1XHHA

Solution structure of porcine beta-microseminoprotein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
91
structure length
91
Chain Sequence
QCYFIPNQSLKPNECQDLKGVSHPLNSVWKTKDCEECTCGQDAISCCNTAAIPTGYDTNKCQKILNKKTCTYTVVEKKDPGKTCDVTGWVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel solution structure of porcine beta-microseminoprotein
pubmed doi rcsb
source organism Sus scrofa
molecule tags Unknown function
molecule keywords beta-microseminoprotein
total genus 3
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1900 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xhhA00
1XHHA
chains in the Genus database with same CATH superfamily
5EBWB 3ARUA 2DIEA 5FA3A 1D9KC 2EE3A 4K7FB 4KQ3H 1ZHKA 4Z0BL 4YDZA 1KEGL 3MN8A 1S7RA 3TF4A 1IKFL 2K4AA 4U7MA 2J43A 1PBYA 3SODB 1Q72H 4UZGA 1XGRA 4L8DB 4PLKD 2DWDA 4PJ9B 5KVEL 2NZ9D 2VC2L 5EU6E 3SD2A 2PWHA 4TF4A 3ARXA 2J1XA 3ZL1A 3MRJB 3OKNA 4MMXA 4AJ0A 2PTVA 3D9AH 5EUKB 1U8QA 5GS3A 1BIIB 4EAEA 1D5BA 3ARBA 2QMJA 1ZV2A 4GXUN 2Y07L 4M8QA 4GBXC 3P0YL 4DPRA 4OVUA 5DI8A 5DS1A 2K45A 2QFRA 3VRIB 3HNVH 2BSSB 3CHSA 3BWAB 4FNSA 5HJDA 4YDIL 4AX3A 4BQBA 1KGCE 1OTTC 1QO3B 3RNKA 4FNTA 5TE4H 1B90A 2E8YA 5FKAA 2A74B 1HINL 4PRIE 2X0WA 3U1PA 4ZSOB 3LSOA 2K7PA 2MQ3A 2EDRA 4FQXC 5CBAA 2K8QA 1T1ZB 3I6GB 1QRND 4F7CA 2H2SC 4K94H 3VGHA 3RUGB 3VXSE 1BSIA 1AD0B 4BHUA 4HH9B 4WKZA 2E5EA 4FFZA 1CK0L 2WINB 2ORBH 4P5MA 2Z3FA 5CCGE 3EG9B 1JK9A 4UM9B 5HHQB 2AZAA 3FPYA 5SX5H 3L2LA 4NC0B 2Q8AH 4WV1B 2JJTC 1M2VA 5HGDA 4DQOL 4GS7C 4ZTOL 4Y2OA 4EN2A 2CRIA 3US9A 4OUUB 2VZ1A 5KSBE 1YMHA 4ZZKA 2AJVH 1OGAA 2N59A 2HN7A 3QPXL 1IEHA 2P8PB 3QWRA 1FE8L 5I8EA 1TVHB 2P44B 5AWNL 4JO3H 2P4AB 2I24N 1UC6A 3BPCB 3AXHA 4WO4B 2IAMC 3VXUE 1QLEL 5CINH 3UBXA 3C8KA 4JRYD 3CDZB 4OQ1A 1MCLA 1JS4A 4PJ7F 4IRSD 2NTFA 3QXVA 2XBTA 5J13B 5JHAA 4YWGH 3DMMC 3APCA 3FRUA 5JXEA 2D7MA 4WF7A 3TO4A 2H0PA 3B2DC 4TQPA 2LLNA 4U1JB 4CL7A 2AVGA 1TQUA 4P2OC 2E74C 2O6EA 4OCRH 3VGDA 3X1GA 4ZS7L 5FM5O 3QORD 3X14B 3VFPA 2DQFA 3S3SA 4BIKA 4ONGH 2WKGA 2Q8BH 1TXKA 3ZGIA 2Z34A 2NNAA 2WMPB 4FQQA 1S7VA 5AVWB 4Z7OB 6CGTA 1YNKH 3MMEA 3O2WL 4K3DL 5SWSE 2VT0A 1BX2B 3GMMB 4ZFGL 5DLLA 3TESA 4KQ0A 4RSVA 2X9XA 1PTZA 2PP9A 3KGSA 5F97E 4YEEA 1HCFX 2ZKWA 3I02A 2ZX6A 4L1LA 2YD3A 3FW6A 2HRLA 1Z0NA 4K9EH 1LWHA 5IJVB 2X87A 2OZ4L 3KLAA 1B3JA 3ILEA 4JZJA 5A3IC 3FQWA 5ISZE 5T1JA 2EEXA 3GKWL 3D0VA 4FQHA 4K8RC 2I27N 2L04A 2OMTA 3ECBA 3MRBB 1FNAA 2NY2B 1PDKA 3K0WA 3KXFB 3L3GB 4JDVA 1QLFB 1V3LA 3MV8A 5AQ0A 5F93C 3S5LB 3NOIA 4APQB 2MCPL 5JPNC 3CSYA 5ADOH 3EYOB 1U2CA 5KYYA 5AAMA 2W92A 3ILQD 1NCAL 1CYGA 1YEKH 1P4LA 3QHFH 5ACLA 5CCJA 1MCCA 3Q3GB 5JW4N 1S5IH 5INCA 1OF2A 2IF7A 2QQLH 1OLLA 1Q1JH 1SJXA 1SHXA 2PWGA 1LP9F 1OCOB 3DX9B 1JV5B 3CFEB 5DJYB 3E9UA 4JN1L 4KOCA 5EO9B 3BMWA 2XFXA 2A83B 4QI3A 4IKIA 1EZLA 1GZPB 3W0WD 2KBGA 5F1SA 3ZQ9A 1PYWB 2BVTA 3H8NA 4HLEA 5DJZB 1Z7JA 4F2ME 2DI7A 2JQZA 1MY5A 2MPAL 5SWZE 5AYUL 2GAZA 1AQDA 4WNJA 1VCAA 2JI2A 3KW8A 3MV7B 4FKEA 1ZKAA 3X3GH 1EFXA 4X5XA 1EMTL 3N55A 3KPOA 4HKBB 1MFDL 3MUZ1 3V6FB 3MZGB 2B2XH 3SJVA 4UINH 1GMEA 1OARL 5CJ8A 5L6YL 4M9PA 3QJFB 2YFNA 1N26A 3H3PH 1NFIA 1EJ6A 1MCSA 4TM9A 3QR1A 1DN0B 4NIKB 4G6FB 3DGGA 3ILPB 3DV6B 4OR1A 3SKOA 4IIZA 3WSQH 5HI5C 5JHLL 3QJHB 4ELKB 3DTDA 2IWGA 4KTEL 4UQBA 1YNTB 4X99A 2E27L 2IH1A 1A7PL 4CDHA 3OL2A 5DSCB 4WWKD 4WWOA 3AREB 2OW7A 4HPOH 4HEPA 5KVDL 1URIA 2RQ8A 1G6VK 3U6RA 2VZTA 2E7DA 2G9KA 3QQNA 2NW3A 1IBZA 4L8SB 4CMMB 1NKGA 1C16A 3BPOB 5I8CB 2WQSA 3Q9PA 1SOXA 3VWKA 4ABQA 3H0TB 2ZOUA 1RJLB 3H3BC 2OP4L 4G9DB 4DVBB 5J89A 2GEQA 4Y2LA 3DI3B 4GUOA 4XVJH 3VD3A 3I3EA 2DKMA 1OT2A 4W9ZA 3BD4A 5IW1A 1MDTA 1BAFL 2OBGA 3NRQA 4LB8A 3O6FB 4NQCA 1X9UA 2BSRA 5GS0D 1II4E 1MW2A 3NJGA 4XZUB 1NBYA 3AFLA 3LXAA 1G7LB 1D5XA 1QVOA 6FABL 1OM9A 1UD3A 1DQIA 1HX0A 2VC2B 3C2AH 3UROR 1EX0A 5J4MA 5EOCL 3L2NA 1Y6KR 2HG5B 2EVFA 1A7NL 1TCRA 3EO1B 1MH5A 1SM3L 1TZHA 2Y6SD 1IL1A 3FJTA 3QXTA 2QSTA 3VD5A 1QI4A 2BP8B 3LKNB 4J3UA 3UXFA 2O5NA 2VDOB 3MV8D 5C6WH 1A66A 1TQWA 4DQOH 2GITA 4OZGB 5KN5B 2YS4A 3CE1A 5F3BA 3GYRA 2I60L 4RRPM 2DBLH 3FYIB 1ROWA 4J1UB 4L37A 1NFDF 5TDNB 1HYSC 3HE6C 3LD8C 1EJOL 3U25A 2DEXX 4G6MH 4Y4KC 4S1DC 4B7LA 1FL3B 4MB1A 3RGVB 3GSUB 4KI5E 4A55A 3DHJA 3IWVA 4Z7WE 2FBJH 4Y16A 2ZNXA 3POHA 1QKZH 5F7FA 4GAFB 2VDQH 1KTRL 4KVNL 2AEIT 4TL5A 5GZOA 3JWOH 3RGBA 1S9KC 1BVKA 4ALAL 2YBGA 4M1DH 1ZVNA 4YFLI 3ARVA 4YHMH 5JQ6H 2NQCA 4AJVA 2PPDA 4MAUH 5D7JB 5DRNB 3QYCA 4Y1AA 1XFPA 2Q6WA 4DNLA 3CXDH 2UY7A 3VFVA 4YHZL 3FCSA 3DTXA 3TBVB 4G6AD 4JY6B 4QCIB 4AG4H 3U9WA 4MJ6A 2XA8H 3EBHA 4BHUI 4Z8FH 1WZAA 4ZXBA 3L7FB 1P5UB 2WO2B 3W0WB 4ZUUA 4OD1L 4JM2C 3ZTJH 2Y25A 2Q2EB 4FXGB 1SXNA 4P04A 3ZE0B 2EYTA 3ETSA 5A3ID 3OKMB 4OV5B 1G94A 1J5DA 3N0AA 2ZUYA 3HG1B 2NY1B 3MPCA 3B9DA 1P7QA 4P8QA 3UJTH 2LR4A 4FKKA 5KBLA 1T5XB 3HKFA 2IBGA 2ZKMX 3UO1H 1S9XB 5EUOA 4ONOA 5HDBE 1B0IA 3CG8A 2WXOA 4P5TD 4QKTA 4PJBA 1J5IA 3LZLA 1UJ3C 1HU8A 5EO1A 1WITA 1INQB 1RL1A 2ERJB 3A6BH 1N59B 1RJZA 4WY7H 2F53E 1JWMA 3D18A 3II1A 2H1XA 4LLDB 2VDPB 2CNZA 4XOBA 3Q1SL 3H7BB 3TIEA 5IMLA 1KMGA 3EADA 1J8KA 1EHLH 4UWQB 1M1XA 4AUJA 3JT2A 4K5LA 3F58L 1JPTH 4EN3C 3HJEA 3TBSA 3QQ9C 1JWSB 4MDRA 4C83B 4GPVA 4KXAA 1L0QA 2AK4A 5E8PB 2CU9A 2XWXA 4XVUD 3UG5A 1OAUH 4C4KT 3QUZB 1HHGB 3VGBA 1XF1A 2X6MA 1M7IA 1O7SA 5E6ZA 1BOGB 3AS2A 2I60H 3TA4D 3UTTB 3C5JA 1CE1L 1DVZA 4GW1B 3MRCA 4ZYKB 2ZSVA 3RVVD 4A66A 2X4UB 3IDIB 2Z9TA 3P3UA 3MJ8B 2DF3A 1J7VR 2NT0A 1TFHA 2F58H 3DXAA 4X98B 5ESQB 4AGQA 3M6DA 3QNZA 1YHPA 2MWCA 5G4MA 1MREL 5TE7H 4IU3A 1DJYA 1XGQB 3RBGA 4OF8A 2W80C 3BISA 1LQSR 1T6VN 1T21B 3MNZB 1F41A 1TVBB 3O2DA 4ODBD 4OCLC 2FJGA 1ET7A 1NBQA 5CHNB 1G9NC 1OAZL 2VM4A 4OZFB 3MNMA 5EUOE 4QO1A 3NBNA 3BAEH 2P1YA 4ODHL 2CJUL 1J0KA 4K3EH 3QQXA 4HXBH 4XP9L 2DKUA 2R23B 5D71L 1FBIL 3I75A 1A6PA 1RMFL 1NDGB 3UJIH 4V1DB 5DUML 5I28A 5GGVY 1LWJA 4BFRA 2YPVH 2A99A 4KNTA 1F3DJ 1UKQA 3IDNA 4AOFA 4ZW3A 2YZ8A 4YK4C 3VXMB 1WAAF 2VMDA 1XB3A 4NKQB 1CF8L 5JIDA 5EZJA 2VN4A 4I18C 3OQRA 1OE3A 2H0JA 2BFGA 2VLJA 2JKLA 2VMJA 3T1FB 2PXYA 1FHNA 1BF8A 1M6OA 4R4NC 1XSJA 3ARFC 1KN2L 2EKJA 3REWA 4RISH 3TYGH 1ZT4A 4HJ0C 1XF5A 2ATKB 1DVUA 4YNYB 5HHMD 4FMFA 1ZSDB 2EEDA 3RWHA 5DK0A 4KI5C 4Y2DB 5KS9B 1IMHC 1MI5E 4OIAA 4XE0A 1XL4A 5F6IC 4AZ8B 2FLRT 5CINL 4AK2A 3SO3C 3FFCD 1IQWH 1KXVC 4PJ6A 3VFUB 3O8XC 3V4PH 2PMZA 1DEDA 2FTAA 4CN1A 2CUMA 2ADGB 4MX7B 5C6TH 1YEFH 3B2UD 3CIAA 3FNKA 2K8MA 3BEWA 4U1IA 4NZRL 3HR5A 5DZ9A 4OLUH 2A77L 5F7YC 5GIRA 4Y1TA 2AP2A 4OKVA 3KWWB 2RFXB 3ABKB 4P46C 5CWSB 4KHXH 1CVRA 5CSBA 5IUCA 1PZSA 5JW5A 4N24A 5AB1A 4MB5A 4DEPB 5IMOB 4BD4A 4G80A 3LV3A 3MLVH 1K2DA 3IJ8A 2WJ5A 2AJZB 5DLML 3SB3A 1JZJA 3MYZA 3WLWD 4KRPC 1E6OH 3P2TA 5AW0B 5CD3B 1OOAA 1G5GA 1E4XH 1PSKL 5H94B 4WNQA 3WNNA 5KW9L 1YY8B 1IT9L 2R27A 3PJSA 5F7MC 4NSKB 2ZWLT 3IFOB 2XBDA 2IH8A 4KTDL 2KPNA 4N1EA 4TRPL 3SY0A 4F57H 1CTMA 4IRJA 3TNMB 2XVGA 3N40P 2GEEA 1HZHH 2BVPB 4DKTA 4HOWA 4HS6A 3QFDB 3FU8A 4WHYG 4O9HL 2Z93A 1K9TA 5KYXB 5A2AA 1M05A 3C9NA 1N19A 4GP8B 2R1XA 1JF6A 4WV1A 4WU5A 1W0YT 2IOOA 4HA1A 4E0RB 2X10A 5HGDB 2IEPA 1AR1C 3T08A 2D0HA 4HVBA 3BN3B 2F7PA 5I8EB 4A6YL 4NUJB 4JK0D 3OAZK 1ZWIB 3BIKB 1V27A 2F15A 2VLLB 4XVJL 2VZVA 4OVVA 3IMSA 1A3LL 3FC8A 1R4XA 4Y19D 1A6TA 4RFEA 1O6VA 5IVXA 1MY7A 1AZCA 4MDJA 2FECL 4FZ8L 5F7DA 1SDDB 2CGZA 3BAJA 4JM4H 4RX4D 5FB8B 2G3NA 3V7AE 3GSQA 4ODXA 3MRHB 2GG1A 3TO4B 2V7NA 2WWNA 2R1WA 2HMIC 3G7TA 3H2QA 5DUMH 1EGJH 3NN8B 4HUWA 1FORL 1OAQH 1H8LA 1WZ1L 3D33A 1RK7A 4PRPD 4DP7X 2EUXA 2Q10A 4YSCA 1S9WA 3LQZB 3STZB 4HETA 3GSWA 3VDAA 3A4EA 4XRCB 3L3JA 3WOVA 3HNSL 3UG3A 4XI5D 3RE0A 1QWNA 3HC3H 2DBJA 2PR4H 2G3ZA 4LVHB 2DQMA 5I30L 5L6YH 1EQWA 1TKWB 1ODAA 4HZAA 1X5KA 2FO4A 4QXVA 1FLRL 1GIGL 3BN9D 4P2OA 5D2LB 5BV7H 1ZANL 4YHNA 2J8OA 2XI9A 1D2OA 1JCVA 3ZL4H 1IAII 5HYSG 3DK2A 3RL1A 1E2ZA 2DMKA 4XVTL 1BZQK 2MSPA 5J6SA 2UUDH 2XWDA 1MI5B 1NDMA 1XB6A 4KXZI 4WSKA 2KC0A 4HG4J 5CD5C 4G8GB 3GXNA 3HE7D 3QIUC 4QT5A 2XJLA 4NQCE 1GSMA 2P5EA 2WYZA 2X53A 2XWTA 4RAVB 2JMRA 4U3SA 5IB4A 2K78A 2YOCA 1OSZB 4X6EB 4P3DB 3G04B 3FQTB 4U6HB 2V9RA 1MFBH 4JFFB 3VXNA 15C8L 1A7OH 4J27A 3CDYA 3CZFA 4OCYH 1MF2L 4YL9A 5K39A 2OTWB 4JDVB 5I19H 5IHHA 2QQLL 2TRYA 4PIRF 5HHVL 5B1KA 3WUWB 5ITBL 1S9VB 4U1SA 2OMXA 1BAGA 3BUBA 1TG8A 2APFA 4GNKB 4UT6L 3BOVA 4OCXH 1PJ9A 1NMCB 2DMGA 4OGAC 4HFUL 4E9SA 1ZGLB 4PTTB 5DD3L 1KPRB 3KBHE 4JDZB 1ID2A 3M17A 4RGOH 4B9ZA 3LN4B 1BZ9A 1ZE3H 3FFDA 1JTOA 4A68A 3GTNA 3S36X 1WQVT 4XAKE 2KLTA 4URKA 3MACL 2Y72A 4PN6A 2E47A 1OGSA 1U58A 2CDGA 1R3HB 3B9KD 4D0DA 2ATPB 2UZXB 1FO0H 4FL4C 1DQDH 3Q6FA 2BNQD 3I9AA 4BA8A 2YKLL 4MNQA 5FYLL 3B43A 4LHUD 3CFJA 3K2UH 3FO0H 3TYGL 4FXKC 2LQRA 2FR4A 3V0VB 3L3DB 3ZZQA 3UIZA 3J2PA 5JIHA 2HKFL 3QUXA 1WBYA 4YIQA 5CEXA 2DI9A 1TO5A 2WXLA 3BDYL 4Y4FD 2FEJA 4ZQKB 4M6NH 4NQQA 3DXAD 3TBWA 1SY6L 5EEUA 4AE1A 4ILDA 3DV6A 3WIHA 2LU4A 2C4FT 3NCYS 3CN3A 3WKYA 4CVZB 2AQSA 3LPGA 4ZMQA 1L3NA 5BV7C 2GIYA 3CFCH 4ZODA 4CJ1A 4MLSA 3MZTA 3KH4A 4YXKL 1UZ6E 4DT2A 7CGTA 1SJEA 5IHZA 3GSRB 1NH6A 1W8OA 2ROXA 4OFPA 4XXDB 5KVFL 1VGEL 3RKDC 3MUGB 2HX8A 4Y5XC 1HAUA 5CR8A 2YC1A 1I9JL 3ATDA 3ELAT 4M1CC 4ZJ9A 4QJ5B 5F7LB 1I82A 3GXDA 4K3JH 3E6FA 3OLIA 4MAUL 4LIQL 2IALB 4MYWB 4B27A 4LU5H 2ITDA 3EYVB 3KD4A 4FA8A 3P4MB 5C0IB 4WEUD 2MEJB 3WDHA 5E99H 3DMMA 4ADJA 1DBJL 4ZW7A 4HAKA 2XTSA 2BY3A 1AC0A 1KJMB 4HIEB 3GC3A 3VG9C 2X89A 3W37A 1NBYB 4P3CL 1D5MB 3SSGA 1OCCB 4NLHA 5BZZA 1A3RH 3PDOA 3MU3A 1FNGB 4X9IA 4AQ1C 4MD4A 5PCYA 3LY6A 2O6PA 4H4NA 5EH1A 3US0A 5ELIA 2WZPD 1TU2A 3TJHD 5D2LE 3Q0HA 3RI5F 3IU3B 2WWMD 2XIBA 4X8JB 3ZDYF 4ZFFA 5BUGA 1J5HA 4ODWB 4B3EA 3IMRA 3M88A 3LS4L 4E2OA 4K7PL 5EBMA 5JDSB 2CIIA 5CS7A 2Q7YB 1UWFA 2XG4B 4ONHB 4X2UA 4AK1A 1ZEAL 4QRPA 4WCYL 1S7QB 5AKSA 1VAHA 2X3BA 4X80L 4M61A 3T04D 2DD8H 3B2VL 2FUTA 1KYOJ 2VLME 3D48R 4MD5B 3G08A 4OIFA 4RNRB 4XHJC 2CR0A 3ZQWA 1NM9A 3D3VD 5FCUH 1DJZA 1WEJH 4PGEB 3T0EA 3P0YH 3TVMC 2BY0A 4UZSA 4X6FB 5CUSH 4YPJA 1K5WA 3FQYA 3GK8L 43C9B 1L3WA 2H3KA 3KDMB 4XB3A 3QDJA 4PB9H 5EF0A 1QFWL 2QL1A 3BE1L 4JHZA 5MEND 5IQ7L 1C12B 1MUJA 2Y24A 4G59C 1HT6A 2CIKA 4WFGD 2BLFA 2H0FA 5BRQA 1GRWA 3CLEL 3GJFK 3LKRA 4KK8D 4LLMB 4RMSA 3I3DA 5DHEA 3QEHA 5E1GA 5JOPE 3AAZB 1NQBA 3F04A 4XO5A 3TT3L 5LAXA 2CLVA 1MOEA 1IKFH 4BV1A 3VG0H 2V9UA 1RUAH 4OFKA 3IPEA 5IT2L 4GUPA 1WWWX 2E9BA 4HWBL 1VFBB 5EIIG 3E1ZA 3QG6B 3BH9A 2M8XA 5BMFH 4PY7B 5E6IB 5EZLA 2C9XA 5IHLB 4DVRH 2GC7C 3I6SA 3BW9A 4AC2A 1JWUB 4DCQA 4WTQA 2DM7A 5B22A 3IFLL 3MOQA 5I66B 2APWA 2FWOB 1O9ZA 3OKLA 3OKEB 3IJYB 5EDXA 2R0WL 1J05B 3VW3H 3EOBB 2J1ZA 1I7UB 5D7IF 5AVYB 2AV1B 1J9RA 3BXNB 5E7BA 3RL2B 1ACYL 2Z4QA 1OCWL 1GAFL 1U8PA 1ZHKB 2H32A 5JIIA 2B1HL 2WXRA 4OLZL 5F9OH 1XH1A 1XAKA 5AVQB 5GGVL 3SDAA 5CUSL 5I74C 1VKXA 4PJ5E 5EU4B 3BH4A 2XPYA 1GJIA 3HMXL 2D7TL 1KJ2L 2V7HA 3FB6B 2EINB 4AIZA 1P4BH 3FZUC 5DT1L 4TNGA 4B9IA 1MPAL 2I25N 2LVEA 2O1AA 4FRWA 3PQYD 2JCCB 4OCXL 2GBVA 2I9TB 5LBGA 4K3HA 2Q8AL 1G5AA 1YUHA 5DZPA 4CKVX 3T0XA 4PJEF 3LMJL 3O2DL 4HHAB 1YY9C 1FZOB 2VDKB 1E3ZA 4LPVA 1KUMA 3SYAA 2VN3A 2VR6A 1YEIL 3IF1B 5C71A 4O4YH 3M8OL 2VDMB 4TULL 5D96C 1V3JA 4Z3HA 4QRTA 4XBPA 3S3BB 5C9JB 2OL3H 3KYKL 3IGLA 1UZ8B 5F2FA 3SIKA 1NAML 1VIWA 5KS9E 2DLHA 2Y7MA 3SE9L 1J0JA 2A74A 4P3CH 1I9EA 1H6FA 4DERA 2OZNA 2G2RA 4NRXA 1SLVA 2X70A 5E2UH 4HH9A 4WKZB 5DQJA 2MOGA 5A7EA 3SGJC 5E1IA 2IH9A 4ZMXA 2VJXA 4HZLB 4NI6A 4WWKA 1TYEB 1I3GL 4F92B 1JK9B 4FEMA 4OM0L 3IFNL 3QUHA 4IOFD 5HHQA 7FABL 4PG9A 4JAMA 3QJSB 3ULSA 2ZSVB 2HVKB 3PG2A 3I85A 4HJSA 2J12B 3NACH 2A6KB 2FO8A 3LPWA 4NHUA 3NJJA 2XZAH 3E8UH 1P4IL 1EDQA 4HAGA 4XPGH 4AIOA 3QNZB 2AKRA 1NAKL 1D7CA 2X4QA 2X89D 2Z7WA 1K3IA 2V2XA 5I6XC 1U4FA 3HE7A 3BP5B 4ORGB 1CG9B 1TVBA 3G5WA 3IVKB 4JFHD 2FQDA 1ORSA 5F1IB 2E6QA 2IQAA 1R24B 1KY7A 3BWZA 3S34L 5IG7A 4K55A 2C9VA 3CH8A 4X5WA 3ULUH 4YDVA 5CZXD 1IGIH 1SM3H 1XGYL 4ABVA 5IJKA 1OGAD 4V1DA 3MODL 4LCIH 4OAWA 4QTHB 4Y9BA 3H85A 3L08A 5AVRB 3KLDA 2VXUL 5HDQL 1OP3K 1XF3A 4FJ6A 4WGVB 4AGPA 2VR3A 4GG6B 5AB0A 3LKOA 3DO7B 1ES0A 4MCMA 3RKPA 4ZW6A 3L4YA 2H32H 5I1GL 1NICA 2Y2TA 3ASWA 4L9LA 3AMKA 4XP4L 3NIDF 1UYWH 2B8OT 1P69B 2Q3XA 1S5HB 3MNVA 5L9DH 1I8AA 3REWB 4LCCC 2EACA 2WZ6A 2X4NA 5ALBH 3GNML 1R33A 3VGFA 2R2HA 1U95B 1JP5A 1ZSDA 3HEIB 1F4XH 4M6NL 2NXZC 5DK0B 4AQ1A 1I1FA 4Y19A 2W94A 3JV4B 4FNLH 1YYLH 3ML9A 2BS71 3HFMH 5C0CA 3T65A 4GB9A 1P5VA 2R69H 4QWWC 1CK0H 2EH7L 4U1IB 2WYHA 4PS8A 4PGZA 4KTGA 4R3SA 3L1OH 5ENWA 4K94L 3VXMD 3U0WL 5KYYB 3FPXA 3HZ3A 4O2FA 1OTUD 2FBOJ 4MDIB 4PB9L 2ZUWA 1HOCB 3VH8A 4YBQD 4MJIA 2Q0ZX 3VNYA 1OGTA 4HPHA 1KCKA 3ALWA 4Z95L 1XGTA 4D0CA 2Z31D 1BZ8A 3UFIA 1CTOA 1K2DB 2NY0B 2BVYA 1QSFA 4G5ZL 2AJSL 2WLKA 3GRWH 3K6SA 3X3FH 5AWNH 1ZANH 3LEXA 2MH4A 4AV4A 2HRPL 3E2HC 3EHBC 2XDHA 2DJSA 4XN5A 1EV2E 2J88H 4YHPB 4WHTB 1QW9A 1IAIL 1PYWA 1MQKL 3FQUA 3I6LE 1TITA 1CFQB 4HMEA 3SY0B 1TJHH 1U3HA 2C3GA 1NGWA 4IQHA 1R0AH 1OTSC 2P5ED 4QRSB 5KSAC 3SE3A 3T0VA 1E8YA 5IMKA 3F5WB 5MP6L 2D3LA 3CXFA 3RILA 1OW0A 4AVJA 5DMGC 5T5FL 1XGRB 4L8DA 2YAMA 1V8HA 4CADA 2YBRA 2XYCA 3V10A 3SGDH 2R1XB 3QEUA 5D6DC 5EC2B 1T80A 2ZCLH 3WLWC 2EYSA 3HUJE 1CD0A 4P59L 1R3JA 1MFAH 3UYRL 2W0FB 4JY4B 3WJJA 4PRAA 1F5WA 3ZZSA 4YC2B 1B0GA 2OMVB 5EIQA 3ARBB 32C2A 2EICA 4FA7B 2VLLA 4W70A 5KSAA 4KHTH 1FV1B 1UXWA 2PYEB 3EJTA 3DLQR 1UACH 1VDGA 1G9ML 1OW0C 5IB3B 3EGXB 4KROD 5AOMA 2R0KH 4QRRD 2CO6A 4H26B 4X9FA 2A6JA 4PP2B 2ZE0A 3BE1H 3NGBC 1MNNA 3I9GL 3H3KA 1BQSA 4FXLA 3SDAC 5HY9B 1C16B 5I8CA 4DESA 1KZYA 3UDWC 1CDBA 2AJUH 2HYMA 2OI9B 3BN9C 4K07A 1UKSA 2H4EA 2W9EL 3HC0A 1KN2H 3FONA 4IRSB 5GS1B 3QDJD 3ZQXA 2VITA 2ZAIA 3O41B 3T6WA 1A1NA 3EHBD 3L3OA 3DVGB 3QUKB 4TUKH 4ANVA 3PL6B 3ROLB 2JJSC 4NDMA 3MGTA 4UM9A 2DOCA 4F7TB 3LRSA 4QTFA 3IKCB 1F4YH 4N85A 4F5CE 2KDGA 2X6BA 4DGVL 1KJ2B 2Z31B 5FYKL 3ORJA 1FG2B 1V7NH 4OUUA 1UGKA 3N3EA 3DHMA 4LLVB 4IW4C 5I8KL 3HI1A 4R96A 1BM3H 5DUPL 3SO3B 5B4MC 4LBEB 3RRQA 4Y7OC 1WWBX 5IB2B 4K5OA 1I7ZB 3TA3D 4N9GA 3WNLA 4YE4L 2ICWA 1FNSL 4OV6F 3VWJA 1E5CA 4P4RB 4YXLH 1W16A 4RAVA 4U3SB 1ETB1 2XWTB 1DSFH 2PO6A 4PJGE 5GS0H 4OZIF 2DAVA 2YOAA 2QGEA 5DC2A 1BVLB 1S46A 1RUQH 4EKJA 1C8QA 5EBLB 4LARL 2M83A 1CQYA 3R19A 4OCMC 1G6RH 4IGBD 4O02B 2JI1A 5FYJL 4PW3A 5AYUH 3WFEH 1OT4A 4PBDA 5T1MB 4PJBF 3T6XA 3C5SA 2R29H 1A4JA 5JPMA 1MLCB 4MQ7A 5ESAB 2OCJA 4PJCE 3RG1C 1V7ML 1INEL 5DEJA 3TJHC 1CDGA 2XICA 4OBSA 3QIBA 4V33A 1KCSH 4PJ8A 4PTTA 5JW4R 3K4AA 1KLGA 4KZ0A 4ES9A 2VABA 3RIFF 3U9UA 2RAMA 3HE7C 3QIUD 3T4AA 5DC4B 2GTWB 1YEDB 2F19H 4YXHL 4PHXA 4YBLC 1IEAA 3C5ZD 1R3IL 1CE6B 3DC0A 1FL6A 1XT5A 4JUSA 1MCWW 5E08H 2K3TA 2X6CA 3FOLB 4L1HA 5KVGH 1AIFA 1EZUA 3AXIA 3SPGA 1GW0A 1KLUB 3R06A 1GJWA 3BT0A 4XPBL 3VI3E 4I4WA 2E75C 4QMEA 2G9HB 5FW7A 5KG9A 5KVDH 1ZAGA 4JBSA 3JWNH 4OCSL 1LE9B 1BDYA 2ZXEB 3UJJH 5E24E 4JY6A 5F9AC 2ROYA 4D3CL 3PIQB 5J12B 3MV7E 1IBBA 4H0LC 4IIQC 2YXMA 3QUXB 4K0OA 3K80A 4M3JA 4TUJB 3QISA 5CGTA 1CL7H 2HP4A 4KQ4L 1GS6X 5C2UB 1BEXA 2HFEA 4GAGH 4M7LT 2OTPA 3QJZA 1OM3H 1KCVH 1H15B 3H9SE 2FD6H 4J6RL 2HVBA 4KK5D 3U1SH 1HFUA 1P4LB 2EYTB 3QRFM 1EGJL 2EXYD 2EIMB 1A22B 2FJFA 1WSST 2C1PA 1JV5A 3CFEA 1H9VA 5DJYA 5GZNA 3X1FA 1T1WA 4ZOAA 5GZND 4ZFQA 2WZ5A 1FFPB 3KVDD 2HLFC 1EGJA 4G8FB 3PAUA 5EFIA 1I1CA 4BCYA 2RGSA 4QXWA 3HG3A 3PWPE 1CE1H 3CV5A 4A2HA 1I53A 2VXTH 2OQJA 5I76B 4PCSA 2WV3A 4ZNEE 3OZ9L 1YQVL 3DETD 4S1SL 2ESVD 5G5DA 5C0BA 1J8RA 1W0VB 4MA7L 4K5MA 1NOAA 4HKBA 3V6FA 2XQYK 5KBNC 2F8IA 3WEBA 5C0EB 5KUMA 1KACB 1RJYA 3P9WB 3BPOC 1M71B 3QHZL 3LKQB 5IW6A 3EBGA 2JXMB 2PXYC 1GPOL 1IV8A 4XI5C 4FDWA 3MJ9L 4U6VH 4QXUL 1SEQL 2A1WH 1O0VA 1TZ8A 1T1YB 3PGCA 1QAWA 1QUNB 4MJ5B 5ICUA 4X8JA 4ZFFB 1MCWM 2ZCHH 3D39B 4KMQA 5DZLA 5F9WC 4QXTB 1U3HC 4QF1A 3OAUH 4L5FE 2F8VA 4XZ4A 2WLYA 5GJTH 1NLDH 2OYPA 3MCLH 1UURA 4X0NA 3BSZH 2H6UA 1OV8A 1WFMA 3BJ91 4CMMA 1AZNA 1RZ7H 3VG9B 4NXKA 5DQ9A 5E9DA 4GRLB 3ZRCC 1Z5LB 4LP4A 3TYFA 4IU3B 2B16A 1L9QA 4XMPH 5LXGL 1BPVA 1DUYA 4H8UA 3KR3H 3ZMRA 2VW7A 2OZ4A 43C9A 5JXEC 1D7DA 3LQAL 4F7MB 4BFEA 2HTKD 2VR8A 3JT0A 4HFWB 1X5MA 4OM1L 1KF9B 4OD1H 3KYAA 5L8LB 1INDL 3X12B 5KAQF 3SE4C 4LOFA 1WA1X 3PNRB 5H8DA 3AAZA 2F1EA 3T8VA 3DOIA 4YXHH 5D4IA 4LDLB 4E9TA 1TZHB 3BQUD 1IL1B 4NENA 1ZK5A 1IEBB 5KSBB 1OQXA 4GUPB 1NEUA 1JTTA 3BFQG 3HI6H 3H9SA 2VM3A 5CKGA 3UZQB 3OLEA 1KB3A 3WNIA 1GGIL 2I9LA 1OAZH 2YJLA 1YYMH 1HEZB 1EAPB 5IESL 3TGXA 3UJTL 2H3XC 7FABH 3S9DB 2HFFA 5LGKA 1DN2A 2NX5B 5LJYH 2ZYRA 2WN3A 4TQEL 1WH0A 2IANA 4E41A 5C92A 5KVGE 5C7ZA 4M7JL 3IT8D 1RK1A 2ATKA 3L48A 2D73A 4ZSOE 4JM0A 4PLOB 5GRUH 3EOBA 2JCCF 3N85L 1WBXB 4XCNA 4JM2A 1IT9H 4JPQA 1C7TA 1JPSH 3B8YA 2BSED 4GMTH 5I0WA 3MRPB 3SDAB 2F54B 2ADGA 4MX7A 1KBGL 1AZRA 2VNCA 4R97C 3GZQA 4DP0X 3FB6A 4GG6F 1Y6MR 1VZIA 3VGEA 4WGWB 2UXVA 3VI3B 2HX9A 3LTVA 2ZX9A 5F8QC 4GRWH 4ETQA 3HZKB 1NMCC 2E76C 5TK2A 4Y16D 5DWUH 5C7XH 2KZWA 1I8LA 3UAJD 2ZX7A 2ALWA 4JGMA 3CX5J 3BKMH 1X7SA 1H8NA 4J6IA 1ECYA 4ISVA 4UMSA 1I9RH 1NIDA 4K9EC 4J2XA 5JPMC 1X9LA 3D0LA 2V3FA 2Q86A 4QCIA 2VMFA 4YHOH 4LBAA 2P24A 2B4CL 3FULA 4XBPB 1MHCA 3RTQC 3SY6A 1GYUA 3QIBC 3MAWA 4PJGA 3IJ7A 4KVPA 5E8DH 1OAXL 3IJEB 3S3PA 1E4JA 1C1EH 4BQ9A 5EBWA 3HBQA 4JCMA 2ZXDA 2R4RL 4MB3A 4DAGL 3FL7A 2NY0D 2MCG1 5DF0A 2FEEI 1SDAB 3AQDA 4W9GC 2WQVA 3KG5A 3T77B 2BDNH 4LLWA 3DK0A 1FQ9C 2Q2LA 3VM7A 2X2JA 1M05B 3HG1A 4K9JA 3AGVA 2WAQA 1Q4NX 2XQBH 3L5HA 2A74C 3EUDA 5A16B 4LP5A 5HI3C 3Q9QA 3DX1A 4L05A 1JZHA 3PHQA 2A9BA 4HK3N 3MRLB 1P6AB 2Y1ZA 4B5EA 5CZXC 4ODVL 4I85A 1KYOK 1RHHA 3MVSA 1AXIB 3WAJA 1HYSD 1CICD 3P40A 4TNEA 1J9QA 2L4OA 4X50A 1A7NH 3N41B 1ZWIA 5IZ7A 1N7MH 1UUNA 4EVNA 1J9CT 3KBPA 3VUAA 5BO0D 5DI8B 1B0RA 1MXDA 4HSQA 4RFEB 3HHRB 4C4KO 4IKNA 1DTUA 1RZKC 1SOQA 3QDJE 1NSNL 3U30C 1U8KA 2M26A 2BNRA 2C4FU 2Q87A 1FCGA 1M7XA 4P9MH 2YGQA 2IANE 4WK0B 4OCSH 4OZHB 1H3PL 1FFNA 4OT1L 4JO2H 4Q4EA 4HIXL 4XR8C 4ECNA 5EU3B 2OMWA 1JRHI 4LNRA 4OFIA 3QZLA 1KB5L 3GSWB 5KVGL 2ADFL 2Z6FA 1XCTA 4Z7AA 4PJ9D 5FFOA 4EO5A 1ES0B 1FNSH 1PEWA 1ZEAH 2X4SB 4WCYH 3TS8A 5EORL 4K94C 5FXCH 4S0SD 1WG3A 3BP4A 4K2UH 2WSPA 4O58L 5AB9A 2P8PA 3IDXL 2D9CA 4AYFB 2H6PA 3FDWA 5MENB 5ISZD 3O3EA 1MFUA 2EZ0D 3QUML 5DMIH 3HZMB 2CMRH 4FQIH 4WO4A 2EVIA 1VFUA 4BKTC 4JN2A 4Y4KD 4KNQA 5EOTA 4IRZL 4PMFA 3WU1A 1QR4A 2NTFB 2UXFA 1LDSA 1NCCL 2DQIH 2HH0H 4Z76A 3NP3A 4PRHA 4I2XB 4MTMA 1NCTA 4MMZA 1OSZA 8FABA 4CSSA 5JR1H 3G04A 4PJ5A 4GRWB 1NCOA 2WUCH 5DA4A 4L1SA 5FK9A 4YZWA 3N41F 4LOUD 3WCYA 2D3NA 5BV7L 1W6LA 5D6CB 4U6XA 5F7EH 2WVUA 2W9EH 4BZ2L 3QCVL 4DSYA 2XX1A 3WY2A 2VERN 2Y3AA 1SOSA 2NSMA 2DWTA 3NFSL 4EZLA 4AYMC 4APQC 3T3MB 2I32A 3VE0B 1XZ0A 4MCYA 5HHXL 5JIMA 2X3AA 3TJPA 2WMPA 4LVOB 3UBHA 5B3JF 1NBVL 5IK3B 3QCUL 4C58B 3TTYA 3LN4A 5KUKA 1IAMA 5BRZB 3BRGC 2CPUA 1EJFA 5TH2A 1KGYE 2D2CC 1F18A 5D1ZI 5C0CE 1PG7W 3APDA 3E38A 4F15B 4GKSA 4ANWA 2JIXB 2LVCA 3MLZH 3CFIC 1SBSH 2NCEA 4D0DB 2UZXA 3L9YA 4P5KA 2VN6A 1XWVA 2X40A 4XWGH 4N2BA 2W8CA 4ZS7H 3HMXH 4LL4A 5T1KB 1I7TA 1Y18A 4IBTA 1K3ZA 2BIMA 1NEZB 4A37A 4WTWA 3N91A 1RZJH 1WV7T 3QPKA 4BFJA 2H2PC 2WO4A 4W4NA 3PWPA 4GW5A 3C09B 1JERA 1R3JB 4QNPE 1HQRA 2ZOLB 3UX9B 4MMYA 3VJ6B 4XO3A 2OMUA 2FL5B 1A6VH 3GMOB 5AB2A 1U8HA 1QATA 4RGNB 4GKNB 3CBRA 5BQ7A 3GSRA 2DQHL 4NM4H 3ESVF 5LQBL 2X9WA 2ID5A 2W38A 4K4KA 2A83A 2AJVL 2F54D 1PCSA 2MNUA 5K33A 1L7IL 2GSIA 2GTZA 4DFHA 1YY8A 1AI1H 1MVYA 1MCJA 4NSKA 1T5WA 5DD6B 3SQBB 1F11B 1P0SE 3D5OF 3EBAA 3IAQA 3NCFB 2VMEA 4YSRA 3QZWG 1F58L 2WLIB 4JRXD 2FO1A 2C9RA 3EYVA 3PGDA 1DEEB 3GTVA 3U9PL 2YA1A 2P5WD 4TN9A 1EJOH 2BHZA 1J48A 3LN5B 3PUCA 5IJKC 3TBYB 4HLJA 4UNIA 3NMEA 4U2ZA 5EF1A 1LVEA 2X1WL 3DUUB 3WENA 4JHUA 2F68X 3K72B 2VLRE 2WCPA 1EVUA 3LRSB 4FNLL 2HTLC 3OJMB 4P2OD 1K4DA 5KSBF 4FCHA 1EEUA 3ILPA 2VDNL 3S5LG 4FHJA 1N5YH 4KDTC 2WQ8A 3CCHA 3IDGB 4PR5B 2KI6A 1QKZL 1KPUA 3TH4T 4IRSC 2IH1B 3BLKA 4PRPA 5I73C 5AZ2H 3UBGA 3JTTA 4F2FA 2GB2A 1A6TB 5IVXB 3SBWA 2IV9A 4PW4A 4HAFA 1PZ5A 4G9FD 4IBLT 4FD0A 3N5AA 3RTQD 1QTYT 2ZUSA 3U6RB 1AR1B 4YVNA 4PJ7E 5SWSD 1SDDA 3SYPA 3UGEA 1IGFH 4JRYE 5C9KA 1F56A 4X6CF 1IM9A 1QNZH 3GXIA 4IS6A 4GUQA 1W15A 5IFJB 3KPNB 1KBGH 1WE5A 4DP9X 4RISL 3OZ9H 3T0EB 3VQMA 4H7VA 3WY1A 2VQTA 4PV9B 2AF2A 2CM6A 1L9SA 1Y0LA 1I8KA 1YPZE 5T1MA 1RUPH 3WO4B 3VU2A 2CGRL 5FYJE 2JSFA 3GBNL 3LQZA 4K8RD 4PJAE 5C07D 2JKWA 3QIBB 1RPKA 4F7EB 1LJMA 3SDXA 4URTB 5GGQL 4B6ZA 3FT3B 5HYFA 1A4AA 1IE4A 2OLDA 5I5RA 4H8QA 1LHZA 2AAAA 3TL5A 1WGVA 4M93B 1H3TA 3MLRL 2G4EA 1Z9PA 3FH7A 3V5DB 2GFBB 1N67A 1YJDL 2RALA 1C1EL 3AC0A 3AWFA 4K3JL 1QEWB 3WTUA 4A38A 5F3BB 3KL0A 1GYCA 4I4WB 5GJTL 1MJ7L 2O93L 3NEOA 8PAZA 5D1QE 5I23A 1U3NA 2PPCA 5I1EL 4X6EA 1TNMA 3ARSA 1AZVA 1IBYA 1IGJB 4PMEA 2EIDA 4JQXA 2TSBA 3V0WH 4DGUA 2YPVA 3B2PA 3OKEA 3PHOA 1R5VB 4M5SA 1FSKC 4S1RH 2N7AA 5AAMC 2FDBP 2K9UA 4IRZH 2O30A 4D0BA 5C2BL 1CLZH 3TN0C 4AQ8A 3GJEB 1E4WL 1NAMH 3H4FA 4BRJA 5DEFB 2XV2A 4J39A 3THML 4X83A 1X4YA 5EOCJ 4RMTA 4QOKA 4UIMA 4AGLA 4XPHL 4P2RA 4PGBA 3HAEA 4N0YL 2FIKB 1T1WB 1JPFA 2CO4A 3HLAA 4FJZA 1HILB 1BP3B 3FQ4A 4M29A 5C07B 2P5EE 2CK0L 5DFTA 3QI9B 1E42A 2DL2A 3HS0A 3ELQA 5HYJE 4MBOA 5EFIB 4L4VE 4J4PA 4GOSA 1MQKH 1KFAL 3L17A 3MRFB 5E8DL 2P5WA 3DX7B 4IKKA 3SPIA 2ATPA 3K81A 1U92B 5D55A 1ZLVK 2I7OA 2F0CA 3HIZA 1AQKL 1IIIA 3FCSB 3UDWA 2QDWA 5B39G 4EXPX 3VD4A 4PI2A 1DQTA 1XVSA 5EMYA 4NZJA 1YG9A 1JXKA 4K7PY 3WD5L 3IGKA 3KPSA 5BS0B 4H8WC 3RAJH 5KJ4A 3HLKA 2JXMA 4O5LH 5HYQA 5EEVA 4LCWD 4FQXD 1ILSA 4DGIL 5BZWB 1BAFH 1SXBA 2ZKHL 1A25A 3RU8H 1RV6X 3UTSB 1UACL 2YPKB 2ZWKA 1NPNA 3FO2A 4WWKB 3MODH 4LCIL 2GK0A 2PCFB 2WTRA 3AGWA 2LAGB 3OX8A 2CALA 4WFHD 2EADA 4QLWA 2COVD 2WIMA 5IGXH 4U0RB 4EI5A 2AQRA 2N0MA 2L7EA 4WTZA 4JANA 3V0HA 4PJBB 5DQ9B 5E9DB 4UQ2A 5IT2H 3FFCB 1G1YA 4MNHA 2ITDB 3QUZC 2BOBA 3U2IA 5FO7A 2EDBA 2XWJB 4C47A 2QV4A 1KT2A 4UV4L 1DUYB 4FLSA 4H8WL 3BPLC 3IVKA 2FEDC 5DHDA 4OZIB 1X44A 3D3VE 4KMLB 4N6QA 4QKXB 2Z8WC 4U0RC 1E28B 4K8RH 5DS2A 6PAZA 4GEIA 3BGFC 3IMTA 1EPFA 3GUFA 2IFGA 2EDHA 2JKRM 3E6HA 5DUBA 1PKQB 1BGXH 4JFZL 5E03A 7TAAA 2K9FB 1S9YB 3QEQB 2BCKB 4QRUA 2X4OB 5JXAH 3SDDB 4NENB 3QUZA 1HHGA 3E9TA 5JUEL 2HX7A 2A73A 1PU0A 1A6WH 5EU5B 2BRRH 2VWEE 4X7CC 1DSFL 1DE4B 2IFFH 2QHRH 3UZQA 2RB8A 1K8DB 2KQNA 2I9LB 4HG4K 2Q76B 3NVQA 2V8MA 3L95A 4XAWL 5G4NA 4M61B 3UIYA 5LO7A 4MD5A 5HVFB 2VSMB 2EXSA 3FUMA 4QRRE 4JDEB 3B7YA 3RDTB 3VI4E 3GS0A 1S7TA 2NZ1A 4GG8A 3FCBA 2FUQA 4XCFH 4Y4KA 4F9PC 1T21A 5TTRA 1F02I 4Y19B 4HK0A 1MZYA 1IAIH 1AI1L 4LASH 4GO6B 3WEOA 5IREA 2PO6D 2G75A 4Z7WF 3BMVA 4Y16C 3BYYA 1P5VB 2XZCH 1H3WM 2QTEA 4YR6A 5I1JL 5CNHA 4EKXA 2GYSA 1QRNE 4GW4A 3GGWA 5A1AA 3PV6B 3TA3A 3O8XB 3O4LD 2LOEA 4GRMB 3ZE0F 3IDNB 1DBMH 4AL8C 5GZNC 2X6UA 3ZHLA 4PGDB 2CRZA 4MJIB 3RNQA 1CXHA 1LO3H 2Z64C 4ESKA 3AU1A 2JNZA 4KH2A 4YVUA 3FT0A 5E1HB 3UJJL 2HUHA 1M7DA 1BM7A 3MLWH 4QHNB 2VR9A 1KB9J 5CMAB 4YHPA 3OAZH 4WHTA 4JUTA 2FWOA 3OKLB 4HCRA 3QWOB 5D96B 5EEYA 3TA3C 2EEBA 1AHKA 3IJEA 3LRLA 4MJIE 3RWHB 1W72H 3QULB 1J8HA 3RWIB 5LGJB 4JG9A 2FSEA 3BXNA 4MHHG 4ONGL 3BP7B 4NQEB 4KXCA 3TCXA 3WBDA 1JVLA 4Y88A 2BMKB 3D0AA 2QVIA 3ZDYB 1E67A 1SJVA 4YS4A 3KHQA 4J3SA 2ZQKA 2V8LA 4PW9A 3RJOA 3MNWA 5GISL 1LDPL 1U8MA 5IIEA 1LO4L 2NY7L 2ENJA 1GOHA 1G7QB 2FGWH 5JPNB 1BIHA 5DVPA 1FVCB 4FCAA 1WJ3A 4G8GE 2BVUA 1FC1A 5HHOE 3ETBJ 1UWGH 4ERSH 1B0GB 1SUJA 3Q2WA 3KWUA 4EVNB 1OP5H 4OGQC 5KSVA 1FV1A 1UXWB 4AMWA 2F1BA 4HUUB 2R8SH 1PLBA 3QDMB 4M6OL 5ITFA 4Q6IB 4L18A 2NDGA 2F58L 2J7LA 4O2EA 4X5RA 3HCVB 2XZQL 1T7VA 1E9OB 5FAAA 2CJ3A 4ZX6A 2QGBA 3PWVB 3KPQA 5PAZA 4IBVA 1RVFH 3EOYG 4ZT1A 1L9MA 3HAEG 3O2VL 1A4KB 4JKPL 2X70B 3DNKA 1MCOL 1OOWA 3RVVC 3QFDA 2NY6D 4LL1A 4HULB 2Z93B 2SEBA 2OSXA 3MLVL 2N7SA 1P4IH 3NZHH 2BNRE 4GI9A 1UOLA 4JRFA 4TVSa 1BW8A 5EZIH 1R46A 2C9SA 2PW2B 3ARGD 1QFWH 4KZDH 2UXTA 4FFZL 43CAB 1LO0L 1BBJA 3MKKA 5FUZL 2NNRA 4S1RL 4W9LC 1TQBB 4DPCX 2G5UA 1KIRA 4DTGL 2V9TA 2MKWA 2IGTA 5JQIB 1Z3GH 3BP4B 1S2EA 3R18A 3UADA 3APMA 4POZC 4ONFL 4QAWA 2IMMA 4OJDH 5L4JA 3MJWA 2G60H 3QPXH 2W0PA 1GIGH 3FFCE 4I0PD 1BCIA 1A6VL 1RFDL 3F65A 4KOBA 3TZVD 2BIQA 4M4RB 4PV8B 4NGHH 1OB1B 2JB6B 2WVTA 4MDJB 4UDUA 5EOTB 5AKRA 1M3JA 2CLZB 3FQNB 1AZZC 2PCPB 3MDJA 3WNKA 2L7JA 5FC9A 4L2YA 2M2DA 2Q1EA 4B50A 4GMSL 3CMGA 5F6HI 1N12A 5SX5K 2GCYA 1LYQA 5I8KH 4O02A 4NYLA 3UTSE 4G3YL 1N6UA 5JW3L 1UATA 1JUFA 1V55B 3G3LA 1WAAE 2WXHA 4PRIA 2QR0A 1QWHA 4UTBH 5IVXF 1SMDA 4RGMB 1S7WA 4NZRH 1Z9LA 2XPGB 3VXPB 1CS6A 3T4AB 1AH1A 3V9EA 5FO9B 1XMWA 3FUNA 4NZFA 5D2LA 3UYPB 1EANA 1KIUA 2DH3A 2FYYA 4DGYH 4U1HB 5FKPA 5JHDA 2MNJB 2GI7A 4J3TA 2Z91A 3O9WA 4Q9RL 1FL6B 1CFMA 3FT4B 1GH7A 4AH2B 4XP9H 2EIZB 4GKSB 4QLRA 3MCG1 3RL1B 4KO9A 1NANI 2NCMA 4YDNA 1PY9A 5CJXA 5I1LA 5IQ7H 1KXTA 2AMUA 1JZ2A 1ASQA 1TSHA 3BSZL 3Q6GL 5AFAA 5J7CC 2HKHL 3ZUCA 2P5EB 4M03A 1GA2A 4NN6B 5C07E 5TFSH 3FCTB 2IOIA 1DYZA 4TL4A 5DD5H 1LP9B 4GIAA 1W72A 3D85B 3FUDA 3J8F7 1NFDA 4GQ9H 2ADYA 1AO7E 3MTXA 1BG9A 4KGJA 5A2BA 1FGVL 3K3QA 3K46A 4R0LA 5B39A 3ZKQD 4YDMA 4Y2DC 2WXPA 4WGKA 2W88A 2OMUB 4TNWF 3MLTB 1CGUA 1W2KT 3GMOA 3DGCR 4U1NB 4P07A 3QRGH 5DJ2B 1CDHA 4WI6A 3S35H 3SKMB 3EFFA 4JCLA 4LIQE 4E41E 2ZTBA 1Z9NA 2NUTA 1IARB 4OGYL 2ETWA 3S96B 3CFNA 2K70A 3FQRB 2YIHA 1CGSL 1HHIB 2E7MA 3QJOA 1AHWA 4QHLB 1EDHA 4I9XA 4ZTEA 1T5WB 3Q43A 5DD6A 4H25A 3KPMB 2D31A 1EBPA 4JHVA 3B7SA 1KG0A 2O5YL 2OQJB 2QQNH 4UILL 3MV8E 3L4CA 4FYSA 1JYWA 3U2SB 2ZF8A 1QR1A 1E5ZA 4ZMVA 1DEEA 5I1IL 3CFJB 1YEGL 3EJYC 3D69A 3OXRA 4XPTL 4ZPTA 2WLZA 4NQDA 2VDNH 2ZOWA 4HJGA 3ZO9A 4Z76B 3ZKSD 5CEXB 3DUUA 2QVTA 1GY2A 1Q38A 4OB5H 4R90H 2EKSB 3CLFL 4PBWD 1M71A 1OAKH 2YUZA 4WV1C 5K9OB 5IBUB 5IW6B 4FFZH 4O02L 1QYGH 1HE7A 5FYLE 4WWPA 4FXTA 2ZXWB 5HGAA 4LCUA 1TQBC 2EDWA 4D94A 4XPHH 3QNFA 3RZCA 4RWHA 1G7JA 4QXTA 3QZOA 4N2HA 4Z0BH 1CB4A 4BFNA 4Z7UE 1PZ5B 5ADPL 1MHHA 3MRRB 5G55A 4IEFA 2BW4A 3T3MF 1M57B 1D2PA 3BP6A 5HY9A 3AROA 4LCWB 2PR9A 2XHNA 3BVNB 3BDYH 4PTUB 5BJTA 2CGRH 1FJ1B 3ZL4L 4I89A 4PJDE 3HC0B 4IRSA 5L9DL 3TYFB 5LG6A 2CCLA 4XMXA 2FZ3B 4X42A 4LT7A 3WIFB 3PDDA 3AITA 4TNVF 2BW5A 2FEDD 3RURA 3ERXA 4JKLA 3ROLA 4NDMB 2X4TA 1KIPA 1IQDA 3S4SA 5JOFB 4JQIH 5DK3A 5DVKA 3NGBB 5E8EB 5GGRY 5IOKA 1XR9B 1GOFA 3X12A 1KJ2A 2H8PA 2VH5L 3ALXA 3MV11 5JO5B 2WBXA 2MNWA 2ADJA 3EYQD 1AGCB 3S36L 4MD4B 3MROA 3ATBA 1N4XL 2C34A 4N0CC 3S5ZA 3X17A 4F37K 1FZMB 1IC0A 3PWNA 4FFYH 3HI1B 4NHCH 4R2GB 1E5YA 3AB0B 1ZVYA 1JZ4A 5DJDB 1E7UA 3VFTA 4XMTA 1NCIA 2COQA 5CBEA 4L9LC 1KWGA 2QSVA 2EQDA 1O6TA 3VRJB 4X7DC 2JJVA 2DQDH 3LOWA 4B53A 3O6ML 1NC2A 5IEHB 4QRPB 4IGBA 1R75A 4I5BB 4BXVA 2A6DA 4MXWL 2HFFB 4OUOA 2ZAGA 1KB5A 4J3OD 4HEPG 4XNZB 3NK4A 5EOQL 2O6DA 4WHCA 3MRDB 4ZW8A 1SPDA 4GBXA 3ZR6A 4FQ1L 2QEJA 1YN6A 2ALAA 1UB5A 1OKEA 1FO0L 3ES6B 1P2CB 4AMKL 2QGCA 3EF4A 1X5LA 3KDMA 5HHXH 5HP5A 3OSKA 4AKPA 4Y1AE 1MIEL 3AY4C 3NFSH 1FVEB 5C0JB 3FQXA 3QS3A 1HL4A 1C12A 1F1DA 3MLXL 1PLCA 4PVMA 4UOZA 1OY3B 2VABB 3U9UB 3L9EA 1F86A 3LAFA 3MX0B 5ALBL 3H9SD 1DJIA 5C6TL 4DP6X 2E9IA 3WY3A 5BZDB 4TQEH 3DSFH 1ORQB 5CZRA 1T03L 5K9JH 2YZ1A 1PIGA 5I1DB 4N8CL 1RIVH 2B59B 3EYUL 2VH5H 4KK9C 4AQ8C 4L4TD 4DOHE 4FABL 1FYTA 1OEZW 3WS3A 1MNUH 3QH3B 4MA3B 3T0DA 2GUOB 4HWZB 2CO7B 2UY6A 3A5VA 2Z92A 3FN9A 4PJXA 1LE9A 4KHTL 5C0AB 1RULH 1IIKA 5SWSA 4OFQA 3Q2NA 4HPYH 1FH2A 4N2DA 1WFJA 4L5FL 4B96A 2IAMA 4Z7WB 2E7LC 5FHAH 2FH6A 4E9RA 2FATH 2AXGB 1KTBA 1SF5A 2FHCA 4AC4A 2QGDA 3QQDB 1DCLA 1IC4H 1RUAL 2DQHH 3UTPD 3UTSA 3BPNB 5D93B 3WV0A 1UZ6F 3O4OC 4U0QB 5CJXC 3QUYB 1Z0MA 4KUCF 5LBSL 4Y5XA 1AS6A 2RQEA 3C60C 4PGJA 1A14H 1MLBA 3D7PA 2CUHA 4FI6A 4HJ0D 5E8NB 2NR6A 4YSEA 2BNUB 1OAXH 1WTGT 3N50A 3IYLW 5E23A 3CMOL 2B0SH 1I31A 4JRXA 4HXAH 5T1DL 3RWCA 5MENE 1A8JH 1DQJB 3CWGA 5DJXA 4V2BA 2DRUA 1WLHA 3FO1B 3HB3C 4KK9D 5FX3A 5C08E 4OZIA 2YQBA 2R2BB 3CBJB 4U1LA 2EUVA 2ZNWA 3L3OC 3HN8A 2WP3T 4YXLL 2MIZA 4X4MA 3B8SA 1LO0H 1WFUA 2A2QT 1BXXA 5JIQA 2BO0A 3E6HB 1RUKL 1LD9B 4GKLA 5FLUA 4NKDA 2O5ZH 3SDYL 5AD0A 4XMWA 4MJID 4Z3FA 1FBIH 1NL0H 3QWNA 5D2LF 3VYNA 4YHZH 4KY1H 4AEIH 4YSUA 2MOQA 4NKMA 5AOZA 2OMWB 4LNRB 4N22A 3N04A 2V3DA 3LCYA 4CU8A 3M1CA 3VFMA 2CDEB 1V7MH 1G9NH 2GSGA 3ULSB 4XN2A 3ZYIA 3P30L 2BXZA 3FUHA 3CSBA 5DVNA 1UM5L 5HGBA 3FUJA 1UJTA 4NJ9H 1FLTX 1UJ3A 1B9KA 2B2XL 3MBEB 1NMAL 5T33H 3IRCA 1Q0YL 2AJ3A 2P8LB 2Y9RT 4HIIA 2FNBA 2H6PB 5FYJD 2XQYA 1Z5LA 1PLAA 2OR8A 2PO6C 4CC0A 3PWLB 2CWRA 4YGVA 3UYOD 2IMNA 2V2XB 5IROD 1VERA 1O5DT 4XP4H 1I3RB 1A7RL 3HMWL 3PNWA 1NWPA 1A6ZA 3GO1H 3VFGL 1GMIA 1ORSB 5F1IA 4WO0A 2IQAB 3G9AB 4XB7A 2H3NA 4QJ4B 2WIIB 1OCRB 2D2OA 2HT3D 3ECQA 4L0ZA 3UO1L 3LS4H 1GS8A 1WCBB 3F85A 4ACTA 4HS3B 4CN4A 4G6ML 1NLBH 3PAYA 4BBWA 3K7UA 1PNCA 1AP2B 1Z2KA 4R5TA 1OSYA 1HKLH 1MCOH 3VFNA 3WN5A 2OMYA 4JFQA 1NJ9B 4XBEH 3LZPA 2WQWA 1FCCA 2R39A 3MRKA 4XO4A 4P9HC 4GRMA 3SGKC 2V33A 2OW6A 4FERA 3REVA 4KKPA 5D7LB 4EUPH 1XXFC 4D2NA 4PGCB 5IW3A 4FLQA 3IS1X 3I9IA 3LKOB 4NZUL 3DO7A 1OVZA 1COBA 5A2IH 4PJ8D 4WY7L 3BKYH 3IXAB 4L5FH 2DYPB 1QOKA 1LE5B 2AK4E 2FX7H 3VFWB 4LPCA 4G1MA 2ZWYA 2ZAHA 5D9SA 1CUOA 3SKUD 1ZLEA 5IROC 4Q56A 1JXFA 2O72A 4B97A 1U95A 1RU9H 3HNSH 2JKJA 3V0AC 1QYGL 3FHAA 1WBXA 4WJG3 4JM2B 2VZOA 4UBDD 1L9RA 4NQEA 1F0LA 3WEXB 5M7QA 4J3OH 4GG6A 1KTLA 5TGBB 3QARA 5FYKE 1BMGA 1AR1D 2XJKA 1WBZA 2VDOL 3O4OB 3BZFB 1IFRA 4Q52A 4J5VA 3G6DL 1BMZA 3T0AA 1WIOA 5HXMA 2W65B 3DJZA 3EJPA 4ADIA 1GR7A 3CZUB 1RLWA 4NT6B 4PS4H 3VXQA 2XYBA 2WB7A 5ISZB 1RAMA 4O2FB 3M46A 4MDIA 1QSEE 3OMAB 1XAUA 2FEEL 4MMXB 3KBFA 1YCSA 1MFEL 3DHPA 4MMYB 4B9CA 3IN0A 1HNFA 4D9RD 1MFNA 4PJEE 3M7OA 1WC7B 5FDYA 4D0CB 3NAAH 2HT3C 3GDBA 3MRNA 3TEXA 3VI4A 3GINA 5AVUB 5BZXA 3LNHA 1R5WA 1J86A 1TTFA 4HUUA 4HV8A 3OPZL 3QDMA 3NFPA 4JKPH 4QWWD 5IVZB 4DAGH 4LDEB 4NX0A 1UCBH 5I75C 4ODHH 2WD0A 2D3VA 4O5LL 3QZNA 1RUKH 5GRYA 5L2JB 2ZCZA 1EEYA 4JFDB 3V8CA 1MWAB 3PWVA 4LF3B 4MMXC 3B9VA 3SE3C 3QUMB 4AEHH 3O6MH 3JTSA 3BKJL 3LSOB 4XC3L 1CVSC 1UCTA 1XGUA 1D5IL 2IG2H 5DC9B 5C8JB 2ZPKH 4E9LA 3MUHL 4BWTA 5CFAA 5IMKB 1WZKA 2IBBA 4NN7C 2J72A 3T0BA 3LN5A 5D6DA 4KMTL 2MTAA 3PU7A 4ZFOB 3VCLA 3CH1A 4CADB 4X6CB 4OI8A 4Q89A 1EEZA 3FTWA 2NY4B 2VISB 3O8XD 4JPSA 3WI9A 2Z35A 1A7QL 4F93B 5IOPB 1YMHB 3DYMA 2HWZL 1PMYA 3VXUB 3PP4L 3KYMA 4JJ5A 1L4IA 2P7TA 4Y5VC 2BK8A 4L4VD 5D7LD 4ZX4A 2R15A 4TS6A 3CFUA 3S5YA 4EI0A 4PRPB 2WQRA 3OKYA 4PV8A 3BQVA 1BBDH 1FNEB 1OB1A 3EGXA 3KVQA 3QT2A 4X4KA 5I0XA 5DRXB 3TV3H 2QKIA 4I9WE 4WSGA 3MLZL 5E8OA 3G6JE 3D34A 4H1LA 3IGUA 4ZS6D 4UIKH 5FIEA 2AHIA 3FRUB 4EDWL 1SBBA 1A1MA 3RPIA 3RY6C 1NBZA 5MEOA 4WFFE 4YHLL 2KPWA 3HS0C 5HPMB 3L3OB 3NZUA 1BWMA 3IETB 3VXSB 5EU3A 4OF6A 4MA1B 5DRZB 2R4SL 2EIJB 4PRIB 4M6ML 3V4PB 5FF6A 2ZOKA 4X4ME 3O3BB 1Z5HA 3ZTJG 2EC9U 1F00I 1WZ1H 4TVUA 4OB5L 4LPTA 1C5CL 1UVQA 3BFWA 4RFOH 3P4NB 4IOSA 3O3EB 5D1XE 3JWDL 1W0WA 1YNKL 1NCUA 3O2WH 1XR8B 4G5ZH 4K3DH 4XOAA 2QPEB 4Y4FB 5A2CA 4KRLB 2XTJD 1GTFA 1UTDA 4UU9B 2GFBA 4LASL 4BRVA 3FYEB 1AGFB 5DWUL 4NQDD 1QSEA 4JS7A 3T0ED 3ZDWA 5D5MA 4WI2A 3D3VA 4Y4HA 4JZJB 5GGSB 2WXQA 3KMDA 3Q8EA 4KKAD 4PRHB 3VYOA 1A9BA 3V52H 2XV0A 5EU6B 4TLTA 4PLNC 4GXVL 1LTXA 5EBLA 1EWHA 1UFGA 3CN2A 1YQVH 2ZJSH 2JKIS 1DQVA 2R56H 3QRGL 3V5KB 2OL3B 4Z7OF 3MJ9A 3C5SB 1QTSA 3PRZA 3B5TA 1KC5L 4FQCH 3VE0A 1ID5I 2XQYG 1SDYA 3OAWA 2ZYHA 2AS5M 1MRDL 2ED8A 5ID1A 4LQ1A 1BQKA 2VXVH 4N90E 5IK3A 4AKQA 4WEBH 4EI6A 1BYNA 2VDQL 2CDFA 1WUNT 1RUQL 5EO9A 3CD4A 2XFXB 1HILA 1OQOA 1FN4B 2ITCA 3FRPB 1IAOA 1TMQA 3HBGA 4I18B 4ZAKA 1AHWB 3NRFA 4NAQA 1ZLSH 4JHWH 1SN0A 1UKTA 3K6NA 2P5WB 4HOZA 1D5RA 4AJWA 2QFPA 2EDEA 2OSLB 2MFNA 3L1OL 3LRKA 4BH7B 5FEBA 2G9HA 2WUBL 2MHAA 3MV7A 1K4CB 3C60D 4AM0B 4WK2B 4Y2DD 3UTZA 4UCFA 1I1YA 4HJGB 1GOGA 4NUGH 3SDXE 4M48H 1GGCH 4HCRH 2P49B 3HPLA 3A0OA 2W81C 2P5WE 1P7KB 3MFGB 1KEML 1GTNA 1HYRC 2FX9L 2YQGA 4ABWA 4NC1E 4H88L 3GI9H 2X44D 4LCUB 4BFIA 5GRWA 2DMCA 1VENA 2IDTA 4BUHA 1MCEA 1NIBA 2X1PA 4GKNA 4D8PB 4HC1L 2XCMC 5SWZD 4CNIB 1UXSB 5AKTA 5C0GB 1U8JB 4NNPL 3N2JA 3EJYD 4JRLA 3GPEA 2GTZB 4N2OA 5CGYC 4C56A 1HI6B 3ARPA 3X11A 4DEPC 4CC4A 4FP8H 2XNAB 1XSOA 3RAJL 2VDRH 3IRPX 3VWKB 4R83A 3CHXA 5KBDA 2BNRD 3F62A 4N8CH 3CX5K 1FO0A 6TAAA 4H2AA 5DYFA 4AT6A 5C08B 1WA0X 3RZCC 4OD3H 5H37H 2EVJA 4DP5X 2BH0A 1HWHB 5DA0B 1SGKA 3WXVH 4ZD3L 2X4TB 4JZNA 1KIPB 2N01B 5C0EA 1RKRA 1SJMA 4YMPA 2R7EA 2BM3A 3GF8A 4BQ8A 1M9WA 4AEHL 3KJ4C 2WK2A 3U1QA 5CIPB 4DN4H 4Q58C 5LN8A 1N68A 3ABMB 5D1XB 4OSUL 4R2GC 1H8OA 1IX2A 2EEAA 1T1YA 1HXYB 4NFCA 4JRXE 5F9WB 5L0QB 2WOYA 1I85C 1DQML 3V79C 2FAUA 3CLWA 4S1QH 1CI5A 1T3FA 1ZDSA 2ODHA 3KL3A 2LT9A 1AMYA 1WCQA 4Z3EA 1DBML 2APSA 3EGDB 3PXHA 1XGPB 2V2WA 1BZ7B 4LKCA 2K6YA 3FT9A 1HL9A 5JA8B 3D50A 1H3PH 4LEOA 4OT1H 4QR7A 1SLWA 5MEQA 5E2UL 4YEFA 1EK3A 4P9ML 4GQPH 3GBML 1QPKA 3RTQB 1HVXA 3JTBA 1Q9LB 4NCDA 4AGNA 1NUFA 3CJJA 1KC5H 2ZXGA 3GB7A 5DD0L 2BWDA 4HFWA 4EQ3A 1BD2D 1U8CB 2KLRA 1OM3L 3VW3L 2LE9A 3QWRD 4DHLA 5I19L 3MRQA 1CL7L 4KQ4H 4PRPE 2GIMA 2TRHA 2VKWA 2H2SD 5DXWA 1JZGA 2R69L 2F1AA 4OQTA 1YNTF 5GGRA 3LZFL 3KYOA 3ARED 3KCWA 2V2TB 3VU1A 4DN3L 4TSCL 4FQLH 3PE9A 1JI1A 3NESA 3MA9L 3WTWA 4PGDA 3EXLA 4P2QB 5JMOC 4HC1A 3C8HA 3V6ZB 2AC0A 3WFZA 3OMIB 3QO0A 3VI3F 3VFVB 5J9PA 1EJ8A 3OXSB 4D7BA 2HG0A 3LRHA 2HKAA 3ZLQC 3GBDA 3WDIA 3L4UA 2BOCA 1RPUA 1ZA3A 2Q3ZA 3HC4H 3KE0A 1AD9B 2OR9L 5F71A 3BAWA 5DHVH 1UB6B 4P46B 2CA3A 2XT1B 5FA3B 5K5YA 1HSAB 1SMAA 2YA2A 5D7JD 1K85A 4PG2A 4C4UA 4QOKB 3TBTA 2VZ3A 2FT7A 3DURA 1TOXA 1XCWA 1JPGB 5I2IB 3QB7C 2FBJL 1EHKB 2YGVA 4ZXBC 5GGSY 4Y4HC 2VLKE 3B2VH 3O4LA 1MLBB 2ZCLL 4HGKC 4NQUA 4KZDL 1OD7A 1OHQA 3FXIC 4JHAL 4ADGA 4OLXL 4XGZB 5I1HH 5HHVH 1WWAX 4HKJA 1VEMA 4DUVA 4GQQA 1IM9D 1ACZA 3SPHA 1EZVX 1ET5A 2ICEB 3LVTA 3PL6D 1X5IA 2Q86B 2BOLA 3PF2A 1TZOA 4GI6A 4JL1A 5KVEE 5KVFE 3KPSB 3U46B 1E9OA 2ESVB 3EOTL 4OCWH 3EGSB 1ZDQA 3INOA 3V0GA 2QSCL 1OAKL 1SFHA 1MRFH 1DUZB 4G43A 4QYOB 5CJBA 5DZVA 1TQVA 2KL6A 4JGNA 1MFDH 3RUGA 4BCXA 4NM4L 5C3TA 2AK4B 3JWDH 2OFQA 3QQ3A 2WXJA 4ZAKC 1ZTMA 2ICEC 2C3WA 5ABAA 4QY8B 3P2DA 2RHEA 3EG9A 4UQDA 3MLSL 1KBPA 1CLYL 4OJFL 4TNFA 2VKXA 4KBPA 3L2MA 4DP4X 1J87A 1UEYA 4Y2OB 1ZVSA 3LXBA 3HI6L 1UA3A 2ITFA 2R0WH 4ZUVB 4X98A 4XWOD 1FIEA 3CVHA 3EDDA 3FFCA 1FRGH 1F2QA 2PLTA 3CQQA 1Y07A 3GBLA 4AI7A 1XH0A 4JFPA 5ICZA 5C70A 4OFYA 3U36A 2IGLA 2BSTA 3UBXB 3K6FA 3OPUA 4L3AA 2R9HC 2VSKB 1KYUA 3WFHA 2WW8A 1PKOA 1B9ZA 4F5CA 2CLZA 5GRUL 4NC1C 4LHUA 3DBXA 2BZ7A 2BNQA 4WFHE 4HS3A 1TJGH 4WWNA 1VFOA 5B38G 5TQ0H 4G82A 1KJ2H 3E0GA 4QD2E 1OHZA 5F89A 4A7GF 3MOAH 1NDGA 1MAMH 4NM8H 2GCYB 1EA9C 5TF1L 2W60B 3UJIL 1LEIB 1YLBB 5E6SB 5C86A 1X5XA 4WI0B 2O5XL 2YRZA 5B1BB 4UDTA 1DSWA 3I9GH 5JORB 4YSPA 4AQAA 3HG4A 1JVOA 2C3HA 1S7VB 1EHXA 2N7BA 1AO7B 2XN9B 1EHAA 2DI8A 1IGML 3OVUB 4M7LL 4U1HA 1S7TB 2Z91B 3O9WB 4GG8B 2FIRT 2LFGA 1P4UA 5G4OA 4FYQA 4XODA 1ND0A 3G5ZA 4PRDA 4LMQI 4R7DB 3MLXH 2FX9H 5DMGD 1HAWA 3VSVA 4R4FL 1N2RB 3HNTH 1CXEA 3WYRA 1CFSB 1UWXK 4KJQC 4PJ5B 3DDGA 4OCYL 1TQSA 4FQJH 1G7HA 2CGYA 4PCTA 3IDXH 4A2DA 3TA3B 4APQA 1Q9KA 4UI2A 4N20A 4RMRA 1OAYH 4F91B 4PRBB 2A9AA 2HUEA 4ODUA 3WG7B 3I50H 2VJ0A 2XKUA 4L2LA 3CLFH 1D3CA 3GSOB 4WFFD 3GK8H 2XRAL 5CLWA 1KNOA 1IGCL 1ERNA 1NCHA 3DX9A 5FO2A 3BUYB 4QUOA 2NZIA 1I8MA 1X5YA 1BLNA 3ATFA 2VLJE 1Z3GL 3OD3A 4APQD 2LLLA 2XN1A 4L3CB 4J3XA 3U4BL 1NFAA 5IBLC 2X1XR 5AW5B 4P2CG 2W59A 3MRIB 2JKXA 2X9YA 1FPTH 1J8HB 5KW9H 2OJZL 4KO5A 1SMOA 2MJWA 2J6EH 4RX4A 2BVPA 1CJYA 3TN0D 4ZUWB 3GMQA 4HS6B 4P48A 3MFFB 4UV4H 4KUZH 2IPKA 3SCMA 1G7MB 1PY0A 5ANMA 4MWFB 3MI6A 1GXEA 2Y5TB 2LHAA 1G7QA 2EKSA 1J5OH 2NY5L 1WAPA 2WSDA 3ARBD 3D4GA 1U8QB 3AADB 3L54A 1OT1A 3BIKA 5T1DH 4AIXA 1RIHH 1N4XH 1JFQL 1HHJA 2BFVL 1UWYA 2FRGP 2J8HA 5DSCA 3VX1A 1TPXB 2DB8A 5TJWK 4R4BA 3SCMC 1R9FA 2CJUH 1BJMA 2JH2A 2QT6A 1U21A 4OF7A 2NY3C 5E8OB 1YN7B 3LZNA 4H1LB 2WBJA 4HUVA 3O81A 3QDME 3JSSA 2NX5D 1AD0A 3GHBH 5D1XC 3CNKA 3Q8BA 3X1EA 1SHMA 3DYPA 1QNIA 4QDGA 4LARH 1A6AA 1YMMB 1YYCA 5C0ND 5MEPA 3NDZE 4LVNB 5EBGA 1UGNA 4NJ9L 3HE6D 4YQXL 2ZXBA 2DYRB 5CILH 3ZHDA 2FO4B 3OR7B 2NPLX 1FZMA 1MCPL 5FUOH 5KTEL 5KBPA 1TCRB 3EO1A 3GEFA 3T71A 4TVPE 1XR8A 3VXOB 1HQ4A 3Q05A 4RLDA 4P2RD 2MRYA 2VDNB 3ZOAA 3NA9H 2JJTA 4G8GA 4HKZB 3FU7B 3GO1L 3IFPA 2CXGA 2PCPA 1PD0A 3L3KB 3LQMA 4Y9EA 1ROCA 1WIPA 3QFGA 4IS6B 4BK8A 1Q9WB 5FCUL 4E5XA 4U1JA 2C7UA 4JKNA 2XU9A 4NHCL 1PZAA 5I1EH 3LDBB 1I8KB 3ULVC 1U8LA 3TP4A 2DLFL 2ZP9A 1E5UI 5L8KB 4FI8A 3RGVA 2JTDA 4YHKL 4ENED 4Q0XL 5KBKA 2E7BA 3G5VB 3WMQA 3F8UB 3EKCA 5DMKB 4S11A 2KMWA 5F1NB 2R0KL 5J13C 5DJ6B 4NZTL 3ESUF 1FYTD 5FUOL 4EI6B 1HSBB 3SGJA 4WW2F 4XMLL 4B9FA 3FFDB 2HVJA 1BECA 3FTUA 4DN4L 2Q7NA 4DKDC 3PWPD 4G5AA 1FAKT 4I3RL 3GTTA 1URZA 2C4XA 1RLBA 2ZIDA 2KLSA 1AHWC 2VQ4A 5B38A 4XNXH 1KXTB 4P05A 3PABB 5D7JA 1L7IH 3ZMEA 3WL9A 5LB1A 2OSLA 5FA4A 1BOYA 1IBHA 2WN2A 5MI0B 4X4YA 5H4ZA 3FTXA 2Z92B 1U8NB 3NSYA 1J12A 3TBVA 1IGMH 2H7WA 3AU0A 1KDIA 1TQTA 2YXWA 5GS0C 1L6XA 2CZNA 2IQ9L 3K2UL 1NFDB 4IJTA 4QRRB 3RI5K 1QLFA 2BSCA 2QVMA 3MV8B 4HUMB 4ZXBB 1R0AL 3PHOB 1BV8A 3O6KH 2OK0H 1YDPA 1F3RB 4Z3TA 5ETUB 1EHNA 3II3A 4JQIL 1BQ5A 4HHWA 4NCC2 2NSQA 3EO9L 2QVFB 4QNPF 1V54B 4FABH 4ETYA 2D8KA 2ED7A 2EAEA 4XCYB 3MO1B 1KCUL 4NNXA 3AVEA 3JVGC 2E9WA 3AABA 2YSSA 1HDMB 4YHLH 1UT9A 2IADB 1T89A 4FXKA 1I9IH 1KBWA 2AEQL 3HAEB 1JXJA 2QKSA 3QORC 4G8EB 3NIDB 3TCLB 1ETJA 3MUGA 5CJOL 2IH3B 1F45A 3TZVC 5IBTL 3B83A 3BRDA 4PU2A 4J3BA 4NC2B 2WNWA 5HDWA 4C56B 2AI0H 5A6IA 2VQ1B 5FUZH 3GMLB 3QUGA 3H6AA 1G9NL 4FQLL 1T0PB 2YPVL 3HHMA 5C08A 4X4XA 5HYSA 2EDKA 2YPLA 3B2MA 4UNTA 5DJXB 3D69B 4AM0Q 1EFXB 4JCWA 1KB9K 1IGFL 2E7HA 3TZVB 5I75B 1KJMA 4HIEA 5DJCA 2VDMH 1DVFA 2HJFB 3QJFA 4L29A 3H7BA 5KS9F 1PGRB 3ULVE 1DQLL 3ZT7A 2WXFA 4ZTPH 1HCYA 3TH2T 5LNEA 3TBSB 4K7PX 3DWTA 1KXHA 3QJHA 2JLLA 3L3IB 4P5TA 1FAIH 4ELKA 3KPTA 3VD0A 1ZGLM 1UH3A 4NEHB 4NKMB 2Y6SC 3H2WA 3GUTB 2B9BA 3AREA 2F8XC 2PCFA 2WTRB 5CCHE 1UM6L 2XG4A 3KCPA 1ZA6A 4ONHA 1JNNL 3CVIL 3P02A 5E00B 3F64A 3NA9L 1G1CA 5D1ZB 5KOVC 4JANB 1DVFC 3ETBF 1LEKA 1I9JH 2FB4H 2X38A 1TTGA 2P8LA 3IE4A 4KK5C 4Y5VB 1DANT 4PFEA 2ADIB 5JW4Q 2PF6A 4P2YA 2O5ZL 2J3SA 5DRWB 3POCA 2G3MA 4UAOB 4ZBJA 5I1HL 4PJIB 2DICA 3P9MA 2FJGB 4KX9A 3Q5TA 4JY5L 1NIFA 4NKIL 5LVEA 1AS7A 1UWEH 2XA3A 3J7HA 4JO1L 5FDWB 1W72L 1BXVA 2A38A 2XN9D 1D5XB 5DT1H 5HYJB 5IQMA 3LQAH 4NPYB 5DUBB 4IBUA 5FHAL 3OF6D 3VFSA 2D03H 3LKRB 4AE0A 1T22B 3VFNB 3PWNB 4RWYH 5AW8B 1NM4A 4IOIA 4N2LA 2RCSL 1CPUA 5F0MB 3KZ8A 2V2TA 4R7XA 4FG6D 2I7SA 5FYLH 5AZUA 3REVB 3HC3L 3ISYA 3UTQB 3BWUC 2BP8A 3NJVA 1XQ4A 2R83A 1ZT7A 4NIYE 1YMMD 3HN5A 1PS3A 4P2QA 2XC8A 2YEZA 3DOSB 4NGHL 3OF6A 4WKXA 3D85D 3V0DA 5LBSH 4BUGA 1KIQB 4X0KA 4H8WH 4J1UA 4WUUD 2IQ9H 2F7QA 3T1FA 4HC1H 2VDPL 4MZIA 1U3JA 3VFWA 3P9LB 4GBXB 2WVVA 2X6VA 1NBCA 4G1MB 3S48A 1QFHA 1I9RL 3F12B 3UMNA 3B3IB 4UOW0 5D1QB 4DO5A 4ZZFA 1KXQA 4XPBH 4N6RB 1EUTA 1KJVB 1LQBC 3EBIA 2ZXCA 3WHE0 1K8IB 1HWWA 1RZQA 4PRHD 3SE4A 1U8PB 4R0LC 2G5BB 3X1BA 4EZKA 1G7PA 1A3LH 5FV1L 4DO6A 4FTVD 3W5MA 4GT0A 1QZ1A 1T0MA 1IJNA 1ORQA 2DIBA 1BVKB 4NO0B 4G6KL 5HHOB 1NUGA 1MCNA 2YD8A 3O4LB 1E27A 3QORB 1JHTA 2J8UF 3HUJA 3VFOA 3WS3B 1KENH 3CSGA 1ZPUA 3QH3A 4MA3A 5DR5L 1PQZA 1L7TH 3KYNA 3L81A 3WFEL 4IBWA 1D6EA 4HHAA 5BVPH 4AW4A 1KCBA 1EMTH 3F7KA 4U1KA 3WUWG 1DVFD 2AJSH 2WBKA 5EZOH 4X7TA 3FAWA 4MA8H 4EXKA 2XZCL 5I1JH 4HIPA 4QRTB 1CDUA 3SYOA 2DWXA 1S8DA 2YLHA 4MJ2A 3VWJD 5KVDE 2EDFA 3GXUB 4WEMB 4WNQB 3GSVA 2MOVA 2LABA 3IAGC 2B3IA 3CDCA 4CW1A 4AXWA 3V4VA 1T04A 4YFEA 2VZUA 3JTSB 1JNHA 3ARRA 2QADB 2XIIA 5LG1A 2DQCH 3BP7A 5CZVH 5I5IA 2AMGA 9CGTA 4OGYH 1S7RB 1TJXA 5KOMC 1URLA 1PX3A 3HB3B 4XVSH 1PW3A 4YHYB 4L0YA 3AW5A 5C09D 4GRWF 3NABH 4H0HB 1U8MB 5IIEB 2ZX5A 1EEZB 2LTQB 3P11H 5J1AB 1D6VH 4E0RA 1S9XA 4PJ7A 5EUOB 1EXGA 1CFVH 1RZFL 3D87B 3GMPB 3VXUD 2E9GA 3QDAA 3MRJA 3FOMA 1P4BL 1ZHBB 2JK5B 1VZGA 2Z7UA 3QPQC 1SVBA 1BYPA 4LSQH 4LEBA 2QQQA 4LQFH 1OCZB 2Y1YA 3GHBL 4M8QB 1DQJA 4ZX3A 1DBKL 1QACA 4RFOL 3WS6A 4F8PA 3IGFA 2G4GA 4XMLH 3UABA 1NAKH 1O9VA 3OJDB 1J1PH 1AAJA 1R19A 2BSTB 3CLEH 4JFXA 4PRNB 5DFVD 3S6CA 1DLHA 5I8OL 3J07A 2NZ9C 3CHQA 3R4DA 3PXJA 5DRXA 4Y19E 4U1MB 3KPQB 3ASNB 2BNQB 2O5XH 4X5WB 3KNBB 4MNGE 1EEQA 1T20B 1XO8A 3F7YB 4M5ZH 4OZHF 4WI3A 2DL9A 1E30A 1MJUH 1TLKA 1XGYH 2R0ZL 3ATEA 2FX8H 3IETA 3L6FB 3IBOA 1YEHH 3SPJA 2YD2A 3EJZC 3JYBA 3VXSA 1Q0YH 3NK3A 3HZVA 2ZYIA 3OKKB 3WS6C 4Z3GA 4UDTB 2BINA 4Z78A 1OLZA 1ZHLA 2EE6A 1CWVA 4PM1A 4F80A 2YRLA 5BVJB 4JNXA 1AO7A 1OGAB 1A7PH 5J11C 4UOQA 4LHJB 3D09A 2PTTA 1NPUA 3P4NA 3I84A 3MXVH 2I07A 2IDQA 3VQ2C 4F33B 2YPLE 4YHNB 3QCUH 3SKNB 2UXGA 1NLBL 2XZAL 4MNQE 2RJMA 4IMKA 1PLGH 2MQGA 4N2AA 2WGXA 3O6LL 1XDTT 2HZHA 4GLRI 4RGMC 1RZGA 4G8IA 4YHKH 5HDBB 2BIOA 4KUCD 3D3VB 2AI0L 1A2YA 2WIIA 4OZIE 1F4XL 5GGSA 4EDXA 5AAWA 2JKTM 3FT1A 3TF7C 2PXYD 3IMUA 2BXYA 1BFVL 2A9NH 3ZDZE 1IGTB 4WFEE 4ZO6A 1SXCA 3RQ3A 4W81A 4U4BA 1DFBL 5B21A 3GT6A 3WN5B 5I1IH 2OMYB 2XQ0A 4JFQB 1TLMA 3MXWH 4L3EB 1MHPL 3OB8A 3V9FA 3QI9D 3ZE0E 4PJBE 5FYKD 4J8RA 1RJCA 3GQFA 1B88A 3WFDL 1TZIA 2XG5A 4PWIA 4CA4A 5JA9A 1NMBH 3CPLB 2CBOA 2PABA 3NQIA 4I88A 2PW1A 1E4HA 2K0RA 2FQFA 2R2EB 3HRZA 4N0UB 2VLJB 3V7AG 4FQ1H 5FO9A 35C8L 1SYSB 4N8VA 2R59A 3BUTA 5L7XH 3LEXB 4FTDA 4H1LG 1QW8A 4NKOB 5EOQH 1SY6A 3IBEA 3O0RL 4DETA 1KEGH 1A3RL 4I2XE 4ES8A 2N4IA 3TT1L 1KBBA 4H20H 4P9HH 3TU6A 4DVRL 4QHUB 2WXMA 3I02B 1I75A 1QUPA 5DURB 4ANXA 3LEVL 2SODB 3FHEA 2X4PB 2FCBA 5EWIH 1DVQA 5KS9A 3TV3L 3RFZB 2CDGB 2GIXA 1KB5H