1XHGA

Crystal structure of a 40 kda signalling protein from porcine (spp-40) at 2.89a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPP-40
publication title Crystal structure of a 40 kDa signalling protein from Porcine (SPP-40) at 2.89A resolution.
rcsb
molecule tags Signaling protein
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xhgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xhgA01
3W6MA 1P6WA 1C92A 1DWJM 3WF2A 2J7CA 4PEEA 5D9NA 1H3GA 1QHPA 3VVGA 3LMYA 1W9UA 3UESA 3IJ8A 3WQ4A 5CGTA 1M01A 1LWHA 5HNNA 4A4AA 3II1A 3TOPA 4B3LA 1JDCA 4M1RA 1E3XA 2WNWA 1E0VA 4AD0A 5ABEA 3N12A 4UZSA 3U5UA 5E9AA 1H0GA 4ZXOA 1UD8A 4JIEA 1KWKA 3S2CA 4E2OA 3G6LA 3T0DA 1H41A 1EXPA 3WQWA 1FFRA 2E9MA 3AZSA 4W7UA 5BRQA 1HP4A 3RJXA 1VFOA 2CXGA 4K68A 4CN6A 2OYLA 4MB3A 1JAKA 3EMCA 4AD3A 1ODUA 1WZMA 3WF3A 3RILA 4CU8A 1B0IA 4QCFA 1TVPA 3VTRA 2A3EA 4MTVA 1MFVA 3WELA 3G6MA 1O7AA 2VCAA 3TONA 2WZIA 2J79A 2VX5A 1HJXA 4D6GA 1CXKA 3GH5A 1XH1A 1KXQA 2BNJA 4OBSA 2JF7A 1UH4A 1QI4A 4X0VA 2VR4A 2WLZA 1JZ7A 4BQ2A 4J3SA 2W66A 2BS9A 4QLKA 2EJ1A 1CXLA 3WH9A 5KZ6A 4W84A 4QFUA 4UFKA 1DWIM 4OUEA 1US2A 6CGTA 4LYPA 3VNYA 1I1WA 3SCQA 4A3HA 5AC5A 4UQ9A 1FOBA 5HBFA 1B9ZA 2WZHA 3OLDA 1BG9A 1KR1A 1NOFA 4AXNA 4CN4A 5A8NA 1XCXA 1KCLA 3MV01 5BXTA 1V3HA 2OWWA 2YIHA 1X6NA 4AYSA 1PIFA 2HVMA 3VD4A 1HVXA 4BQ4A 2VVSA 1J0ZA 1E43A 3VIGA 1EQPA 1HJSA 3WD0A 4WJXA 1EDTA 4W85A 2E9LA 3SCPA 1ZL1A 4GO9A 4RE2A 3B9EA 2WXDM 1UKQA 4HZ7A 1NWSA 3GYCA 4D1JA 1V3JA 3OGVA 1B2YA 4AZ5A 1DWGM 1WDSA 3BAWA 4F8XA 1PX4A 3ARSA 3A6OA 2GVYA 3U7BA 1VIWA 1OBAA 3UEQA 3MSDA 1UA3A 4BS0A 5BXPA 3W38A 3EMQA 4AZBA 5A95A 3RM8A 4HZ8A 1GOMA 4DUWA 3GTNA 1LQ0A 2J7DA 2VZVA 1UWTA 3PZGA 2WK2A 1M7XA 1CPUA 4KGJA 2BV9A 2CBIA 1R86A 3OLIA 2J7FA 2GUYA 1C7TA 2WZEA 3WDIA 3SCWA 5A1AA 3NDYA 1NOWA 3PZOA 1BSIA 5A6BD 4AIOA 2VZOA 1WDQA 3ARUA 1W3HA 2XSBA 2YLLA 4EK7A 1MW3A 1UYQA 2PF0A 2Y24A 1W2PA 6TAAA 3WBEA 4TX8A 1JDAA 3WH5A 1BG4A 2PWHA 1CDGA 3RIKA 3MKKA 4MDPA 4C7DA 4J3XA 5DMYA 2GDVA 1W1TA 3VDBA 3SUWA 1WDRA 4CCCA 2YDSA 3AFBA 3UCQA 1J18A 2WVUA 4JFUA 4HA1A 1KQYA 2ZIDA 3AXXA 1V3KA 3WUEA 2GSJA 1UUQA 2XVKA 1CTNA 2XIIA 4HP5A 3WD2A 1ISYA 5FOOA 1GQIA 2PBOA 3T2PA 2BVDA 4BZYA 2VRKA 5FL1A 4TTUA 3WNKA 1RPKA 1E72M 5GPRA 4AZ7A 5FCZA 1CENA 2BVTA 3UETA 4H8HA 1GW1A 1ISWA 5E6ZA 2WSPA 1RD6A 1I1XA 1QW8A 1E56A 3VIMA 4ATDA 3UG3A 3RCNA 4F79A 1W3KA 2X2YA 1E3ZA 5DT7A 4DM2A 3CH9A 1GOKA 1G1YA 4W86A 3WFLA 3W29A 4HOXA 4DUVA 1J10A 2XM2A 3OGSA 3L4TA 1E70M 3K8KA 5E6YA 3AS3A 3KE0A 4AC1X 2EO7A 2PWDA 3GNOA 4L4PA 1TUXA 4GQQA 5EFFA 4DWSB 1PEZA 4JFSA 4MB5A 3AMKA 3ZJ7A 2ZUVA 3CZJA 3A4WA 3CZEA 2CBJA 4P7LA 4AZCB 1JNEA 2J4GA 1ZBCA 1R85A 3WN6A 3NYDA 3QHOA 4PTMA 4TOQA 4D72A 1KFWA 1MVYA 3HU7A 2WB5A 4BQ3A 3AJ7A 3WEZA 4ATLA 3VU2A 5DEZA 1UD4A 2X0HA 4UZUA 4N42A 4LYQA 3EDKA 3MU7A 2J7EA 1V0LA 2WVVA 4ZXLA 4CN1A 2PWFA 2D2OA 1W1YA 4PCSA 4V28A 3WH8A 5AYBA 1X1NA 3WF4A 3GNPA 1WB0A 4J7RA 1EDQA 2WANA 4ATWA 2AOSA 1EO7A 4MJ2A 1SMDA 3CO4A 4UOJA 2E8YA 3T0BA 4MNLA 2JIWA 1UWSA 3ALGA 3GBEA 4WSJA 2J8GA 2UY4A 3M07A 5BXSA 3ARWA 1B31A 1VBUA 4GI8A 4V27A 4W5UA 1J01A 1EHAA 4H8VA 2ZOXA 1HF6A 2C7FA 3DYOA 5JIPA 4AEFA 1S46A 1K9DA 4PUEA 3CUHA 5I79A 5M03A 1E4MM 3PBGA 5JBDA 3K46A 1QI0A 2IXVA 1EIBA 1QNPA 1CLXA 1VEPA 1HP5A 4JFWA 5A8MA 2ZUNA 1CBGA 5I2UA 2WM0A 3WBAA 3SCOA 4Y7EA 1GQJA 5EB8A 2VMFA 2EPLX 4CVWA 3EDFA 3W28A 1CXFA 2WCSA 1R7OA 1JI1A 1BTCA 2D3NA 1E4NA 3OZOA 3WH7A 2XVGA 4QLLA 3VIFA 3AICA 1V6YA 4FMVA 1J0KA 3UERA 2GK1A 4AD4A 3NDZA 1UR4A 5E0CA 1J0YA 3A47A 1Q6GA 4XB3A 1XRVA 1UD5A 3WF1A 4D6CA 2X09A 3TTYA 1OGGA 1BGGA 2WC3A 4E8DA 1FP9A 1JZ6A 4P7QA 1BPLB 3OGRA 4B9YA 4U2ZA 3OB8A 4EKJA 4CD8A 2XVLA 2FGZA 5A8QA 4HPHA 1VEMA 4W89A 3TTQA 1W3LA 1MFUA 3S6TA 1ZB5A 1E6RA 3MMUA 2J78A 2XFFA 5IHSA 4DM1A 8A3HA 3LPFA 3DC0A 3L2MA 1B30A 1EA9C 2ZXDA 5DO8A 3NSMA 4CD7A 5CSYA 1EQCA 1TA3B 3EYPA 3VX0A 4AISA 5F7UA 3SUTA 5LA0A 2XGIA 3VD3A 1LLOA 2DSZA 5A3HA 2JEQA 1AQHA 2QMJA 3CPUA 3F5LA 4CU6A 2E9BA 4DWSD 1UG6A 1V6WA 1JDDA 3AZTA 3CZGA 2OSXA 2CESA 4D6DA 3EDJA 1MQQA 4CKQA 3QGVA 5E0FA 5I6SA 4BA0A 4Z2KA 4MADA 4CD4A 1K6AA 3QHNA 4GIAA 3ZJ6A 1ITCA 2DIJA 1NOUA 3ZJKA 1LG1A 3RM4A 3VMOA 1JGIA 3BC9A 5CJ5A 1KGWA 3T2QA 4PMVA 2DT1A 4PN2A 2ZUMA 1GVYA 4PMYA 1IT0A 1DWAM 1WO2A 3CHEA 3ZM8A 3ZSSA 4JCLA 1FH7A 3AS0A 1FP8A 4OOUA 1NP0A 1MQRA 4Z2JA 1VB9A 3CLWA 1B3VA 4Z2HA 1BVZA 4WIWA 1CWYA 2J8FA 2PWEA 3VGDA 3CZKA 4MB4A 1W9PA 4PCTA 2ZUTA 3VM5A 1JXJA 2CETA 5BCAA 3BLKA 4UFJA 1U2YA 2WWDA 3ZOAA 3WF0A 4JHZA 1QI3A 2ZXBA 2YL9A 1B3XA 2VX6A 4MNMA 3T08A 3OBAA 1E6PA 2D0FA 3BLPX 3L4ZA 2C0HA 4FLOA 2G3NA 3BCDA 1OWQA 2ZX9A 2OYMA 1QNQA 4D6FA 2DT2A 2BHYA 3HN3A 2J62A 2XSAA 2PWGA 4JCMA 2GJRA 2OYKA 1WKYA 1UH3A 1E0XA 4UR9A 1CECA 1V3IA 3A3HA 3WENA 3I3BA 2CKRA 1PZ2A 3U7VA 3PHAA 1BYAA 3SCUA 1XYFA 5ABGA 4AZGA 3W25A 4AW7A 1B3YA 1KGXA 3CTTA 3N11A 2XYLA 1XGZA 3BH4A 1R7AA 3D5HA 5CPSA 1Z32X 3MV11 3FAWA 4BQ5A 1ISVA 2CHNA 2EQDA 2DT3A 6A3HA 3T09A 3VPLA 4Z2LA 4EANA 1FHDA 1E9LA 4WKHA 1QNRA 5FD0A 1CXIA 1CLVA 1IZJA 4W87A 2D20A 3VOCA 1WZKA 4XUYA 4GXPA 5AC4A 4M29A 1E6ZA 2WVTA 4MPKA 1UZ1A 1V3LA 2C8NA 3SCTA 3ZIZA 1JYWA 2ZXAA 3I3EA 4HMCA 3L4UA 5D9OA 3SUVA 1ZJBA 3J7HA 3NCOA 4M24A 3GXDA 1QOXA 2VT0A 2QHAA 1K9EA 2WHLA 3AMLA 3BCFA 4PMOA 2WMFA 1UQZA 2XUCA 2VRQA 2VVNA 4UFLA 3CIVA 1BFNA 3AIQA 1JZ2A 1JL8A 1PX8A 2VC9A 3VIKA 3FHQA 3VO0A 3WQVA 1KXVA 1MQPA 4FLSA 1H4PA 4BF7A 3IAPA 3IAQA 2BHZA 4KRUA 3AHYA 1D2KA 1UQYA 2WCGA 4NI3A 1VJZA 3NUKA 4X9YA 2VX7A 2VR5A 1V08A 3MUZ1 1H2JA 3UR8A 1H11A 3ZT7A 2J47A 2ZWYA 2XFRA 5BROA 4MJ4A 4F9DA 4TUFA 3MUIA 3TTSA 3WNOA 2CBVA 3WUFA 4B9ZA 1LL7A 1CZ1A 4TXEA 5IFPA 3VDAA 4HTYA 5A2AA 2V5CA 3VUPA 3W81A 1W91A 3VGGA 3CHDA 1D7FA 1XV8A 2IXUA 4W93A 3TP4A 5D8WA 1VJSA 2AMGA 3SCRA 3TA9A 3CMGA 1JI2A 3VNZA 1JF5A 2YLAA 1J9YA 4J3UA 1B3WA 3L4WA 2V38A 4B16A 1CEOA 1NH6A 5C71A 4NRSA 4PYSA 1W32A 3W26A 1XH0A 1WAWA 1V0KA 3FXYA 1PJ9A 1CGXA 4MAZA 4NRRA 2WMIB 1E4IA 1E6NA 1EH9A 3WDQA 4ML4A 3CHCA 1BQCA 2EPMX 2G4FA 3O9NA 3VGEA 3ARQA 2WKGA 4PMRA 5DT5A 1PPIA 2ZX8A 2PC8A 5BXRA 3FNDA 4CUCA 2D0HA 3ZT5A 2YDQA 4PMUA 3VIPA 4TVCA 3N04A 3AROA 2QMKA 1KCKA 2XFYA 4JL1A 4AY1A 3FW6A 4X0NA 1UR1A 3O2LA 4KMQA 2ZX5A 1V02A 5CPTA 1ZJAA 2CHOA 1XD1A 2YA0A 2CIPA 1V0NA 3AISA 3RDKA 5IFTA 1WPCA 4E4PA 2IUZA 3GXMA 2V3DA 2VUYA 1M53A 4Z2GA 3EDDA 2X0YA 3WEMA 1HL8A 2D0GA 3VD5A 5BYWA 4LYRA 1C90A 3VGBA 1HKKA 1E55A 3I3DA 2WKLA 2BVYA 3WD3A 3VX1A 4P8XA 1U33A 4PTWA 4HMEA 5CLWA 4LXFA 5I78A 2DSUA 3AIRA 2X05A 1TVNA 4ZE5A 2WCAA 1ZBWA 2ZUUA 4ACZB 4LGXA 3WFZA 1H1NA 4P8VA 1V03A 1HL9A 3RO8A 4OBRA 2AAAA 5CQ1A 1UA7A 3CBWA 1BHGA 1UOKA 3DYPA 2CKSA 4OIFA 4U5IA 4U31A 5LA2A 2V5DA 1FA2A 1GOIA 3GNRA 4KWUA 4KRTA 5C8BB 3N17A 1C8YA 3KL3A 2J77A 2J7GA 2VQTA 2ZICA 3WMCA 1TFVA 3GBDA 2Y8VA 4H41A 2D23A 2VCCA 3ARYA 1XYZA 4HPGA 2NSXA 3PN8A 1GQLA 3AQUA 3EBVA 4OJYA 4GO8A 1NWRA 1Y7VA 4XX6A 1UKOA 2Y5EA 1HNYA 1KXHA 3CUFA 3SUUA 1TCMA 4B3KA 3SUSA 1G94A 1JD9A 3BSGA 3QOKA 2WBKA 4URIA 1UD3A 2BY3A 3AIBA 2VOTA 4HU0A 1HX0A 2WPGA 1OT1A 3A4AA 1UR0A 4S3KA 2GDUA 3KL5A 1XSJA 2NT1A 1E1FA 4V2XA 1J0JA 2WVVB 2VJXA 1GVIA 4U3AA 4PMQA 5IHRA 1CGUA 1JZ4A 5A6MA 4PMDA 1W2VA 1QNSA 4P7OA 2RGLA 4PRWA 2VL4A 4RE4A 4UQAA 1FFQA 1GOOA 2XVNA 2XTKA 5I23A 2A3BA 2WMHA 3WNMA 1E6SM 1D3CA 4ACYA 1JG9A 4B15A 2D24A 2JEPA 3LPPA 4TX6A 4C7GA 1JYNA 4UFIA 2VO5A 1KXTA 1C8XA 2EPKX 1DP0A 3IJ7A 4YHEA 1ZBKA 2G8ZA 1W9XA 2YBTA 4MAVA 2CBUA 3PTKA 1OSEA 1LJYA 1OGSA 5M3WA 1CNVA 5I3DA 5FIPA 3VDHA 1UR9A 2EPNA 8CGTA 2D3LA 1DTUA 3AI0A 1U30A 5IXEA 1BYDA 3UG5A 1GOQA 3NSXA 4M81A 3WQ8A 2XWEA 3AYRA 2J74A 1OIFA 4UOZA 1AMYA 3QOMA 1KB3A 2GK1B 3F4VA 2Y2WA 3MUAA 2DSKA 3PZMA 2BHUA 1E6QM 2F2HA 2G41A 2PB1A 3GXIA 2UWFA 4WK9A 3GH7A 4GZEA 3W53A 3B9AA 3BGAA 4TTGA 1FHLA 2W63A 3WD4A 4JHOA 1ZBVA 3HMCA 5A6AA 1G9HA 1EDGA 3D3AA 5A2CA 3AXIA 1XC6A 3UR7A 1CGVA 4JFVA 3BAIA 4NF7A 1QPKA 4EE9A 4RE3A 3W4RA 3FAXA 2UY3A 1OCQA 3UG4A 7A3HA 1VFFA 4HU8A 1Q4NX 2XPKA 1EO5A 1W9BM 2EBNA 1WDPA 3AYSA 1OD8A 4HOZA 2JIEA 2J7BA 4LX4A 2DEPA 2WMJA 1JZ3A 1QW9A 1GORA 1VFUA 2YL8A 1DEDA 3BAYA 1CGWA 4H04A 2E3ZA 5BRPA 1HJQA 2B31A 1ZS2A 3CUGA 3CUIA 4MNKA 2DH2A 5ABFA 4UCFA 2W67A 1AQMA 2EEXA 3BMVA 4WSKA 4GKLA 2J25A 4WKFA 1UD6A 4XV0A 1JD7A 5I24A 5JBFA 4AZ6A 5A69A 2VRJA 2W91A 4WLCA 3IK2A 5BWFA 3F5JA 2WLYA 5JUVA 2VURA 4OKDA 1W1PA 3B9DA 2BY0A 3ARXA 2Z1KA 2XWDA 1MW2A 2VNCA 1W9DM 3BAKA 1LL6A 1KBKA 2GJXB 3K8MA 3VD9A 2J7HA 3QR3A 2CPUA 5CSUA 4MNJA 3K1DA 3L2LA 2YA1A 1XSIA 2YA2A 4TVUA 4C7FA 2YKKA 3MMDA 4GI6A 2YJQA 1UWUA 1E5JA 4PTVA 1E5NA 4OOZA 3NIYA 3W24A 5JIWA 2VX4A 1V0MA 3RPMA 1UHVA 3AHZA 4J28A 1VBRA 3OZPA 1H49A 4UFHA 3GZAA 1JIBA 1WE5A 2ZUWA 2XVPA 3RMEA 4UQBA 4JFTA 5I0DA 3BAXA 3WNPA 4AMCA 2JF6A 1E1EA 2VTFA 1GUVA 2E8ZA 4IISA 4HZ6A 1V6VA 1HKIA 2NT0A 3MMWA 3POCA 1MXGA 3AIWA 1UWIA 3AMCA 4IM4A 4IUGA 4UFMA 5TD4A 3LPGA 1J11A 2GFTA 2ZX7A 2WHMA 5CXPA 1VF8A 1JYVA 4P7RA 1GHRA 3RM9A 3BAJA 1GHSA 1WP6A 3ZT6A 4A3YA 1LF1A 2WHJA 5FL0A 3SURA 3VDCA 2PI6A 4CCEA 2YL5A 1OD0A 1DWFM 1MYRA 4J3VA 3ARPA 2WC7A 2FHCA 5A6BA 2FHFA 2D22A 3ZQ9A 1US3A 3ZO9A 4PSRA 5A8OA 1RH9A 4UQCA 4FLRA 4W7VA 4QDMA 3M46A 5EBAA 1V6UA 2OLHA 1I75A 2CEQA 3DHUA 1GJUA 3MUY1 1VFMA 1UR2A 2Y8KA 2O9OA 3PZIA 3ARRA 1XHGA 2V3FA 3N13A 1CYGA 3WY1A 4D71A 3WDHA 2A3AA 1NWTA 4W88A 3F5KA 3CHFA 3CGTA 3WUBA 1C3FA 2W61A 1AVAA 2FGLA 3NSNA 1QI5A 3WDJA 1PIGA 1GPFA 4JL2A 3GM8A 2DIEA 3TTOA 3GH4A 1NM9A 3VILA 2OWCA 3IANA 3WQ6A 3VIOA 2Q8XA 4NZCA 3CZ8A 4M82A 3OLEA 3L4VA 3FN9A 2BY1A 4KGLA 1J0HA 4JKKA 1BVNP 4EAMA 2CERA 3WUGA 1NP2A 5AY7A 2VZUA 4JAWA 4D6EA 4Q7NA 1OM0A 1QVBA 2FH6A 4U5KA 1PBGA 4ZENA 2XHYA 3BMWA 1YQ2A 1H09A 1OT2A 5CLTA 1MW1A 5HDRA 4PMXA 3WMBA 4LPCA 3VIJA 1EOMA 4QAWA 4S3JA 3FY1A 9CGTA 3CUJA 3AIVA 3PZ9A 4GQRA 5D8ZA 2G3JA 3SIMA 3K4AA 1HT6A 2UY5A 4E8CA 1TZ7A 1YHTA 4AD5A 1HKMA 2OWXA 5JBEA 3AS1A 4UQEA 5EFDA 2BXZA 4CVUA 2JE8A 1C8QA 4U33A 3WD1A 4HOWA 1E4LA 3IJ9A 3WMSA 2O9RA 2EPOA 3M7SA 3U5YA 1TMQA 1WZAA 1FH8A 3WQ5A 4ZE4A 1BYCA 2O9PA 4HA4A 3EDEA 2O9TA 2MANA 3WL1A 2X1IA 3T0AA 3WKZA 3KL0A 2DSWA 2YDRA 1DHKA 3THDA 4UTFA 3PZQA 2ZXQA 1QBAA 4IPLA 2CITA 1JFXA 5LA1A 4D1IA 1F4AA 4FLQA 4JKMA 1JFHA 2QPSA 1B90A 4J3WA 1ISXA 3MO4A 4R27A 3ARTA 4M8UA 1JZ8A 4GZIA 2J75A 4AIUA 4D6HA 1UH2A 1N82A 1Q6FA 5GQBA 2WMIA 3QHMA 1M04A 3O6AA 1LWJA 1HJWA 4AZIA 5A2BA 5HOSA 2WYSA 2CYGA 1EHNA 1L8NA 4P7NA 4H8UA 3KWXA 3ECQA 1GCYA 1MWOA 2OSWA 1E15A 5D9PA 2FH8A 1R87A 1WNOA 2O92A 1UR8A 5D9MA 1CGYA 2WBGA 3SCNA 2D1ZA 1PZ3A 5LYRA 2BXYA 4HA3A 5I77A 1E73M 2VCBA 1KQZA 5DF0A 3WSUA 1OGBA 1WCGA 4NSBA 3WH6A 1JAEA 2V3GA 4P8WA 1R8LA 2UY2A 5ECUA 1M03A 3HJEA 1ECEA 1QI2A 2XIBA 5M5DA 4ZEPA 3PTMA 3VM7A 4AWEA 5IDIA 3SCSA 1G01A 3W82A 4AD2A 1VEOA 3PZUA 3CMJA 2E0PA 1OINA 2G3IA 3VIHA 2W4XA 3VKKA 1BAGA 1JYXA 1MXDA 2W92A 2DDXA 4CGTA 1TR1A 2WVSA 1V02E 3VMNA 1CGTA 5E70A 3DECA 4J27A 3ARZA 4PMNA 3AS2A 5GNYA 2XM1A 1ITXA 4ACZA 2Z1SA 3AHVA 4UOQA 1BF2A 4FF5A 1K9TA 2ZUSA 2ESCA 2BY2A 2OSYA 1JZ5A 1UWQA 2PBGA 1XH2A 5ABHA 3L4XA 1UKSA 1AQ0A 1G0CA 1W1VA 1QHZA 1J12A 1A47A 4M80A 3ARVA 4CCDA 1IV8A 1Q6DA 1C7SA 5CPQA 4CD6A 3AZRA 5A6LA 1V3MA 4HMDA 1RP9A 4RL3A 1JXKA 3WL0A 1A3HA 2JALA 1HIZA 3APGA 2DGAA 2VI0A 3DHPA 3N15A 1ODZA 4CD5A 5FKYA 3AXHA 4L4OA 1TG7A 1E6XM 3AHTA 3K8LA 4JKLA 1OB0A 3POHA 3A4XA 4M56A 1GQKA 2RGMA 4UNIA 1UWRA 4DWSA 2NW0A 1JNDA 1QHOA 5DFAA 3B8SA 2VZSA 2CCRA 2ZE0A 3WNLA 3PZNA 4AZCA 1Q6CA 4AZHA 2DPEA 3BSHA 1NARA 2TAAA 2YL6A 5HPOA 1E40A 4KH2A 5GNZA 1ESWA 1GJWA 3PZVA 2G3MA 3DYMA 1E71M 1GZJA 3WNNA 4W8LA 2QF8A 3AIUA 2DT0A 3VIIA 3THCA 3AIEA 1PX3A 1BGAA 1OIMA 3SEPA 4XZWA 1B1YA 3EMZA 4OZOA 2WSKA 2WW5A 1MW0A 2WMKA 4J3TA 4JZ5A 1QBBA 3VINA 4PBGA 2BFGA 4IPNB 1HVQA 1ISZA 2JFEX 3WIJA 5GNXA 1E0WA 3T2OA 4LQ1A 3JUGA 4H2CA 1V6XA 1JF6A 3AOFA 1KGUA 7CGTA 3LPOA 4XZBA 2DH3A 1HKJA 4DWSC 4GINA 4PUDA 1NWUA 2FDMA 4PMZA 3AMDA 1HJVA 1GOWA 1FH9A 3MANA 3WDRA 4YN5A 3OIHA 2QLYA 5E09A 1UKTA 1SFSA 2XGBA 1VENA 1C93A 1WZLA 4D6JA 3VGHA 1XSKA 1LG2A 3GDBA 1EOKA 4AD1A 1UD2A 5HXMA 3OLGA 5JH8A 2WAGA 1CXEA 3M6DA 3ZJ8A 2FHBA 2ZX6A 3VD7A 5CG0A 3OA5A 3N9KA 4GZJA 4ZFMA 3ZMRA 5AYIA 2YBUA 5ABFB 4BCEA 4D6IA 3W27A 5CZKA 2E40A 5M17A 5A6JA 2DQXA 3ZSTA 1SYTA 1O6IA 1G5AA 1CXHA 3MS8A 3PTQA 1ZU8A 5A94A 4YPJA 4WKAA 2WWCA 3W0KA 3AMGA 1H5VA 4PTXA 1UKPA 3ALFA 2ZWZA 1B3ZA 3W37A 2VZTA 1EGZA 2XJ7A 3FHAA 4U3CA 1UZ4A 4YHGA 1L0PA 4QLJA 1F4HA 4GPNA 1W9VA 1KR0A 3W6LA 3KZSA 1DWHM 3K4DA 4WF7A 3RJYA 4MB1A 3SCVA 5C70A 4TVDA 2F8QA 5A6SA 3NJ3A 2WMGA 2WC4A 3BXWA 3MSGA 1TA3A 3N1AA 4H7VA 5KEZA 1C91A 2WHKA 1GNXA 1SMAA 3GXFA 2V3EA 4AIEA 1CIUA 1K9FA 1W3JA 2W62A 1HXJA 1H0IA 5D4YA 7TAAA 2W5FA 2E4TA 2YOCA 3KEHA 3OG2A 4W7WA 1BLIA 1HN1A 1SR0A 3CZLA 1QNOA 1J0IA 3AHXA 3WEOA 1KBBA 4W8BA 2GJXA 1XD0A 1LL4A 2EXOA 3L4YA 2HISA 4CU7A 2X8RA 2DSVA 4W5ZA 3PZTA 1HJUA 2F61A 1GONA 2XG9A 1NQ6A 2Y4SA 4P8UA 5A8PA 2VQUA 1PAMA 1IZKA 2GJPA 4QP0A 4Z2IA 3U57A 1XCWA 2QV4A 4UQDA 1VAHA 4R5EA 3N18A 4QCEA 3E1F1 4U2YA 5HPCA 1Q6EA 3ZR5A 5EMYA 4W8AA 3VGFA 4DUXA 4GI9A 5CGMA 4AEEA 1RP8A 4Q22A 2CNCA 1VRXA 2A3HA 5I5RA 4N0RA 2A3CA 4PSPA 1BYBA 3VMPA 4F66A 5A6KA 3WDPP 4FK9A 1X6LA 4F9JA 1KWGA 2QPUA 3ZR6A 4MDOA 1TE1A
chains in the Genus database with same CATH superfamily
1C92A 2J7CA 3IVSA 3VVGA 3WQ4A 4TW7A 1J5SA 5T8GA 5BWAA 3OHIA 5HWMA 1GVRA 1JDCA 3GIYA 3IJDA 1E3XA 4LVDA 2WNWA 2QNEA 1E0VA 3ZFHA 5ABEA 1R3RA 3U5UA 1FCUA 4JIEA 3B40A 3T0DA 1H41A 3G1RA 1UUOA 5I3FA 4CNPA 1FFRA 3LLDA 4ICCX 4W7UA 3RJXA 4C5YA 1VFOA 3RR1A 4K68A 3UZZA 4CN6A 3ABOA 3SRFA 1JAKA 2KR7A 1ODUA 2PPPA 3QPEA 4DELA 2YB1A 2Y7DA 1AG1O 1PZ1A 2RFGA 3M41A 1MFVA 3WELA 4XD5A 3E38A 3G6MA 3WK3A 2VCAA 4Y9MA 1B6CA 4JTTA 4C60A 1CXKA 1KXQA 2BNJA 4GH3A 4WJ8A 4H01A 3IUHA 4S3BA 2I17A 3I10A 3N9SA 1XI3A 3BW4A 5D37A 1JZ7A 5DN1A 2NWRA 3OVRA 5CJNA 3SECA 1XBZA 5TF0A 4QFUA 1BXBA 4G56A 3ITVA 3SCQA 2XN0A 5HBFA 2GGHA 2I5QA 2NQZA 3CXOA 3O05A 1KR1A 2ZQSA 3DFNA 2B5UB 5A8NA 1XCXA 4MZ1A 2OWWA 3GWQA 1X6NA 3VD4A 1B57A 2VVSA 3CC1A 3DEQA 3TEVA 1NDWA 3WD0A 4WJXA 1EDTA 2E9LA 4YYFA 1NWSA 3GYCA 4L6OA 1V3JA 3OGVA 4AZ5A 1DWGM 3BAWA 4F8XA 5I7GA 3JU2A 4ZFCA 1KNWA 3ARSA 4NXSA 2ATSA 2GVYA 1H62A 5XINA 3U2ZA 3JYMA 1KT0A 1UP0A 2FTYA 5MKGA 1OABA 1BD0A 2WSYA 3B0VC 5A95A 3S6DA 3GYEA 1GOMA 4QG9A 4YCPA 3LZ3A 1M41A 1L6YA 4QEHA 3EXRA 4M6PA 1UWTA 3PZGA 1DJYA 1A5SA 4HJFA 4KGJA 1R86A 1EJRC 1GOXA 3QPZA 5HMSA 3V5OA 3SCWA 5A1AA 5U4NA 3UA4A 3NDYA 3M5YA 1FY6A 1BSIA 5A6BD 4M3PA 2VZOA 1WDQA 3ARUA 2YLLA 3FK4A 4JIIX 1MW3A 3TJIA 3EB4A 2BXVA 4LCRA 3B06A 3ZLFA 3ITTA 3PWGA 3RIKA 4MDPA 4C7DA 3A3WA 3ABQA 2GDVA 1GVOA 4UUIA 4K1GA 2YDSA 5IBXA 1J18A 2WVUA 1LOQA 1KQYA 3PG8A 3EXTA 2GSJA 1CTNA 2VXNA 2NV2A 2WZMA 1U5HA 4R7OA 4F0SA 3LTSA 1E51A 3JZEA 3LSCA 4BZYA 1XQLA 1EC7A 3WNKA 1JCMP 3MI3A 1CENA 4ZGYA 4LUIA 4TMCA 5D03A 4QJ1A 3EKLA 4MMWA 3REQB 1RD6A 1I1XA 3E5PA 4XAGA 3R43A 1XFCA 2GL5A 3UXDA 4KR0B 5KMYA 2PU0A 3KLLA 4K1WA 4DX3A 5DT7A 1RJPA 2Q3OA 4W86A 7TIMA 4HOXA 2ZE3A 4G7EA 3K8KA 4AC1X 1M7OA 2PWDA 1FWDC 2VFIA 4DWSB 4AF0B 1ZTVA 1PEZA 5CPNA 4JFSA 5CPLA 3AMKA 3N3TA 3TYEA 2HK0A 3S9YA 2NVCA 4KS0A 2QVHA 4L9ZA 4AB4A 1LQ2A 2J4GA 1WBHA 1R85A 2A5HA 4TOQA 4BQ3A 3AJ7A 1D3GA 3L9CA 4HQVA 3PBVA 3WEZA 3TAKA 3VU2A 4DF2A 4NNCA 3M44A 4LYQA 4KFNA 2NLYA 4QJ3B 1V0LA 3PULA 4ZXLA 3W7GA 2WQPA 3KM8A 2OQLA 1QNVA 3UWEA 3O07A 1OZQA 2E28A 3QF0A 4R34A 2V6AA 1JULA 2E6DA 1WB0A 3QLLA 5EPDA 4MJ2A 2E8YA 4IMFA 5CBIA 3LOTA 4I8DA 4QITA 4NJJA 5C9UA 3M07A 3GIPA 4GI8A 3DYOA 1DJZA 3RR4A 5M03A 1U1HA 1T40A 2F4EA 4LCSA 4X3ZA 2XSXA 3H22A 1QI0A 2XDFA 1CLXA 5A8MA 1AA1B 5I2UA 4LUSB 3GNDA 3SCOA 3BPWA 1F3TA 2VMFA 2VDIA 1XLJA 1KBJA 4CVWA 1IR1A 3GTIA 3W28A 3W7PA 2FPTA 1XPGA 2W3ZA 1YXDA 3B8VA 4JTAA 2CLHA 3O5GA 1J0KA 4HJWA 5AN7A 3UERA 3NDZA 2WNZA 1V5XA 5E0CA 3A3XA 2EAWA 4IMEA 1XRVA 3TTYA 1OGGA 1K77A 4QJ5B 1BGGA 4DZ2A 2WC3A 3PVFA 1JZ6A 4P7QA 2FZMA 1AK5A 1JEZA 3B05A 4EKJA 3C8NA 1RPXA 2ZYFA 2FB2A 2FGZA 2UZ5A 1K70A 4W89A 4GWEA 3O5IA 1ZB5A 2GGIA 3MMUA 3E0VA 4YVXA 3DC0A 3GU0A 1NELA 1B30A 2OCZA 3LMZA 3HM7A 1TELA 1NEYA 4CD7A 3LHTA 1EQCA 3DI1A 3GNNA 4N9CA 3WCZA 3VX0A 1UMLA 5F7UA 3SUTA 5JVLA 3KTXA 1UOZA 2I56A 3VD3A 3W76A 3YPIA 1VFSA 1AQHA 3F5LA 4A3QA 4CU6A 3NQMA 1YTKA 4IPIA 3AZTA 1MQQA 1W5NA 3QGVA 2IF4A 5FACA 4I5UA 4MADA 5FF4A 2FVKA 4GIAA 5CJMA 3R11A 3R7MA 3ZJKA 1LG1A 3S46A 2G5WA 3PPCA 1JGIA 2P50A 3T2QA 1E44A 4PMVA 4GYPC 1GVYA 1Q7QA 1WO2A 4H3DA 1NVMA 3NWRA 4C1NA 4OOUA 3SRKA 3ZS4A 1VB9A 1B3VA 4Z2HA 6XIAA 4WIWA 2J8FA 2PWEA 4E38A 2YZ5A 2VKZG 5D32A 3N9RA 3HGSA 2CETA 3BLKA 4UFJA 4IQJA 1U2YA 1NMVA 2QJMA 2YL9A 4YWSA 1FKKA 2AKMA 2D0FA 3V5FA 3L4ZA 2W27A 1OWQA 3O5FA 4D6FA 4IZGA 1QTWA 4MWAA 3BWWA 1ENUA 4X2PA 2J62A 3C2YA 4JCMA 1FCQA 4RV3A 2W0UA 4LC8A 4XIAA 1E0XA 4GCAA 4Q4MA 2ACQA 4UR9A 1V3IA 3WENA 2CKRA 3R25A 3PHAA 1CW2A 5BXJA 1XYFA 1KFEA 3V4BA 4AZGA 3W25A 3CTTA 3LCIA 2QCCA 1XGZA 1O1HA 3D5HA 3WLNA 3MV11 4BQ5A 4IT4A 3W1PA 1ISVA 2EQDA 4J35A 3BJTA 3EXSA 1IR2A 3C0SA 4EANA 1B5TA 1E9LA 1FHDA 2VFHA 1K02A 1IZJA 4W87A 3STGA 4FX7A 3VOCA 4ADSA 4GXPA 1VR6A 1V51A 2RUCA 3W7RA 1RY8A 4XWUA 2DVUA 1EFZA 1O60A 1FVPA 1YPXA 3SCTA 3ZIZA 1X1ZA 1JYWA 2PTWA 2ZXAA 4HMCA 3SUVA 1DBTA 2R1LA 3GXDA 4S38A 3BCFA 3AMLA 2OPJA 3FKRA 2RJHA 1TVLA 1BSLA 3B4YA 2WZTA 4LWWA 1VLIA 1L2UA 1PHWA 3CIVA 2BX7A 1XLIA 2J9XA 3PBWA 3SQSA 1PX8A 1MMFA 3I7SA 3CAQA 4KPLA 1GRJA 3VIKA 1XCFA 4W4QA 2A7RA 3FHQA 2G0WA 5CAHA 3W84A 4FLSA 4GMEA 3MKCA 4ORIA 3MT1A 3W22A 4LSBA 2BHZA 2QCMA 1D2KA 1VJZA 5D33A 3EWWA 3NUKA 2VR5A 4XO6A 1W8GA 2OOGA 1H2JA 1SJAA 2J47A 4IGMA 2ZWYA 4LY4A 5DRCA 2OX4A 4F9DA 5KTLA 4HTYA 3W81A 3VUPA 3ABXA 5FJUA 1XV8A 1R38A 1Q65A 1Z44A 1P0NA 1NSGA 1PTAA 4TIMA 3CMGA 3E0WA 1JI2A 2A6NA 2YLAA 3OHMB 1N7KA 3PP7A 2O0TA 4R85A 4OGZA 1XGEA 3G8RA 4DT4A 2BVWA 1S5NA 1AUSL 4FX8A 1WAWA 2IQ0A 2QT3A 3VI2A 1F61A 1NFBA 2RDXA 3HF3A 2EPMX 3VGEA 2WKGA 1WAUA 4PMRA 5DT5A 3V1HA 3TR9A 4IFRA 4CUCA 1XLHA 1Y8BA 4TVCA 3UA3A 4Y90A 1KCKA 2NQJA 4XZIA 3W02A 3O2LA 4HSHA 5AZ0A 4OWGA 1TKKA 2YXOA 1AL7A 3IGHX 4WRHA 2V30A 3AISA 3RDKA 4LEFA 1FKWA 3LTPA 3TW7A 4E4PA 2V3DA 4ODOA 1EJWC 2QCDA 3KRBA 4K7VA 3LCFA 2FPYA 1S3TC 4AG0A 2IMRA 1HL8A 2D0GA 4AHPA 4DRJA 1XIIA 4KCTA 4TW6A 3WD3A 1SZRA 4ODQA 1U33A 3ITYA 4HMEA 5CLWA 5DCDA 3FSTA 4C6MA 2KGJA 3TCSA 2X05A 1HUVA 3EX4A 3N3MA 5FJOA 3KBWA 2Z1XA 2ZUUA 4LGXA 4ACZB 3WFZA 1C9DA 4RZ6A 3UF8A 2JKEA 1VD6A 4F0KA 1HL9A 3NQEA 4L56A 3RO8A 1BHGA 4IIEA 1LZOA 3LS9A 4MGVA 3O5KA 5LA2A 2DIKA 4AX7A 3JRKA 1GOIA 3GNRA 2ZRVA 1OC7A 3WLSA 3H4GA 3IRSA 4G7EB 2ZVRA 4H41A 2PV2A 4BI7A 4FA3A 5CC7A 3PN8A 3GR4A 3G1YA 1EP1A 3LBMA 1NWRA 5A6TC 3RXZA 2Y5EA 2YR1A 3P7YA 1KXHA 1Y65A 3BG5A 3SUSA 1ZALA 3BSGA 1XGDA 3KOYA 4ODMA 4MZ8A 3FYOA 2CLIA 4A05A 3EX6A 1Q4WA 4H9UA 3FFSA 1EJVC 3N4EA 1FWEC 4U3AA 1JZ4A 4PMDA 1T96A 1W2VA 1VFLA 9XIAA 3ANUA 3W1LA 4FAMA 2OZ0A 3WLOA 2Y70A 2DW6A 1FKBA 4TO8A 1W56A 2A2IA 1W1IE 4B3ZA 4UQAA 3W71A 3M0KA 3Q2DA 2FAPA 3RF9A 1GZ1A 4XAKA 2A3BA 1BL4A 3WX7A 4WHBA 4LB3A 1IIGA 1JG9A 2D24A 1SJDA 4Z42C 4TX6A 1D7IA 4C7GA 1XWYA 1JYNA 5JH1A 4C91A 1ONEA 5FJTA 1E9YB 1KV5A 3GVGA 4YTRA 3PPGA 4YMZA 1SPQA 1PZ0A 4N9EA 2YBTA 4MAVA 4QS5A 3BE7A 1YNPA 3H23A 4ORMA 4HSOA 3NQCA 4JIRA 2CFFA 2D3LA 1L6WA 1U30A 1JQXA 3P8IA 3N25A 1YIXA 4M81A 5CZSA 4C6FA 5ENLA 2GJLA 4Q8OA 3TUUA 4HB7A 5J8LA 1Q8JA 3RRAA 2BOFX 1JPIA 1AMYA 5FF3A 4TNSA 1KB3A 1WKDA 4JN8A 4CLMA 2Y2WA 3MUAA 3PZMA 1FWTA 3G3MA 1K03A 2OLAA 2G41A 3TYZA 3BGAA 3M0YA 1REQA 3CASA 1EDGA 1CGVA 2P4VA 4AFYA 2FVMA 2RDTA 4EE9A 3NPVA 5CPMA 1OCBA 1EO5A 2L5HA 2A7NA 2EBNA 1X1OA 3NOYA 1DIKA 1ADSA 1TJ2A 1GVSA 4LV4A 3A5VA 3FYYA 2ALRA 3WLJA 2A85A 1N55A 2Q71A 1DEDA 1EGMA 3JS3A 4HT3A 1EBHA 5D05A 5BRPA 3LDVA 1Y5WA 5CSRA 1AW1A 5G2IA 2QUTA 4JTQA 5LIYX 3CUGA 2W67A 1AQMA 2EEXA 1RCQA 2R8WA 1UCWA 2VFGA 4DAIA 3I4KA 4AZ6A 2RQSA 4JIHA 3BDKA 1DOSA 3S47A 4NQ1A 2GUUA 1GK8A 1W1PA 4YTTA 3LCHA 1XIJA 2QV5A 4KWOA 4EF9A 3QY8A 3TDFA 2ZQVA 2HPIA 1XBYA 3K1DA 3L2LA 4C1NB 3D6NA 2V5JA 2Y85A 1KFKA 2YA1A 3DERA 2YA2A 2YKKA 3MMDA 3TN5A 1EX1A 1EJXC 4OOZA 3NIYA 4DAFA 5JIWA 1FKSA 1V0MA 5AZ1A 4BF9A 4PL1A 3N73A 3H7RA 4H2HA 3CV1A 4E3VA 3ELFA 1Q13A 3OZPA 4O13A 4JN6A 4GNVA 3PJXA 4L6HA 5KSWA 4JFTA 4KW2A 2JBMA 2QCGA 4RE0A 4JX5A 1WOBA 2VEPA 3L0KA 1FWHC 4IISA 4MIMA 3CAWA 1J4IA 1LYXA 3TYAA 4EPBC 1X39A 1A5KC 3DZ1A 3MHUA 3POCA 3FOKA 4MVAA 1IEVA 3MSRA 3MI6A 4UFMA 1J11A 3KTCA 4E2BA 1JYVA 3PWAA 3IV8A 4P7RA 4E2VA 5BOOA 2VELA 3RM9A 1GHSA 3ZT6A 2QDEA 4YIWA 3B9OA 3GU2A 3UW6A 2WHJA 5FL0A 3VDCA 2GVJA 2ZZ6A 1FWIC 4J3VA 4IL0A 2NXGA 3KFTA 2D22A 4Q4RA 4JFKA 1JPKA 4ERGA 3ZO9A 3NO3A 3PSVA 4JGDA 1U5JA 1YDOA 4C90A 3QSRA 5D2TA 2LJ4A 1GJUA 1NIUA 3MUY1 1VFMA 1O5KA 1A5BA 1TTJA 4X9SA 4XD6A 3PZIA 3ARRA 1XHGA 2V3FA 4ASTA 1GT8A 2NSOA 3S2NA 1EUNA 3WDHA 2A3AA 3WUBA 2PLJA 1FWFC 5MHBA 3M5VA 1WXYA 2FGLA 1JCTA 1QFEA 3GH4A 4JFIA 3FCPA 4NX5A 3KW3A 3L4VA 2OO6A 4LUJA 4R88A 4UNLA 2VZUA 4D6EA 4NNAA 1QVBA 4MFDA 3T0CA 2XHYA 4ZMGA 3BMWA 5I3GA 1YQ2A 1OT2A 1UBPC 3BJFA 5CLTA 3WMBA 3BQ6A 4QAWA 1TPVA 1DJWA 3AIVA 4JN7A 2BLEA 4ML9A 5D2WA 4QRNA 3F4CA 5GPGA 5LNWA 4B2DD 1RCOB 3ES7A 1K4HA 4PBEA 4QG6A 4LOCA 1P6BA 1UZDA 1HKMA 2EG7A 4KCVA 1M9HA 2PRLA 2QGHA 2V67A 4JNMA 2JE8A 3ISIX 1C8QA 1UC4A 2A3LA 4HOWA 3PFMA 5I3JA 9XIMA 4DRNA 1ZPTA 1P4CA 2R14A 2AWGA 1FH8A 3WQ5A 4ZE4A 1BYCA 4IIGA 3RO6A 5DBUA 4HA4A 2O9TA 2WNQA 4QDWA 3L12A 3LGDA 3USBA 5DCBA 3N2CA 5TAOA 3QTGA 2YDRA 1X7IA 4L5ZA 4UTFA 1XINA 1OF8A 2CITA 4L9YA 5LA1A 4JKMA 2QW5A 2NX3A 4J3WA 1XYCA 4EOUA 3MO4A 4IMDA 1VJIA 3ARTA 4GZIA 2WPBA 1UH2A 3PJTA 3DBPA 3O6AA 1C9HA 6REQB 2WYSA 2CYGA 1EWEA 4P7NA 3XIMA 2M2AA 2G95A 2OSWA 4WVXA 4NYUA 2O92A 2GVLA 4Y2WA 2WBGA 1OCJA 3PUGA 4DO5A 1F40A 4NT0A 4JQ2A 1SO3A 4HU3A 3WBYA 1OGBA 1WKFA 4DNMA 3WH6A 1JAEA 2Y1HA 4ZS6A 2V3GA 4P8WA 4Z1AA 3HQPA 3DXIA 2PDQA 3EAUA 2FFCA 4JR5A 1QI2A 3D46A 3PTMA 1CT5A 5KZMA 2BP1A 1R46A 1G01A 3PZUA 2I9UA 4PGLA 3CMJA 3GU1A 2E0PA 3VIHA 4C6BA 5HJYA 3WQPA 3GKFA 1IT7A 1TR1A 2CWXA 3T8QA 3PUEA 1PKYA 3VMNA 1CGTA 4ZZ9A 1VCFA 3W7EA 3NTPA 4J27A 3ARZA 3T9PA 5KITA 3KS6A 4IPXA 5GNYA 1TV4A 1T0OA 2H3DA 4FNTA 1ITXA 1XLKA 1DV7A 1K9TA 2OFNA 2ZUSA 3ZR4A 4MPQA 4GIYA 4ODLA 2OSYA 4LF2A 4KQZA 4N02A 1XYAA 1M3UA 2KE0A 4NY2A 4A2RA 3MUXA 5HW6A 1W1VA 5H1WA 1C7SA 1TX0A 5CPQA 3AZRA 1YW1A 3LHWA 3IHZA 3CQHA 2HVNA 2JALA 2V0TA 4ZB0A 1HIZA 3H24A 1SUXA 1ELSA 4QQ3A 3DHPA 1PKNA 1BF6A 5FKYA 4AU0A 4C02B 1OX6A 3R4IA 5LNRA 3LG3A 3RYSA 3POHA 3TC5A 1UWRA 2V2DA 2ZDSA 2FPVA 3B8SA 2VZSA 1ZFJA 4O0KA 1UASA 3W83A 3WK0A 4NXKA 2CLLA 2F6UA 3FJNA 3SN1A 4ZSTA 4AXKA 2X2GA 3SFWA 4AZHA 4DZAA 3MI2A 5HANA 4N6FA 1ESWA 1RJQA 3VKJA 3PZVA 2G3MA 3TSBA 1GZJA 4NZ1A 5D2XA 4CNNA 1M5YA 1PX3A 1BGAA 3I6EA 1F76A 2E5BA 1NJJA 4OZOA 2WSKA 3QKZA 4QISA 4J3TA 4MSSA 4JZ5A 1QBBA 3VINA 2BFGA 4IPNB 1F05A 1JDEA 3TROA 5FJRA 3U2EA 3EX2A 1DIDA 3JUGA 2QGYA 2V8ZA 2Z1BA 1L1PA 4JEQA 2V9DA 3NM3A 3ERPA 4KWWA 4PUDA 1OFEA 1GYMA 1KW1A 2XN2A 4ZPVR 3AMDA 1FH9A 4Q7BA 3EA2A 3WDRA 1WYIA 4ZQRA 3BURA 3OIHA 2LLEA 5G1YA 4ONVA 4O16A 1VS1A 1SFSA 4US6A 3UBPC 4HHLA 1WZLA 4IP7A 4PUWA 3TX9A 4D6JA 3VGHA 3QYQA 4EPEC 1VFTA 3FJ4A 4I90A 4HBOA 3ZJ8A 2ZX6A 3VD7A 1OYAA 3OA5A 3N9KA 3FDKA 4W9OA 4PB4A 2FZBA 3O5EA 4F40A 2I9EA 1OFBA 4D6IA 3W27A 1UC5A 1PWMA 4NZJA 5A6JA 4QR6A 2DQXA 1HZYA 3CLMA 1O6IA 3PTQA 4XD4A 1L6FA 5A94A 3GIQA 3HPZA 4YPJA 1PV8A 3AMGA 1NF0A 1H5VA 1T41A 4PTXA 3WLRA 3H55A 1B3ZA 3W37A 1UZ4A 1W31A 4J2PA 4S3FA 1S5MA 1E0TA 3DAQA 3KZSA 2HZGA 4Q8WA 1P1MA 5REQA 3L0GA 2F8QA 3JYJA 2VGFA 3W7LA 3U48A 4U28A 1W54A 4O52A 2WHKA 1GNXA 2X7WA 2H90A 3GXFA 4H9ZA 1K9FA 4AIEA 2NQHA 2W62A 2P10A 2J27A 3KX6A 4Y9NA 2E4TA 2YOCA 1J4EA 3W9ZA 1U1UA 4S3EA 2ZZ1A 4GIRA 2HCVA 2PDUA 3IVTA 2E5DA 4W8BA 1XD0A 2ACSA 4O10A 4IQLA 2GGJA 4CU7A 3M9YA 2ONEA 3NO1A 1T8XA 1GYNA 1T11A 3O5MA 1IQ8A 4JTIA 2DZTA 1OVDA 1Z8AA 2GJPA 1OX5A 3E49A 1XCWA 5C6MA 2HTMA 4ERAA 3GG7A 3HTWA 4UTTA 2QULA 3M64A 3HMJG 4RNIA 5HPCA 3G0SA 1RA0A 2E6YA 1Q6EA 3U2CA 2ZCGA 3W2KA 5EMYA 2O7QA 4FN2A 1DHPA 4PTDA 1FKLA 1OHLA 5F1UA 2C13A 2A3HA 3HFTA 4RW3A 1EPXA 4DO7A 1D8CA 1O95A 4G8TA 3CGNA 3W01A 4F9JA 3H21A 2QPUA 4C6DA 3ZR6A 1TE1A 1GVEA 5C9RA 2CLMA 1DWJM 1XLDA 3WZ0E 3GRIA 3FVMA 1H3GA 1FWJC 1VCGA 3IJQA 3LMYA 1W9UA 3IJ8A 2WM1A 3II1A 2EPHA 3UZXA 4Z1DA 4M1RA 3TJ4A 4PFHA 2NXIA 3B4UA 4AD0A 4EWJA 2OGJA 4WDTA 4UZSA 4IFKA 3LRKA 1H0GA 1Q6RA 2TPSA 1D7HA 1UD8A 3S2CA 4E2OA 2PPGA 2PDLA 1ONXA 3BGJA 1F6YA 4XAPA 2E9MA 4MWAE 3NURA 5E93A 3UD6A 1IWBA 3VNKA 3GO2A 2Y88A 2XIOA 3DG7A 3EMCA 4H9YA 4AD3A 5DELA 1H7RA 5I07A 3LGEA 4FOKA 3W1NA 5C55A 4H9TA 1B0IA 1TVPA 3TXZA 2B7NA 3VTRA 3G1HA 2PV3A 1KM0A 1BKSA 3HQ1A 2ZA3A 5HA7A 2VX5A 1SU5A 4D6GA 1JNTA 4US5A 3WQDA 4DHGA 1UH4A 2P88A 3TZFA 1SR9A 1WX0A 4X0VA 2WOQA 4H9MA 2W66A 2BS9A 4QLKA 5FAGA 3O06A 2EJ1A 3OZMA 1YE4A 4AMAA 4QQUA 1YADA 4WXZA 1QWKA 4W84A 3M0ZA 5TBOA 1A5NC 6CGTA 1L9WA 3ATZA 1FOBA 4IJCA 2KAUC 1B9ZA 4QGCA 1VGAA 4O1BA 3EOUA 1BG9A 3VE7A 2CLFA 4DZ3A 5K3VA 4CN4A 4XBKA 3T1GA 3S9ZA 3MV01 4REQA 1NFGA 2IKJA 2VYOA 8XIAA 2AGTA 1KBIA 3VIGA 1EQPA 4UC5A 1D6OA 2Y62A 3SM0A 4W85A 4JX4A 2DG3A 1RVGA 2DZBA 1UKQA 1O4UA 2JGQA 3ITXA 4D1JA 4F48A 4IXXA 3LRMA 3OA3A 5M2FX 1A53A 1GKRA 1AL8A 3F7JA 2IKGA 4NJKA 1TR9A 3PAOA 1XLCA 5BXPA 3R8GA 3EMQA 4EACA 1VBJA 4GE8A 1GYLA 2RSEA 4HZ8A 1TJ1A 4FNSA 2DZSA 4XO7A 3GTNA 1P7TA 2J7DA 2VZVA 4WQ6A 1DPMA 1QT1A 2PEVA 4QJ4B 4LY8A 2V69A 4JQ3A 1CPUA 3DFSA 5CBJA 3OLIA 4KEUA 2RURA 1C7TA 3GVWA 4NASA 3SB0A 1NOWA 3UQAA 3P3BA 4FS9A 5C7VA 1R3YA 2YCLB 1W3HA 3U4AA 6XIMA 1UYQA 4RV8A 2Y24A 3ODKA 4TX8A 1CDGA 3BLOA 2NV1A 1O12A 2HWGA 2CLPA 3UGVA 1W1TA 5DQPA 3VDBA 1EPVA 3SUWA 3VOHA 4WDUA 3AFBA 1QPQA 3BGGA 3FXGA 3AXXA 1KV8A 1V3KA 2XVKA 2Q5AA 1XG4A 4XTDA 3HG4A 1VKFA 4HP5A 4H83A 1XLAA 1ISYA 1GW9A 2Y7GA 3T2PA 1TV2A 4EAYA 2BVDA 4E4FA 2ZRZA 2WKJA 4RK8A 2VRKA 1MRAA 5FEZA 1RPKA 3KP0A 3DFPA 2N87A 4AZ7A 5FCZA 3R6IA 2FGBA 3UETA 2XP6A 3FGCA 5E6ZA 2HJPA 5EU9A 8RUCA 4HHMA 2WSPA 1MO0A 3VIMA 6TIMA 3EZ4A 3UG3A 4F79A 1W3KA 1A5MC 4C6NA 1OK4A 3CTLA 1E3ZA 1X98A 1ZGDA 3HV9A 1UPMB 1GOKA 5K4ZA 1TCDA 4Q33A 1LLWA 3W29A 3HG2A 4IHCA 1JPMA 3NQDA 3TW9A 2DVXA 2XM2A 2FFIA 4OQVA 2F84A 5B80A 3M47A 5E6YA 1OFDA 3KE0A 3T6CA 4ZPWR 4HHPA 1TUXA 5EFFA 1YRRA 2FLIA 3U0HA 4DF0A 2ZUVA 1HG3A 1QO2A 3WYZA 3A4WA 3CZEA 2CBJA 3NFUA 4JTJA 4Z1BA 3UWQA 5K9CA 1ME9A 1JNEA 2DU2A 2XZ7A 1ZBCA 3DGRA 3NYDA 4PTMA 1TMLA 5AYYA 4D72A 1KFWA 1ZHAA 3XINA 2VEMA 1D8WA 2R94A 3O15A 3V0SA 3SGZA 4JS3A 2GOKA 1UD4A 3SZ8A 3EDKA 1DJNA 2Z1WA 3NTYA 1NFPA 2J7EA 3TWBA 4GVGA 3NQ7A 2PWFA 2D2OA 4XVDA 3PRDA 3VE9A 3EWXA 5CEWA 2MLZA 5JU6A 3O5PA 3D0CA 3GXTA 1FJDA 1VPXA 1A3WA 1SMDA 2J9YA 5CZ0A 4ZVJA 4WX2A 1XLEA 3NQVA 2RH9A 2JIWA 1RVKA 4HNCA 2L2SA 3GBEA 4AY7A 2J8GA 3ARWA 4V27A 4W5UA 1NDYA 4NL1A 3WJSA 2ZOXA 1HF6A 4LW7A 3QMSA 3CJPA 3M0HA 1K9DA 1TV7A 3MZNA 4H6RA 3CUHA 5I79A 3PBGA 3GDMA 3K46A 4W9QA 2IXVA 1YX1A 3TN3A 4DJFC 1VEPA 3GDKA 4JFWA 2ZUNA 4K6AA 2PGRA 4LANA 3F2BA 3A23A 3MHGA 2GWGA 2WCSA 1JPDX 3CM4A 1JR1A 1JI1A 1BTCA 3BLFA 4RPPA 1H61A 3PANA 3GU9A 3GXNA 3LNMA 3K2GA 2EKCA 4S3AA 3OVGA 3VIFA 4GG9A 1PB0A 4FMVA 1YEYA 5C9ZA 1XRFA 2Z0IA 4BFAA 2RDWA 5K9XA 5AB3A 4XB3A 4KF1A 4DBDA 4TYOA 3WF1A 2XP7A 4IPJA 1ZRQA 3LQLA 3I4EA 1RR2A 2F7FA 2PDNA 4TV5A 2NWSA 3RK8A 4LNCA 3QV9A 3OGRA 4NI8A 4DRKA 3GNXA 2XVLA 1A50A 3KAIA 3QPYA 1W3LA 1MFUA 1U22A 4FNUA 4LS0A 1FWRA 3W1RA 4L64A 2XFFA 4JTRA 2F23A 3LPFA 5REQB 3NGJA 3L2MA 3TYDA 2ZXDA 2FKPA 4QEEA 1W5OA 3NSMA 4R53A 4N9BA 1UPPA 4QT3A 5LA0A 4E5TA 1LLOA 2AL2A 2DSZA 4DPQA 4DJFD 2G4JA 1FBAA 1UBSA 3GHTA 1LTDA 3GW3A 3UZ5A 1QR7A 1JDDA 3NQBA 4N4QA 1QO5A 3EEGA 2Q02A 2OZ3A 3TCEA 1XF0A 1GKQA 3OU8A 4D6DA 1KFLA 4HNVA 5I6SA 1FKIA 3KCJA 4L9XA 1OJXA 3QHNA 1UIOA 5E1QA 1K8YA 2QUVA 4L7ZA 2DIJA 4E3TA 2DJLA 3RM4A 1A5UA 3BC9A 3NG3A 4LAMA 3V5CA 3C6CA 4PN2A 3UJ2A 2FIQA 4PMYA 2R1MA 3AS0A 1FP8A 3WBXA 2ZC1A 3O0KA 2YCKX 2KX9A 3CZKA 2ETNA 2XPAA 4MB4A 3BOFA 1E1CB 3VM5A 1JXJA 3R0UA 4JQAA 4MYAA 5BCAA 4PH6A 1IXQA 4DQWA 4QAIA 3ZOAA 1EXBA 3WF0A 4JHZA 2ZXBA 1IWAA 1W6TA 4MNMA 3T08A 3OBAA 1E6PA 3BLPX 3KBSA 4YXGA 2C0HA 4HIBA 3BCDA 3KBVA 2QYGA 1Y0OA 1JGMA 1L6GA 3K30A 4WY0A 2QKFA 2HS6A 2J24A 5AECA 2XSAA 2OYKA 4GUJA 1WKYA 1TV8A 4AAJA 1JRCA 1PUDA 4GABA 3KVMA 1CECA 3A3HA 1PZ2A 4C6OA 3IKGA 3R58A 2HNEA 4KQNA 1TPFA 4HYRA 4GISA 4AW7A 1KGXA 2XYLA 3V16A 4B5WA 4H9VA 2QF7A 4ZQNA 4FF7A 1Z32X 3FAWA 1UP3A 2CHNA 2I5GA 3NO5A 2DT3A 1IGWA 4EIVA 3JZUA 2RDUA 4QG8A 5FD0A 5LSMA 1MUWA 3CQIA 2D20A 3H70A 4M29A 1R3SA 1RZMA 1W3NA 5H2ZA 2I7GA 2A1YA 2YPIA 4MPKA 2WVTA 3PR2A 3NCOA 2INZA 4LAVA 2WHLA 3H2AA 4PMOA 1UQZA 2GPTA 1LWIA 4UTLA 3OW1A 4AIBA 2P8BA 1DXFA 3MW7A 2VVNA 2GVEA 1VP5A 2HRWA 4K8EA 4KBXA 2WJDA 3VO0A 3UWYA 4UTMA 1PDYA 4BF7A 4RNJA 5DY2A 4X9YA 2C79A 3MUZ1 2HEJA 4DRSA 5I03A 3FSUA 3HBLA 1BWLA 1I0BA 2XFRA 3WNOA 1VQTA 1R9YA 3VDAA 4GY1A 1IEIA 4WDWA 5HWCA 4W93A 1FHVA 4S2CA 1RUSA 2H8ZA 1FXQA 5EYWA 2AMGA 4QHRA 4EPKA 4DBEA 4MJZA 1JF5A 1KA9F 4O50A 4C1KA 4IGSA 1CI1A 2DG4A 4ZR8A 4NKCA 4B16A 3KAGA 4RXGA 1ZCCA 3W26A 1XH0A 1GG0A 3PNUA 1V0KA 2O7SA 1PJ9A 4RDYA 1WOAA 1CGXA 4NRRA 4ZA0A 2OT1A 4M0XA 4ML4A 3UU0A 3CHCA 2H6RA 3ARQA 2G97A 3LHVA 2EHHA 3TAOA 3FNDA 5EKYA 1HGWA 4OV9A 3E12A 2YDQA 4PMUA 3UPWA 3AROA 4JL1A 1DQWA 1DIOA 1W17A 2X41A 4O1FA 3F4DA 3C3UA 1ZJAA 1QDSA 4J4KA 4OT7A 4Z1YA 2JKPA 3RPDA 4A2SA 2FJUB 4O1DA 1B4EA 1EZ2A 3SQLA 5LXXA 3EDDA 2X0YA 3WEMA 1ADDA 1DTNA 1KTCA 2C91A 3VD5A 3BO9A 4LYRA 3NPUA 4DLMA 3HPSA 3N34A 2J6XA 1QPLA 1E55A 4ZB2A 3VX1A 4IGNA 3A22A 3AO0A 3QZAA 2ZZ5A 4LXFA 3RX2A 4B90A 2RUSA 4WGHA 3UJEA 3FGCB 2DSUA 3AIRA 3NEVA 2PV1A 1PYFA 1ZBWA 3I6RA 4GKTA 2VC7A 1MZRA 2XP9A 3UR2A 4J2MA 4GJIA 5CQ1A 2CC0A 3EIPA 1UA7A 3DYPA 1UOKA 4U5IA 1WUFA 1N8FA 5A5WA 4ZO9A 4KWUA 4KRTA 5E9XA 2J7GA 1QZ2A 2J77A 2ZICA 2XISA 3WMCA 1TFVA 4L3NA 3GBDA 3UXLA 2PAJA 2QCLA 3KZPA 3W1AA 1YXCA 3C0JA 1B9BA 1R30A 1YPFA 2HDJA 2X1SA 2P3EA 2NSXA 5EMMA 3AQUA 3EOLA 4Y96A 3MVTA 5H91A 1HNYA 4NZFA 3CUFA 3EKZA 3SW6A 1TCMA 2JQXA 3E6EA 1SZEA 4R3UA 5LIXX 4URIA 2BY3A 3REQA 4DB7A 2VOTA 2ZR6A 2WPGA 4G1NA 4BJHA 3KCEA 1UR0A 3KL5A 1XSJA 1Q1CA 2NT1A 1E1FA 4O1AA 4DBWA 1IXPA 1WXZA 4OV4A 3E9AA 2HNHA 2TRSA 4A22A 2YX0A 1CGUA 2CW6A 2DZWA 4C6IA 3EGJA 3INPA 1TCOC 2RGLA 2PWVA 1YE6A 4PRWA 2PP3A 4RE4A 3L5AA 3BANA 4AF0A 2PP1A 2XVNA 3L68A 5I23A 4ZOBA 3WNMA 4HU4A 3LCLA 3L5LA 2JEPA 4JFMA 3NA8A 4RZ5A 2Y7FA 2VO5A 1C8XA 2YXXA 3PY2A 3RCMA 3KACA 1CB7B 3Q45A 4GY7A 2HROA 2IPFA 1K8XA 3M0LA 1LJYA 3DENA 1AMKA 3E96A 1OGSA 4XKMA 2VN1A 1U1JA 1TIWA 3M0IA 5FIPA 3LUOA 2EPNA 1DTUA 2GGGA 4H00A 4ROPA 3QMRA 4LVFA 4FP1A 3WQ8A 1ZJIA 2XWEA 1JCLA 5K4XA 4K38A 4FALA 4IP4A 1QOPA 1X8CA 4UOZA 3HPXA 4GHRA 4H9XA 1HTIA 3F4VA 3LY0A 1IGSA 2DSKA 4K3ZA 3TV8A 5BOEA 3KVJA 4GH1A 3VK5A 2F2HA 3HO8A 3W53A 1W1ZA 3ENLA 3P82A 4JHOA 2IPGA 2QCEA 4DJDC 2WJZA 3QC0A 3U8GA 4EVZA 5C7HA 4CCZA 1XC6A 4EX4A 4MYXA 4QXIA 4XIMA 3M7WA 4GZ7A 1H50A 3BAIA 1QPKA 4DO6A 3CT2A 3H7UA 5DMNA 3DESA 3RLUA 2UY3A 2AL1A 1EL3A 4FNPA 4HU8A 2XPKA 3V36A 1WDPA 3VNLA 1OD8A 2J7BA 5KZDA 1MEHA 5HUPA 4LX4A 4DRPA 1L2QA 1PL9A 2DY3A 4N9DA 4JTKA 1Y5XA 2AL2B 2ZC8A 4GC4A 2P5NA 4MNKA 5D09A 5TIMA 4GKLA 2J25A 2YCEA 4O4VA 2X7VA 3ZLGA 2YYTA 2GQ8A 4XV0A 5GVJA 5I24A 5JBFA 1PTGA 5C0QA 3P8JA 2VRJA 1HL2A 2NLIA 4K8GA 2QR6A 3B9DA 2OJPA 4YVPA 2Z1KA 1OFOA 2XWDA 3F2DA 3SIZA 2RJGA 4KEVA 3BAKA 1LL6A 2GJXB 3HGOA 4G7FA 5E5CA 3QR3A 2HQAA 3QGKC 1AH4A 5SWUA 4FIQA 4I5RA 4XISA 2GQ9A 2ZRXA 1J8VA 1SZFA 1H7XA 1RA5A 2JZVA 4C7FA 2YJQA 4GVHA 1UWUA 3BLLA 4XZMX 3RU8X 1E5NA 4ZQCA 1NAL1 4DJDD 5C9XA 3C2FA 1M5WA 5G4WA 3RPMA 3TW6A 3K1GA 1Q6OA 2LKNA 3W7JA 2C71A 4MKSA 3LGGA 2EJAA 2GJNA 1VBRA 1FKJA 3WG6A 3GTHA 4UCGA 1TV5A 3CL8A 1C8VA 4NNRA 1WE5A 2X42A 1U5VA 1F8AB 1Q5MA 1F6PA 2G3FA 4EF8A 5I0DA 3QZ6A 3RPTA 3WNPA 3E2RA 2CZEA 2P1FA 2YZRA 1GUVA 2TODA 2ADAA 1V6VA 3O3RA 1GTEA 3R5EA 1UWIA 3IS4A 4IM4A 4IUGA 2ZR4A 3T0TA 2ZX7A 2OXNA 2BSLA 2WHMA 4MJMA 1Z9AA 4M6UA 1I9CB 1GHRA 2OQYA 3R12A 1F7BA 4H7ZA 3UI4A 1LF1A 3GVQA 2PI6A 4IICA 1TTQA 2YL5A 3MBFA 1MYRA 3GKAA 4TX0A 2E1WA 2WC7A 1VHCA 1F3WA 4OUIA 5A6BA 1UR3M 4PB5A 1ME8A 5AHMA 4PSRA 1RH9A 4UQCA 4FLRA 4QDMA 1QPOA 4J4NA 3U4FA 2Y63A 1TPDA 1DJQA 2OLHA 1I75A 1KTNA 4U84A 1H51A 1DORA 1FHUA 4AWUA 1KFCA 2Q8LA 2B4GA 3BZJA 1YYAA 3S5ZA 1CYGA 3WY1A 4D71A 1Q45A 1NWTA 3F5KA 4JBRA 1J4HA 3B8WA 5HATA 1QI5A 1PTDA 1NU5A 1EYMA 3WDJA 4TW8A 1QOQA 4AHOA 3C8FA 4ZOCA 3A4JA 1NM9A 3CL6A 1AD4A 2OWCA 3WQ6A 3VIOA 2Q8XA 3CZ8A 1J79A 1K1DA 1F8IA 3LSBA 4Q4PA 1A5LC 2BY1A 3G1VA 4EAMA 3RNDA 3WUGA 2VEFA 2H9AB 2AQOA 5HTGA 1OM0A 2VGGA 3GAKA 2ZZ2A 4GYJA 4G50A 3PRBA 1R2TA 3W2JA 3VIJA 1EOMA 3FY1A 3CUJA 4H6EA 4NX0A 4G5DA 1XDJA 1NY1A 3OO2A 4UIOA 3H2EA 4ZPTR 2J13A 2DZAA 3FS2A 4FX6M 1YHTA 3BCJA 1I2PA 3TLLA 5JBEA 3AS1A 4JYSA 2H8XA 5EFDA 2PZNA 4POCA 4AYGA 4GQGA 4AVFA 4U33A 4LAXA 2PDXA 3N19B 3IJ9A 2EPOA 3T07A 3KBMA 3OQ8A 2PODA 1RQHA 1ZNNA 3GG8A 4LC6A 3GS6A 2MANA 1F73A 2ZA2A 3WH0A 1T6MA 1F8MA 3VOIA 3T0AA 2DSWA 3OEXA 2E5CA 3THDA 4A35A 2V5KA 3PZQA 1LBMA 3RX4A 4DI9A 4IPLA 2Y5JA 4BEUA 1F4AA 3I7RA 1JFHA 4WY0F 4AQLA 3U2OA 3SGGA 1ZZMA 2ABAA 2XIJA 3APYA 3UYIA 3BLDA 1LP6A 3U3HA 4D6HA 1AJ0A 3MCOA 5AC7A 1QRQA 3GC4A 1Q6FA 4L4MA 2Z2AA 3QVQA 1LWJA 1HJWA 3U6WA 2O56A 5A2BA 5HOSA 5AKQA 4XBJA 3G77A 1EHNA 4IG2B 3ECQA 1KTBA 3W7NA 2P0IA 2PE4A 1H5YA 4IXHA 2O4QA 4XAZA 1ITQA 1SW0A 3MJYA 3QRHA 3SCNA 2D1ZA 1PZ3A 2F9RA 4XK2A 4OE7A 4P61A 1E73M 5C9WA 5C2XA 3LXAA 3G22A 5DF0A 1GWJA 4NSBA 3KS5A 3N4AA 1R8LA 1O66A 2INFA 3EOSA 2INEA 5ECUA 3HJEA 3MWAA 3WJYA 4MGGA 3GLCA 5I00A 3F2CA 1VEOA 5JXQA 3W07A 1G4PA 3DFQA 3LV6A 4IH3A 2G3IA 4O1CA 3VKKA 1MXDA 2DDXA 4CGTA 3UPMA 2WVSA 1V02E 4XZ9A 4DRMA 3QM3A 4JPGA 2C16A 5CG7A 3LYEA 4ACZA 2Z1SA 5HWJA 4FR6A 3W7HA 3QFWA 3KHJA 3W7CA 4DXVA 3QW4B 5B8IC 1UWQA 2PBGA 3BOLA 1XH2A 4HBKA 4K2SA 1G0CA 4Y9PA 3NZ1A 1A47A 4M80A 1IV8A 4CD6A 4W9TA 1G7VA 4HMDA 3M43A 5CCZA 4BEQA 2NZLA 3UP8A 2MPHA 3K5XA 4X22A 3T78A 4HNLA 3SADA 1OFPA 3VKCA 4L4OA 3CS2A 1VCVA 3K8LA 4JKLA 1LQAA 2RGMA 1Q6QA 4O15A 2NQ9A 3TC3A 4NJHA 2PLKA 5DFAA 5IM51 5CBBA 2CCRA 3WNLA 3PZNA 4KRZA 2QDDA 3MJMA 3LU2A 1DE5A 1UWAA 3OVQA 4I9AA 3BSHA 1NARA 1ROTA 1MDRA 1XBVA 2TAAA 1HQTA 1VH7A 4IWWA 4UTHA 1OC5A 4NHVA 4UMBA 1JUBA 2MNTA 5JH2A 3PF3A 3DYMA 5IOBA 3TSDA 4YU1A 4HSNA 3R94A 3VIIA 1TTIA 1OIMA 1UROA 3SEPA 3R13A 3EMZA 2WW5A 5LGXA 4DYJA 5I02A 2JFEX 4OFCA 5GNXA 1E0WA 4LQ1A 4H2CA 3S6OA 4HD5A 1OCNA 1OC6A 1V6XA 5HNRA 1FX6A 1WQ5A 2PWUA 1KGUA 3TC6A 4IFOA 4EXAA 3LPOA 4KIEA 2DH3A 4AH7A 3TR2A 3KOZA 1PCWA 1VRDA 1NDVA 3G2GA 4Y8FA 1HJVA 4YN5A 3LQGA 1AD1A 3VFCA 1UKTA 1EEXA 4MM1A 3S3GA 3O5JA 5H8PA 1XSKA 1A0DA 1QMLA 4AD1A 1UD2A 5JH8A 2WAGA 1CXEA 3UNDA 2PRHA 2FHBA 5CG0A 5DRIA 4B4FA 2HMCA 2EG8A 4GZJA 3ZXWA 5AYIA 4MZYA 4DROA 2CLKA 4C6QA 1W3IA 3CPGA 1ALDA 3UWWA 3KCOA 3ZSTA 1G5AA 3RAOA 4GYPA 1CXHA 3MS8A 4AUBA 4Z08A 3RFWA 3M5XA 3GC2A 2VENA 3NL5A 3QV8A 2XJ7A 3FHAA 4U3CA 3E5BA 2NVDA 3GZ3A 4FNRA 4PCPA 4TMBA 1LROA 2HE8A 4GPNA 3USZA 1KR0A 3W6LA 4PB3A 1DWHM 4ES4A 2W79A 1J93A 3RJYA 3TZNA 5C2CA 4PE8A 5JQ9A 4OECA 5A6SA 3NJ3A 1RCXB 3P61A 2WC4A 1K7FA 2ISFA 1TA3A 2PPOA 3UF9A 1G67A 3S2LA 1GPWA 2V3EA 1XKYA 1OX4B 2CXEA 5CPOA 2FQIA 1TWSA 3KEHA 3OG2A 1BLIA 4ZBCA 2QEZA 5B7YA 3N2MA 1HN1A 3IKDA 3N6QA 4G9PA 3AHXA 3AU2A 3C3NA 1KBBA 3B3DA 1UZHA 2X8RA 2PTXA 3BTNA 4L4LA 4W5ZA 4DH0A 1EJSC 1GONA 2XG9A 4P8UA 2VQUA 1PAMA 1IZKA 1RQEA 4GXWA 2XH0A 3OTRA 4UQDA 3TJXA 4NYYA 1FD9A 2UZ9A 3E1F1 4WOZA 3CT7A 3TVAA 4W8AA 4DUXA 1K8ZA 1EQ3A 4ROQA 2D9FA 4Q22A 1WA3A 3NOEA 1ZENA 3DHDA 1LCOA 4PSPA 3C4UA 1TZZA 1WDDA 1YDNA 2Z6JA 3WDPP 1Q6UA 4FK9A 2XP4A 1KWGA 3NXFA 4MDOA 1FWGC 3URAA 3CL7A 1D3HA 3SAZA 3WF2A 4PEEA 4UMCA 3LLXA 3P62A 1QHPA 1CB2A 3R89A 3MHFA 4M19A 5CGTA 1M01A 4GGBA 2XFWA 5HNNA 3MA8A 2QQ6A 4NU7A 3TOPA 4K8HA 4B3LA 3ANVA 4ITZA 5LNUA 3H4WA 2D2GA 2QUMA 1P6CA 3N12A 2E09A 3B04A 4LCQA 4MFEA 1KWKA 1TPEA 5A8GA 5B7ZA 1EXPA 3WQWA 3O8AA 3UI5A 3HA1A 3AZSA 4X63A 5BRQA 1HP4A 3O5QA 4IQEA 2CXGA 3WK1A 1JQVA 2OYLA 4YNGA 2E6FA 3S5OA 4PUMA 5GJNA 4MSPA 2CLEA 1WZMA 1XL9A 3RMJA 3WF3A 4CU8A 9RUBA 3IEBA 1EIXA 4UTKA 5FF0A 4PUUA 4MTVA 1MXSA 2ACRA 1K8CA 1FCVA 1O7AA 3TONA 4ERIA 3QQWA 2J79A 1HJXA 4HZMA 4CQCA 1H1ZA 2ZQ0A 3GH5A 2XIMA 1Q8AA 2PCEA 1KFBA 3LK6A 1QI4A 2PDHA 1MEWA 2EGZA 2VR4A 4FNQA 3OODA 4J3SA 3HURA 5HJXA 1ZK6A 4Q3MA 3WH9A 5KZ6A 2FJKA 4LV9A 3KABA 4D2JA 4LYPA 3VNYA 4DJED 3UXAA 4GOAA 1QAPA 3AJXA 5AC5A 4XD3A 3UQNA 4LH8A 4Y8EA 1OY0A 3PSWA 4X60A 1AFSA 3OLDA 4B92A 4AXNA 2ITKA 3TOYA 1KCLA 5BXTA 2QAFA 2ZZ7A 1A80A 1Q85A 2YIHA 3NQ2A 1PIFA 1QW7A 3O6CA 1HVXA 1J0ZA 1IE7C 2FKEA 1HJSA 1KO0A 1M7JA 4LNYA 3SCPA 4RE2A 3B9EA 3FJ6A 4YTSA 2QDGA 1HXVA 3DOPA 1KC7A 1WDSA 4ZSUA 3A6OA 4DZHA 1LRNA 3MSDA 3CB3A 3GSMA 3U9IA 2JGYA 1TB3A 3QJAA 2E68A 3GG0A 3EPOA 2A7PA 4AZBA 4Q6XA 1W5QA 3VA8A 1R3WA 4DUWA 1F3EA 4OTKA 2HE5A 5G4HC 4GFIA 1M1BA 4LRTA 4GD0A 1M7XA 5I3KA 3TSMA 3NVTA 3S1GA 2PDJA 3CAVA 4GGQA 1OFQA 4ZO7A 4GUGA 2CBIA 2J7FA 3UGRA 1V7YA 1B3OA 2OVLA 2WZEA 5BRBA 1XUUA 3OG3A 4I9TA 4XVEA 3WDIA 2YW3A 2PN0A 4Z0JA 4DBSA 3QYSA 1XIMA 4KERA 2CZFA 1ZAHA 2PCQA 4EK7A 3F4NA 2PF0A 2ZA1A 6TAAA 1NQKA 3VZYA 2SFPA 2OR2A 3UCDA 4XQ6A 3L23A 3WH5A 3B0UX 4WOQA 3VAVA 2NXHA 3P60A 1JNSA 3MKKA 3NAVA 2ISWA 2JKAA 4J3XA 1IYXA 1S2TA 4CNUA 5DMYA 4ZB5A 3B0XA 4GK8A 5AC6A 1T99A 4C65A 3M0JA 1BRLB 6REQA 1WDRA 1TJPA 2QJHA 1V8EA 3UCQA 1TZ9A 4JFUA 2ZIDA 1UUQA 3CWOX 2XIIA 4IJBA 4HNUA 3C2RA 4Z17A 3WD2A 1KLYA 3IK8A 1GQIA 2PGWA 3LI0A 4HYWA 2YCJA 4J3ZA 2WSRA 3L67A 2BVTA 4H8HA 2XP5A 1XIGA 3R10A 4O19A 1JCJA 4MKVA 3MZ2A 3VNMA 2XP8A 1XYLA 1A7XA 3M4HA 2Q6ZA 1RLCL 1XRSA 4H1ZA 4O18A 5U7SA 3FA5A 1F74A 3EPNA 3M1ZA 3SY8A 1G1YA 2PGEA 3WFLA 4B4HA 2TSYA 1J10A 4ZQMA 3OGSA 1E70M 4IIDA 1XICA 3AS3A 2FYMA 2B7PA 1ZSXA 4JTFA 2V5BA 4MB5A 3ZJ7A 3CZJA 4L6DA 2ATMA 2E77A 3KBJA 5HJLA 4P7LA 1HW6A 1XLGA 3KP1A 4C6CA 4DIPA 1J6OA 2DZVA 3P80A 1MVYA 2WB5A 1IT8A 4LVAA 2QCHA 3MBDA 2E67A 4ATLA 2HXUA 2Q8ZA 4BWLC 4UZUA 2MLXA 4O53A 4N42A 1BEUA 3NL6A 1OZMA 4LEQA 5AVNA 2WVVA 1W1YA 4PCSA 3KBNA 3WH8A 3PR9A 1X1NA 3WF4A 1RY0A 1YKWA 4U10A 2YXGA 3GNPA 4WDXA 1TWDA 3W73A 3P67A 4ATWA 4R0XA 3RLVA 5FI8A 1XRTA 4S3GA 4XSLA 2B7QA 2A4AA 4NNBA 5LIKX 4UOJA 3CHVA 4NJIA 1FKXA 3L65A 2AMXA 4NAFB 3MY9A 1AW5A 4MNLA 4UBPC 4PUJA 4LAZA 1UWSA 4WSJA 3HIJA 2RUDA 2UY4A 4JTSA 5BXSA 1B31A 3S4TA 1J01A 5F4XA 4JXCA 2C7FA 1UB3A 5JIPA 1S46A 4PUEA 4BF8A 4AHQA 1XPYA 4TU1A 1AH3A 2VUNA 3OYXA 4E8GA 1CBGA 4E0CA 4I7WA 5D30A 2ON3A 3S9IA 3CU2A 2QZRA 3T7VA 4WR3A 3EDFA 3QXBA 2QIIA 1CXFA 2GGEA 4QS6A 1R7OA 1XYBA 2D3NA 3TJLA 1E4NA 4YWIA 3THUA 1GTHA 2XVGA 4QLLA 5HULA 3AICA 4K7YA 2IS7A 3EKGA 2GK1A 4AD4A 1BVWA 2ODOA 4ADTA 1UR4A 1SZGA 1J0YA 3A47A 1JPHA 1Q6GA 3JR2A 1UD5A 1QU4A 4D6CA 2REQA 2YSWA 2A0NA 4GCXA 4A8IA 4J40A 2E6AA 1VYPX 1FP9A 5M1TA 2VC6A 2Y78A 4DWDA 4GUFA 3T40A 1ADOA 4Q8VA 2FZDA 2PD5A 4U2ZA 5AFDA 3OB8A 4GC3A 3W2MA 4QIBA 5FJIA 4A29A 2Z2BA 4HPHA 2RHGA 3DDMA 3TTQA 4KEZA 1KRAC 2OKOA 4QX4A 1E6RA 3W2NA 1Q66A 4W9PA 4GNKB 2J78A 5IHSA 4DM1A 8A3HA 1WUEA 4FPSA 1EA9C 4FZIA 2QCFA 4XSMA 5I09A 1KKRA 3CV2A 3MKVA 3D3FA 1TA3B 3EYPA 4RX0A 3G5EA 2CZDA 4AISA 3TLQA 2XGIA 3TMLA 1K7XA 3PBMA 4XAFA 2JEQA 4ECLA 2QMJA 3CPUA 4FR1A 4DWSD 1UG6A 1V6WA 3GUGA 3PPFA 2PRMA 3WJXA 2NQLA 3CZGA 1A0EA 2OSXA 5DIUA 2CESA 5EA9A 3EDJA 4CKQA 4Q8TA 4HCLA 1QK0A 5K7JA 4Z2KA 1TWZA 4DPPA 4O57A 3LUTA 1K6AA 3RGTA 3GFXA 2Z26A 1ITCA 4MG4A 2VCDA 1NOUA 2F6KA 2ZKMX 1R9ZA 3KOFA 3ZYZA 2PDPA 5CJ5A 1KGWA 4R9OA 4N2YA 3E0LA 2ZUMA 2WJFA 3I65A 1DWAM 3ZVHB 3ZVIA 4INFA 3DKLA 4JCLA 1FH7A 4B2DA 3W1TA 1DKWA 1TQJA 1MQRA 4Z2JA 5DXYA 1BVZA 2X30A 1CWYA 1ZLPA 3GC5A 3VGDA 3N2BA 3A64A 4ZL1A 3QLDA 4LB4A 4PMJA 3UXKA 3THQA 1TMHA 2WWDA 3CQ0A 1B3XA 2VX6A 2Z4GA 4LALA 1P0KA 3PJUA 2V68A 2OYMA 1QNQA 2ZX9A 2DP3A 4WEVX 1LT8A 4AEOA 1I2NA 4DY1A 1RXOB 4AWTA 1ONWA 3HN3A 3O6DA 2PWGA 3W75A 2GJRA 3NL3A 3O5DA 3N2OA 1KM5A 3LEPA 3MVIA 2BMBA 4PULA 3GHUA 4GYFA 3U7VA 4BK9A 1QXLA 3QV7A 4GI4A 5ABGA 4FB7A 2ZRYA 1IHIA 4E6MA 3N11A 4IPPA 1JCXA 2Z7GA 3HQOA 2JK2A 4V33A 3LXBA 4NZ5A 5G4EA 3VPLA 1A4LA 4Z2LA 2FZ8A 3MP5A 4WKHA 1QNRA 1CLVA 4HN8A 1QJWA 1WZKA 1KKOA 1TQXA 3BQ5A 2DW7A 3T4CA 3OOQA 1OG6A 1PWLA 1UP2A 1V3LA 2C8NA 1UJPA 3BK0A 3L4UA 1AJ2A 1PHQA 1TTPA 4O54A 3IUDA 3W70A 2E7FA 4Q8UA 5AHIA 2WV8A 3O5OA 1ZJBA 3J7HA 3Q67A 1QOXA 4AVOA 2VT0A 2OLSA 1K9EA 2PDYA 1EP2A 1TRDA 1RSCA 3EX3A 5DCEA 2VRQA 2QXWA 3WLHA 4UFLA 5GJMA 3AIQA 2ABBA 2VC9A 3TH6A 2RAGA 2R6OA 5H6HA 1KRCC 3WQVA 1MQPA 3A9BA 1H4PA 1DJIA 3IAQA 1Z6KA 4UR7A 2PGFA 4NI3A 2VX7A 1V08A 2DFAA 3UR8A 1H11A 4FHAA 5BW6A 4MJ4A 3MUIA 3TTSA 3OQEA 1CZ1A 4TXEA 6ALDA 1AW2A 2V5CA 3LBCA 4FIRA 1W91A 4O0ZA 3UYCA 3CHDA 2VHLA 2QDHA 3KZ7A 4JHMA 4WUIA 3WMLA 3EEZA 5DO2A 3TP4A 1AZ1A 4CQBA 1VJSA 3VFLA 3SCRA 3TA9A 3FIGA 3UZYA 3UT0A 1EB3A 3L66A 2AGKA 1S3HA 3NL2A 3CO8A 4Y9AA 4J3UA 3LCXA 1B3WA 3L4WA 2V38A 1EJTC 5C71A 1NH6A 3OIXA 4PYSA 1TYGA 5BMWA 1C29A 3KUMA 2BWGA 3FXYA 1YW5A 4PRRA 3NRKA 4MAZA 2WMIB 1FUYA 2P3ZA 1E4IA 1I45A 4N6EA 3WDQA 4D8LA 3QW3A 4C6PA 5FJJA 1FAPA 1BQCA 3ES8A 4UR8A 3O9NA 3RU6A 2VEKA 2ZX8A 5BXRA 1G4SA 1EX5A 3TNBA 2D0HA 3ZT5A 2Y6ZA 3VIPA 4UDMA 3ONBA 4EP8C 3N04A 3RLHA 4EPDC 2QMKA 2XFYA 1O5RA 4AY1A 1EWDA 3M6YA 1UR1A 3NPWA 4KMQA 2ZX5A 5CPTA 2CHOA 1SFJA 1XXXA 4MY1A 4HK6A 1V0NA 5BU6A 1XISA 2IUZA 1BQGA 2PC4A 4HPXA 1M53A 3SI9A 4Z2GA 2CZVA 4PODA