1XHGA

Crystal structure of a 40 kda signalling protein from porcine (spp-40) at 2.89a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPP-40
publication title Crystal structure of a 40 kDa signalling protein from Porcine (SPP-40) at 2.89A resolution.
rcsb
molecule tags Signaling protein
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xhgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xhgA01
5CQ1A 4B15A 2OSYA 2QPUA 3EMQA 4JKMA 2EPLX 2Y4SA 3WELA 4HMDA 3WF3A 2D0GA 1WNOA 1UH3A 1VB9A 3MV11 3BC9A 3UERA 1MYRA 1UZ4A 3N13A 2E8ZA 1G0CA 4KGLA 4HOWA 4AZHA 9CGTA 1Q6EA 4CU6A 1HP4A 3ALFA 1BTCA 2CBUA 4TVDA 3AS3A 4U5KA 1UD6A 3PZQA 1E3ZA 2WVUA 4OZOA 4R27A 3VD3A 4LYPA 4D1IA 3DC0A 3W81A 1GVYA 4KRTA 1ZJBA 5M03A 2WAGA 3CZLA 1LLOA 5BXTA 1QI5A 2YJQA 1NP0A 4DWSB 1PBGA 2XFRA 1UKPA 3G6MA 1UR9A 2W92A 2VX6A 3UG5A 1SMDA 1EHNA 1V3MA 5A69A 2G3MA 3L4YA 1GW1A 2NT1A 3NUKA 3N18A 4M56A 8A3HA 1V6XA 1VBRA 1WDRA 1PZ2A 1XSKA 3WMCA 3WF2A 2JFEX 4BCEA 2C0HA 2QMJA 2WBGA 2JEPA 2WWCA 1GVIA 1ISWA 1V3HA 4XX6A 3ARRA 2ZX8A 1B90A 1H0IA 3GXDA 1NWTA 1BG4A 3TTOA 1KGXA 2GJPA 4TTGA 1DEDA 1JI1A 1K9TA 3KL3A 4F79A 4B9ZA 1DP0A 1XSJA 3PZIA 3VGDA 2WMIB 4DM2A 3TP4A 3GZAA 3VPLA 2G8ZA 4AIEA 1W9XA 1W1PA 1Q4NX 4DWSD 5I3DA 5DMYA 2J77A 1E72M 1LF1A 1KXHA 3WH8A 3CLWA 5GQBA 4JHZA 4TVCA 2YL6A 4HZ6A 3ZR5A 3BAKA 3AICA 1WZMA 3WDPP 3AROA 2DSKA 2JF6A 3BMWA 4W8AA 1CLXA 1OT1A 3WKZA 4JKKA 5CSUA 1IV8A 4AIOA 4P8VA 1EOKA 4CD7A 2YBUA 3VM5A 1KQYA 3EDDA 4Z2KA 1XYZA 3QHNA 1VRXA 4ZEPA 2XSAA 1X6NA 3WSUA 2WMGA 4W84A 1TA3B 2ZWYA 2PF0A 4TUFA 2QPSA 3ZQ9A 2XVPA 2XIIA 1H11A 1XCXA 4PYSA 3ZT7A 3F5LA 3PTQA 2CPUA 4PTXA 2ZXDA 3WD4A 3CUJA 1ODZA 3SCVA 1V3KA 3GXIA 1JAKA 3VIOA 1QOXA 1BF2A 4LGXA 4J3XA 3WEMA 1UR1A 1HP5A 4W7VA 1CGYA 3W27A 2XWDA 2UWFA 2CBIA 1ZB5A 3EMZA 3ZT6A 4MTVA 5A6KA 1IZKA 2BV9A 4AEFA 3SEPA 4HMCA 1JZ5A 5A94A 1JI2A 4U3CA 4Z2JA 2JIEA 2FH8A 1BVNP 4PCTA 3WDHA 2J25A 1C3FA 1RP8A 3CPUA 1E6PA 3LPGA 2WHKA 2XYLA 3U5YA 1UWUA 4CN1A 1W1YA 1MQPA 1R87A 2PC8A 2V38A 1TE1A 3AISA 3WN6A 2WKLA 4GO8A 5FIPA 3AXHA 2YDSA 3AIBA 1KWGA 1V3JA 1CPUA 3AIWA 1ISXA 7CGTA 3UCQA 2FHBA 2OYMA 2YL8A 5A6LA 2DIJA 1US3A 1D7FA 4IPNB 3CZ8A 1WKYA 4JAWA 1W3LA 4HU0A 3VIHA 1J9YA 4L4PA 2OWWA 3UG4A 3CBWA 1JG9A 2G3IA 4H8UA 2BXYA 1W32A 1X6LA 4D72A 1Q6DA 3VGGA 3B9DA 3KWXA 3SCOA 2MANA 5LA0A 4AEEA 4S3KA 1N82A 2IXUA 4UQAA 5HNNA 2WC7A 2B31A 3E1F1 3SUSA 2YL9A 4TX6A 1J0JA 3MS8A 3VDBA 2Y2WA 3OLIA 3WENA 1OD0A 5ABGA 4BQ3A 2J7EA 4Q22A 3T2QA 4HU8A 3VD4A 3ZIZA 2WXDM 1ZS2A 1HF6A 4KH2A 3AHYA 4LQ1A 3UG3A 2EJ1A 2WC3A 3VMNA 4LYRA 1A3HA 2WHJA 4U3AA 3OA5A 4QP0A 3SCPA 1E0WA 1E5JA 4IISA 1YHTA 3EYPA 1DHKA 2XVKA 1TA3A 4AD4A 1XYFA 4D6IA 3VIIA 2D3NA 2J62A 4PMUA 1RP9A 5JH8A 3WEOA 4FLRA 3MU7A 1CTNA 4MNJA 2EPMX 1FFRA 1BYBA 3FXYA 1JNEA 1WZLA 1LWJA 1E4NA 1W2VA 1BVZA 1KR1A 2DSUA 3FAXA 2CESA 3ZMRA 4D1JA 3RPMA 2VZSA 4P7RA 1J0KA 1VFFA 2PBGA 2WSKA 1QNQA 2TAAA 3SUTA 5IHRA 3SCUA 3WQ8A 1CZ1A 4RE3A 1WDSA 2UY4A 1JXJA 1V0LA 1OB0A 3QHMA 3MUIA 3T2OA 3W53A 2VX5A 2CXGA 2Y8VA 3OLGA 1MW0A 4YN5A 1DWFM 2D3LA 5DFAA 2PWHA 1HKKA 1C91A 3F5JA 1PPIA 4J7RA 2VTFA 3J7HA 4XZBA 1XRVA 4EK7A 1XV8A 1QBAA 2XVGA 1UKSA 1MW1A 1W9PA 1QHZA 2GJXB 2CITA 2WVSA 5AC4A 3W24A 3AMDA 1FFQA 3WL0A 1PX8A 1W2PA 1E5NA 1PIFA 3THCA 3WNLA 2J47A 3WQWA 2EPOA 5I77A 3AXXA 1UD8A 3CHEA 2OYLA 1JL8A 2QMKA 1PEZA 4UQ9A 5IHSA 1AQHA 2ZWZA 2ZX7A 1CGVA 1VAHA 4ML4A 1JDDA 1FHDA 2W66A 3VX0A 3WQ4A 2WBKA 1JZ6A 1CLVA 1VEOA 2HVMA 2VCCA 4ZFMA 2ZXAA 1JYWA 3AHXA 4F9JA 3PZNA 4PBGA 5A6BA 1BPLB 4PMXA 2VL4A 2YDRA 3EDFA 3AHTA 2AMGA 3RMEA 2J79A 3B9AA 3U5UA 1JDAA 2ZXBA 2WCSA 3PZMA 2V5DA 1EOMA 1ITXA 1B3WA 4HPGA 1EGZA 2J7CA 4F8XA 4GO9A 3TTSA 4H2CA 4AW7A 4H41A 3SUWA 1NWUA 5BWFA 3VIMA 1JZ2A 4AD0A 3SCWA 2ESCA 2EO7A 4TOQA 2E9MA 2XM1A 4J3WA 5BRPA 4WSJA 3APGA 5EMYA 2YDQA 1E3XA 3W0KA 3T0DA 1VFOA 2EBNA 4BQ4A 5LA1A 1UD3A 1GOKA 2O9RA 3GM8A 1UD5A 1AQMA 1IT0A 2WMFA 4C7GA 1JZ7A 1EHAA 2CBJA 5AC5A 1TUXA 1JF6A 1MVYA 3RCNA 3ZSSA 2VOTA 1EXPA 2BHYA 4CCDA 1BGAA 3GNRA 2E40A 2XJ7A 2DGAA 1GORA 1B3VA 3T08A 3DYPA 4JZ5A 1UWTA 5BXRA 2ZX5A 5BCAA 1JYXA 2XTKA 4HZ7A 4JFVA 4D6HA 4PTWA 1XHGA 3L4WA 2G41A 4CCEA 4P7OA 3VGBA 3VD9A 3VTRA 3CUFA 2GJXA 3N1AA 4V27A 1TZ7A 2ZE0A 3T0BA 1KBBA 1EQPA 5IXEA 3A4AA 3QOKA 5JBFA 1E1FA 3KEHA 3WH9A 1NOFA 4GINA 3UR8A 3EDJA 3SCQA 1PIGA 3NYDA 4J3SA 4F9DA 3VU2A 1UR0A 2BNJA 1QI0A 5E6ZA 2BY3A 1OIMA 1X1NA 2V3GA 1JNDA 2DPEA 2BY0A 3WNOA 3I3EA 2DT1A 5DT5A 3N15A 1UKOA 1LQ0A 2E3ZA 3W25A 2XSBA 5IDIA 4C7DA 2A3CA 2EPNA 4AC1X 3RM8A 2GDUA 3T09A 3WFLA 4AYSA 5JIWA 3WFZA 1FHLA 3AOFA 1E4LA 3BMVA 3PZ9A 3HJEA 3GNOA 3PZUA 1F4HA 1V6WA 4OOUA 1UR4A 5CG0A 3OGVA 4EE9A 3IJ7A 1UR2A 2PBOA 2YLLA 1XH1A 4NZCA 4TXEA 3D5HA 4NF7A 1TG7A 2ZUUA 4UQEA 1HJWA 4CN6A 4D6EA 3F5KA 2GUYA 2VRJA 5ABFB 4B9YA 3K8LA 3I3DA 3WUFA 1UH2A 4JCMA 3OB8A 4UR9A 5E6YA 4ZE4A 5A1AA 1QHPA 4AD1A 1K9FA 1U2YA 5F7UA 3QGVA 1P6WA 4LXFA 2CEQA 4WSKA 1OD8A 4GZEA 2J78A 4GI6A 4V28A 3WIJA 2VI0A 4OBRA 2X8RA 4FMVA 5M17A 3U7VA 4U2YA 2DT3A 5CPQA 3BCDA 3OGRA 2GDVA 4ATWA 2UY2A 2VQTA 4MNKA 1MQRA 4CU8A 3G6LA 1E73M 5E9AA 1CEOA 3RDKA 4NSBA 1MXGA 4PTMA 1XD1A 4UFIA 2XG9A 3AZTA 1UKTA 3JUGA 3IJ8A 2EQDA 2W67A 4MPKA 5A2CA 3MMWA 2WZIA 1GQKA 1BAGA 1YQ2A 3AHVA 2A3HA 1FH8A 3AIUA 5A2AA 1CDGA 3W29A 5A6MA 2XIBA 1CXIA 1R7AA 3NSMA 4CUCA 2FHCA 2VX7A 3AMGA 4GKLA 3UESA 2W63A 3BAXA 4N0RA 3CHFA 4A4AA 2ZICA 1G9HA 4GI8A 2O9TA 3IJ9A 1UKQA 6CGTA 2FHFA 5I78A 4V2XA 5KEZA 2ZOXA 1KCLA 4D71A 1CGWA 2ZUNA 1KGWA 3CUGA 5C8BB 3ARWA 3CH9A 1JZ8A 1VEPA 2HISA 2X09A 5I6SA 4W85A 7TAAA 5I24A 4WK9A 4E2OA 2E0PA 1BFNA 3PZGA 1KCKA 3OBAA 1V6YA 3AMCA 2BXZA 4HA1A 2DSWA 4TVUA 3W26A 4AZ5A 1I75A 3CUHA 3WDJA 5D8ZA 1G94A 4Z2IA 2GSJA 1A47A 4M29A 5I5RA 2DIEA 2VZOA 3WD2A 2WW5A 4B3KA 5BRQA 2VC9A 2CCRA 4KMQA 3M46A 4PTVA 5BXPA 1FP9A 4TTUA 1Q6FA 4GI9A 3VIJA 1V6UA 4W88A 3VMOA 3CHDA 5HPOA 5FL1A 3T0AA 5A8PA 5ABFA 2A3AA 2CBVA 1GQLA 5D9PA 1HJSA 3GTNA 1WB0A 3BAIA 1QNSA 2EPKX 5JIPA 3NJ3A 3SUUA 5GNXA 3SUVA 4WJXA 5M3WA 1C7SA 4N42A 1HJUA 2E9LA 4BS0A 4YPJA 3N12A 2BY1A 3LPFA 3CZKA 2D20A 5HBFA 1CYGA 3VNYA 4GXPA 3WMBA 4ATLA 4AIUA 3RIKA 2V5CA 4ZXLA 3UETA 2XGIA 5CZKA 4QFUA 3ARZA 4DWSA 1UD4A 3BLPX 1EDTA 3WDRA 3VNZA 2PB1A 1WCGA 1LG2A 4P8UA 1GHSA 5LA2A 1B9ZA 1EO5A 1SMAA 4UZUA 3N17A 3CZJA 2UY5A 1QNPA 3MMUA 1E71M 3POHA 4E8DA 4UQCA 3AIVA 1WE5A 1I1WA 3IAPA 3DYMA 1CIUA 1KB3A 1QNRA 5CPTA 3BLKA 3GYCA 1HL9A 4M82A 2DSVA 2YBTA 2WNWA 3GXFA 3AJ7A 1EIBA 4UFLA 1J18A 4E8CA 1JGIA 2WMIA 4OOZA 4PSRA 2WCGA 5FOOA 1K6AA 1DWGM 4HZ8A 1HNYA 3IANA 3RM9A 2XGBA 2ZXQA 3DHPA 4Y7EA 1M03A 4HPHA 1F4AA 1HJXA 2W91A 4FLOA 3MO4A 5CGTA 3B9EA 4HA4A 1NM9A 1B1YA 1J0HA 4W5UA 1LL4A 5A8OA 2J74A 5A6AA 1I1XA 5EBAA 1KGUA 1U33A 4D6JA 4PMVA 1W3HA 4YHGA 1DWAM 4GZIA 1GOMA 3OLDA 3KZSA 1VJSA 3CGTA 1NWRA 3K4AA 4F66A 1LL7A 2PWDA 2YA1A 2ZX9A 3PZTA 1M53A 4UOJA 2XVNA 1BYCA 1J01A 1JD7A 2W5FA 4P7LA 1E4IA 4FLSA 4AZ7A 3AIEA 3EBVA 1M7XA 3F4VA 1UOKA 4PMDA 1ISVA 5CSYA 4AD3A 2BHUA 4FF5A 4LPCA 1NARA 4D6FA 4MB5A 4MB3A 5ABHA 2WHMA 3BXWA 4AZIA 1XH0A 1UWRA 3CMJA 1TR1A 1B3ZA 5DT7A 1TVPA 3WD1A 4M80A 1E9LA 5FD0A 3ZJKA 4GZJA 1JFXA 3VUPA 1D3CA 2BHZA 5JBDA 5E0FA 5D4YA 4CD4A 2JEQA 2ZUVA 2VNCA 3ZSTA 3K8KA 1UUQA 3CZGA 4WKAA 4M8UA 3WNKA 1L8NA 1G01A 3UR7A 3OIHA 1DWIM 4KRUA 1J10A 2J7FA 4PUDA 4CKQA 3SIMA 2PWGA 3DYOA 4C7FA 2WZEA 1HL8A 2VJXA 2PWFA 2XVLA 1UWSA 4DUVA 2VZUA 3ALGA 4B3LA 3II1A 2XUCA 3WMSA 4WKHA 3W4RA 2C8NA 4IPLA 1LWHA 2PWEA 1WDPA 2D0HA 5C70A 1HVXA 3BGAA 3WH7A 4W8LA 4OKDA 3FNDA 3N04A 4UFMA 2YKKA 1J11A 3RJYA 4HMEA 4L4OA 4Z2LA 1FOBA 3D3AA 2VCAA 2DSZA 1VBUA 4UZSA 3GBEA 3UEQA 2XHYA 1OINA 1V02A 2IUZA 5DF0A 1WPCA 2OSWA 2WLZA 3WY1A 1G1YA 2ZX6A 4QAWA 3HU7A 1TFVA 1OT2A 4UFJA 1O7AA 1PX4A 2WANA 1H09A 1W9UA 4PMOA 4XV0A 4AMCA 2PI6A 1WZAA 4A3YA 5FL0A 2WYSA 2Y24A 4XUYA 1NH6A 3ARPA 2V3EA 4IM4A 4ACZB 1SYTA 4AZGA 5CPSA 3CMGA 4W87A 2NSXA 2WK2A 3CIVA 2OSXA 1W3KA 2JE8A 1QNOA 1E1EA 1QW9A 4H8VA 1UD2A 5GNZA 1D2KA 1TVNA 5JUVA 1W91A 1J12A 4HOXA 4P8XA 2VRKA 2WKGA 5D9NA 3WQVA 2V3DA 4CVUA 4BF7A 3S2CA 3VOCA 1GJWA 3VVGA 1PJ9A 1JFHA 3PHAA 2FGLA 1UWIA 1UR8A 4BA0A 1E4MM 3AZRA 7A3HA 1DWJM 5EB8A 3OZOA 4AY1A 3ZJ8A 3WUGA 3POCA 2VUYA 1QHOA 3OGSA 4JL1A 3ARTA 3WNNA 4DUWA 4YHEA 5HDRA 3PZVA 1R7OA 4JKLA 4MAVA 4PUEA 2GK1B 3MUY1 2VR5A 3GDBA 1JAEA 1E0XA 1HJVA 2VVNA 4X9YA 1M04A 1RD6A 5E09A 5FCZA 1C8YA 4UTFA 4JCLA 1UYQA 4UOZA 3RO8A 5HOSA 1JD9A 4HP5A 4CU7A 1B2YA 3O6AA 5I2UA 4M81A 2BVYA 1UZ1A 4UQDA 5A6SA 1GHRA 3BSGA 4ATDA 5AY7A 2CETA 3GXMA 3EDEA 2GJRA 2YA0A 2ZUMA 1TMQA 3NDZA 1EO7A 1MFUA 1BGGA 1AMYA 4PMNA 1MWOA 4HTYA 4GQRA 1Q6GA 1XGZA 3SURA 2GVYA 3ARXA 5AYIA 2G4FA 1HKMA 1UWQA 2WM0A 1NP2A 1K9EA 4JIEA 1DTUA 3VIKA 3GBDA 1C8XA 2YLAA 4MDPA 3W28A 5IFTA 1V03A 1NOUA 1HKJA 1XSIA 4GPNA 2WPGA 4WIWA 3NSXA 3AS2A 3VDHA 2VO5A 3WF4A 3WUBA 1E40A 1WP6A 4PEEA 4MB4A 4U5IA 1FH9A 2EXOA 3ARUA 2JIWA 4W93A 4BQ2A 1FA2A 3ARYA 1CXKA 5DEZA 2G3NA 2JF7A 5HXMA 2VX4A 3AMLA 4NI3A 3FHAA 4H8HA 3OG2A 3MUAA 5CXPA 1W9VA 2O9PA 1GONA 2D0FA 4QLKA 4X0NA 1HN1A 3BCFA 3THDA 1ITCA 2VR4A 4AZ6A 1EQCA 4W7WA 4UOQA 1H41A 1VF8A 1OCQA 1W1VA 1C7TA 3W37A 3ECQA 2WVVB 3VD7A 4M1RA 4P7QA 3VD5A 3WDIA 1ESWA 1CXFA 4R5EA 2GK1A 4W7UA 3AFBA 3M6DA 2CNCA 3VIFA 1CNVA 1MW3A 1QVBA 4OUEA 1BQCA 2CKSA 2BFGA 3ZR6A 1CGTA 3WNPA 2OWCA 4P8WA 5A2BA 4Z2HA 5CGMA 1ISZA 3RJXA 1ZJAA 1CWYA 2F61A 4B16A 3CZEA 1GJUA 3TTQA 1ISYA 3W82A 1J0IA 1HX0A 4JFWA 2WB5A 2J7BA 2D23A 5GNYA 3LPOA 1V3LA 4Q7NA 1MQQA 4U33A 3S6TA 5A8NA 3AIQA 2BS9A 3L4TA 1PAMA 2VURA 4J27A 3BAWA 1FH7A 1ZL1A 1JZ3A 3AYRA 1B30A 1HKIA 3VGFA 3AI0A 1OGGA 3FW6A 1S46A 4JFUA 1GUVA 1GOWA 3AMKA 3IAQA 2Y5EA 1JYNA 3NIYA 1V6VA 2Q8XA 1Z32X 3N11A 1QBBA 1V3IA 1GCYA 4UFKA 1H3GA 3A6OA 4HA3A 4CVWA 3W6LA 1GNXA 2D24A 3OLEA 2W4XA 1GQJA 3FAWA 1E43A 2ZUTA 3ZM8A 2DT0A 2O9OA 3WD3A 2J7GA 3WH5A 1E6SM 4U31A 3WD0A 1SFSA 5I79A 3TTYA 2QF8A 3ZO9A 4J28A 1KWKA 1GOQA 3O9NA 3M7SA 1EDGA 1Q6CA 1OBAA 3A3HA 4D6GA 1WO2A 1GZJA 2VT0A 4JL2A 4ZE5A 5GPRA 3N9KA 4AD2A 3QR3A 1J0ZA 3VX1A 3MANA 5BXSA 1R85A 4CD6A 4S3JA 1C90A 3NCOA 3BAJA 3PZOA 4PCSA 5AYBA 3O2LA 3LPPA 2DDXA 1ZU8A 1L0PA 4RL3A 3AS0A 4H04A 1UH4A 4UCFA 4PMRA 1UHVA 2X1IA 3AIRA 4AZBA 5FKYA 1B3YA 3L4XA 4EKJA 1HXJA 3SCNA 4J3UA 2O92A 1LJYA 1OIFA 4DM1A 2VRQA 4UNIA 2WVVA 2CERA 2CHOA 3L2MA 1QW8A 1V0MA 5JBEA 2QHAA 1G5AA 3WL1A 1W3JA 1US2A 2XFYA 4OIFA 1XH2A 1B31A 3PBGA 4QCFA 2E9BA 3AYSA 3MMDA 2J8FA 3VGHA 1E55A 2VZTA 5A3HA 2Z1SA 4MNMA 1H1NA 1ZBWA 1MW2A 4WLCA 1BG9A 3TOPA 1LL6A 6TAAA 3SCSA 2IXVA 2J8GA 1H5VA 3DECA 2EEXA 3ARQA 1V02E 1PX3A 1C93A 4ACYA 1UA7A 1DWHM 3PN8A 2X0YA 1GQIA 4QCEA 3M07A 1BSIA 4AWEA 2DEPA 3VGEA 4D6CA 1E6QM 3ZJ7A 4H7VA 2VZVA 4QLLA 3EMCA 1VFMA 2E4TA 3GNPA 1WAWA 4CD5A 2WMHA 1UG6A 2J75A 4MB1A 1E70M 3K4DA 1E0VA 4LYQA 2FGZA 5E70A 1B3XA 4JFTA 4J3TA 4CCCA 1H49A 1NWSA 4CGTA 3K8MA 4PMYA 4AISA 3L4VA 2CKRA 4KGJA 4OJYA 5KZ6A 1NOWA 2QV4A 2WLYA 2YIHA 1JZ4A 2QLYA 1E6RA 4UQBA 2FDMA 3VINA 3K1DA 2ZUWA 4A3HA 4W86A 2RGMA 1KQZA 2VCBA 4AXNA 3K46A 1ZBKA 3L2LA 4FLQA 5D9OA 1JIBA 3FHQA 4AZCB 4D6DA 3ARSA 2X0HA 5EFDA 1VEMA 1E6ZA 1W9BM 2OWXA 5EFFA 5ABEA 2BY2A 2W62A 3HMCA 5TD4A 5LYRA 1V0KA 2V3FA 3RM4A 2ZIDA 1JXKA 3MUZ1 4BQ5A 2X2YA 1GPFA 3AQUA 1VENA 3BAYA 4NRSA 4GQQA 1CGUA 4MJ2A 4WF7A 1IZJA 1HT6A 1CBGA 2JALA 3BH4A 4PRWA 1KR0A 5IFPA 4PN2A 5CLTA 3NSNA 3PTMA 2F2HA 2WVTA 2WHLA 3WBEA 4URIA 1PZ3A 1ZBCA 1H0GA 1CGXA 3CHCA 3MV01 5A6BD 1ODUA 2XM2A 1QPKA 2D2OA 3WQ5A 2D22A 2J4GA 1QI4A 4W89A 2A3BA 1BYAA 4IUGA 4CN4A 2X05A 2VQUA 1XD0A 4HOZA 3WH6A 5I0DA 1M01A 3WDQA 1TCMA 3VIGA 2WCAA 4UFHA 3W6MA 2CYGA 2XPKA 4MNLA 4KWUA 3HN3A 3VO0A 4ZXOA 5C71A 1OSEA 1R8LA 1BHGA 1OM0A 3MSDA 5D9MA 4RE4A 3ZOAA 1HVQA 3FY1A 3U57A 1O6IA 4TX8A 4MJ4A 1H4PA 3NDYA 3VKKA 1MXDA 1OGSA 1GOIA 1UQYA 3VDAA 3GH5A 3KL0A 2DT2A 3T2PA 3L4ZA 3CO4A 2A3EA 1QI3A 1CXLA 3BSHA 5HPCA 1ECEA 3I3BA 3VILA 1W1TA 1EH9A 1E15A 3VMPA 2WWDA 3AXIA 1KBKA 1OWQA 3ZT5A 5M5DA 4PMZA 2NW0A 1JDCA 4JHOA 3A4XA 4EAMA 3VDCA 2WSPA 3KL5A 1H2JA 1KXQA 3MKKA 2DH3A 1OGBA 1C92A 1CECA 3WNMA 3WF0A 3WBAA 3AZSA 3AHZA 2CIPA 2XWEA 4W5ZA 4DWSC 2J7HA 4AD5A 3AS1A 1RPKA 4PSPA 4MADA 4CD8A 4QDMA 3A47A 5CJ5A 2C7FA 2DQXA 2YA2A 4PMQA 3CTTA 1AVAA 4AZCA 3CUIA 4DUXA 1B0IA 1LG1A 4EANA 1XCWA 4LX4A 1VIWA 2E8YA 3MSGA 5E0CA 1AQ0A 2GFTA 3A4WA 3B8SA 2CHNA 1V08A 2YOCA 2OLHA 3OZPA 4M24A 1CENA 5ECUA 2YL5A 3GH4A 4K68A 4MAZA 1EDQA 1NQ6A 1VFUA 3IK2A 2AOSA 1MFVA 1FP8A 3FN9A 1U30A 1GOOA 5BYWA 4Z2GA 3QOMA 2DH2A 4W8BA 1WDQA 8CGTA 5CLWA 2J7DA 3EDKA 1KFWA 1HIZA 2F8QA 2XFFA 1KXVA 1WZKA 5D8WA 5A8QA 1V0NA 1K9DA 3L4UA 2FH6A 1CXEA 3VM7A 5A95A 3WF1A 1E6NA 4MDOA 2RGLA 3KE0A 3TA9A 1ZBVA 2VMFA 5A6JA 3SCRA 2WMJA 1JYVA 2W61A 1XC6A 1E56A 2UY3A 4J3VA 1BYDA 1C8QA 3TONA 2BVTA 2BVDA 3DHUA 1W9DM 5I23A 1HJQA 4FK9A 3PTKA 4U2ZA 1EA9C 4E4PA 1RH9A 5BROA 3U7BA 3LMYA 3SCTA 2WZHA 2ZUSA 4NRRA 4XB3A 1R86A 4RE2A 1SR0A 1CXHA 4JFSA 1Y7VA 3QHOA 6A3HA 3RILA 3ZJ6A 2NT0A 4OBSA 1VJZA 2WMKA 2VVSA 3WEZA 2G3JA 3ARVA 5DO8A 2AAAA 1JF5A 1KXTA 5A8MA 4P7NA 3WUEA 4WKFA 4BZYA 1UQZA 3WQ6A 1QI2A 3VIPA 4ACZA 3GH7A 4XZWA 2Z1KA 4ZENA 1J0YA 1BLIA 2Y8KA 4QLJA 1UA3A 3W38A 2D1ZA 4X0VA 2WC4A 2OYKA 1E6XM 4GIAA
chains in the Genus database with same CATH superfamily
3EB2A 3F4NA 4YNGA 4MKVA 2OSYA 1POKA 2I5GA 2QPUA 2V68A 3DBPA 4O18A 2Y4SA 4HMDA 4N4QA 2FGBA 2ZZ6A 5LGXA 3B4UA 1UPMB 3WLRA 2EG8A 1NQKA 2PGRA 3BE7A 1Y5VA 3TQVA 3FKKA 3W83A 2BZNA 3BQ5A 3W1RA 4CU6A 1HP4A 5HW8A 1XUZA 3ALFA 1EPVA 4YWSA 4RZ4A 4ORIA 4B2DA 1E3ZA 3NM3A 3VD3A 4LYPA 3LCHA 5F1VA 1OF8A 1A0DA 1VC4A 2WAGA 4FIRA 3C8FA 3COTA 2CWNA 2PRMA 1BKHA 1QI5A 5BW6A 1PBGA 4ZOBA 1NSGA 2B0MA 3W2JA 3P5ZA 2XFRA 5HWBA 2VX6A 3EOOA 4CQCA 1SMDA 1V3MA 3RCYA 3O5IA 2BVWA 2C3ZA 1WOAA 2O4QA 2NT1A 3UWUA 1VBRA 1WDRA 4A8NA 4HN4A 1R3YA 4Y9PA 3RRXA 2WBGA 1WA3A 3PRBA 2VP8A 2I57A 5D05A 1GVIA 3GIPA 3UQBA 3ARRA 3ITVA 1B90A 1H0IA 2VFEA 2Z6IA 2A85A 3UG8A 1DEDA 1JI1A 1K9TA 2YPIA 3KL3A 4F79A 1XSJA 3PZIA 2WMIB 4FF7A 1FKSA 3GZAA 3TH6A 3C52A 4O17A 3E5BA 2DZUA 1ELSA 4ERGA 3E2VA 4PTNA 2H8ZA 4IPXA 5LNRA 3WH8A 5GQBA 4JHZA 5I3FA 1Q13A 2VHLA 3B3DA 3TOYA 2DSKA 2JF6A 4IHCA 4B4HA 5AYZA 3PWAA 3TSDA 2XP3A 1I2OA 3GFXA 3MMTA 1EOKA 4LBUA 4CD7A 2H9AB 3VM5A 2DZXA 3EDDA 4Q8NA 3TQ0A 1G67A 2KFWA 2HVNA 2XSAA 1X6NA 3WSUA 2YW3A 1FCVA 1YLVA 1TA3B 2PF0A 5KMYA 4ODNA 4KWOA 4XZHA 3ZQ9A 2VWSA 3PWGA 1VZWA 2F21A 1XQLA 2CXEA 3LQGA 4LGXA 2PU0A 1UR1A 3CQIA 2FFCA 4ZQNA 2XWDA 1YPFA 1ZB5A 1F7BA 5MHBA 5A6KA 3IKGA 1R2TA 3P61A 3KBNA 4OE7A 4JIRA 1JZ5A 4LH8A 4IQEA 2DG3A 1JI2A 4Z2JA 5AC6A 2J25A 3CPUA 2CZEA 3LPGA 2WHKA 2QJIA 2PN0A 4CNOA 1W1YA 2ZQ0A 2V38A 3GUGA 3C56A 1YTKA 2QT3A 2XH0A 4UC5A 3AXHA 3E2SA 1VFLA 1V3JA 1CPUA 3AIWA 2Z6JA 1LQ2A 4HU4A 3UCQA 1WKEA 4O1CA 1TZ9A 1US3A 3CZ8A 2BOGX 1W3LA 4C6DA 4L4PA 3CBWA 3MUXA 3ITOA 4H8UA 1DIEA 1PCWA 3PC0A 3ZLFA 4ODQA 4D72A 3C6CA 3OVRA 3TW9A 1W6TA 3DU0A 3KWXA 3K30A 1FWAC 3KZPA 1W5NA 5D2YA 3OQ8A 3MBFA 1FD9A 4L72B 1X8FA 3M5VA 4RPPA 3KHDA 1J4IA 4UQAA 4HNOA 2WC7A 2B31A 2OJPA 2Y2WA 5DCBA 1OD0A 3LM3A 4IG2B 2ZZ1A 2F7FA 2GGHA 3ZIZA 4HNLA 1M5YA 4F2TA 3GDKA 1Q8AA 2Y6ZA 3T4WA 4LRSA 1NMVA 2CLHA 2OB3A 1A3HA 3WQFA 1OHLA 1O94A 1VBGA 2Z1BA 4FO4A 3GVRA 2Z00A 1T11A 4IISA 1DHKA 3TYDA 1TA3A 4AD4A 1RQEA 4PB3A 2PDIA 3WEOA 4BF9A 2HSAA 1IYXA 1PO9A 3MA8A 4RLIA 4PE8A 1BYBA 3W7JA 2AMXA 1VRDA 2VN1A 3A24A 1KR1A 3ZMRA 3M0KA 1Z42A 5ECVA 3LTYA 1ICPA 1EYEA 4KWWA 1MDLA 3PJWA 5EL1A 1O12A 3STPA 4ZTXA 2TAAA 1OX4A 3DFQA 3P14A 5LSMA 1YADA 2P50A 2UY4A 2R82A 4C02B 4OT7A 3EPNA 3LRLA 4I6KA 3Q4DA 3BLOA 3BJTA 3OLGA 4PR4A 3GU9A 2PWHA 1C91A 1EBGA 3F5JA 4QJ3B 3MPGA 2MNTA 1XRVA 2ACQA 4B5SA 2PZ0A 1VLWA 1Q7ZA 2GWNA 2XVGA 1UKSA 1EBHA 2CITA 4EXQA 5AC4A 1AL8A 3IRDA 2NXGA 3N19B 3U3HA 5IDZA 2BSLA 4G5DA 1PX8A 4RW3A 3W7RA 2ZADA 4L6HA 1YXYA 4WRHA 2QUVA 5F4XA 3W7EA 4AIBA 2J13A 5IHSA 1TE6A 2ZX7A 2DJLA 5HNRA 3UXDA 3KABA 2W66A 3SJNA 3WQ4A 2WBKA 2RURA 3L67A 4ZFMA 1JYWA 4KR0B 3QMTA 3H2AA 3L9CA 1Q63A 5A6BA 1W3NA 3NTYA 3K4WA 1GJPA 2VL4A 2YDRA 3OA3A 3AHTA 4N7QA 4R53A 3LCLA 3CU2A 2YGYA 2CFFA 1V93A 3GTXA 3RMEA 3RF9A 1IX5A 1LBLA 2FPVA 3MI6A 1A5MC 3V3WA 1ITXA 3N73A 4XVDA 1YE6A 3MDWA 1IEWA 1FKWA 1JCYA 4GO9A 3WX7A 3USBA 2HXTA 3EX4A 1Q45A 5HTGA 3GTIA 5AHLA 3O5LA 2EF9A 1F2JA 4H9UA 1TO3A 1XIBA 3H7UA 3DFYA 4ALDA 4WSJA 5D38A 2QCHA 5EMYA 3URNA 2PWUA 1K77A 1W8GA 2ALDA 2FTYA 1VFOA 2BASA 2VFFA 1UD5A 3AO0A 1EHAA 2BGQA 2CBJA 9RUBA 2P3ZA 4AF0B 4BHYA 2ZC1A 2BHYA 3R2GA 1XLMA 1WX0A 3GNRA 2E40A 2J88A 1GORA 2V67A 7ODCA 4JZ5A 2P1FA 1QMLA 4Q33A 3E96A 3W9ZA 4MWAD 3MO7A 1LM1A 3VD9A 4XISA 1ZCCA 1ZUAX 5HNTA 2ZE0A 3T0BA 1SZRA 1KBBA 2C6QA 5JBFA 3IV3A 3UWWA 1XYBA 1PYMA 4FZIA 1KKOA 3MHGA 1PIGA 3GFZA 1QI0A 4DRHA 1FWBC 2BY3A 2G3FA 3I3EA 4O0ZA 1L2QA 5DT5A 3QY8A 4ITZA 1LQAA 4C7DA 4GYJA 2A3CA 2HRWA 1XDLA 1KRAC 1O66A 2EPNA 3UPWA 3RM8A 3T09A 5JIWA 1XRSA 3RRAA 1POJA 2PS2A 1ZZMA 3PZ9A 2Q8ZA 5AC8A 3HJEA 3PZUA 5FSDC 4OOUA 1UR4A 4F0RA 1HL2A 1KTCA 1Z48A 2GWGA 5I3HA 5CZJA 4DLFA 3IJ7A 5FI8A 4NZCA 4TXEA 4UQEA 1RA0A 3P0XA 2ZRYA 1XBYA 1XUUA 2ISVA 3I65A 4AH7A 2F84A 3WUFA 5J5DA 3T8LA 4AD1A 2PC4A 2OKOA 4JTTA 5F7UA 3QGVA 2CEQA 1JCNA 4GZEA 5KSWA 4OBRA 4FMVA 4TX0A 1J79A 2IF4A 3G18A 4MLJA 4MSSA 4HSNA 4GJ1A 1MQRA 1ADDA 1R46A 3VKAA 4Z0JA 3UNTA 3ZYZA 2NZLA 2YFOA 3TR2A 4NSBA 1P4CA 4NG3A 3SSJA 1XBVA 5FAJA 1F9CA 4NILA 4E2DA 2M2AA 1UKTA 5HMEA 3IEBA 3XINA 2W67A 4MPKA 5IM51 1GQKA 3KZ7A 1R9ZA 4RUBA 4Q8UA 1JQVA 4A3RA 3AHVA 3E0VA 5A2AA 1GVEA 5A6MA 3C86A 2V2HA 2XIBA 3PUGA 2W27A 1VCVA 4C91A 3P60A 3K2GA 4GNVA 4GKLA 2DW6A 4N0RA 3DERA 3CHFA 1FCUA 4EP8C 2ZICA 3SAZA 2O9TA 4TW8A 4FR6A 3H22A 5I78A 1VR6A 1IT7A 3WLKX 1SZFA 2R91A 5JH1A 5C54A 4UR7A 3D46A 1N1AA 2ZUNA 2ZR4A 3CUGA 2XP4A 4ICNA 3E74A 2X09A 5FJRA 5I6SA 4BFAA 4W85A 4LCRA 5I24A 1MXSA 1TIWA 1U1JA 1BFNA 1RJQA 4R0XA 5REQB 3PZGA 1KCKA 4HA1A 3FIGA 4NASA 3VYLA 4A05A 2AQVA 2VFHA 4GKTA 1I75A 3CUHA 2OOGA 1G94A 4HHMA 4Z2IA 4QT2A 4KEMA 3QQWA 3WD2A 4I8DA 3SZ8A 1A80A 5FJIA 2C1HA 1F07A 4TTUA 2FB2A 3V5FA 4W88A 4O19A 3T0AA 1CB2A 4BWLC 1MZHA 3HMJG 4AB4A 4G7FA 4C6IA 1NEYA 1WYIA 3GW3A 3CL8A 3SUVA 1HJUA 5AVHA 3Q2DA 4IX0A 3LPFA 4RX0A 1CYGA 3A23A 4H6QA 1H60A 1ML1A 1ADOA 2ATMA 3WBWA 2H3BA 3AYVA 1KCZA 1B9ZA 3UA3A 3SRDA 2NWRA 5TIMA 3IGHX 2E77A 1S5NA 3V0TA 2NQZA 1CIUA 1E51A 1KB3A 4NT0A 5K9DA 1I2QA 1QNRA 4I5UA 3ISIX 4V1XA 1HL9A 3L68A 4QE1A 4DZHA 2DG9A 3GXFA 1G4TA 5DBTA 2RUDA 1K4HA 1J18A 3CAKA 3L0GA 1J2BA 4E8CA 3EXTA 1JGIA 3UI5A 1B54A 1LLZA 5JMUA 1EWEA 4LY8A 4OOZA 5FOOA 2WCGA 2OZ3A 2OXNA 4HZ8A 4FXSA 2XGBA 4Y7EA 1M03A 2XH4A 3QC3A 3T81A 1C9HA 1NM9A 4JX4A 4W5UA 1YTDA 3TQKA 3UFYA 3UXIA 1XLKA 3G24A 1OFBA 5EMKA 1MO0A 5REQA 2PLCA 1D7IA 1OX6A 3PY2A 1DWAM 3CQKA 3OLDA 3N3TA 4PFMA 2HV5A 2X7VA 4UCGA 3IIVA 3MKVA 3NAVA 4HD5A 2XVNA 3OZMA 2GQ3A 1J01A 3LNMA 4DNMA 3V5OA 1UUMA 1E4IA 4O28A 3AIEA 3EPMA 1M7XA 3F4VA 4PMDA 5CSYA 2BHUA 4LPCA 1NARA 4PUJA 5I02A 2WHMA 2R6OA 4FOKA 2ZVIA 4DH0A 4KWVA 4G2PA 4J2MA 1LP6A 1KM1A 2R14A 3DI0A 5FD0A 1E9LA 3ZJKA 3QSTA 3IJDA 2XH7A 2XIQA 3GXNA 2ZUVA 4Q4MA 2PDJA 3OIXA 4NZJA 4YU1A 3ZSTA 3K8KA 3R8RA 3CZGA 5HK4A 4LAOA 3WNKA 4DYJA 3I6EA 3OIHA 1J10A 5D04C 2JGQA 3KACA 1EX5A 3PRAA 2C16A 2PWFA 1N8WA 5H1WA 2FDSA 1KTBA 3TTEA 3II1A 4WKHA 4OU1A 4IPLA 4DAFA 3TYZA 2D0HA 3BGAA 3WH7A 1L6WA 3D6NA 4W8LA 4AWUA 4UFMA 4YTRA 4JY8A 5C2GA 3G3MA 4KEVA 3W1NA 4Z2LA 4ZVJA 3TCZA 3W70A 2I17A 4XO6A 3NL3A 3LHUA 2DSZA 3JW7A 1VBUA 5D02A 2G5WA 1JR1A 1FX6A 3KOYA 1OINA 4QE5A 1V02A 1WPCA 2OSWA 2WNQA 1LTDA 1VYPX 2WLZA 4Y6GA 2WNZA 1G1YA 2Q6ZA 2QCEA 3HU7A 2X1RA 1Z9AA 3C2VA 3I4EA 4UFJA 2PRLA 1EP3A 3G1FA 1H09A 1LCOA 4PMOA 4XV0A 4AMCA 3OW1A 4A3YA 3WQOA 4IJCA 4TW6A 1GEQA 4AZGA 1UC4A 3CMGA 3N3MA 4W87A 2NSXA 4KFOA 3STFA 3H2MA 4ZO8A 1W31A 5CZSA 3CIVA 1ZHAA 3OHIA 4JFKA 1TVNA 3LRMA 4MG4A 3GG8A 1T8QA 3TKFA 2J9XA 1WDWA 5D9NA 4HHLA 3S2CA 3GK0A 2PD9A 4FN2A 4M7TA 3W7IA 2ZKMX 1P5QA 2F6XA 4TMBA 4XAZA 1TQXA 1UWIA 1UR8A 4BA0A 5HJLA 1E4MM 2JZVA 3TZFA 4GVGA 7A3HA 3OZOA 3LCXA 2XN2A 2D9FA 3ZJ8A 3WUGA 1UP3A 2GOKA 2VOMA 3FCPA 2EKGA 2Q09A 1TRDA 3OGSA 4DUWA 4YHEA 3BMXA 1R7OA 3ELFA 4K1GA 3M1ZA 2OLSA 2GK1B 1FWEC 3W2UA 3TROA 1W8SA 1HJVA 3MHFA 1LROA 3EA1A 4X9YA 4RJEA 1Q6UA 3GS6A 1RD6A 1XIGA 2HE8A 3S1GA 4PCNA 4AMAA 4JCLA 1DXFA 2ANUA 2BVYA 2VFDA 4C1NB 4C6EA 5A6SA 4HCDA 5LIKX 1MUMA 1DTNA 4BWLA 1F73A 1YE4A 4MZ8A 4C6LA 2I56A 2PZNA 4A8IA 4S23A 3OYZA 2ZUMA 5J5RA 1AW1A 2BOFX 2B7QA 4HNNA 2FZNA 3G0XA 4W9QA 4PMNA 5EU9A 3ENLA 4AQLA 3SRHA 4HTYA 4GQRA 2RKXA 5D30A 3B8DA 3NL5A 2G4FA 2ISDA 3OHMB 3VE9A 3TC3A 5HT1A 3BMBA 1K9EA 1J96A 3PS7A 4MDPA 2YLAA 1V03A 1FWNA 1F74A 1HKJA 4RK8A 3C2FA 1KFCA 4GWEA 1BWVA 3NSXA 3NL2A 3S2MA 3R1ZA 3E12A 3PF3A 4LUSA 2VC7A 1E40A 4L1XA 4D8ZA 1JCXA 4Y8EA 6PTDA 3FLUA 5D03A 3QR0A 5T26A 1FKFA 4MWAA 1B9BA 2VX4A 2AWGA 5JXQA 3OG2A 4GI4A 3EA3A 2GVJA 2ZQSA 3V35A 1UPPA 2FKPA 3JZEA 4QLKA 4ASTA 3THDA 3VOGA 2TRSA 1JNSA 4UTLA 4QBXA 4AZ6A 1EQCA 1FWCC 3LMZA 2ZA1A 2Y5JA 4XAYA 1OCQA 1OZMA 1C7TA 1ICSA 5LHFA 3W37A 4POCA 1RAKA 2WVVB 3VD7A 4F40A 4P7QA 5FJPA 3VD5A 1CXFA 4R5EA 2GK1A 3A4JA 1W54A 4KKXA 1OC5A 3VIFA 3GSMA 1FWIC 1MW3A 3K5XA 3CMFA 1EGMA 2GVLA 3NO3A 5G1YA 4M3PA 1CGTA 2HJPA 3GG0A 3E9AA 4P8WA 4E3VA 3B05A 4Z2HA 3Q67A 1IWAA 4LY4A 1IQ8A 4ROQA 4K38A 3WK1A 4C1NA 5DCDA 4JTSA 1CWYA 4L1GA 5C9WA 1GJUA 3KOXA 1XRFA 3G1AA 4O54A 5GNYA 3PJXA 7REQA 4Q7NA 4U33A 4C6FA 3IUDA 3M0JA 2EG7A 2OZ8A 4IMCA 3MKCA 4H3DA 3BURA 4L5ZA 1PAMA 4QEHA 3BAWA 2P3EA 4OWGA 3AWNA 4HNUA 1JZ3A 4GH1A 3VGFA 3A21A 1S46A 4NAEA 1GOWA 4ML9A 1D6OA 1V6VA 2DVTA 2Q8XA 3N11A 3B8IA 1V3IA 4O8AA 2VC5A 1H3GA 4C5YA 3A6OA 4H6KA 3OLEA 2BP1A 2POTA 4NQ1A 3FAWA 1ZALA 1N2VA 2ZUTA 4AHOA 1V51A 2J7GA 4MMWA 4M1BA 5DBUA 4U31A 2RH9A 2DVXA 4I90A 3TTYA 2QF8A 3BUVA 3EB3A 4XZMX 4XD5A 4US5D 1FKRA 1Q6CA 3O05A 4D6GA 1GZJA 4JTRA 4E8GA 1ITUA 4UTKA 1FKKA 5GPRA 4AD2A 2QNEA 3VX1A 1Q2RA 1VQTA 3DFOA 3H6OA 4LAVA 1C90A 1KM4A 1JULA 1K7EA 4HYWA 1SR9A 3PZOA 4PCSA 5AYBA 2PD5A 5CAKA 4ZOEA 4L1WA 1BRLA 3AIRA 2DUAA 2AL2B 4AZBA 3VXGA 2PV3A 1B3YA 3L4XA 4EKJA 3MQTA 1M7PA 2O92A 4IMFA 3GHUA 3E0FA 2WVVA 3P2VA 2CERA 2PDWA 3L2MA 3Q65A 4DRMA 2QHAA 4EX4A 1G5AA 2QJNA 4EF9A 3WL1A 1US2A 4JTHA 4XD6A 1LBMA 5J8LA 3NPXA 4OIFA 1H7PA 3CPRA 2IKHA 4ODMA 3MMDA 4F0SA 3ODKA 2JBMA 3BW2A 2PA6A 3TOPA 1BG9A 3SCSA 4Y9NA 3DECA 2EEXA 3O16A 3ZFHA 3R58A 4GACA 3RPTA 4CLMA 4YXGA 4CNPA 3FA4A 1IWPA 1GQIA 5F4SA 4S38A 3GG7A 1XLHA 3LCWA 2PDCA 3ZVHB 1TMHA 2BXVA 3MCOA 2E4TA 3BV7A 4CD5A 3G77A 2XP5A 2FTWA 5CJNA 3M64A 3WLPA 2UZ5A 4LYQA 4WX2A 3KP0A 4J3TA 1OVDA 4NNBA 4D8LA 3RXZA 1ZJIA 2FPYA 3VUSA 3K8MA 1TWSA 1Q6IA 2QCMA 4KGJA 4QQ3A 4FNRA 1DORA 1NOWA 2QV4A 5FEZA 1ONRA 1JZ4A 2V5LA 3C2RA 4GG9A 4DVOA 3U2OA 4GYFA 3K1DA 4PBFA 2ZUWA 2YYUA 5HATA 1KQZA 2VCBA 3CWOX 3HIJA 4MGGA 2E6FA 3JU2A 4AXNA 3K46A 3L2LA 5AHNA 2YX0A 4IP4A 5D9OA 1OFQA 2DORA 3MSRA 3UP8A 3H9RB 4WJEA 1IWBA 1E6ZA 3E0WA 3BPWA 3G1SA 3RFAA 2BY2A 3S9IA 4QNWA 1TR9A 1VD6A 3G1DA 2X41A 4M6UA 5LYRA 3BLEA 4IZGA 1GPFA 1DQXA 1XDMA 2OPJA 4UTIA 3DG7A 2OCZA 2V5JA 1NFPA 2YCKX 4HPXA 4WF7A 4PN2A 1JQXA 1TWZA 2F2HA 3PTMA 2F6KA 2B7OA 3WBEA 1PZ3A 1EWDA 4HNCA 4RDVA 3UYCA 2PLMA 2QJHA 4DIPA 3NOEA 3JYJA 1LOSA 1T41A 1QPKA 3WQ5A 4O53A 2D22A 1TJ1A 1H7RA 2J4GA 4Q8MA 4G8TA 2A3BA 4MFEA 1Q5MA 4K1WA 3LBMA 1YYAA 2VQUA 3DCPA 3LUTA 4HIBA 4HOZA 1BD0A 4A35A 3OBKA 1TCMA 3W6MA 2XPKA 3B8WA 3KHJA 4ZXOA 5KINA 3MSDA 1Z69A 4RE4A 3ZOAA 1HVQA 3ZVHA 1O6IA 4TX8A 4JHMA 1H4PA 4K36A 1KT1A 1UC5A 3ZXWA 3VDAA 2X1TA 1YX1A 3BLFA 3L4ZA 4KIEA 1XLFA 8XIAA 2A3EA 3LX9A 3BSHA 2NSOA 3QY7A 4MSPA 1ECEA 3VILA 3N9SA 3TNBA 3VMPA 2FAPA 4DBSA 4XWUA 3QM3A 5M5DA 2R8WA 4PMZA 2NW0A 1JDCA 1GGOA 3FGCB 2WSPA 4JTUA 3MKKA 2DH3A 2QGYA 3WNMA 5LXEA 1QK0A 1RVGA 3HB9A 1ZCOA 4W5ZA 1DIKA 4MF4A 4MADA 1AH3A 1FQ0A 3A47A 1RSCA 2C7FA 4QDWA 2YA2A 3CTTA 3U48A 1AVAA 4DLMA 3M16A 3NPWA 1XKJA 1AQ0A 2O55A 1V08A 4JYSA 2YOCA 4M24A 2YL5A 3GH4A 4NIRA 4MGVA 4K68A 3GDRA 4L9ZA 4Y9OA 3CHVA 3FN9A 1U30A 4NJHA 2PE4A 1CX9A 5BYWA 1UP0A 4C6QA 3TMQA 3LCIA 1IIHA 5CLWA 3CO8A 3EDKA 1HIZA 4D8AA 4F0HA 2EG6A 4RDZA 1KXVA 4EACA 4LAUA 5A8QA 4MY8A 3GHSA 5AVNA 5C0QA 1AFSA 3QMRA 2NQLA 2NX9A 3W1AA 2KAUC 3VM7A 4LV9A 5XIAA 3HG3A 2MLZA 2QF7A 5DX7A 1QPLA 2VEFA 1JYVA 4LALA 3FK4A 1E56A 1TTJA 2PDXA 1EJ7L 3P74A 3TONA 1XLDA 4AY8A 3T42A 5I23A 1HJQA 3KTCA 1EA9C 3PP7A 3M4HA 4LF2A 1Z8AA 3SCTA 2WZHA 2ZUSA 3RPDA 4NRRA 3M9YA 4XB3A 4RE2A 3W72A 2VDIA 2OG9A 1YPIA 2A7PA 1F76A 4OBSA 2WMKA 4QR6A 5DO8A 3DGBA 3UW6A 2VYOA 1KXTA 2OX1A 1DJXA 4HK5A 3WLQA 4RNIA 1PZ0A 3W7KA 4XZWA 1BLIA 3Q45A 4ZODA 3VNIA 2GZXA 4JICA 1OYAA 1V7AA 4Q3MA 1TV3A 1RALA 1UA3A 4IF2A 3DKJA 2D1ZA 3UJEA 3NQMA 5EGRA 1E6XM 2R1NA 2XIOA 5CQ1A 4B15A 1PKYA 1OFOA 1XINA 3EMQA 4HCLA 4UMBA 1A5KC 3VCCA 1KFJA 2D0GA 2CZFA 4FAMA 3DI1A 2MLYA 3BLDA 1DL3A 1EX1A 2PDYA 4N02A 4HOWA 3G8RA 1Q6EA 4LVDA 3MJYA 3EWYA 4AX7A 4NZ5A 3N6HA 4HHHA 2VCDA 4U5KA 2M08A 3CAQA 3PZQA 2WVUA 1L8PA 2LLEA 3WK3A 3PB2A 2EAWA 4R27A 4L80A 4O13A 4KRTA 3KVLA 3QTGA 5M03A 3CZLA 2HK1A 2PWVA 2YJQA 1NP0A 1Q66A 4PL2A 3GC2A 3SY8A 3U9IA 4Y8FA 5CPMA 1UKPA 3OP2A 2HTMA 1HFBA 1EHNA 3UWQA 4ERAA 3L4YA 2VUNA 3LRKA 1C9WA 3VKCA 1VP5A 4IPIA 4ZSTA 3NUKA 3N18A 4M56A 8A3HA 1ZJHA 2QCNA 1N7KA 1XSKA 3HO8A 2JFEX 5LXXA 5AB3A 2DY3A 4TW7A 4QITA 1JRBA 4UTMA 1TV2A 1FKHA 3ZZ1A 1K03A 3M47A 2EHHA 4GRSA 1SFLA 2ZTJA 4XX6A 3OEXA 3GXDA 5CKSA 4FXJA 2GJPA 3KS6A 2HBVA 1SPQA 1IEQA 3THAA 3VGDA 2Y5SA 2VDHA 2WJZA 1YNYA 4DM2A 4GYPA 5HNUA 5C7HA 1XW8A 1TJ0A 1YNQA 1DOSA 4DWSD 1LUCB 1UJQA 1Q6QA 1E72M 2YL6A 2IW0A 4HZ6A 3M44A 3BGJA 1GZGA 1SO5A 2CLOA 1N8IA 3AICA 2KZHA 4PGLA 5B7YA 2J8TA 3AXKA 1AJ0A 4KWSA 4ODOA 4PEKA 3B7XA 1Q85A 5CSUA 1T40A 3MVTA 3PPFA 1UMYA 4AHQA 2ISWA 2YBUA 2OGYA 4Z2KA 3IJQA 1QWGA 4LVFA 4MPQA 3H8AA 2QVHA 1UWAA 3ABRA 4W84A 3UPBA 2ZWYA 3KDNA 3TN5A 2QPSA 1DE6A 5C2CA 1TQJA 3OZYA 4JPGA 4LVGA 1RBAA 3SECA 3DN5A 4XZ9A 3F5LA 3QPYA 3FJNA 1MZRA 2A2IA 5J6EA 4Q4QA 3SSZA 3WH0A 4FR1A 1V3KA 3GXIA 1JAKA 2QAFA 4N9CA 4C5ZA 3AU6A 1U1UA 4JQAA 3FYOA 1V77A 2GGEA 4MTVA 1OFDA 5D32A 1N55A 2DVUA 4LCQA 3SEPA 4HMCA 1XM3A 2WZTA 1Z41A 3S9YA 2JIEA 3TDBA 3WDHA 2PDQA 4IGSA 4M6VA 4IP5A 5DELA 4PTDA 2X0SA 1S1PA 1WV2A 4UTUA 4CN1A 4DBUA 1R87A 1WKDA 3MC5A 3W84A 3FYPA 4US5A 4DYEA 3L21A 1TE1A 1ECQA 3ABQA 5HMDA 1LOQA 1O5RA 2WKLA 5FIPA 3M6YA 2YDSA 3AIBA 1KWGA 4Y96A 4MIMA 4MOZA 7CGTA 2OYMA 4R3UA 2YL8A 3HG4A 2DIJA 4JEJA 1D7FA 3R10A 3TDFA 4JAWA 5HQMA 1QZ2A 3VIHA 3KBWA 1JG9A 2BXYA 1W32A 2IQ0A 1UZHA 1X6LA 2OFJA 1Q6DA 4YTUA 3VGGA 3SCOA 3WG6A 2Y7EA 1LUCA 2C71A 1S3HA 4EXAA 3DFHA 2IXUA 3DH7A 4UNLA 1Q6RA 4WJ8A 3E1F1 4NYYA 1L6FA 2YL9A 3H53A 3MS8A 3VDBA 3WENA 3N2OA 2J7EA 1RHCA 1SO4A 3H2EA 3NQBA 5I3JA 4BF8A 1W26A 4I7UA 3AUJA 5K9CA 4QISA 1ZS2A 2ICSA 1HF6A 4KH2A 3AHYA 3WQDA 3HM7A 4U85A 2EJ1A 1XGEA 4A8RA 1BEUA 5GJNA 2C0AA 3VMNA 2BX7A 1Z44A 2WHJA 3OA5A 4MY9A 4QP0A 1G6CA 1ZQ5A 1E5JA 3ES7A 5J04A 4YCOA 1DXEA 2AAMA 2NV2A 4I6VA 3PAOA 1SFTA 1ME9A 2I7GA 2PDHA 4RDWA 3VIIA 4DJFC 4WOQA 2ZQTA 2ZDRA 2V82A 3UGRA 5JH8A 1UUOA 4GJJA 3MU7A 4IOTA 1YATA 3MYOA 2E67A 4KCUA 3UZYA 3FXYA 1E4NA 1W2VA 3FAXA 2CESA 1JJKA 2SFPA 3KX6A 4P7RA 3VNMA 4U84A 1FCQA 2I16A 1MUCA 3I6RA 1D3GA 2ZZ4A 4M6QA 4O10A 4Q4OA 3QHMA 4Z0SA 1NF7A 3C2YA 4ZFCA 3W53A 2PDGA 2VX5A 2YZ5A 3BOLA 2Y8VA 3H7RA 1EGVA 1DWFM 2C14A 2XP6A 3D0CA 4J7RA 3LB0A 3O5KA 5D2WA 3KWSA 3J7HA 3LXAA 4HYRA 1H1YA 4EK7A 1QBAA 4K37A 4G1NA 3FDGA 3INPA 3W24A 1B6CA 1QR7A 4TX9A 1FFQA 2GUUA 3MUCA 3TK7A 1KM2A 1PIFA 1TZZA 2J47A 1EUNA 2P0OA 3QY6A 4ZZ9A 5I77A 3EZ4A 4U86A 3CHEA 3HF3A 2OYLA 1PEZA 4LNYA 4DBWA 4PB5A 5G4EA 5H91A 4WUIA 3RLVA 3VX0A 5H8UA 2D2JA 3IVSA 2VCCA 2IPWA 1J4HA 2PPPA 5CAHA 2HWGA 1MNSA 3LSBA 1AD4A 3B9AA 3U5UA 2Z2AA 2NQJA 1L6YA 1JDAA 1DVJA 2V5DA 1EOMA 3W87A 1B3WA 4MKSA 4NZ4A 4DX3A 5C2XA 5LKYA 2J7CA 3NZ1A 4KERA 2X42A 4AW7A 4BI6A 4DELA 5F1UA 4FNPA 1U1HA 4UTTC 3IUIA 1TIMA 1R2SA 1P5BA 3M0LA 4J3WA 1VCGA 3NPUA 3ITLA 3Q94A 4AWTA 1E3XA 3T0DA 5HAOA 2EBNA 3PFMA 1UD3A 1XF0A 3B9OA 3ITGA 1AQMA 1IT0A 2WMFA 3BQ6A 3QFEA 3DUGA 5AC5A 1TUXA 3ONBA 5I3KA 1MVYA 2VOTA 1H7WA 1QOQA 3D47A 4CCZA 1P1XA 3S1UA 1VHNA 5BXRA 2ZX5A 1A53A 3P93A 2XTKA 2HNEA 4FI4A 4JFVA 3T9PA 1XHGA 1BWKA 2Z0IA 1Y0OA 4P7OA 1GWJA 2FLIA 5I03A 3CUFA 3N1AA 3IK8A 3LLFA 2C15A 3SGGA 1UBSA 5IXEA 3A4AA 4AVNA 2DZTA 2AKZA 1E1FA 3KEHA 2PV2A 1UW9A 2GUBA 3WH9A 4EAYA 1R3RA 2XFWA 3EDJA 1VPXA 1FWJC 4J3SA 2DZSA 3HTWA 4HKPA 1X1NA 2PURA 4I9TA 1JNDA 3LN3A 2BY0A 3WNOA 1F61A 1RV8A 3QBUA 4G50A 3N15A 1A5AA 3W25A 4HARA 1XLEA 4NJGA 1EJVC 4NJJA 3KAFA 4X3ZA 4DQWA 1FHLA 3AOFA 1E4LA 2WZMA 3BMVA 1J6PA 1F4HA 3PBVA 3IGXA 3LZ5A 1OG6A 2X16A 4AXKA 4EE9A 1Q4WA 3QKZA 2YLLA 3D5HA 1TG7A 4GMEA 3ME3A 2E5BA 3GUWA 4WEVX 3F5KA 3O6YX 2GUYA 5ABFB 1UH2A 1RR2A 3O5FA 5E6YA 3CB8A 2QQ6A 5A1AA 4IMAA 4ZTYA 2PTZA 3CL6A 4JQ4A 4LJ3A 4WSKA 1R3WA 4GI6A 5HINA 2X8RA 1ONXA 5M17A 3U7VA 4U2YA 3BCDA 4UNKA 2GDVA 4ATWA 4QG9A 3T05A 4QTGA 4DI8A 3G6LA 1S2TA 2R24A 2Y7DA 5E9AA 1YBQB 1A5CA 3N9RA 1V79A 4UFIA 1YIXA 3IJ8A 5A2CA 3MMWA 1K8ZA 5HUPA 1YQ2A 2A3HA 2RDXA 3A5VA 3VZZA 1BSLA 3AIUA 3RCMA 4GISA 1CXIA 4MJMA 2Y85A 4O11A 1M7JA 4ZB5A 1XCFA 1Q7QA 2VX7A 2Z7KA 3LU2A 1EEPA 2W63A 5E93A 2E6AA 2J9ZA 3UYIA 1G9HA 3W7DA 4BR1A 3IJ9A 5F2IA 4QG6A 1X7FA 4DB7A 5KEZA 4V2XA 4M0XA 3M0HA 1KCLA 4D71A 2ACSA 1TKKA 5C8BB 3BG3A 4OV4A 3CH9A 4W9TA 1GQNA 2HISA 4AU0A 4WK9A 5TAOA 4CNNA 3UPMA 2E0PA 5EMJA 5E0KA 4I5RA 2C1GA 3OBAA 1RK6A 4TVUA 4DJED 3M0IA 2OU4A 2XZ7A 2INZA 3E38A 1XWYA 4FPSA 2GSJA 4MFDA 4G6CA 5I5RA 2VZOA 2PTWA 4M19A 3NPVA 3M5ZA 4LAYA 4PTVA 1Q3NA 3ANUA 2ZTKA 4F0KA 4K2SA 3VMOA 3CHDA 5FL1A 4XKYA 5ABFA 2A3AA 1P7TA 2CBVA 1HJSA 2OLAA 2EGZA 3GTNA 3BAIA 1QNSA 3SUUA 3PVFA 4WJXA 1X1ZA 1C7SA 4NAFB 2X7WA 2PCQA 5BXJA 3N34A 2PUZA 2CWXA 2FQIA 4O2TA 3CZKA 4QIUA 3VNYA 3BLLA 3P8IA 1KBIA 5KITA 4LT9A 3M0MA 3UETA 4TR9A 1DQWA 3S2JA 2X1SA 1OYBA 5CZKA 3ARZA 4DWSA 1JCMP 1EDTA 1MRAA 3O5GA 3G1XA 4DUOA 4O12A 3S1WA 2PTDA 1GHSA 4GCXA 3HQOA 1EO5A 2NUXA 3OO2A 4X2PA 1O4UA 4UZUA 3NDOA 2UY5A 4W9PA 1QNPA 3MMUA 1E71M 2CLPA 1RQBA 1A7XA 5HR7A 3AIVA 1I1WA 1PDZA 5G2HA 2Y1HA 1I4NA 1LZOA 4NP7A 5CPTA 5T9BG 1XIFA 3BLKA 4M5PA 2YBTA 4ICMA 3GU1A 1FKXA 4K3ZA 1XI3A 4BKNA 1K6AA 3F1QA 1R3VA 1P0EA 3DHPA 5F2LA 4HPHA 3JZUA 3MO4A 5CGTA 1B1YA 4LC8A 3GKAA 1LL4A 4GH3A 3SBFA 3UU0A 1I1XA 1KA9F 3BOXA 3FYYA 5EBAA 5DY3A 3CT2A 1U33A 1W0MA 3G2GA 3VNDA 3H24A 1ME8A 3OBEA 1BTMA 1VJSA 1TPB1 3PSWA 2PWDA 3U4FA 2YA1A 4F66A 2ZX9A 3ONCA 6ALDA 2LPVA 2NV9A 1O5KA 5FEPA 3V1HA 4WXZA 1ISVA 5SWUA 4B90A 4HCHA 4AD3A 5ABHA 3S46A 5K4ZA 4XBJA 3BXWA 4AZIA 5PTDA 1XH0A 4EXBA 3BJFA 1B3ZA 3LG3A 2AGTA 4NAFA 4M80A 2PAJA 2RDWA 5D75A 3S83A 3H2FA 6XIAA 3VUPA 4YTTA 4IMEA 4H9XA 2ADAA 5E0FA 1J4EA 4CD4A 2JEQA 2OFNA 2VNCA 1FKGA 4Z1YA 3R89A 3NQ8A 3R8HA 1UUQA 1U5HA 2ACUA 2QULA 1L8NA 3THUA 3UR7A 3CYVA 4DAIA 5HWMA 2Z25A 2AQOA 3SIMA 4XAKA 2P10A 3HQ1A 3S6DA 4EPKA 3TUUA 1NFBA 1R47A 3ALGA 3IIPA 4B3LA 2XUCA 4YIWA 2CZVA 3W4RA 1RBLA 3WQCA 2PWEA 1HVXA 1OZQA 3FNDA 3LHVA 4H9ZA 2YKKA 3R0DA 1H61A 3PPCA 1U5JA 4JIQA 1JPHA 3O5JA 4HMEA 4L4OA 1VCFA 3D3AA 4XUGA 2VCAA 3KLKA 4HZMA 3EWCA 5DF0A 1K70A 4L6DA 3W23A 3PSVA 1O5QA 3KBMA 4QAWA 1GYMA 1TFVA 5BWAA 1JUKA 3BSMA 1A3XA 3QYSA 4J35A 1LYXA 3GVWA 1W9UA 1WZAA 4TQTA 4H9YA 5FL0A 2TMDA 2WYSA 1ZY9A 5IOBA 1UP2A 2QDDA 3O6DA 4M7SA 4PODA 2VGGA 4A3UA 3GFYA 4GE8A 5CPSA 4Q6JA 3CIWA 4L4MA 2BTMA 1GT8A 4ZCWA 1S1RA 1X96A 5KZEA 1UD2A 4PH6A 5D2XA 1F05A 3IPWA 3C0QA 1Q2SA 4P8XA 1NF0A 2Q02A 1RQHA 1U22A 4L56A 2ISFA 4CVUA 4WHBA 5C6MA 2GPTA 3OODA 4QE4A 2A6LA 1PJ9A 5DITA 3PNZA 1JFHA 2FGLA 1NTHA 4UTJA 1V5XA 3VZXA 3S9ZA 2INEA 2Z7GA 1VFTA 2L2SA 2O7QA 1DWJM 5G1TA 4AY1A 3POCA 3T07A 2VUYA 1QHOA 3ARTA 1SSGA 2CHRA 4NUWA 5HDRA 3L2IA 4MAVA 2CLLA 1VJIA 5HMFA 2DZVA 3OOQA 2VR5A 2VXNA 3CTLA 3TN3A 4GBDA 2JKAA 3SJ3A 2DZAA 4ZPWR 3M5YA 5E09A 3C2OA 1W3IA 4KBXA 4UTFA 1UYQA 4C6CA 5HOSA 4S3AA 3O6AA 5I2UA 3NNTA 3EWBX 3CB3A 5IBXA 1GHRA 4ATDA 4XIMA 5AY7A 1ZSXA 1WXZA 2FZBA 3EDEA 2B5UB 1OCBA 5A6TC 3MBDA 2PRHA 4JXCA 3CQHA 3NDZA 1MFUA 4Y9AA 3KADA 1AMYA 2G50A 2WO5A 1D9EA 1Q6GA 1XGZA 1A3WA 4NKCA 1S5MA 1US0A 3S5SA 5AYIA 2WM0A 1I8JA 1NP2A 2DG4A 3C3NA 4JIEA 1DTUA 4B5UA 4H2HA 1C8XA 2INFA 5IFTA 3BANA 5TF0A 1YRRA 1XSIA 4GPNA 2WPGA 2V30A 5CH9A 4H19A 1MRQA 4DZAA 3WF4A 4DJFD 2RUCA 1F5ZA 3KBJA 3B0PA 4U5IA 4Z08A 3LUOA 3WQEA 4JTLA 3ARUA 3A3XA 4S3DA 2GGIA 2JIWA 1Q6OA 5DEZA 3HGJA 4NI3A 2CZDA 4H8HA 5CXPA 3NQ6A 1AZ2A 2O9PA 3BCFA 2MLXA 3LHYA 2V69A 1UCWA 1IIGA 2V5BA 2VM8A 1VF8A 3GO2A 3DC8A 1W1VA 4FEZA 3ECQA 1QPFA 1SO6A 4ZPVR 3GHTA 5T91A 3APYA 4M1RA 3O1NA 1A50A 3TVAA 3LHTA 4W7UA 2XP9A 2NVCA 3M6DA 4B91A 2RUQA 1CNVA 1BF6A 3U2CA 1QVBA 5BNKA 1BQCA 2BFGA 3ZR6A 1A5NC 2TODA 3G3DA 4CNUA 3MDUA 5FACA 4L61A 4WVXA 3B0XA 3TQPA 3GU2A 3B4YA 4B16A 3F2DA 1ISYA 3W82A 1L9WA 2V8ZA 1UOZA 1IEIA 1HX0A 3QLDA 3LPOA 1V3LA 1F6KA 1MQQA 1JCJA 4C6OA 4G9PA 5A8NA 3AIQA 2BS9A 2VURA 4J27A 5EY5A 1HKIA 1F3TA 3AI0A 4I9JA 3DEQA 4JFUA 1AZ1A 1GUVA 3FS2A 2TPSA 1JYNA 4BEQA 1N8FA 1BL4A 3D3FA 2C13A 1Z32X 2KGJA 1XFBA 4UFKA 5HWJA 2RDTA 4UXDA 4IJBA 4CVWA 3W6LA 4J5NA 4IFRA 1GNXA 1WUFA 3QV7A 1LT7A 3TU9A 1IXQA 2DT0A 2O9OA 3NGJA 3WD3A 3WH5A 4IQJA 3L23A 3WD0A 1SFSA 3GZ3A 3ZO9A 3KAHA 3B9NA 4J28A 1GOQA 1QXLA 3NZRA 1KWKA 1O1HA 3M7SA 3V75A 3UY8A 1DJZA 5CC3A 3TC5A 4DZ3A 5HQLA 2WSRA 2VT0A 3SY1A 3ERPA 4ZE5A 4RZBA 2HZGA 3T1GA 4LNCA 3PPGA 3QR3A 4O1DA 5BXSA 1CB7B 4BI7A 3R12A 2HEJA 3KOFA 3LPPA 1U83A 4JFMA 1ZU8A 1L0PA 4UCFA 2V63A 1UHVA 4DZ2A 1FTXA 5FKYA 3SCNA 3E02A 1S2UA 4J3UA 3H4WA 1LJYA 4DM1A 5KTLA 4NYUA 3O06A 3ABSA 2E6YA 4JQ2A 1ZAHA 2R1MA 4Z17A 1W3JA 1P0KA 1RY8A 4QJ4B 4LUTB 1B31A 1UROA 3PBGA 4ZQRA 5GJMA 3W71A 3W6YA 1OX4B 2E9BA 3AYSA 1H63A 3PG9A 3LXBA 3TWAA 3VGHA 1WOBA 4B3ZA 2HMCA 1MW2A 6TAAA 4DJEA 1PHWA 4TV5A 3NI6A 3ATZA 5D2TA 3H4GA 4I9MA 4LC6A 1KCXA 3W1LA 1UA7A 4YYFA 2QW5A 1UIOA 2YB1A 3PN8A 4QCEA 2WJFA 1E1CA 2G37A 3FVDA 2P8BA 4QGCA 3MP5A 4KFNA 3VGEA 3WQGA 3P7YA 4D6CA 4IQ2A 3ZJ7A 4H7VA 2VZVA 3TX9A 3EMCA 4LU0A 1VFMA 5CZTA 1WAWA 2R1LA 2J75A 3BG5A 3P3BA 4JDBA 3LBOA 5C55A 4WXYA 3H54A 2FGZA 5E70A 1B3XA 1AK5A 3L5MA 5JVLA 4H8NA 1VHCA 3TJXA 3KXQA 3CJPA 1H49A 3H26A 4PMYA 8RUCA 5H8MA 3HFTA 1UR3M 2D73A 2DFAA 2QLYA 3LCFA 3L0NA 4UQBA 3VINA 4DT4A 3BL3A 4W86A 5HW7A 1QRQA 4JIPA 2RGMA 3SFKA 3NA8A 5FF2A 4IL2A 1Q8JA 1ZBKA 4FLQA 1JIBA 3FHQA 4GLEA 3UJSA 3KCEA 2QCFA 3DENA 1EC8A 1AJZA 5EMLA 3BCJA 4JTGA 1JCLA 3SQLA 2W62A 4QZVB 3ZLHA 1V0KA 2A5HA 3RM4A 1PE1A 2ZIDA 4JTAA 3MUZ1 4WGHA 2DU2A 1KFEA 2DUXA 4A3QA 3CV7A 2X2YA 1FWWA 1VENA 4NRSA 1CGUA 1VGAA 1HT6A 5D33A 4B5WA 4PRWA 3AWOA 1KR0A 5CLTA 1ZLPA 3NSNA 4ZO6A 2WHLA 1PZ1A 4LUTA 1SW3A 1ODUA 1I2RA 2D2OA 4JN8A 1QU4A 1QI4A 3LLXA 4XD4A 5AN7A 4W89A 1CLKA 3T8QA 1BYAA 2WQPA 4IGHA 2X05A 4WY0B 1NMWA 1ALDA 3WDQA 1P0BA 2FVKA 5EMMA 3HN3A 2VKZG 1OSEA 1TV7A 1OM0A 4IIEA 4HJWA 2IMRA 1QCWA 4DRKA 4LCSA 3VKKA 1OGSA 3PM6A 1UQYA 1KV8A 4LVAA 1DJYA 3BLIA 2DT2A 4AVFA 3PBUA 2IPFA 3CO4A 1FWHC 1PKMA 3GVGA 1QI3A 2CW6A 5HPCA 3O8AA 1I2NA 3LI0A 4AFYA 3I3BA 5BOFA 3B03A 1HKVA 4V33A 3W22A 3QF0A 3AXIA 3IJ6A 4J4KA 3ZT5A 3HJZA 4LF1A 3ITTA 3B8TA 3VNLA 4EAMA 1EIXA 4HNVA 3BJSA 1KXQA 1O68A 3RGTA 1E0UA 1FXPA 1OGBA 4IIHA 4ODRA 2YZRA 1EZWA 4O4VA 3S5ZA 4A22A 3AS1A 1TTQA 3EXSA 3G1RA 3HV9A 3OJGA 1GG1A 3UI4A 2O56A 5MF5A 4GQ0A 3A12A 4Y2WA 3G5EA 4EANA 2E8YA 4YTSA 5BRBA 3B97A 1HG3A 3LOTA 3PWIA 3A4WA 1D7KA 2CHNA 2OLHA 3OZPA 3DKLA 5ECUA 3REQB 3URQA 4MAZA 1EDQA 1I60A 1VFUA 2AOSA 3QR1A 1GZ1A 2W9MA 1GOOA 1ZENA 5HW6A 1HGWA 3EWDA 4Z2GA 2DH2A 8CGTA 2NX3A 2JGYA 3V18A 5C9ZA 4GFSA 3TN4A 2REQA 3QH2A 5D8WA 4RPQA 5G5IA 3C61A 1VBJA 5CEWA 1VFHA 1K9DA 3DIPA 1MDRA 1HTIA 1M41A 3QVQA 1G7VA 1C29A 3NXLA 3ID7A 2CLEA 4MJZA 4WY0A 2QS8A 3KE0A 2VMFA 7PTDA 3IK4A 5A6JA 3SCRA 4HA0A 3TNOA 6ENLA 1Q7MA 5RUBA 3ZLGA 1XC6A 3S8HA 4J3VA 1BYDA 2RAGA 4O1AA 2BVTA 1UBPC 3QZAA 2VEIA 4U2ZA 4FK9A 4ES4A 4LRTA 4N4PA 1XYLA 3QGAC 3G0SA 4EWJA 3FEQA 5CZ0A 4DRSA 4XTDA 5LNVA 1R86A 1XQKA 2A4AA 4JFSA 1Y7VA 3QHOA 3TN6A 2R1PA 3K1GA 2CU0A 4HK6A 2NT0A 2CLIA 5G4WA 1GVOA 5CC6A 3BG9A 2G3JA 3HG5A 3GLCA 3ARVA 4IX2A 2AAAA 1F8AB 2ZQVA 4P7NA 4BZYA 4Z1AA 2GSEA 1DJWA 4KEZA 3QEZA 4ACZA 1GKQA 4DY1A 3GRIA 4QLJA 3OTRA 4Q4SA 4Q7IA 4R88A 4YTQA 4UTHA 4FX8A 4DJDD 5HJYA 3BW4A 4XAGA 1EJSC 4IXXA 2PTXA 4JKMA 5CBIA 3QRHA 1UB3A 3O3RA 1VLIA 2JQXA 3KTSA 3WF3A 1WNOA 1VB9A 4PCFA 1REQB 3UERA 1MYRA 4AYGA 4KW2A 3N13A 2LGOA 5CBJA 3I7SA 2E8ZA 1G0CA 3CASA 9CGTA 5CBBA 3REQA 4QM1A 3M0XA 4TVDA 3MSYA 1RZMA 1UD6A 1FUYA 4HK7A 3R94A 2FVLA 4ZA0A 4DO7A 4WDXA 3DC0A 3T4CA 3LSCA 1E9IA 1ZJBA 1M5WA 3JR2A 3IGSA 4PB4A 3T7VA 3P84A 3KOWA 2P76A 3NO5A 2YSWA 4WCJA 1OFEA 3KP1A 3G6MA 3UG5A 3CV6A 3ZR4A 1MI3A 5A69A 2RHGA 1KV5A 3ATYA 3CUZA 1QPOA 1P48A 3RYSA 1PZ2A 3WMCA 3WF2A 3PA7A 1D8CA 4YWIA 4BCEA 2C0HA 1V6TA 1EEXA 2XH2A 1LDCA 3W2MA 3VCNA 3OVQA 1GVFA 1D3HA 1XBZA 1NWTA 1JGMA 3TTOA 2D2GA 1KGXA 3IV8A 2KE0A 5FJJA 1ZP4A 4JNZA 1DP0A 3TP4A 3M0YA 2G8ZA 2XDFA 1H7XA 3CYJA 4PUMA 1W1PA 3EWUA 5I3DA 2RDUA 5DMYA 2J77A 3H12A 1LF1A 1KXHA 1EA0A 5C5YA 1F6YA 4PUWA 3CLWA 4J9JA 1J6OA 3Q37A 3S47A 1EC7A 4HU3A 3ZR5A 1B5TA 3BMWA 1CLXA 4PUNA 4IPJA 3WKZA 4JKKA 1FKJA 2MF9A 1IV8A 4LEQA 2ZVRA 3O6CA 4AIOA 4AEOA 3FSUA 4X22A 4H00A 1KQYA 1XIEA 3U4AA 3QHNA 3T0TA 2OQLA 4DYKA 1W5OA 1REQA 2J9YA 3S42A 3UJ2A 1O1ZA 4GK8A 4A29A 4TUFA 4H1ZA 4GVFA 3P81A 1XCXA 4PYSA 4MLRA 3ZT7A 3F03K 3TCEA 3PTQA 2CPUA 4UUIA 4PTXA 1W5MA 2DUZA 2OVLA 2YCIX 3IVTA 1HW6A 2OR2A 2Q71A 4ZBCA 4J3XA 2R94A 1ZP3A 2YDAA 3CQ0A 3WMLA 1CGYA 1R3TA 2UWFA 2CBIA 3EMZA 3LD5A 2BV9A 4AEFA 2XN1A 3QV6A 4LVBA 1MUWA 4DROA 2FH8A 3AUOA 1BVNP 4PCTA 1U5VA 2Z4GA 4E3TA 2QIIA 2Z27A 5G1MA 2XYLA 4QIBA 3P80A 1TWWA 2B4GA 3VOFA 3UVIA 1F40A 3KBVA 4JR5A 3AISA 2GOUA 5HUOA 4S3CA 3WN6A 4GO8A 4LUJA 3WK0A 3O0FA 3R25A 5A6LA 3FJ6A 1X7IA 4IPNB 1WKYA 4HU0A 4MWAC 2Q5AA 1XLAA 3UG4A 2G3IA 2C19A 1F3EA 1TPVA 3SRKA 3C0SA 1X1OA 4WR3A 3B9DA 3UR2A 1J4RA 3MZ2A 1SZGA 2MANA 4S3KA 1N82A 2QV5A 1YW1A 2WOQA 1TPUA 3SUSA 4TX6A 4CEUC 3H70A 1AH0A 1H7OA 3OLIA 2EJAA 1PYFA 3R43A 1HQTA 4HU8A 2PDUA 2WXDM 3VFLA 1SJAA 4LQ1A 3GR7A 2WC3A 1NFGA 4S3GA 4I7WA 3NG3A 4AWSA 3SN4A 2JKPA 3M0VA 1DJQA 3SCPA 4ZB0A 4HYVA 4LUYA 1LORA 4FNUA 4JYDA 4UB9A 4XG1A 1YHTA 1XG3A 2XVKA 1J8VA 2PODA 4CNTA 3Q58A 3ICJA 3EEGA 2J62A 4PMUA 3NQ2A 1RP9A 1G7UA 4W9OA 1NU5A 4MNJA 2EPMX 1FFRA 2GYIA 3CH0A 3DXIA 1RVKA 2E25A 3NQCA 1OYCA 3SIZA 4B5NA 4NJIA 3QW4B 5C9XA 1JNEA 3TSBA 3W76A 1WZLA 1BVZA 2DSUA 3R0KA 4D1JA 2VZSA 1AODA 1J0KA 2PLKA 1Z6KA 1QNQA 3PUOA 3QFWA 5B80A 3SADA 4LB4A 1WDSA 3KDOA 1JXJA 4H7CA 1OB0A 2WM1A 3HGRA 3UQNA 5B8IC 2F9RA 2OO0A 4GIVA 2CXGA 2QJMA 4YN5A 2YXXA 3RN6A 2D3LA 3KRZA 5DFAA 1HKKA 1PPIA 3KCJA 2VTFA 2QR6A 4XZBA 3NEVA 2BGNE 1DV7A 3B8VA 1YDOA 4DEFA 4FNSA 4H9MA 2OX4A 1W9PA 1IXPA 2WVSA 2QDHA 3STEA 2TYSA 3WL0A 1W2PA 2VWTA 7XIMA 1TX0A 1YDNA 3WNLA 2EPOA 4U28A 3APTA 1SJDA 3WLLA 1UD8A 1JL8A 3RFWA 4UQ9A 3CQJA 5M2FX 4KFPA 1AQHA 1Q1CA 2OZTA 4F48A 1JPIA 3PBWA 4ML4A 1DE5A 1XYAA 4MYXA 1JZ6A 1CLVA 5LNWA 1VEOA 2NVDA 2QPXA 2ZXAA 4DPQA 1JUBA 3AHXA 5DXXA 6XIMA 3PZNA 1BPLB 2ZC8A 3EWWA 2R9RA 1RBOB 1AMKA 4MZ1A 2NLIA 3EDFA 4C6MA 3EX6A 1KRBC 2AGKA 2J79A 2ETNA 3PBYA 4LUSB 1GW9A 5H2ZA 3NYZA 3W7QA 3T44A 2WCSA 3PZMA 4O15A 2P0IA 4OHQA 3GYEA 4HPGA 1EGZA 1Z7AA 3AJXA 4H2CA 1FVPA 4H41A 3SUWA 4C60A 2E6DA 4MWAB 3VIMA 1JZ2A 4AD0A 1VYRA 2Y63A 4TMCA 3SCWA 2B81A 2ESCA 2FZMA 2H8XA 2EO7A 4QSFA 4TOQA 4GY7A 2E9MA 3URAA 1TELA 2ZA3A 5BRPA 1S5TA 1PTGA 3TW7A 3WLMA 2V2DA 4N6EA 3B0VC 1FKIA 2YDQA 3W0KA 1B4EA 2OOFA 3NXFA 1LOLA 1OFAA 4PULA 4NX0A 1RCXB 3ITCA 5LNUA 1BGAA 3TV8A 5JH2A 2XJ7A 3FKRA 5T8GA 4GBUA 2DGAA 2X40A 3T08A 2H6RA 3RR1A 1CI1A 1UWTA 1JYXA 2X2GA 2J6XA 5EA9A 4D6HA 4PTWA 2G41A 1P6BA 4CCEA 2FYMA 3B06A 1F8MA 4GCAA 2A1YA 1DPMA 1TZ7A 3KOZA 3SDOA 2Y88A 4JN6A 7REQB 3QPEA 3S2NA 4OUIA 5T9CE 1R9YA 1D7JA 1NOFA 4GINA 3FX4A 3UR8A 4Q4PA 3ZVIA 3SCQA 3QGKC 1PINA 4JY9A 2XPAA 4F9DA 1UR0A 4C6NA 4NAEB 3IRSA 4JS3A 2V3GA 4BJHA 4IP7A 2DT1A 1C8VA 4C6PA 1TX2A 2E3ZA 2XSBA 4ZO7A 5IDIA 2UV8G 1OFPA 3NFUA 1XKYA 2PGWA 3LV6A 4NZFA 3WFLA 4AYSA 1EJUC 3WFZA 1QPQA 5HUAA 3ZWSA 5CSSA 1ONWA 3U6WA 4L4LA 3KAIA 3OGVA 1KM3A 2RJGA 4K8HA 3OQEA 3IKDA 2VC6A 1UR2A 1RK5A 5AOUA 4IMDA 4NF7A 4CN6A 4D6EA 4QJ5B 5FF0A 4B9YA 2I1OA 4I3GA 4JCMA 4ZE4A 3W73A 4R9XA 1QHPA 1K9FA 1U2YA 2E5DA 3M41A 2A0NA 1OD8A 3F7JA 3H2NA 4GFIA 1CCWB 4V28A 4X60A 2Z1XA 1BRLB 5HA7A 1FDZA 3OGRA 4PRTA 2VQTA 3IARA 5DANA 3H21A 1QDSA 1CW2A 3U0HA 4FNQA 4DIAA 1YEYA 3CWNA 1H50A 3TYAA 1A5UA 1TPC1 2QCGA 2XG9A 3AZTA 3FJ4A 1O60A 2KI3A 3EB4A 3QTPA 2EQDA 4IWWA 3SR7A 5GPGA 3CV2A 4XK2A 1BAGA 1NDVA 1SFJA 3W29A 1OY0A 1FWSA 3V1PA 3L65A 1XIDA 3QXBA 3T55A 1R7AA 3BO9A 2QYGA 3NSMA 1EYMA 4DJDA 1KC7A 5JQ9A 4B5VA 1TV5A 2P88A 4IIGA 1D7HA 2PDNA 4LAXA 2PU1A 1UKQA 2HE5A 1J6YA 4UIOA 2ZOXA 1LRNA 4GVIA 4HBEA 2FZDA 2POZA 2VGIA 3P8JA 1CGWA 1SW7A 2XP7A 1KGWA 3VDGA 3N4AA 3CWHA 3EWZA 3NZGA 1RLDA 3VNKA 2DP3A 3GX9A 3JVAA 3O5DA 2VGFA 3MVIA 3WJZA 1JCTA 4GABA 2OT1A 4RZ6A 3EY6A 3WFAA 1LT8A 2BXZA 3W2KA 4O0QA 3W26A 3U2EA 2ZZ7A 3WDJA 1TSIA 1KD0A 3W7GA 4M29A 1OCNA 1V8EA 3THQA 4B3KA 1VKFA 2GGJA 2FVMA 1ADSA 4LFYA 1S5WA 3M46A 4JX5A 1AJ2A 3QPZA 5BXPA 1FP9A 1M7OA 2HS8A 1O5XA 1OC6A 2XN0A 4AHPA 3W7MA 1V6UA 1AA1B 2XU2A 3CEPA 4FHAA 3AAMA 4LB3A 1W56A 1GQLA 1IXOA