3BMXA 3GR7A 1CDGA 4PMNA 1JI1A 4ROPA 1VPXA 3QY6A 1DL3A 3ISIX 4BF9A 1V3JA 2Z24A 3HFYA 3OP2A 2B0MA 4P7LA 2IXVA 1QPLA 2PZ0A 1RSCA 1QUMA 2AAAA 2VEKA 1V6VA 3LV6A 3EZ4A 2PLJA 3PK7A 2Y85A 4W8AA 3WF0A 3FJLA 4PL2A 1FKTA 4GH3A 1A5AA 3ZR4A 3W2NA 3R25A 1MRQA 1EEXA 5TIMA 5C54A 3H23A 1QNRA 4QS5A 1E1FA 3NXFA 3HV8A 1VBUA 4PCPA 1WAWA 3EKGA 1CGYA 3APGA 1QBAA 3BCFA 1VFSA 4RDVA 2WZEA 3NZQA 1E6SM 4DO7A 1JCHB 3URBA 2OOFA 2VC9A 3N1AA 3GC5A 4DXVA 4L7ZA 1LQ0A 4WGHA 2QDHA 1S2TA 1CBGA 5CPQA 4W8BA 4WJXA 4JR5A 2TPSA 2HE5A 1HIZA 3ZLFA 4NAEA 4J5NA 4I9MA 4QCFA 1Q6IA 2WSQA 4FNQA 4LAXA 2FTWA 1L2UA 4FLSA 4QE1A 3SECA 3R89A 3WDHA 2DORA 1NMVA 1TTJA 1KM4A 2QUUA 1SQ7A 1YMYA 3IVSA 3KS5A 1DEDA 5K9DA 5HW8A 3AIQA 3W7QA 4B3KA 4UTWA 4EAMA 4EF9A 4BF7A 2D73A 1TCOC 1H51A 1RP8A 1XXXA 2V0TA 3NOEA 3TN4A 1TPWA 4O8RA 4R7OA 1TWSA 2G95A 3JXVA 3ARUA 1IEIA 1EJXC 3WJYA 1S5MA 1VBHA 3P0XA 2ZA3A 4W7UA 1KFCA 5EY5A 4GY1A 4L6DA 1TELA 1CB2A 1XQLA 3MSDA 1DXEA 2HV5A 4AH7A 3V0UA 4QG9A 3P74A 2QJNA 5L6UA 3QZ6A 2WOQA 2ZQTA 3IIVA 1KFBA 3KBWA 2F6KA 1XX1A 4NI3A 1G4SA 4HB7A 4D6CA 4V27A 5LHEA 1FH9A 1W9PA 1M3UA 1LQ2A 4IP5A 4QLKA 4F79A 2Q01A 2R8WA 4ES4A 1T96A 4WSKA 3NIYA 4HA0A 4ORIA 3EPNA 1ZHAA 4Y96A 2JIEA 2YDAA 2OLHA 2B7PA 2YBTA 1PKLA 4ERGA 4MY1A 3BAIA 3ONBA 3EWYA 3GDLA 2Y8KA 1TPC1 4QLLA 2F2HA 3ES8A 5FSDC 2O4MA 3C2VA 2GGEA 3OTRA 3VD4A 3MMTA 3N9RA 1FQ0A 3CHEA 1H3GA 3P62A 4PRWA 1KM1A 4ODOA 3N4EA 2UY5A 1X98A 1R47A 2I9UA 1W0MA 1G67A 4O8AA 4H83A 3S3GA 3CQ0A 3THQA 3T0DA 3GZ3A 1FCBA 1K70A 2R1LA 1TWZA 4EE9A 3NVDA 3GO2A 3ZO9A 2E9BA 4DT4A 1S5TA 3VX0A 1CT5A 1M68A 3RRAA 3SCOA 4JFWA 3DFOA 3QH2A 3WLTA 1E51A 4XBJA 4DYKA 3BLFA 1K9EA 1OFDA 4H00A 2PV1A 4BCEA 5AOUA 4LAWA 4RCXA 3MZ2A 5T8GA 1WUEA 4MYXA 4O1DA 2VCDA 4ML4A 4M81A 2XM1A 5HAOA 5HT1A 2J77A 4QHRA 4DZ5A 4OZOA 2D9FA 4M82A 4AXKA 3EOUA 1B5TA 4EX4A 3SB0A 3PPGA 2LGOA 4XD6A 3ZLHA 2QMJA 4GRSA 5FEWA 4NY2A 4EKJA 4P5UA 2BTMA 3NPVA 1H7RA 2BX7A 1JDAA 3CH9A 4MADA 4DF1A 1FXQA 3OZPA 1I2RA 1EZWA 4KT2A 4ECLA 2PWVA 3GHRA 3LV5A 3TVAA 4LUSA 3GNRA 4BQ4A 1B90A 4KEMA 3OOBA 1XDJA 2OWCA 4NYYA 3W1RA 3HZ3A 2CBIA 3CYVA 2Q02A 2V5KA 4QP0A 5BNKA 5TQLA 3PB0A 1LBMA 3UR5A 3SIZA 2X1RA 3OVPA 2BWGA 2ITKA 2Z2UA 4TVCA 1TX0A 1BSLA 2FDSA 3IACA 2WSRA 4JICA 2Z0IA 2VR4A 4LV9A 1QI0A 3NQCA 4A3QA 4AZ6A 3VFLA 1SSDA 4XAKA 1GCYA 4C6IA 5EMLA 4R33A 2F21A 1UKTA 4A29A 4DRJA 1TG7A 3HMJG 1FDYA 2DZWA 2WLZA 2ISFA 4M80A 2OZTA 3LMZA 4HMEA 1WDPA 5GVJA 1Z9AA 3WUGA 4GUIA 4GZ7A 4FXSA 3PUEA 1U5JA 4IJBA 3MQTA 2YW3A 4H01A 3KLLA 3W6MA 2QCCA 1GG1A 5CPMA 3VILA 3P2VA 1K77A 1K8YA 1VBJA 4IL2A 2R91A 4ODRA 4LBSA 4AG0A 2CBVA 3RNDA 3N14A 5DO8A 4DNHA 1QOPA 1PEZA 1PBKA 1KKOA 3EDFA 5C8BB 4D6DA 1O1ZA 3C5QA 1DOSA 2JKEA 2YXGA 1UKOA 4Q6JA 2YYUA 2DZVA 1QJWA 3HMCA 4JQ4A 2V3DA 3GHUA 2CXGA 1Q45A 3AXHA 1TIMA 4UUIA 4ZFCA 2AMXA 5CCZA 3W1PA 2GSHA 1FDJA 3LM3A 1HFBA 2GJRA 4I9JA 2X09A 5IDZA 2X1IA 1QBBA 2F61A 3LPGA 4C1NA 5TBOA 1OFBA 4OFCA 5TAOA 1FAPA 3GH7A 4O52A 1AH4A 2CPUA 2OX1A 1LUCA 2JIWA 3LOTA 3GIQA 1VJZA 4XAPA 1XIJA 3KUMA 3R5EA 1TO3A 4CVUA 4WLCA 4DF0A 3DFYA 1R9XA 4Z1YA 3WNNA 2HISA 1DP0A 4XB3A 4YVPA 3APTA 2ZADA 1UCWA 1E1CB 3JZEA 3SAZA 2DG3A 2O7SA 4JFSA 3RLUA 5AC6A 4WR3A 3SUTA 1A4MA 4UQ9A 3TQVA 1GZJA 1DJHA 1RJPA 3N19B 5REQB 3TYCA 1CXIA 1DJZA 4CCDA 1JYVA 2ZR5A 1XYZA 4R85A 4A05A 5DEZA 3C0JA 4MPQA 1XLDA 5HOSA 2BOEX 2BVDA 1F76A 1MZHA 4RZBA 4MY9A 3V75A 3WQ8A 3O16A 1JZ4A 1P7TB 1QNSA 2ADAA 4YTTA 1UD6A 1QU4A 5IOBA 1PKYA 4LAMA 4FAPA 1XGDA 4FR6A 1O66A 1W3TA 5AY7A 4EVZA 1NQ6A 1DV7A 4NNAA 3UJRA 4FEZA 5A2AA 2GK1B 1J2WA 5BXRA 2OSYA 2VGIA 4LPCA 3DXIA 1TFVA 3EIPA 3HPXA 3KX6A 7XIMA 3TP4A 1ODZA 4ZPWR 1MVYA 2E1WA 3EMZA 2GYIA 4DXKA 1Y8BA 3CGMA 2YA2A 1IT0A 3RX4A 2ZUWA 2OO0A 2QPUA 4IH3A 4A3RA 1EQCA 4YXGA 3L4UA 2OJPA 1XLIA 3BCJA 3UJFA 2PN0A 1PZ3A 3G22A 4XO7A 3UEQA 4YCOA 3I4KA 1I2OA 4LS0A 5DCBA 1HP5A 3T2OA 5GNYA 1EB3A 4XWUA 3ITVA 3VIKA 2JE8A 5CC5A 2ANUA 2X2GA 1QVBA 1W26A 4ORMA 4OOZA 3PSVA 1SZRA 3PUGA 1JZ7A 2YCLB 3QPEA 3VABA 4ZQNA 1EJWC 1TJPA 3LBCA 1NH6A 2OPJA 4PSRA 3M41A 3TN5A 4DZ2A 5KZMA 4C5ZA 4S3DA 3MHFA 4GUHA 1IX5A 1M6JA 3P93A 2GPTA 4GVFA 3ZWSA 1YXDA 1I8JA 4HMCA 3SCNA 4PSPA 1ZUAX 5D2YA 4PB3A 1A3WA 3ME3A 3TQ0A 4Z1AA 2CHNA 3TC3A 3M7SA 3RF9A 3OPSA 2ZWZA 6CGTA 1JDCA 4FXFA 1FHVA 2TODA 4ZCWA 3AOFA 2VOMA 1XYMA 3T40A 3WF4A 3CASA 3P5YA 4LUYA 5FIPA 2P53A 4OGZA 1R5YA 4NILA 2HJPA 1XW8A 3WJWA 1A5CA 1YX1A 4HYRA 1BD0A 3DESA 1B9BA 2ZDRA 4IMAA 2X30A 3DYOA 4W84A 1I0DA 3U7BA 3E0LA 2ISSA 3T78A 4AQLA 4IXXA 1P6BA 4IISA 5DN1A 2V67A 4MWAC 4Z42C 2ZZ3A 4LQ1A 1ZJBA 1UBSA 1JGIA 3CAWA 2Q09A 3BVJA 3WEOA 3CIXA 3FSTA 1XKJA 1KBIA 3OGSA 3IIOA 3CPRA 4JTTA 4A22A 1LLZA 4XTIA 5E0FA 4WRHA 1S3TC 2DZPA 1PYMA 3GAKA 3NTYA 3LLDA 2J7FA 2WKJA 1E4MM 1I75A 3PB2A 3WQ6A 4JHMA 2Z2BA 3GNDA 2FGBA 4UFHA 3W02A 3WLOA 3CGTA 3M0JA 1IXPA 2UWFA 3FHQA 4LB4A 2QDDA 3KACA 1RK6A 4HTYA 4NJIA 1O7AA 4X9SA 1ECQA 2KR7A 5JH1A 3VNIA 5AHNA 3EB4A 2PDUA 2XIMA 1AQ0A 4LF1A 5CGMA 4WZHA 3SQMA 3EOEA 2IS7A 5LIKX 1SZNA 2EJ1A 4JTQA 4W88A 1KM5A 3GVQA 1F61A 4CEUC 1VR6A 5EMUA 4X3ZA 1DIDA 4H9MA 2OKTA 3S47A 1LBLA 2YIHA 3W6YA 3EMCA 4ZQOA 1YADA 3VINA 3R7MA 2PP0A 3GTXA 3SY1A 4AEOA 2CZVA 3LHWA 3TLQA 4E38A 1EFZA 1NARA 4IF2A 1OX6A 4NXKA 5FL0A 1XH2A 1TUXA 1HJWA 1L8NA 1YNQA 4W7WA 4PUEA 3NI6A 2YJQA 4H8HA 2VDIA 2XP7A 1E72M 3WD4A 2PURA 4JFVA 5F4WA 3F03K 4DRNA 3GTHA 3MKCA 1GQNA 2HEJA 3N3MA 2NT1A 5CBBA 1QO5A 3STEA 4QROA 2QGYA 1UWIA 4UNKA 5E5CA 2I57A 3KVJA 4PCFA 1FKFA 1XICA 4JIQA 5FAJA 1VFLA 3BLDA 1UBPC 4UFMA 2J25A 3OQEA 2MLZA 4J35A 1IE7C 2VVNA 4M6PA 3S6TA 1P0BA 1RALA 3OYXA 1PIFA 4P7RA 4GIRA 2O9OA 1KFJA 4UR9A 2O0TA 1GHRA 3C2OA 1KRCC 3BAYA 1UR2A 3LLFA 2QR6A 4H7ZA 4XG1A 1ZSXA 3KE0A 3SURA 4MLRA 2QJMA 4TW8A 5MKGA 3L65A 4HA3A 5JUVA 3IUIA 3KTXA 1X1OA 1HVXA 4LV4A 2FJKA 3GIPA 1QOXA 1F3WA 4C7DA 3AAMA 1FWDC 4OUIA 1BF6A 1HTIA 1LCOA 1AD4A 3MV01 1N8FA 2FB3A 1FWRA 3SFKA 4J28A 4M6VA 5I03A 3O07A 1B6CA 5AVHA 1IHIA 3S5YA 3IJLA 4A8IA 4I8DA 1UPMB 3PM6A 1AW5A 3BLPX 4Z2JA 5IXEA 4Y9NA 5HANA 1I45A 3MUCA 2VZVA 4DRPA 3EOLA 3ANVA 2WXDM 3AALA 3NYDA 1ADSA 1AJ2A 4UC5A 4US6A 3UQBA 3AZRA 3A22A 1E3XA 3KEHA 1NDWA 4G1NA 4DI8A 4KFPA 3UA4A 1QOQA 3IANA 3I3DA 4DO5A 5HWBA 1QNOA 5CSYA 2WO5A 4J3TA 2ZXAA 4TX0A 4O18A 4NI8A 1JF5A 1DJXA 3TSDA 4TW7A 2DG9A 1YW1A 3ARXA 1SJDA 3SCTA 1BFNA 1AZ2A 1MXSA 2FKPA 4XUYA 4J40A 1QNPA 4MKSA 3W1LA 2ZZ7A 1JCNA 3EA3A 2YZ5A 1WDRA 3E38A 1EJUC 1US0A 2GQAA 3GH4A 3BTNA 1WZAA 1FWEC 2NXHA 4N4QA 4IT6A 3EKLA 2PDMA 3H54A 4IQJA 3O6DA 3DAQA 3S4TA 4Y8EA 3W7IA 4YPJA 1TV8A 3GTYX 4NQ1A 4D2JA 1PV8A 4TVDA 1JZ6A 4C6CA 3XISA 2P88A 4MDPA 5I78A 3B7XA 5FESA 1SO6A 4J27A 2EQDA 3OVGA 3UERA 4W89A 1UUQA 5AZ0A 4D6GA 4YMZA 1HGWA 4JL2A 4F2TA 3GH5A 4G7EB 4XZWA 3M5YA 2PRMA 2PDWA 4K7YA 4U33A 4PMUA 4MY8A 3N13A 4V33A 2IKJA 3COTA 1ZBWA 4WUIA 4B9ZA 3L2IA 4NJJA 2ZX5A 1FKWA 2YDSA 4G1KA 3WJXA 3B0XA 1V0MA 3PVFA 3W72A 1GKRA 3N2OA 4Q7NA 3LERA 3VIMA 2ZZ4A 4WSJA 3GPKA 4K37A 3S83A 2XVPA 4LY4A 1PX4A 4V1XA 2Y24A 2INEA 2M2AA 3O3RA 1F6PA 3H4GA 4HIBA 3E5PA 1UUMA 3WF2A 4W93A 3LMYA 3H22A 1D8WA 4UCGA 2ZFAA 3DBPA 1EJVC 3LPPA 4KFOA 1HKVA 1F6KA 3RAOA 3OA3A 4Q8UA 3SN0A 1XM3A 4UTTC 4U5IA 1OINA 1YYAA 2I17A 3L66A 2VURA 1WBJA 3K1DA 4OKDA 4MB5A 3LNPA 4YS1A 1ITQA 2BSLA 1P48A 2Z26A 3A24A 1FUYA 4BY3A 1ONWA 4PODA 2Z6IA 3T4CA 2X05A 2CETA 1QPNA 3GKAA 4U28A 2Q8XA 2XP8A 3NQGA 1CECA 4CQ8A 1XJBA 3ITOA 2V5LA 5J5DA 5JXQA 2HE8A 4QZVB 1FKKA 3LZ3A 2FH8A 3WH0A 1EF3A 3LGDA 1FWTA 1EA9C 1DJGA 4LYKA 1ITXA 1VC4A 3ABSA 3M0ZA 1RK5A 3F4WA 3R94A 2DGAA 2DIJA 5GJMA 1SO3A 5D04C 4AHQA 5BU9A 3IV3A 3D0CA 4DJFA 4I9TA 4WY0F 3MC5A 1PPIA 2GGGA 4W7VA 4GQBA 2PCQA 2FKEA 3SRFA 3LQLA 1BKSA 4NHVA 1TPB1 5A8OA 1UH4A 2YR1A 1YE4A 3CAQA 1E0VA 1W8SA 4QBXA 4QX4A 4BJHA 2SFPA 2B81A 1NWRA 5M3WA 1S38A 3PHAA 2QV5A 2OTDA 3QYSA 4B2DA 4LNCA 4YCPA 4L80A 5M1TA 1V6YA 3TCZA 4HU8A 3TZFA 1ITCA 2V3FA 2KO7A 2Y7DA 5TD4A 1VBRA 1ISZA 2Y6ZA 3O8AA 3VM5A 1OYCA 3LRMA 4ZOEA 1W1PA 4MPKA 3W84A 1KM0A 4QDPA 2PTYA 3G1DA 1KQZA 4Q4KA 1RY8A 5I3KA 1H5VA 4DWSA 4IFKB 1M53A 1P6CA 1FX6A 2GOKA 4UCFA 1EO7A 4MGGA 1S3HA 4NX0A 4GG9A 2DUXA 3ABXA 2PPGA 4ZVJA 2O56A 1UD3A 2XVGA 3IJDA 3TN6A 2BVTA 5T26A 3VZZA 3TOYA 4LC6A 5KZEA 4S3JA 1J5SA 4QJ5B 2E68A 3W75A 1ME9A 3U0HA 2ZRZA 4OECA 1MEIA 1XKYA 1TCDA 1JI2A 4KCWA 2H3DA 5I3HA 1UASA 3GNOA 2J78A 1TCMA 2VDGA 3W7RA 4O4WA 1OC5A 4V2XA 4WKFA 3DFHA 5DBTA 4YYFA 1I4NA 1E71M 4AY8A 2OT0A 3TYZA 4QAIA 4AC1X 4K3ZA 2J9XA 1CWYA 4C1LA 1QATA 1E4IA 4XD5A 1GZ1A 1C9HA 4M6QA 1W9XA 1HP4A 5AYZA 1EPXA 5D37A 4DI9A 4OWGA 4Q8MA 1U1JA 3PTMA 2W4XA 4E4UA 4ILSA 2P8BA 4KW2A 2GK1A 2OELA 5LSMA 3S0CA 1B3XA 5I06A 1W1YA 3NQ6A 4R9OA 5I3DA 3TCSA 1YATA 1QWGA 1A7XA 1PWLA 2PRHA 2UZ5A 4OBSA 5LNRA 4FXJA 2Y1HA 4Z1DA 4M3PA 1YTDA 3EOSA 3GWQA 4GPNA 3IUHA 1HO4A 3BJTA 2J7EA 2XFFA 4E6MA 2HK1A 5HINA 1BVNP 1KWGA 2PODA 2A3HA 4F8XA 4EOUA 6XIMA 2D69A 4NX5A 1E1CA 1WXYA 2PGRA 4ALDA 4MM1A 4RDWA 2KAUC 4HBKA 4YVVA 3FA5A 1TYGA 3WD3A 3A9BA 1FRBA 2ZUUA 3O7UA 3G18A 3NQDA 4RV3A 3W22A 1W31A 2AAMA 2BVWA 4ZSTA 3TLLA 3U3HA 3CMJA 3TNBA 4AXNA 2X0SA 3K4AA 5HK4A 3GR8A 4US5D 1IEVA 4N9BA 3QC0A 3GXPA 2VZOA 2VEPA 1Z42A 3N9KA 3LYEA 4BK9A 6TAAA 2OFNA 4WD0A 5XIAA 5GJNA 2A79A 4H04A 1E9IA 3MU7A 1W5QA 3BG3A 2CYGA 3W00A 3B9DA 5DT5A 1EP3A 3QKEA 5GJPA 1O12A 1YBQB 4KQNA 3TK7A 3NA8A 1SFSA 4H7VA 3ZR6A 4C6KA 3N34A 4C7GA 2NX3A 1XLCA 5CBIA 4DPPA 2D3LA 4GJJA 1TWIA 4RXGA 2DSUA 2Y0FA 4F66A 1S5VA 2EULA 3CEUA 3HG3A 4HSHA 3NQ8A 1H1YA 2J47A 1XGEA 3WSUA 4C6MA 5EA9A 3T7VA 2XTKA 1HGYA 4YN5A 4DRMA 3N29A 1XF0A 3C56A 5HBFA 5G1TA 5HMEA 3DBNA 1UZDA 5AKQA 4C1NB 3GKFA 4GBUA 1XS2A 1B57A 4K6AA 3ATYA 1A5UA 4D6IA 3GNPA 3ODKA 3ARYA 4H9YA 3LTSA 3MHGA 3A5FA 4N7QA 5G4WA 1V51A 1BSIA 4L72B 4GCAA 3N2MA 2F9RA 2YXXA 4NT0A 4HNOA 3QW3A 1VEOA 2VC5A 4KKXA 3IGSA 1BWKA 5AC4A 1TKKA 1UR1A 1M9HA 2GJPA 2AKMA 4JQ1A 4HSNA 2ZIDA 2NSOA 2QCDA 2B5UB 2ZX7A 4GQQA 5DIVA 4K8HA 4IFRA 4DUXA 3V5FA 2GVLA 3VKJA 2VI0A 3VGBA 4CU8A 3CO4A 3NZ1A 1ONEA 3KVKA 2Z1KA 1M7JA 3WK2A 3UJ2A 1YDOA 4ZPTR 2BXVA 3B8UA 3CQKA 2BZNA 4PCNA 1AL8A 5ENLA 3PPHA 1K6AA 1H62A 3WLMA 5DBUA 2FVKA 1MQQA 5D9PA 2GVEA 4ZMGA 4Y7EA 2OSXA 1REQB 1Q2RA 1CGUA 4KFNA 3VNJA 4QQ3A 2P50A 1KGXA 3L0GA 2AL1A 4AF0B 4LY8A 2E5CA 4OTKA 1DWIM 4KMQA 9CGTA 1GYLA 2G97A 2X42A 1R8LA 3UU0A 1H5YA 1DQWA 5J8LA 4OBRA 2Z1XA 1AUSL 2CLOA 5AVNA 3TYUA 4CD7A 1JCLA 3SCWA 3WH6A 5LIYX 4UZSA 3HGSA 2GUBA 2J7DA 3LRKA 3PAJA 3BZGA 1OQFA 2VT0A 1WOBA 3LSBA 3LZ5A 4F0KA 4ZO7A 2GQ3A 3BLKA 1W3KA 3FDGA 1G4PA 3SEPA 3I10A 1VJSA 4NUWA 1MI3A 1IR2A 2RJHA 1W91A 3E0IA 4XKMA 1W3JA 1FWAC 1PHWA 4C6QA 3W7PA 4O13A 3NURA 2WNZA 2W66A 1OADA 1TR9A 1T7LA 3UXAA 2QULA 4MIMA 1TX2A 3N04A 3PANA 4KIRA 2V5DA 2W9MA 3FGCB 5C5YA 1GRJA 5DFAA 5D38A 1TV2A 4FSAA 2PB1A 5FJPA 1NSJA 1QWKA 1J0ZA 2IPWA 3VIOA 1E73M 3UCCA 1BVWA 1RPKA 3WD0A 2VXNA 1VQTA 1UIPA 3ANYA 3IIPA 1WP6A 3B0YA 4MAVA 5FSEC 3C2EA 2UBPC 1HNYA 3O9NA 2Z2AA 1E6NA 3DZ1A 2HRWA 3N12A 4CLMA 2YW4A 4KIEA 3MI6A 3KCJA 3TZNA 4RE0A 4HZ7A 1D3GA 1PO9A 1JCTA 1PSCA 1Q8AA 3W4RA 1I1WA 5AN7A 9XIMA 3UNTA 4ZL1A 3NEVA 3POHA 4NASA 1BRLA 2XG9A 3QSRA 3GG1A 3WBYA 1RD6A 4LOCA 5D9MA 3T2PA 1RVKA 1CXFA 3UCQA 3DCPA 2F84A 1XIHA 1D6OA 1XYBA 4YWIA 2DG4A 3SN1A 1DTNA 1LF1A 1RLCL 4UR8A 4GQGA 3U6WA 5E0KA 2HXTA 3ZT7A 1ICSA 4BQ5A 1CEOA 2XP6A 3GXDA 3REQA 2FTPA 3BARA 2DPEA 3V1HA 1R3WA 1KW1A 4KRTA 1WDWA 3A3WA 3H2EA 1OFQA 4AWEA 1LL6A 1A5BA 2A3CA 3VD7A 1VLIA 2ZUSA 1P6WA 1N1AA 4IICA 1KFEA 4S23A 3P14A 4QT2A 1XSIA 3C61A 3MDUA 5H8PA 4CKQA 3W2MA 5BXTA 4NSBA 2F7FA 1K4GA 3AICA 3GVGA 1OX4A 4WHBA 5I79A 3ABQA 3GR4A 3QSTA 3S2CA 1ZENA 4JYDA 3KOYA 1CXHA 1EDQA 1TA3B 3HBLA 4QLJA 4MKVA 1E9ZB 1Q7MA 4DBUA 1OG6A 3UY7A 2C3ZA 3IRSA 4FLRA 3GU0A 1YQ2A 1OCBA 5I24A 1BXCA 2CU0A 5ECUA 3M46A 2WNWA 3N6QA 3TXVA 4WDXA