1XHLA

Crystal structure of putative tropinone reductase-ii from caenorhabditis elegans with cofactor and substrate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
274
structure length
274
Chain Sequence
RFSGKSVIITGSSNGIGRSAAVIFAKEGAQVTITGRNEDRLEETKQQILKAGVPAEKINAVVADVTEASGQDDIINTTLAKFGKIDILVNNAGANLADGTANTDQPVELYQKTFKLNFQAVIEMTQKTKEHLIKTKGEIVNVSSIVAGPQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATGFMGAMGLPETASDKLYSFIGSRKECIPVGHCGKPEEIANIIVFLADRNLSSYIIGQSIVADGGSTLVMGMQTHDLMSVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of putative Tropinone Reductase-II from Caenorhabditis Elegans with Cofactor and Substrate
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase family member (5L265), p
total genus 102
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 2004-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xhlA00
3ASUA 2YYYA 3FSRA 1O95A 2CVQA 4IS2A 4B4OA 5CDGA 4YWJA 4AJIA 3JYPA 4IJUA 4FFOA 4ALIA 4EYEA 1R37A 4BO8A 3NTQA 3OQ1A 1AE1A 1Y8RA 2HU2A 5FYDA 5B37A 3PWKA 3R1IA 3H4VA 3CXRA 4XB2A 4XWYA 2EW2A 4WUVA 2EKQA 4PIVA 1GU7A 5DOZA 4RJTA 3UHAA 4A5OA 5I8WA 5L4NA 2PK3A 1NVTA 3LU1A 1MFZA 2CNBA 3PIDA 3WSWA 3WLFA 3WXBA 1IE3A 4DLLA 2PGDA 5TT0A 1ADGA 1ENYA 3MOIA 5KVSA 2DUUA 4W4TA 4RO0A 4WPGA 3K2EA 4JLWA 1YE3A 1FJHA 1YB5A 2C54A 3WGOA 2W90A 2JCXA 5TS3A 4J2HA 1IB6A 2X0JA 8LDHA 3GN1A 3R3SA 1NQTA 1XG5A 3C1TA 3DZGA 4PLGA 3V2GA 3AFMA 3I52A 3E5MA 1GZ3A 1QP8A 2IODA 5IDXA 3AFNA 4EEZA 1B8UA 3C7CB 3GVXA 2B35A 8ADHA 1E1KA 2D5AA 4DIFA 3U4IA 1QG6A 3IP3A 4ND1A 3HN2A 3QWFA 5EJ2A 4A0SA 4CMHA 3H5AA 1WWKA 1UZMA 4QO7A 2DU8A 5HA5A 1EBFA 3PHIA 4CMEC 3H9JA 4YDRA 3OICA 3GF4A 1XIVA 3STHA 3QLJA 1KS9A 1CEQA 3KEOA 4WASA 3DO5A 4HADA 4YAIA 2GSDA 1Y8RB 1I2BA 1UZNA 2RH4A 1PR3A 1O0SA 2AA3A 4R1UA 4CPDA 2AEFA 1C0KA 4DLAA 3UOGA 4LSMA 4DQUA 4DYVA 1NR7A 4M86A 3GRPA 3BMQA 2VYVD 1V9LA 4YJHB 4MVJG 4Q9NA 7ADHA 2AMFA 3VOSA 1BWSA 1YB4A 3L77A 2CMDA 2NTNA 4J0FA 3FCOA 4YCAA 3GEMA 3WWZA 4XD2A 3ONFA 1BRMA 3B1KA 1GUFA 3ST7A 2G1UA 3PK0A 3H9GA 5DOVA 3IOYA 1WZEA 2GYYA 1ZEJA 2RCYA 4BO4A 1N7GA 1FDWA 1NAHA 2I67A 1UAYA 2EV9A 2V6GA 3DAGA 3GGPA 3PYMA 2HK9A 3Q2KA 5GY7A 3SEFA 5IXYA 4Y98A 4DL9A 2LDBA 5EMHA 3VH2A 2A92A 1R0SA 3MTGA 3QP9A 3F4BA 3DFUA 3ONEA 5A05A 3S55A 1BHSA 4Z9FA 3UUWA 3W1VA 4KTTE 1KEPA 3PYXA 4M54A 4CM9D 5JC8A 3ICPA 3WGGA 3TZHA 1A72A 3NT5A 2EW8A 2VYVA 2C82A 1YOVB 4B79A 4CMIB 1UP7A 2EERA 2FHSA 1D7OA 3JQGB 1JW9B 1QSGA 4TVBA 3ZGYA 1JWBB 3DOCA 2FRDA 3S2GA 4CMGA 2HDHA 2ZATA 3RIHA 3RD5A 4E2ZA 2C0CA 3PHJA 1P44A 4NH4A 1N7HA 1R4NA 3TOXA 2ZCUA 5L7WA 3VTZA 3K6JA 5EERA 2Y67A 1X7GA 4M89A 1DJQA 4AJEA 1V3TA 1LTHR 1E3JA 1XA0A 1X1EA 3MJVA 4MDHA 3NT2A 3RKUA 4PGFA 4FFLA 3SXPA 3JQ7B 3NTRA 3QVSA 4S1VA 3WDSA 5G0TA 5L4LA 4XDZA 5KCZA 1KVTA 2BH9A 3FD8A 4UEOA 1KBZA 3WYBA 1NYTA 3QVXA 1DDOA 1DIHA 4J0EA 5EQDA 5BNFA 3E18A 3DMTC 4YEDA 4WCFB 4I9HA 4FJ0A 1M75A 2J3JA 4LVCA 4MVJF 2B83A 4E33A 1DC4A 3BHIA 4H15A 4NJMA 4JROA 1MXFA 3LF2A 2O3TA 4L4RA 1SPXA 4BKQA 1ZXBA 4F3YA 3INGA 3NUGA 5LC1A 3NJ8A 4NFSA 4E12A 2JJYA 3PHGA 4CV0A 3ETDA 1ONOA 3E5RA 5IXSA 4XGKA 3D5TA 1PQUA 2NU7A 3GR6A 3VVCA 1KVRA 5ENVA 3ORFA 5ICSA 4EDFA 1LDYA 2EXXA 3S2FA 3VH1A 3E82A 2YDXA 5G0WA 5K9ZA 4I5FA 4FC7A 1HZJA 3OJ0A 4CM7A 1Z73A 3EY4A 2G82A 3GDOA 1KERA 1LSSA 1ZUD1 2JL1A 3G0OA 3D5QA 5TJHA 3JQ9A 3RU7A 2DPHA 3ZWPA 3MTJA 1GFSA 5AQ1A 2E48A 3AU8A 3RUFA 3AOGA 1PIWA 5T5QA 2HKIA 4HX5A 4I5DA 1F12A 1NM5A 3V1YA 1KVSA 4NNJA 1VL8A 3PLRA 4PZDA 3ZNPA 4FOOA 4BO9A 2IE0A 4IIVA 4II2A 3GZNB 1EBUA 4OOFA 1M6WA 1LJ8A 2OZPA 4RQTA 5DBIA 4FN4A 5A02A 1YBVA 1UXHA 1PL8A 1UR5A 3HDQA 3LT0A 1EQUA 1I33A 3DB2A 3WBFA 4CMBA 3LZ6A 3QIVA 5K6AA 1FDTA 2V6FA 3SVTA 5KIAA 1TLTA 4U8GA 4YT8A 2YZ7A 3FWNA 1MP0A 3BMOA 4M49A 2DM6A 1XEAA 2HMVA 1VJ1A 4FD3A 4IIUA 4P8RA 2YV3A 4PLCA 4YBZA 1YBAA 4Q3NA 1X15A 3CE6A 3GUCA 1EVYA 1YXMA 1PJBA 3GH3A 3JYLA 2EJVA 1Y8QA 1K2WA 1NAIA 4J3FA 2GN9A 1HZZA 3RBZA 4ND3A 3RVDA 2NLOA 3O03A 1Y9EA 1B3BA 1GEEA 1DFHA 1LI4A 2H63A 2I99A 5F5NA 3D4PA 1F0YA 3OQBA 1ULSA 3SJ7A 4N7RA 4CM4B 3DBVO 4MOWA 3PHLA 1VL0A 2GN6A 2IRWA 2BGMA 4LMRA 2BMAA 4YQZA 4OJNA 1DXYA 5I8ZA 1JAXA 4JBIA 5G2OA 1U2GA 3EYWA 2W8ZA 1BXKA 3WJAA 4E32A 5L7TA 5MGBA 4NJMB 1CIVA 3Q0EA 2D3TA 2ZIZA 2AG5A 2X0IA 1PL7A 3WQSB 4AJJA 4CM3A 5BQFA 4RVDA 4BHTA 1GQQA 1B15A 4GMFA 1SB8A 3ZV5A 2A94A 5G4KB 3WIDA 2GDZA 4I9NA 4KP7A 3JYOA 3BMCA 4AJKA 3A1NA 1MA0A 4FS3A 4BIIA 1DC3A 4BB5A 4U0JA 2PY6A 1Y1PA 1P1RA 3HDJA 3WMWA 4BNUA 2OUIA 4BV9A 2C5AA 5T8KC 3E03A 3VPSA 3WGHA 2YJZA 1PGOA 1Z7EA 1ARZA 2B37A 4C4OA 4OQYA 4GL4A 3RC1A 5CDYA 4Y8VA 3X2EA 2VHYA 3I9OA 3KSZO 4N54A 4TRJA 6LDHA 1BW9A 3DAFA 3RBVA 3C3XA 5TX7A 4R1NA 2NV6A 4PLVA 3CMCO 3QVOA 2I66A 3D4NA 4XRRA 3TZ6A 2RHRA 2PGLA 3V2HA 4FJ1A 1IHXA 2FSVA 5L95A 2OL4A 4CUJA 3TOZA 1LRKA 1NR1A 1U8XX 4CR7A 1ADFA 1PEDA 3D64A 4BO1A 5HS4A 3NJ4A 1I3MA 3ZWNA 3GA0A 5B4UA 1HF3A 1VJTA 2QX7A 1RJWA 1XU7A 1LRJA 2AE2A 4J4BA 3AW9A 4AFNA 3C1AA 2NUAA 1GYQA 3ZH2A 4YT2A 2UVDA 3C24A 3JQ8B 3FNFA 4N5LA 4Q3DA 5T57A 4YRDA 5B12A 5JDIA 1B3RA 5TRTA 4MVJI 3U4CA 3ULKA 3W6UA 4WLUA 1GTMA 1PR9A 1BTOA 1KEVA 4NU5A 1PSDA 4A10A 4BGEA 2WMDA 2NU8A 2PNFA 2ZB4A 4I9UA 1VPDA 3PZRA 1DC5A 9LDTA 1P9LA 4E2XA 2CD9A 3VPGA 1NX6A 4IMRA 1K6XA 1LC3A 2XF8A 4R1TA 3U09A 5JO9A 2TMGA 2C29D 2Y0DA 3MJEA 2FSSA 1DBVO 3F3SA 1PZFA 2O50A 3OFSA 2O23A 2PV7A 3G1UA 2IXBA 4GQAA 5ICMA 4FQ8A 4RVFA 5JFOA 4KWIA 1WDKA 1N2SA 2BRUA 1VSUA 1PJTA 2XXBA 3GFBA 2AEMA 3OH8A 4CLHA 3ROPA 3DZBA 1G0NA 3GUYA 1GZ6A 1IZ9A 2FZWA 3HDHA 3TZQA 3X2FA 3OEYA 4D3FA 1GV1A 2D8AA 5HWSA 1UP6A 3MJTA 2PZJA 3QWBA 4Y9DA 2AG8A 2Q45A 2HMUA 3IL2A 4R9RA 1H5QA 1SB9A 3T4EA 4ID9A 2WD8A 1SBYA 4DREA 3OP4A 1GYPA 1HETA 3QWIA 5DBFA 3I3OA 2OMEA 1J4AA 4EJ6A 2J5QA 4UUPA 4E2WA 4JGBA 3ZV6A 1R4NB 1X7DA 5LDHA 2PZMA 3DZIA 3EZLA 3AY3A 4U7WA 3GK3A 4EEXA 5JS6A 5DULA 5CG1A 4UREA 1O94A 1P45A 3OEWA 4O1MA 4JBHA 4NIMA 2PKRA 1HYGA 4OOEA 1ZCJA 4IINA 1I2ZA 2VOEA 5EINA 1R0KA 4G81A 2AQ8A 4NJOA 2WD7B 1UDAA 3IAHA 3P2OA 5JAMA 1V0JA 3E1KA 4LRSB 4J90A 5FI3A 5JAQA 1QLJA 1H0KA 5L51A 3ROMA 5COAA 1T2FA 2YHIB 3C85A 4ND2A 4AJ1A 1EVZA 2HO5A 3R6DA 4RPGA 2BLLA 3FR8A 1Z45A 3GGOA 3RQSA 1RM3A 2E49A 3U3XA 2AXQA 1CQJA 1NFFA 1XU9A 2W4QA 1O5IA 4ALKA 4GX0A 1N9GB 5JAZA 4TKMA 1FDSA 1MLDA 2GUGA 4O6VA 3FF4A 4GAEA 4EGFA 4JIGA 1XQ6A 4ALJA 1HDGO 1LSUA 2EKPA 3PFWO 3VH4A 2NWQA 4CLDA 1PJQA 3FTNA 1ZFNA 1IYZA 5DCYA 3GEDA 3GVPA 4IQGA 1JU9A 4MVJM 1LEHA 2GASA 5KJ6A 2IEBA 3VZSA 1EVIA 2PZKA 2UAGA 2ZYAA 4XJTA 3RUDA 3GMDA 3DZFA 3EVNA 1YGYA 1BDBA 1PJ2A 4Q39A 3KYDB 4OM8A 5CG2A 5B4VA 4MKZA 1T26A 2J5KA 2UUOA 5IN4A 5ILOA 2WYUA 2BI8A 4GX2A 1H2HA 1KETA 3LT1A 3DMYA 4EUFA 4ZQEA 2O7QA 4PZEA 1LSOA 3S1LA 5HTOA 2H1SA 4YJFA 2Q4EA 3H9QA 3WNQA 1SOVA 1YS4A 3INTA 4RDIA 1QMGA 3K9QO 1U5CA 4R4JA 2O3JA 4FC6A 3KBOA 1LNQA 1PJLA 2AQKA 4MIYA 4E4YA 1PQWA 5L40A 2VYND 5TLSA 5ES3A 3PGXA 2OP0A 3HJAA 4OL9A 3SLGA 3U4HA 1WPQA 3LK7A 2AE1A 4D3DA 4RQUA 3H3FA 2X5KO 1PWXA 1Z75A 5KVVA 2Q1TA 1HDRA 1U3TA 4IDCA 4OGWA 4OKNA 1C0IA 1WMAA 1R6DA 2FPGA 2UUPA 2XOXA 1PTJA 3D3WB 3H6KA 3ITKA 3JQFA 2HSDA 4L4SA 2YDYA 3BMQB 2O3QA 4RPHA 4PCVA 1I3NA 3DBRB 1DHTA 4HNHA 3ZU3A 3ZW8A 5IDQA 1LDEA 3VZRA 3UH1A 1LLCA 4QFDA 1LQTA 3DEYX 3OIDA 1ONPA 1NASA 3H9EO 4EW6A 4DC0A 4HKTA 2ZTUA 5IJZA 4N5NA 1QYCA 4DMLA 2VCYA 1UXIA 4ROSA 3WBBA 4AL4A 4FFNA 4NBVA 4IQ8A 4DIBA 4UVHA 5A4DA 4HFMA 3E48A 3B20A 1I36A 4J9VA 4ND5A 3ZHBA 4ILKA 3TZCA 1EUCA 1B2LA 3ADPA 4R01A 3CZMA 2Z1MA 3HN7A 3NAQA 4YAEA 1KVUA 1YL7A 3JQAD 3O9ZA 2EHDA 2OHXA 4TWRA 4J1TA 1CWUA 1I3KA 1U7TA 1DPGA 3CSDA 1LLQA 1PGJA 1HYHA 4BGVA 2G76A 4TRMA 5DT9A 2J8ZA 5FI5A 4WECA 1ZSYA 3WNVA 2EG9A 3WYEA 4B3IA 3B6ZA 3B1FA 4UUOA 5ITWA 3U4DA 4U0KA 3HHPA 2GO1A 1R12A 2UYYA 2VT2A 1FDVA 2PD3A 3GNQA 4D44A 4YAGA 4YRBA 5JNLA 4GMGA 4KOAA 1PU2A 2X0NA 3SLKA 1I24A 3KVOA 1C3VA 4CR6A 5JYDA 3QWAA 2Y0CA 4TRRA 2VYNA 4B4UA 3O4RA 1Q7BA 3OMLA 1HE5A 1I32A 4BNGA 1E1MA 4ZJUA 5A03A 1ZK2A 1T4DA 5T64A 2Y1GA 4UEKA 3F47A 4BNKA 4HFRA 4YB8A 3GEGA 4XKJA 1I8TA 3ANNA 1NQAO 3FNHA 3JQFC 3QA9A 4FOSA 1ISMA 5CFZA 3OECA 3VC7A 4BGIA 1E6EA 2C7VA 3PJGA 3GNSA 5C7IO 5AXBA 2NSDA 4ZRNA 3ONDA 5ADHA 1NHWA 3H5NA 4D0SA 2NU6A 4HV4A 1BGVA 1I5RA 2VUSA 4IUYA 5EIOA 2NQTA 3RROA 4L74A 3UGKA 1YL5A 4AG3A 1N92A 1E3WA 4RF2A 1D1SA 5CEEA 5L9AA 2FPIA 2QRJA 2DTEA 1LRLA 2G0TA 3DONA 4NBTA 1XELA 1ULUA 4JQCA 3WSVA 4O5OA 4GSLA 3AJRA 1P1KA 1A7KA 2Y66A 4Z9XA 4K6CA 4M87A 1DRWA 1Y6JA 3TNLA 1O8CA 4J4HA 2BF7A 4XR4A 3CUKA 3JCZA 1TXGA 1M67A 2DBVO 3LC7O 3DDNA 1MUUA 5TT1A 3TQHA 2R6JA 1PZGA 5CPFA 1JN0A 3GFGA 1U8FO 3DBHA 3EVTA 3L4SO 3H8VA 3K96A 3PWSA 3QRWA 4FGWA 1NNUA 4ZVVA 4OKIA 1NQ5A 4YA6A 5AXCA 4FW8A 4PLPA 4BKUA 3T7CA 3GQVA 1SAYA 4XIYA 2RH8A 2DBQA 4Z3DA 4XB1A 4RF3A 5CDUA 2FY8A 5BNTA 2C2YA 4ALLA 4GX5A 2VRCD 3BXXA 1B16A 3WMXA 4FCCA 4A03A 3PHHA 3Q3CA 3KB6A 4J2OA 4E21A 3AI2A 3PVZA 5B1YA 4A7PA 2BFAA 1E5QA 2OFPA 1M66A 4EJ0A 2BI7A 3K2BA 4RVSA 3Q9UA 5F1OA 3GZNA 5BSFA 3GY0A 1HL3A 5DP1A 4BNJA 3G3EA 2IYPA 4JCOA 3PP8A 1T2DA 4F6LA 1JDJA 3F1LA 1T24A 3M6IA 1BXGA 4I5GA 4L73A 3IUPA 1A9ZA 3L9XA 2OXIA 1GPJA 1KY4A 2Q50A 4JXKA 5F1PA 3UXYA 5F1KA 4ZQBA 3DMTA 3OHSX 3KEQA 5C7LO 1K0UA 2QQ5A 2I6TA 1VL6A 1BG6A 3NDJA 3S8MA 1YH3A 4E2YA 3CZRA 1DRVA 4K28A 3G17A 4LVUA 4UVEA 1E0DA 4K6FA 4RVUA 1PJCA 1GQYA 2IDZA 2UDPA 4U5QA 4WK6A 5U4QA 1P3DA 3GPIA 1HDZA 3P2YA 1UDBA 4BNMA 2J5RA 4RZIA 2JFGA 4J1QA 4IXWA 1I2CA 2VHWA 3P19A 1YDEA 3HFSA 3OJOA 3FNEA 3U49A 3LYLA 3IKTA 4D3SA 1K6JA 1XQ1A 4XX0A 4LRTB 4GI2A 4WCDA 4M8SA 1GEGA 5BT9A 3ROQA 1GUZA 3RBXA 4YYZA 2IZ1A 5TSDA 4O59O 2ZYGA 1HDCA 3DR3A 3OA2A 3VAZA 1Z82A 1ISIA 3DTYA 4P4LA 3GVCA 1A7AA 2NNLD 5ER6A 1VI2A 2VNSA 2QIOA 3FN4A 2A9FA 2X5JO 4CMCA 3GAZA 4CMIA 1K5HA 1ORRA 1Q7GA 1BMDA 1LLUA 1OMOA 1A4UA 3DAPA 4XYLA 3RAJA 4EJMA 3M1AA 5JDIC 3BMNB 2FR8A 4NPCA 4OO3A 4RF5A 3ZWCA 4UAGA 3GVIA 2OORA 5EN4A 1HLPA 1ONNA 4WLOA 3O8QB 4Q3EA 2I76A 5KKAA 3S2IA 3N7UA 4JBGA 5KJFA 3M2PA 1PS0A 1R4MA 5IAAA 4LCEA 3KETA 1SEVA 4QECA 3PWZA 1OI7A 4K9DA 4ZA2A 2VQ3A 2OBYA 3NEPX 3UCEA 4IDAA 1VJ0A 4BGUA 3PRJA 1UP4A 2PKQO 4J16A 2VHVA 2ZB7A 1YJ8A 3F5QA 4BMVA 4E3ZA 1RM0A 2QRLA 2IZZA 3PJFA 4C7KA 3WTBA 1DAPA 5FEUA 3RUAA 4E5NA 2H5LA 4BKPA 4BUCA 2Y1EA 4DLBA 5EL0A 3RFTA 2NQ8A 3F6YA 1EE2A 1EK5A 4MIOA 1U3UA 2HLPA 1H6AA 4TKLA 4NZ9A 2EGGA 4MKRA 3HNPA 4AICA 1KC3A 1DEHA 3P5SA 3GN2A 4RGBA 4U6QA 3JQAB 1A9YA 1E3LA 4A27A 1E3IA 3M2TA 1IUKA 1MC4A 3KOUA 1YO6A 4CQLB 3EUWA 4G2NA 2GNAA 1W6UA 3UAGA 3BMNA 4AJOA 4XZ3A 1HKUA 4QT0A 2X9VA 1H6CA 1JA9A 3IIEA 4CM6A 3DXFA 1YB1A 2EKLA 4YVFA 2E82A 3AUAA 4IZHA 4R41A 4BVAA 4YPOA 3WWYA 4W9NA 2HJSA 3NDRA 5K0ZA 1LX6A 4CLXA 2BGLA 5BSEA 1JKJA 1B8PA 4NBWA 2B4TO 4OYRA 1AN9A 1J0XO 5H81A 4ZRMA 3TF5A 2JAPA 4OSPA 4KDEA 4N18A 3T4XA 2QYTA 2NADA 3VVBA 2NU9A 2RIRA 3K5PA 3W4IA 3QWHA 1F8GA 3MOGA 3RC9A 2VHZA 3I1JA 1PGNA 4RVHA 3HUDA 1T2CA 3RFVA 4JN6B 1TT5A 2JHFA 1O89A 4YJGB 4FGSA 3OM9A 2PLAA 4AJ2A 2YFHA 5COBA 3B70A 2X0RA 1XR3A 2LDXA 1PJSA 3IMFA 3HDYA 4G65A 4MP3A 4Y6PA 4Q3BA 5THKA 5JC1A 1IPEA 4EZBA 4MVJP 4P4NA 4GVXA 1M6HA 3ZNQA 5LCXA 3O8QA 2HJRA 1GV0A 5H82A 4MJLA 1R4MB 4GWKA 4PG4A 2WD7A 4ZHSA 4ZQGA 2J3KA 1O9BA 1PGPA 4CLOA 4CMJA 5K6AC 3JD2A 4PZCA 3L4BA 5TF4A 1W73A 4BKRA 3F5SA 3HQ4O 4JJIA 4AJNA 3Q9NA 4W7IA 3OIGA 3JQBC 2JD0A 1RKXA 5CDTA 4FFRA 4R3WA 3DQPA 1T25A 1KY5A 3DOJA 4IY1A 3HWRA 3JQBA 1G1AA 5THQA 1GADO 1U3WA 3VKVA 3TJRA 4PRKA 4YR9A 3NRCA 1ADCA 2GZ2A 1WDMA 4RF4A 3ZU4A 3AWDA 5DDIP 1I30A 4OXNA 5F3RA 1DSSG 4FSHA 4RPJA 2DTXA 3RU9A 5J23A 4DBVO 1LUAA 3I4FA 1LQUA 2GZ1A 3W6ZA 4FFPA 5A3JA 1CERA 1FK8A 2DC1A 3BHMA 1YOVA 3QY9A 3E9QA 2NTVA 4QTZA 4R9SA 3OA0A 2YUTA 1A4IA 1MFPA 3B1JA 3WOHA 3MCVA 3ANMA 3TZKA 2JKVA 3ADOA 4KQWA 2I5PO 4X54A 1X14A 2DBZA 3UCXA 2CY0A 1U7HA 1JKIA 5KWEA 4NFYA 1HEUA 1TB4A 2GN4A 3DZJA 1A27A 4WOJA 1X13A 5U9CA 4IQ0A 4AJLA 2X23A 4BNTA 4S3MA 2DFVA 1XSEA 4CLOB 2VZ9A 4BL5A 1XHLA 2O2SA 1B0AA 2BKAA 2YW9A 1W8DA 4UVIA 4JP3A 5HM8A 1KEUA 2DKNA 1O6ZA 2Q2QA 4YQYA 1E6UA 5MDHA 3U62A 5IZCC 2FR1A 3PXXA 4WCFA 1HTBA 1NPTO 2X4GA 4TVOA 3V8BA 3K31A 2V65A 4IMPA 4PG6A 1GUYA 2VRBA 3NKLA 4BNYA 1L7EA 1IL0A 1X0XA 2X5OA 3Q2IA 3NX4A 4B7UA 4Z0HO 3JQ6A 2OBNA 2DTDA 2VWPA 3S2EA 3IDSA 4LMPA 1PQPA 2QRKA 4K26A 1HT0A 1LU9A 2WTBA 1JAYA 1MC5A 1VSVA 4ZQHA 1ZH8A 4BNFA 5TC4A 4DQVA 4OSOA 1GZ4A 3WGYA 3DBRA 4W6ZA 4NR0A 4KWHA 4BOYA 4WOKA 1GAEO 4OXKA 3GPDG 3WX0A 1T2AA 1YL6A 3JQ7A 2OOSA 3GGGA 1FF9A 5COQA 1JWAB 5DZSA 2RBEA 1ISGA 1HRDA 1AHHA 4P38A 1WLYA 3I9JA 2WM3A 1ZSNA 5KVQA 4IM7A 5ITVA 1T1SA 1Q1NA 1R15A 1ZKMA 4FDAA 4IDEA 3WB9A 5AXDA 2C07A 4IPTA 1UDCA 3KYCA 4J49A 1WDLA 5A3VA 3JTMA 5BSGA 3AOEA 2VNAA 3UKOA 5JE8A 3WGTA 2VHXA 4LK3A 3SC6A 3C1OA 3ZNOA 2JD1A 2CF6A 1BSVA 4FB5A 2NVWA 4XQEA 5C3MA 5C37A 4WLFA 1CYDA 1GYRA 1BXZA 3PDUA 2Q2VA 5F21A 5I7FA 1C14A 2AQIA 4MPDA 4QFCA 4DPKA 5AVOA 2DBRA 4CV3A 4IJKA 1E7WA 2PD4A 4RV9A 4R5MA 1PJ4A 3V1TC 2B5VA 1ZXLA 4RPKA 2O3SA 3PFFA 4IS3A 5IF3A 1IHYA 1U2DA 5ENDA 4XGIA 5HS6A 2XPCA 1EFLA 2A4KA 4E5MA 2WWRA 3DWFA 3L07A 1SO8A 3ZWBA 3PGJA 2Y93A 1DRUA 1H6BA 1SOWA 3MEQA 4NQZA 2Q1UA 4TZTA 3W8DA 1V3VA 1DO8A 3TSCA 4B8WA 1HXHA 2HMSA 1IOLA 5JCXA 4PN3A 3C7AA 5KNLA 4GSKA 3HFGA 1I3LA 1QYDA 1N1GA 3E6AA 2CVOA 1KEWA 1LDGA 3GZ4A 3HE3A 3RI3A 3TFOA 1IULA 1E7SA 3IC5A 1DIAA 4D79A 2ZB3A 1B26A 4XYMA 3AOEC 1F17A 2Y0EA 5I7SA 5A1TA 4R54A 4L4XA 4XJSA 5DCWA 3RUEA 1WMBA 4RLHA 1A5ZA 2NM0A 4PG5A 2GRAA 4PVCA 5JXWA 2O2YA 4MINA 3AI3A 1E6WA 4D43A 3ZNNA 4GWGA 1HE2A 1F8FA 1LDBA 4C7JA 1RM4A 4GLLA 1EFKA 1Z7BA 2R00A 5G0VA 3W8EA 4GLOA 1X1TA 3KXDA 4YJHA 1JKFA 3BTSA 4R51A 1DC6A 2P5UA 2VWQA 5GZ3A 2FOIA 1PZHA 1UZLA 4TQGA 2CZCA 1QLHA 1DOHA 3DHEA 1AGNA 2X8LA 3LT2A 1IZ0A 3KM0A 5TJ9A 2HMWA 2EP5A 2HRZA 3A14A 4WNCA 5DF1A 1U5AA 1J5PA 4H16A 1CETA 4RDHA 1WAMA 2R2GA 4GGPA 1FXSA 4Y6RA 1HE4A 4BNNA 4RORA 2GCGA 1DIGA 4MP6A 4D0RA 4WJZA 4E31A 1ID1A 4YJFB 2ZJ1A 1JVSA 4U6SA 3TPCA 3A28A 3AU9A 4N5MA 3U9LA 1EUZA 2PH5A 3VHRA 5DN9A 2AHRA 2DQ4A 1S6YA 5EPOA 2W2LD 1SCUA 3GT0A 5T6BA 1Q0HA 5KJ1A 3H5RA 1JTVA 2DVMA 3DZKA 4AJHA 3OJEA 2V6BA 5FWNA 4FPXA 1ZJZA 4NBRA 1P0FA 3BIOA 3P7MA 1U28A 4P4GA 4BO7A 4R68A 3G79A 1TT5B 3LVFO 1BXGB 4DC1A 3E8XA 3L0DA 5IDYA 5CEJA 2Q46A 2JFHA 1ZMOA 1LDNA 2WE8A 2BFPA 4DWVA 3CINA 3IP1A 4PLWA 1N1EA 3DHYA 2VUUA 1VKOA 2DLDA 3I6IA 4LW8A 4Z0TA 5TIIA 3ETGA 1IY8A 3BTVA 4OXYA 4E0BA 3K8ZA 3V5NA 1RPNA 2VZ0A 4INAA 1WVGA 1HSOA 2NVUA 3DTTA 1W0CA 1TEHA 1VM6A 4CLEA 1KVQA 4LCJA 4RVGA 4I08A 3WQRA 2H6EA 3EW7A 3JV7A 1QORA 2FR0A 3GLQA 1ISJA 2ZTMA 2AW5A 2PTGA 1D4FA 4TROA 2AQHA 2JHGA 1DIRA 4PLTA 3IS3A 1RYEA 1WNTA 2PD6A 1UXGA 1ZSVA 4XDYA 4Z9YA 1K89A 1R66A 1Y7TA 3PJDA 1J49A 2FPPA 1UH5A 3DBLA 3O38A 1B7GO 4MVJE 1MB4A 4CL3A 4CR8A 4ZD6A 3FNGA 4DPLA 4DBZA 1R16A 2P91A 3ON5A 3W4JA 3BZUA 4D45A 4ND4A 1JVBA 2GZ3A 2V7PA 1ZK0A 4RLSA 2CVZA 4W7HA 2DFDA 2YHUA 4CODB 3AY7A 3TFQA 4DUPA 4QSMA 1DAOA 4L9RA 2IZ0A 2ZYDA 4ZU3A 1EEHA 6ADHA 2X22A 4BS9A 3A4VA 5JDCA 1ZBQA 1GCUA 1TA4A 2EP7A 1E3SA 2HQ1A 1YBMA 4R16A 3WGZA 3ZW9A 5U1PA 3ETEA 1HWYA 4DA9A 3DHNA 3V1UA 4OIMA 3LC1O 1IPFA 1EK6A 2I3AA 2P5YA 4E13A 1GD1O 2JD2A 5L3ZA 1ZO8A 1MG5A 1U9JA 3EDMA 3GHHA 3PZBA 1H6DA 1KYQA 4WLEA 1YJQA 4WEQA 1CQIA 3LF1A 1UXJA 1T1RA 3SX2A 1E7MA 5EESA 4WNIA 1YQDA 5EQFA 3M1LA 4CM1A 2BGKA 4WKGA 4FR5A 1YWGO 5JSFA 1YQGA 2Q1WA 2GR9A 3IJPA 1HE3A 2YFQA 4YT4A 1ENOA 2NVBA 3BAZA 4CQMA 2WE7A 4YAKA 4BO2A 1PS9A 3BA1A 3GVHA 3I23A 4BO5A 4CV2A 4EITA 1JLLA 4BNWA 1YQXA 3WS7A 2BD0A 3VH3A 4K1LA 1ZW1A 2P9GA 3DBLB 1EVJA 4OH1A 2IXAA 3R0IA 4HUJA 4WLNA 5BR7A 1A71A 2D2IA 4PRLA 1NPYA 1XDWA 4JP2A 3QSGA 4KZPA 4FIZA 4YAJA 1EDZA 3JYQA 3OJLA 4ONEA 4PLYA 1F06A 2DPGA 1T4BA 5FFFA 5CPBA 1ZZEA 3L6DA 1U4SA 5ER9A 1E7YA 1EMDA 2RHCA 3C7DB 4R69A 1Y8QB 5G4KA 2PH3A 3UICA 3ZU2A 5I9MA 1ISHA 4J1NA 2HRBA 1MGOA 2QYSA 5G0UA 3TWOA 2HUNA 3PI7A 3O26A 3OF2A 2OGUA 1E7QA 2BFMA 4WE3A 4CQLA 4BNZA 3I9NA 1SNYA 3NGXA 4JX8A 3KYDA 3CH6A 2G5CA 3GDFA 4J6FA 4BQRA 4DGSA 2I3GA 3HB4X 4BB6A 4XCVA 3HZZA 3FR7A 1UAGA 1ISFA 3OQ6A 2CF5A 4DQXA 1ZVMA 5JDCC 3RC2A 2H9IA 4TRNA 1RWBA 3WICA 5CP8A 2FZEA 3PQEA 5BNIA 2EEZA 1XGKA 3I4CA 1RM5A 4CMKA 3FBGA 2P2SA 1L1FA 2D59A 4HXYA 1U3VA 2PFGA 4RL6A 4OAQA 1LA2A 2OP1A 4M55A 4MIEA 2C59A 1BDMA 4TMFA 4BNLA 5DBGA 3TL3A 2VZ8A 1K3TA 4PLHA 4CUZA 5KJCA 4CMEA 4L75A 1H2BA 1PS8A 2YV2A 4CJXA 1C1DB 4WGGA 3FWZA 1OAAA 3CKYA 3KSDO 2W2KB 3EMKA 4JNKA 2EIHA 1XCBA 2WYVA 2VT3A 4JK3A 3DOOA 2CFCA 2I9PA 3CPSA 3WR5A 3TL2A 1H9BA 3BTUA 4GKVA 5CAEA 3W8FA 3VZPA 5I7EA 2X9NA 2ET6A 2Y68A 3OIFA 3QW2A 4H7PA 4OQZA 3H2SA 3D1LA 1KIFA 1QYXA 3EC7A 4FFMA 4D42A 4CM5A 3NGLA 5L4SA 5L7YA 4IDBA 4B8ZA 3WGIA 5FF9A 4NG5A 5I9NA 1DIBA 1G0OA 1KC1A 2RAFA 4Z6KA 1Q7CA 4D46A 3TN7A 1SEPA 3W4KA 3GOHA 3H2ZA 3G1TA 3Q6IA 4ALMA 4Z3KA 2GLXA 5TGDA 3FPLA 1ZMTA 3EAGA 4GVLA 3ZV4A 3CMMA 3ZWXA 4ZN6A 3I83A 2HMTA 3GDGA 1UJMA 1CDOA 4XQ9A 3ZWOA 1AUPA 3AK4A 9LDBA 1NFRA 3PDJA 2YV1A 3LQFA 3ZWMA 2X7HA 3I6QA 3ZI0A 3PQFA 4L0QA 1B14A 3SC4A 1PGQA 2UV8A 2HK8A 1XWFA 1VKNA 4BO3A 4GGOA 4A73A 3LT4A 5DCUA 3ZWAA 3N58A 1HDYA 5JY1A 2W2KA 3QQPA 2Q49A 2VWHA 1P74A 3WLEA 1F14A 4J43A 1YKFA 1MXHA 5G0SA 1EE9A 4WLVA 2WSBA 2BHLA 2GERA 4LGVA 3DC2A 5A5EA 3CEAA 1ZK3A 3F4LA 3D4OA 3KHUA 3JD0A 3JYNA 2B69A 1GDHA 4BQPA 2R00C 3UN1A 3QVWA 4H3VA 4CM8B 3RKRA 4J4TA 1NBOA 2P68A 3WFIA 1QYVA 3RC7A 1DFIA 5GZ6A 1P1IA 3VDQA 4UUMA 4NK4A 4A2CA 2HAEA 3AUSA 2NACA 1UXKA 4BNXA 1V6AA 4BMSA 3RWBA 2WDZA 3F9IA 2C2XA 5JW6A 3I5MA 3ZDFA 3D3EA 5KTKA 3IJRA 1DLIA 3D0OA 4YJDA 2QW8A 1E3WB 2C20A 2EWMA 3K92A 5BSHA 3L4BC 5JLAA 3H3JA 3JQ9C 4DXHA 1LSJA 4UULA 3WJ7A 3D7LA 3G49A 2ZK7A 5A9TA 3KO8A 3FTPA 3GHYA 3E9MA 2JFFA 3RJ9A 3LDHA 5HBRA 4XYBA 1OOEA 3COSA 1Q2XA 3IQDB 1TI7A 3PTZA 2G17A 4BO0A 4B3JA 2QZZA 3FBTA 1NQOA 2GPTA 2Q2WA 4XR9A 5JCJD 2A35A 4CMAA 1EQ2A 2FP4A 1I01A 3JD4A 4ALNA 4UUNA 3KYBA 1LLDA 4ITUA 4W99A 3GNTA 4FBGA 5AOVA 3GMSA 1QV6A 3BTOA 4TZKA 4UEJA 3ZWWA 2XXJA 5CEFA 1P1HA 4CLRA 1AHIA 2X58A 3F46A 1NFQA 1Y9AA 4CUKA 5F5LA 4I1IA 4II3A 1TVEA 1DFGA 3LLSA 3PQDA 2FWMX 2V6MA 2P9CA 3KUXA 3INRA 4KDFA 4YTEA 4AJPA 2VN8A 1HLDA 3VKUA 5A06A 4YACA 4D7AA 5A9SA 1GCOA 2QG4A 1H93A 2PWZA 1HYEA 3WG9A 1N5DA 4BMNA 5CDSA 3CTMA 3ENNA 2PA3A 1CRWG 3WGQA 4XA8A 1CJCA 5C5IA 1NTOA 3RUCA 1C0LA 4QEDA 3PIIA 1Y81A 4YJGA 3CIFA 4A26A 3KLMX 2NTJA 4J7UA 4MVJD 3D3WA 1VE9A 2F00A 1QR6A 1WXDA 2PGJA 1EDOA 4KUGA 1YDWA 3AM3A 4NBUA 3MJCA 1AXEA 1GL3A 4RCVA 2Q4BA 1GPDG 3ZU5A 1YVEI 4IGFA 2E37A 2JAHA 4CM8A 1X0VA 3JQEA 2WJPA 3ZV3A 1CF2O 3MZ0A 4NMHA 3T7EA 1NWHA 1BVRA 2FN7A 3UF0A 3A06A 4XQCA 5H83A 5ILGA 2Z5LA 2J3IA 1GQ2A 4MP8A 3N74A 2Z95A 1Q0QA 4IGEA 4MO2A 4CLRB 4EI2A 5IZ4A 1SZJG 4XEHA 4UVGA 1MX3A 1RYDA 4HY3A 1QYWA 2Y05A 1WW8A 5IZCA 2QHXA 3AY6A 5TNXA 4CQMD 4NFHA 3RJ5A 5JYEA 1E5LA 1NVGA 4W82A 4E5PA 4Y67A 1K6IA 4CV1A 1TT7A 1SC6A 4LISA 2E4AA 4HFJA 5I9LA 2P9EA 4XGNA 3RUIA 3ZCXA 3NYWA 2X9GA 4WCFC 4DMMA 1NHGA 3MWDB 5L45A 4MVJA 5KJEA 1R0LA 3JD3A 3KZVA 1G6KA 3OJFA 3AM4A 1M2WA 4HNGA 4JJGA 4UVDA 1OC4A 3F1KA 3QVTA 5GMOA 3PEFA 4M1QA 4IDGA 1HSZA 4NU6A 3DZHA 2O48X 3ITDA 3SJUA 3UW3A 4E5YA 2WEKA 4CL8A 4ZICA 1PX0A 5IFLA 3VPHA 4JJFA 3FRJA 3LC2O 3EGOA 4F46A 1ENPA 1L7DA 4PLZA 1WP4A 2X1HA 2JCVA 1E3EA 1H94A 3L6EA 2P4HX 4L8VA 3ZWVA 3EHEA 3C8MA 5DNAA 4IZIA 1AXGA 1LBEA 3NDIA 3K73O 3TDKA 3KSUA 4QO8A 2Y1CA 4FJ2A 4CM9A 4BV8A 2B4RO 1MV8A 5JO0A 3MJSA 4L76A 3QJ5A 3I9LA 2W98A 4KUHA 2EF1A 3PJEA 4PFJA 4B4WA 1ZNQO 4O0LA 3LSYA 1E92A 1T2EA 4Q3AA 4E30A 2B0JA 1D8AA 3JSAA 1ZEMA 2VTEA 1VC2A 1PWZA 4E6PA 4G5HA 5A9SB 3E9NA 4KMSA 1C1DA 4I5EA 1P0CA 2PZLA 3PYLA 3RASA 2ZTVA 3KV3O 1U1IA 5KOIA 1D1TA 3QV1A 2O3RA 2PR2A 3BMOB 2GN8A 4J7CA 5TQVA 1N8KA 4XIJA 3VDRA 1P1JA 2XAAA 2HCTA 2Y99A 3ABIA 4QX6A 5JBIA 4BNHA 4HP8A 3GAFA 2CDBA 1JQBA 1B8VA 4HWKA 4IDDA 4Z0PA 4GPD1 2NVUB 5CHEA 3ZWYA 2B36A 2HK7A 3Q1LA 1P31A 3DL2A 1HDXA 4NK5A 1E1NA 1NWCA 4DPMA 1S7CA 1YONA 1OBFO 3OBBA 3GRKA 1ZK1A 5I7VA 1ENZA 1Z6ZA 2CUKA 1GY8A 5L53A 3EZYA 2SCUA 4DVJA 4DYDA 4PG7A 3DBHB 3NT4A 3WQQA 1HDOA 4NDNE 4BNVA 2CDAA 2VRCA 4EBFA 4AJ4A 1W4ZA 4GX1A 2D4AA 1FMCA 2JCYA 4CM4A 5GZ1A 1QXSA 4E5KA 1UUFA 2ZKLA 2GD1O 4PLFA 4EUHA 2ZJ0A 5IN5A 3KYCB 1H9AA 2VWGA 4PVDA 5JCJA 2P4QA 2Y1OA 3LLVA 5AYVA 1C1XA 3VPFA 4NHEA 2AEJA 3HG7A 2J6IA 2F1KA 3FPCA 3I9KA 3JQDA 5AXAA 5T67A 1ZIDA 2O4UX 2ZB8A 2ZQYA 4B7CA 2C5EA 4I8XA 3RCBA 3QHAA 3RSHA 3OSUA 3VTFA 3ANLA 3BMCB 3RUHA 3JQGA 5A04A 3ENKA 2DAPA 4IJVA 3L9WA 4DIOA 4MKXA 1NPDA 4BKOA 5JMWA 3VZQA 2ILTA 4WEOA 1VLLA 1YRLA 1LC0A 4NI5A 3UCFA 5IDWA 2CDCA 2VUTA 4CQMB 4TSKA 2EJWA 3PPIA 4KQXA 1XKQA 4B3HA 2QZ9A 2D0IA 1LDMA 3WIEA 4RPLA 1ZJYA 2TMDA 3GG2A 1E7RA 1PL6A 1VRWA 2B4QA 4IJWA 1D3AA 4QQRA 3EK2A 4LSWA 3UVEA 1BW9B 1PZEA 3NV9A 4URFA 3ROKA 4DTIA 4XYEA 1NP3A 2D1YA 2X86A 2POQX 1P1FA 5DP2A 5KKCA 2EGHA 1J6UA 1DJNA 4GH5A 4MVJH 1LXCA 4B4VA 4PG8A 5G4LA 5JPIA 3IKVA 3WFJA 1BVUA 2OO5A 2ZTLA 4GBJA 1GR0A 1QRRA 4IXTA 2E6UX 1OC2A 2Q3EA 3JD1A 3KTDA 4LN1A 2PKQP 2GGSA 5JY6A 1V3UA 3UFXA 3ZHXA 3ASVA 1NVMB 4ZQFA 3GC6A 1E77A 1OFGA 3L6OO 3AM5A 1X7HA 3BYZA 3HSKA 1ZK4A 3JQ8A 1KOLA 3I9MA 4IDFA 1P33A 2DT5A 3KRTA 5JMPA 3K30A 4IBOA 5B4TA 2VTDA 2YQ5A 3BHJA 3PLNA 2FMUA 1EUDA 1FDUA 4HFNA 3ZHYA 2I65A 1Q0LA 2ZQZA 4QXMA 1XYGA 1NXQA 4EUEA 3H65A 2X6TA 3AUTA 2W2LA 3SBOA 1ML3A 3FI9A 2YY7A 3RFXA 3H9UA 1M76A 4DRYA 1MG0A 4OHUA 1E1LA 3WYCA 5IG2A 4W9NC 1V8BA 2J3HA 1EZ4A 3ZN2A 3DFZA 3KLPX 3ZHZA 3IUSA 1SMKA 2Q99A 3WTCA 1Y5MA 2O7SA 4F6CA 1C1XB 4R1SA 2ZCVA 1Y5RA 4BNIA 2WYWA 2YQ4A 3AUUA 1U4OA 3Q11A 5LDGA 4R5HA 3VPXA 4R3NA 2C7GA 3MJ4A 3FHLA 3U5TA 3H7AA 4ESOA 7MDHA 4J7XA 3ZZNA 3V2UA 1Z74A 3OETA 2IEDA 5KVCA 5A9RA 2BELA 4RZHA 4XYGA 4OMUA 2CSUA 2BFOA 1I10A 2Y1FA 2GF2A 3GG9A 3R3JA 1ADBA 3ICCA 4J1SA 5HRUA 1DHRA 4F45A 1I0ZA 4P22A 5T8KA 4AVYA 5A5FA 4YXFA 1P77A 4YT5A 3TRIA 4J9UE 5JAIA 1QV7A 3MWEB 2Z1NA 1DLJA 4YRAA 2D5CA 3JQAA 4QUKA 4ZGWA 4XQGA 3QE3A 1C0PA 4Y6SA 2O4CA 3NTOA 1V35A 5C7OO 4BO6A 4O63O 2B5WA 1PJ3A 2O3UA 4J91A 1OZAA 3JQCA 3U0BA 4KUEA 2VOJA 1WZIA 4B7XA 2Q1SA 4XRGA 1QKIA 4KTVE 1N9GA 2YHIA 2IYOA 2DUWA 1XLTA 3AI1A 3HADA 3A9WA 3HB5X 4GKBA 1DB3A 2Y1DA 4HBGA 4Q3CA 4D41A
chains in the Genus database with same CATH superfamily
721PA 1SXJC 3ASUA 2YYYA 1O95A 2EJUA 3GCDA 3JWHA 4ZRDA 3A31A 3LQ1A 1E3QA 5IUKC 5TEWA 4B4OA 3DKIA 3JZDA 4AJIA 5FUBA 4FFOA 4ALIA 4A8TA 4JDPA 2IITA 1NT4A 1IN5A 1L7NA 1FDRA 2ADMA 2WIAA 3NTQA 3TZBA 4BO8A 1WPXA 4ERNA 5FYDA 5HFAA 4DDWA 3UWKA 3OO0A 3PWKA 3ESQA 4BFSA 2BTQB 4IIEA 1RKVA 1Y3AA 2BFEB 4MVYA 1Z6QA 4JT8A 3RS2A 2GM9A 4NWIA 4YYEA 3H4VA 3CLTC 4WKBA 3S81A 2A9VA 4OH7A 3WKEA 1IEQA 4YUVA 4DN6A 5CDFE 1H69A 2EKQA 5DOZA 3KB2A 2XVZA 3UHAA 4G8BA 5L4NA 5CIYA 1XMJA 2WFLB 2MYPA 3RK0A 1NVTA 2CXSA 1L5LA 1D4AA 4R3UC 5ERXA 4WZZA 2E18A 2PGDA 1ADGA 1A9XB 1LW6E 2RHOA 1XZPA 4G4SP 5GGXA 3WIOA 1TX4B 1P61B 3Q15C 2G4LA 1EX9A 1YE3A 1FJHA 2ATEA 5ALZA 2C54A 4OK5A 4JJ8A 1LWNA 2XTMA 4J2HA 5BMVA 3R6LA 1QP7A 5AI0A 2JGDA 3N2IA 3LDUA 1R6AA 3SZLA 3AFHA 3LXUX 3PEVA 3U7JA 1A95A 3NO4A 3KVNA 5C4GB 1IK6A 4Y2TA 3SIRA 3C1TA 1EWRA 4RD1A 2WJVA 4PLGA 5DGHA 3V2GA 4NZPA 1GZ3A 4JITA 1GPLA 4W6QA 1X38A 2EFJA 1A2QA 2FFJA 4OP3A 2OV2A 2C92A 2B35A 3EZ7A 3E2IA 5K05A 1E1KA 3IIJA 3HPRA 3D7KA 3U4IA 3BCRA 1ANKA 1RJFA 2CZGA 2NSYA 5EJ2A 2DXIA 3DNPA 3CZ5A 4EO9A 4OIFA 2E9SA 4P92A 2LKCA 1UZMA 3QU7A 4QO7A 1OFUX 3SI7A 5HA5A 3D81A 1B0PA 1OAKA 1UFOA 5GQSA 1XIVA 5JCOC 3UT0A 3QLJA 4QSHA 3FVTA 2X2PA 2VPTA 3HU3A 3BXGA 1NUAA 3DOHA 2NYRA 3KEOA 1Y8RB 3H4IA 2RH4A 4NYJQ 1GDTA 1BHQ1 4DMFA 4IUDS 2H2FA 4A8HA 1C0KA 1ND5A 4K8OA 4DQUA 2PJUA 4ZHQB 4Z4HA 2Y4NA 2BT4A 2VJCA 1K4MA 1YAJA 2W9XA 3KT6A 4BBAA 4ZMSA 1YCGA 4MVJG 5LYJF 3OZSA 4G07A 2X7XA 1CHDA 2AMFA 5DLEA 3A26A 1U8UA 5EFZA 3PC4A 3AVVA 2OGZA 2GJ9A 3A7DA 5FOXA 1M2KA 3W1EA 4YRCA 5BN5B 1CHNA 2I4MA 4MGIR 4PHFA 1F0PA 4O08A 1EGMB 3P94A 2D5BA 3NS7A 1VFNA 3PXEA 2BJWA 4B4DA 1GRCA 1KBQA 4N8SA 1TM2A 4YCAA 1T3SA 2BFNA 2CNDA 4GYYA 5K20A 3WWZA 3KEGA 1M2VB 4UHKA 3WC4A 4DG5A 1GTSA 4X5OA 1YRBA 5P8WA 1SVSA 4L0DA 3K4HA 2G1UA 3PK0A 1QOQB 2NZ8A 1L5YA 4U8HA 3C8ZA 1JTFA 1U0GA 1WZEA 3D7MA 4GXRA 4G0XA 4EHKA 1FTWA 3KLNA 1N7GA 4HB3A 2I67A 5K2MA 3DKPA 1FFWA 4K0KB 1V39A 3O73A 4MCIA 1DOAA 4Y98A 3AETA 3E5NA 4PE5B 4NAVA 4M0LA 2NYUA 1PKXA 2DUJA 2HXGA 1UJCA 2NSJA 5EJGA 1CLUA 1V2GA 3MTGA 5CVEA 1AIPA 3ONEA 3NIGB 1BHSA 5AHWA 4Z9FA 1SBHA 3HCOA 2CZQA 3W3AH 1F3LA 3EAQA 4YRTA 1QPBA 3ROZA 1L7RA 3WGGA 4Z54A 2C82A 3HA5A 1JHQA 3SX0A 1NSYA 1SKYB 2A5LA 3F3KA 4HC4A 5MF6A 1CQPA 4CEIA 2EX4A 2CFRA 4ZT4A 4YR7A 1Q0SA 2P1ZA 3DPSA 3SBXA 3W6OA 1NMXA 2GPSA 4OF4A 3BFPA 2FRDA 5DBHX 2Q0QA 3RIHA 4RY9A 4Q0MA 4E2ZA 2AS0A 5ALIA 1P44A 4NH4A 4ZV7A 1N7HA 1CR2A 3BAFA 2NT3A 1TKCA 5L7WA 1E5VA 3VTZA 3K6JA 1K7CA 2Y67A 2YRWA 4S1OA 2LTAA 3ZS9A 1LTHR 2E4ZA 1KSJA 1QG0A 4FK8A 3K35A 4JAVC 4TV8F 4DV4B 1X1EA 3M9XA 1GOTA 1WDWB 4LI3X 1W85B 1DPFA 3SCZA 3U3OA 1E2JA 2BEUB 2V55B 4F5ZA 3BK1A 3O47A 3PDCA 1Z4MA 1OV6A 3EZ2A 3JQ7B 3NTRA 4G85A 2X77A 1RCTE 3QVSA 4GUAA 4IIXA 5G0TA 3WDSA 3X1JA 3WL8A 4MUEA 1E4EB 4RD3A 5B2ZA 5FAXA 2JVKA 3GJRA 4LKRA 1DIHA 2Z6VA 4B3XA 5KYXA 2F9LA 5HK8A 2WIJA 3E18A 4X6LA 3DMTC 4W8HA 1ODCA 4TLMB 3TBKA 2R0QC 4RSRA 1JQ3A 3OVMA 4XVCA 3LKVA 2FVXA 4OHWA 4LOLA 4LQ4A 1HLGA 1JQDA 2OHJA 4FMCF 2QZSA 1WSBA 5EXPA 5HTKA 1P2UA 3ACBA 4X8LA 4BFTA 3QVVA 3T1NA 1QVAA 2ZDQA 2UYQA 4JT9A 2XYPA 3T38A 1SPXA 3TB6A 1ZXBA 2J9YB 4AZVA 4CG3A 1M9NA 4PC3A 5BN1A 4ZWNA 3ZW7A 5D5PA 1PJRA 3INGA 3NUGA 3ABZA 3N5KA 1DZ3A 4YLEA 1TADA 1QGDA 4FUQA 4NFSA 5EWMB 3SKVA 4A8JA 1PVOA 1IVYA 1JDTA 2G40A 3PHGA 4L6CA 2XNKA 4C6TB 3D5TA 4D9IA 4CEIB 4IIJA 4KLAA 2NU7A 3AUYA 4XJXA 2FNAA 5FBRB 2WHYA 3EFHA 1QOZA 1Z29A 1SG0A 3GT4A 7YASA 1LDYA 1S2LA 1JIIA 2IT1A 2IZ5A 2H2HA 2HXSA 3AKDA 3EH1A 3IOCA 3KR0A 4I1RA 2LW7A 4LX8A 3PEYA 2DE0X 2EJCA 4I5FA 2E4WA 1HZJA 2C8LA 3BULA 4I99A 2PUEA 4MZDA 2EYUA 2W8BA 2V6IA 1P4JA 1Z73A 3EY4A 3HYSA 3GDOA 3TMKA 1N75A 2JL1A 3G0OA 2ZDGA 4BB0A 3TR5A 2V5VA 5C1DA 3RU7A 4W5NA 3PNPA 4ETWA 4R8RA 3MTJA 1GFSA 2E48A 3AU8A 4I1VA 1ZRNA 4DCCA 5T5QA 3KKEA 4C0AC 4HX5A 4E6EA 2OQIA 3QU5A 4NCNA 1WF6A 3V1YA 3HO6A 1M1UA 2Z2XA 4ZC8A 4YXWD 1GA6A 4YLGA 4GP9A 4II2A 3GRRA 4BO9A 4JYZA 2O57A 1TOAA 2QXUA 1KO4A 2NGRA 1LJ8A 2E2WA 3K3PA 1K8YB 4OOFA 4G5FA 5EIBD 4ZGBA 2P0EA 2HBQA 3D7NA 5A02A 4GOJA 3VNBA 2L2QA 3ZY4A 5F9MA 2Q2OA 4MV4A 4CKEB 2KM1A 3SHOA 4RGQA 3DB2A 1XCLA 3HJTA 4YMTA 5IF9A 5K6AA 3QIAA 1FDTA 3E15A 3DUFA 4W5OA 1U2QA 3EEIA 1C7RA 1RJ9A 1U7XA 4QJIA 2HMVA 1F2VA 1XEAA 2VH2A 4P8RA 4RZ3A 4ZDJA 2YV3A 4Y0VA 3IBFA 5BV1A 5D01A 2FW0A 3KJGA 1YXMA 2OQRA 1IAVA 3GH3A 4EZIA 3PC7A 4U7GA 5JQWA 3SVLA 3U16A 5JIBA 5ALEA 4RXTA 1K2WA 1NAIA 1NSFA 4G9EA 5AI6A 1NF8A 2GN9A 4OQEA 5JARA 4RELA 3ZDQA 1R4AA 2LIVA 3RJMA 4ND3A 3RVDA 3C3WA 1KZ9A 2Z5FA 4L8LA 1Y9EA 2I99A 2H63A 1XZNA 3NUQA 4AO8A 2NUTB 5F5NA 4I4TA 1ZGCA 3QX8A 2W6JA 4TTJA 2YBDA 2VSQA 5KSPA 3N76A 1T34A 3DBVO 3I6ZA 4G41A 4GECA 5CVJA 3PHLA 4WFIA 4B1FA 3TGLA 2EBWA 2BGMA 3LV8A 2ZYHA 1Z4KA 3O2SB 5I8ZA 2OR3A 2A7QA 1JAXA 2JJMA 5EJMA 4LYAA 3BDVA 3MRXA 4KSCA 4B40A 4JB0A 4PZUA 4FFWA 5MGBA 5K45A 4B31A 2CK3D 3LTNC 2UZ4A 2XUFA 3UA4A 1R6TA 2AG5A 2ZIZA 4TLDA 4QATA 4PYJA 1L5FA 3GQBA 4XVHA 1QCZA 4ZV9A 4YRSA 1GQQA 1LZKA 3D02A 1W9HA 2FQQA 4GMFA 3R7SA 4QE3A 1FTGA 1RQRA 2XE4A 1NOIA 3FUCA 5G4KB 5A0FA 4LXTA 4UZSA 4CZ2A 1J07A 1SD5A 2H57A 3DKVA 4X44A 1L7BA 4C6TA 3GB9A 3I2HA 3QFRA 4F04A 3KL2A 1FLDA 4ND7A 3OT1B 1L5KA 1I4EB 5K6TA 4N5HX 3V48A 5LP6B 1KY3A 1WOYA 2GSWA 5ALLA 3DVRX 3WLNA 4Y1RB 3THXB 4OU5A 3D1JA 1CDDA 4Z7QB 5CCBA 2W6IA 4BV9A 3RQIA 2C5AA 2BFBA 5T8KC 3L02A 4C4YA 1T29A 2QBYA 4OJYA 3WGHA 3IMCA 1GNTA 2WM8A 2XA2A 5LDGA 1Z7EA 3TE7A 2E87A 1Z2OX 2B1IA 2YN0A 1KJ9A 2O0LA 2B2CA 5H3HA 3RC1A 4Y8VA 3NR2A 3X2EA 2VHYA 3OQPA 3KOOA 3CZCA 5A4FS 1A9TA 4N54A 2WTEA 1BW9A 4KDRA 1VLMA 4LOHA 1WCIA 2NV6A 3D6VA 2D4HA 1VBFA 3RB8A 5JALA 1RQLA 3CMCO 5D3QA 2NO5A 2O1EA 1ESNA 1VKJA 2Q5CA 3K1AA 3AC0A 1HBJA 2I66A 2WHRA 3D4NA 3HPQA 3D2AA 3LCUA 3A4NA 4X92A 3C48A 3TZ6A 4J16C 2JFYA 2PFSA 3HBAA 1CS0B 2ZSAA 4CUJA 1IBMB 2DHEA 2MYTA 4ZT3A 1Z56C 5LQKA 1CDEA 4ZCRA 3WKCA 3NJ4A 4BZWA 4AXBA 3GA0A 1PUJA 5B4UA 3G9XA 4HQFA 1L5NA 2A33A 2QTWB 1IB0A 3JYHA 4KG7A 1LRJA 1THZA 4FKMA 1C4XA 4GM0A 1XWWA 2CXTA 2EFEB 4PSKA 3UGJA 2P6RA 1K6MA 3C1AA 3PIRA 3VJLA 3ZH2A 5DH9A 4KBYA 1I4LD 3GRYA 4PZZA 5K5EA 4Q3DA 5DGTA 5T57A 3BOSA 5CD1A 5B6PA 5B12A 5TRTA 1U1FA 3UFXB 2ZULA 3K0BA 5AW6A 4WLUA 3T9EA 3FNQA 3E8MA 1N9ZA 2PX0A 5TPWB 4DZTA 4KU4A 2H4JA 3OCXA 3VFDA 1MNAA 2WMDA 2PNFA 2C2KA 3K1JA 2ZB4A 5CURA 2DBYA 1BVHA 2IUEA 3O2NA 3PZRA 5UKDA 4Q19A 4JOBA 4E2XA 2F3QA 1NX6A 2P30A 4IMRA 1K6XA 1XNQB 5JFGA 3U09A 4R1TA 2R7KA 2ZOSA 4TV9F 2TMGA 2XW6A 3SS9X 2YJ5A 1SA0B 8AT1A 3MJEA 1QFSA 1DBVO 3F3SA 3W9YA 3OM0A 3RSSA 2O23A 2PV7A 2ZSEA 3G1UA 5DIZA 4RVFA 3K2IA 2QM3A 2XXBA 1N2SA 3GFBA 1YR7A 3DZBA 2AUNA 1HDEA 1G0NA 2XTNA 4RX1A 1IZ9A 1XKLA 2GPAA 5DLDA 3ZBTA 3RADC 1DX4A 1WCIB 1PJAA 3X2FA 3O8BA 2WTMA 3ZIUA 1T3ZA 1TK9A 2CYCA 2PZJA 4P3NA 3VHXA 3A6JA 1F5SA 5DWQA 2ZI3A 4KIFA 2HMUA 2FEAA 5FOTA 1PZMA 2AJ8A 4P80A 2E21A 1JQEA 2WIKA 4ID9A 3W5CA 3LCRA 1EB9A 1GO2A 1P5HA 2ADFA 1TL7C 4JI3B 4DREA 4F2GA 1QC5B 4PICA 1GYPA 5DBFA 3QWIA 2P3QA 1EBBA 3Q3GE 3REQA 3THYA 3SGLA 2MIIA 1V16B 1OZGA 4LFBB 3W3AA 3UENA 3P9RA 5A4IS 3SS7X 1J4AA 2RJNA 1ACJA 1UBCA 4DNFA 2J5QA 3UHJA 3WB2A 3ZGZA 2ZROA 3OBIA 2ANBA 2V45A 1FDOA 3EZLA 1AGYA 2VK4A 3LCJA 3RV4A 4C4XA 2FJUA 2QX4A 5CYPA 4WMLA 1QONA 3KZOA 4KXLA 2CMHA 5DULA 5CB0A 3F96A 1QRSA 1P45A 3UK6A 4Q21A 3ISTA 1CZLA 4IIJF 1NXSA 2PKRA 2QP4A 2VJNA 3TNJA 4DSOA 2VJMA 4EGAA 1Z2CA 2CBZA 2QLJA 4IINA 3V33A 2I7DA 2QL6A 2AQ8A 3EJWA 3HJUA 1ODFA 2WD7B 3IO3A 1QHXA 3NAZA 1UDAA 3IBCA 3P2OA 4WVLA 3IDQA 6CHYA 3EZ9A 1ZH0A 3P96A 5CB4B 3IUMA 2X0EA 4DCNA 5L51A 2YFYA 3CWCA 5LOVF 4RACA 1T2FA 1ZLYA 3EVBA 5ALHA 4ZAGA 2RH9B 3RRNA 1JL3A 3FIUA 3MGAA 2Q9BA 5B6JA 2CFSA 2ZYVX 4ND2A 3R6DA 4X7BA 5C81A 1UBEA 3GGOA 3RQSA 5DWVA 4E03A 1RM3A 2E49A 5AK5A 2N3ZA 2J09A 1IOVA 3IB3A 1G1MA 3RVSA 2DWPA 4HDNA 3B8HA 3FF4A 4GAEA 3UW1A 1TD9A 4MB0A 2OPHA 1G42A 2IXFA 4FMBB 3W34A 1KI8A 5GTDA 2RAUA 2APJA 2ORWA 5SZJA 4CLDA 3OIYA 3UAZA 3IUQA 1ZFNA 5BP7A 1IATA 1WIWA 4IQGA 1JU9A 2J45A 1SQFA 1VZ3A 4BEVA 7REQA 2CLHB 1GTVA 2IEBA 4IRUB 5EZYA 1GKLA 2RI0A 1E2PA 2ZYAA 3B7WA 4NOJA 1Q21A 1OF1A 4L02A 2C7BA 4PR0A 4M0DA 5B4VA 3OM8A 4NZOA 4KH0A 3CF4A 2D3WA 5IN4A 4DLYA 4XVQA 2WYUA 5TXGA 2AG1A 2LP4Y 2IF0A 2BI8A 1H2HA 1KETA 4FWBA 5FPHA 2HR1A 1NXVA 2VDLB 4ZQEA 1XX6A 3GAAA 2JA1A 4PC7A 5DHFA 5SY6A 3TEJA 1LSOA 3VYRB 1IFXA 5HTOA 1EFDN 1HTTA 1JYSA 2PLNA 3QVUA 3FKQA 3ISJA 2Z2JA 2WPNA 1OWLA 2XNJA 1BMTA 3B6IA 4YJFA 4XW2A 1YS4A 3IPXA 4ZI5A 4BRSA 1QMGA 3JARB 3K9QO 1A7JA 2QRVB 2WU0A 1DT3A 1VKRA 2XDAA 5LD2B 4UXHA 4B45A 1QKKA 4KR9A 2I3BA 5HYVA 5CB4A 2ODAA 3UB2A 3ZJUA 1SUAA 3WNZA 2KX7A 3EH2A 2AFIB 3W04A 4MW5A 4WJKB 3DTVA 3OAAA 2X76A 2XB8A 1QFYA 1G18A 3SLGA 5M2QA 1NRJB 1T6XA 3B6EA 3CNNA 1G6Q1 3QMVA 3ZE0B 1I0LA 4LJ6A 5AUOB 3UUEA 3T5PA 2W70A 3AESA 2FN8A 2P3SA 1J5XA 1KA9H 2NVOA 2RC5A 4UM8B 1R50A 3T5GA 2RARA 1HDRA 5KVVA 3VYVA 1U3TA 1ACLA 1M83A 2PYIA 1WMAA 2ZBEA 4IDCA 4MUMA 4OKNA 2HU5A 1G17A 1PTJA 3FZGA 1LK0A 4W8OA 4BLUA 1UC9A 3GWGA 1M2OB 3H6KA 3JQFA 4L4SA 5ADWA 4HLCA 1J0EA 1ZIXA 3BMQB 3IULA 3QOYA 4PCVA 4UE3S 4DEYA 1WPRA 3DBRB 1ZIPA 4AG5A 4URZR 4TGLA 2QSJA 4Q24A 2BKXA 4MA5A 1WHTA 4IOMA 3VZRA 3IJEB 5JAOA 2WUEA 1H1LA 4NONA 4X6UA 5G1OA 4P98A 1VPVA 2R84A 1E2EA 1KARA 1NASA 2UVQA 5A4JA 4EW6A 4F84A 4Y2YA 3ZKWA 1XTBA 2ZTUA 3EOZA 1L2TA 3LUCA 4FGUA 1QYCA 4N5NA 4DMLA 5IEBA 4ROSA 4UTXA 4C30A 4I4NA 1CQWA 1D2GA 3EDOA 3G0HA 4P2BA 1EUDB 2C1ZA 2LR0A 4FOPA 2QSYA 4DAOA 4HFMA 3LOQA 3A11A 3B20A 1F8XA 3GZJA 2FDCA 4ND5A 1OW3B 3R6WA 1QH1A 4EWLA 1JGTA 2W2VA 1KZ7B 1WQ4A 4X20B 4EUNA 1EKXA 1NYQA 4C6HA 1KVUA 1MEOA 2Y1WA 4WZAE 2Y76A 2V5UA 4S0ZA 1IIRA 5I7RA 3ACCA 4UTRA 1M0WA 3QQ5A 4ZQIA 3K53A 4QUGA 1UM8A 4P4SB 4ZANA 1Q2UA 1I3KA 3LBYA 1L4LA 1T8PA 1H2YA 2M6SA 1DPGA 3CSDA 5EXXA 1JJBA 3I01M 1HYHA 1ZGHA 1U2EA 3FOAA 3QYAA 2J8ZA 5AJTA 5FPTA 5DYWA 1ZSYA 3NCHA 1JZQA 4UM9D 4LCBA 1YR8A 4JBNA 1U6JA 2FTKE 2G5PA 1DKMA 2Q5HA 1U0EA 2Z56A 3B1FA 4Z7OB 2E5LB 3B52X 1QDUA 3CZPA 2GO1A 4J0DA 5BMVF 3OLVA 4Q93A 2UYYA 4HYYA 2FVYA 3X1DA 3U7QA 3KQPA 2V1UA 1T13A 2MINA 3LIPA 4UOZA 1AKWA 1XMSA 4DSNA 5C80A 5C5CA 5JYDA 3QWAA 3RARA 1EDDA 5LQDA 4JEIA 2B25A 3EGXA 2R4TA 3NIWA 3OMLA 1XQXA 5C1BA 4A15A 1FP4B 1T4DA 3VNQA 2Y1GA 1LY1A 2HSEA 3J81k 4HFRA 4URXR 3AL3A 4FOSA 1QRDA 1NQAO 1WXGA 1N8NA 3MRTA 3D6MA 3G2QA 2IVFA 4TKVA 1DCMA 2Q9AA 4Q03A 2WVJA 1GZ7A 3VC7A 4BGIA 3R44A 4YIHA 1YJ5A 4NHOA 2OYCA 3U17A 1W29A 4C4AA 1KYXA 3PJGA 1O7JA 1Z08A 4V3CA 2PQ0A 1SR8A 1O57A 3VBCA 3PSAA 4ZRNA 5JROA 1A82A 3MINA 3ZLTA 1RRVA 4D0SA 3A04A 4MI1A 2FGKA 2I7VA 3O8OA 4U5XA 3T15A 2LPMA 1I5RA 3O1LA 4RULA 3W5BA 1FMLA 2F3PA 4XDGA 4DFDA 3R7WB 2JKYA 1N92A 4DLNA 4JMLA 1BJTA 2WJIA 3CX7A 4OCZA 4G67A 5T4BA 1D1SA 1TFUA 2J9RA 2FPIA 4PXAA 3WSTA 5I3CA 5DNEA 3PF8A 1LRLA 2H08A 4AD8A 4L08A 3KT3A 1IDN1 5HVNA 1PQ4A 1SGWA 5ALQA 1Z26A 4QWWA 1JECA 2IEGA 1AO0A 2HDOA 3NVAA 4WIAA 4DRZA 1A8SA 3I9V6 4O5OA 2JGJA 1II9A 4JJAA 1KDPA 2W00A 5HF6A 4LXGA 1A7KA 1WMEA 2PANA 2XZPA 1FQOA 3TNLA 1F2DA 1TQDA 3CUKA 3JCZA 4LYJA 5JTUA 1TXGA 2J67A 5E95A 1H2WA 2J4FA 4I81A 3TQHA 3NPAA 3K09C 1S4MA 3QFFA 1P8AA 1CRQA 3L7KA 3H1AA 4Q00A 4PYMA 2ZS7A 3DBHA 4EB0A 4BE4A 1G7RA 1EGAA 2G71A 3A3YA 1NNUA 3GLVA 3LYUA 3QVMA 5K0FA 3HKDB 4FR0A 3G7SA 3GAMA 4M9XA 4OGLA 4OKIA 1R8JA 4PRZA 5HSGA 1K8QA 4PLPA 4C76A 1PK8A 2BGNA 2PUVA 5GP1A 5CT4A 2H8GA 3PA6A 3PKZA 1R0RE 1P4RA 1Z0SA 4IV5A 3MFQA 1A77A 4LDAA 1FYVA 2DBQA 2RH8A 4R05A 4DSAA 1E3MA 2IU4A 2HPHA 3MBIA 2XMGA 5CDUA 1KO1A 1PNTA 5BNTA 4KE8A 2C2YA 3EVZA 3AJ8A 3WWPA 4GX5A 3IP5A 3AG6A 2E7ZA 2YZNA 3BXXA 3FHCB 4JFRA 4O4HF 3WMXA 1ZXXA 1F6BA 1LV8A 3HUUA 1H66A 3Q3CA 1BE6A 4UU8A 4GP6A 1Z47A 4L9SA 2J5XA 1E5QA 1M66A 1NY5A 1Q14A 1YR2A 3FZEA 3GZNA 4BQIA 3CZ9A 2Q6LA 4WOCA 4ZVNA 4TXHA 2VSNA 4UHJA 5EIAA 2ZRDA 4F6LA 1UFVA 3AQ4A 1BXGA 3RTBA 3FXAA 1J90A 1L5QA 3EGDB 1A9ZA 2QPTA 3IUPA 4MHSA 5MN5A 1SU7A 1KY4A 4I36A 3TSZA 3UPTA 2YWFA 1IDOA 4XOUA 2IC5A 4GDMA 5DASA 3S70A 4E1AA 3S1AB 1GNQA 1QB7A 3I45A 2BKLA 4AT1A 3LT5A 5IKMA 1NNI1 2KS6A 2B7LA 4ZQBA 3SHFA 3DMTA 1O94C 2GKGA 4XAQA 3KEQA 1K0UA 2QQ5A 2DLCX 4BNKA 4ZHQA 1GU1A 1XCOA 1ZGBA 1QYRA 3NDJA 3ZHOA 4YIKA 5I48A 1UBLS 4K28A 1DRVA 1KJQA 3W8RA 1O96B 3DO8A 4D74A 1F2UB 3G17A 4LVUA 5HQ3B 3OCYA 1E0DA 3TTUA 2ODWA 3KC2A 1QMPA 4IVQA 4RVUA 4W8GA 1PR4A 2GTPA 5DX0A 1X8XA 1ZZGA 3I30X 3L1HA 5CA1B 5ES4B 5ESWA 1CULC 5BV0A 3GUUA 3A32A 2O2CA 1SG9A 3GJ5A 3FJOA 5EJ8A 2UZ3A 3GPIA 2ERCA 3G68A 4BNMA 1KJ8A 4FEYA 4ER0A 3GD5A 2WPDD 2CFTA 1GRNA 5AKLA 2I2XB 5IANA 1KZYC 4BP1A 1DTWB 1K6JA 1GG8A 4WCDA 2GZAA 3B48A 1BS2A 5E7MA 1I7SB 1LS1A 2J9FA 3PUZA 4MVWA 4A2QA 3ZE1B 1T4GA 2IZ1A 2Q3DA 4O59O 5GJVC 1HDCA 4G36A 3DR3A 3L6RA 4HPJB 1AV7A 1UT5A 2AVNA 1TJ3A 2H9AA 3FYHA 4Q3OA 1JNXX 2XHEA 3RO7A 1Z82A 2FFQA 3IT0A 3QKUA 4FYHA 1HV8A 1A7AA 2HJHA 4HDKB 3EBOA 4PANA 2Q7DA 5ICMA 4OL0A 4DLTA 1KP9A 1VI2A 4KR2A 2H4HA 2PT9A 3T5TA 2WHXA 1VSBA 3D2BA 3K7EA 4U39A 2W4MA 1I3OA 4CMCA 3GAZA 5EWLA 4KBGA 3ONVA 1ZD3A 1AQ6A 2ZPAA 3NONA 3PE3A 4DLSA 1CE8B 2K6GA 1A4UA 1UBJS 4M9SA 3TD6A 1G7CA 1LPAB 1IVSA 3RAJA 4B6RA 3DDOA 4EEKA 4RA9B 3IQHX 2RJ3A 4K9MA 3BSYA 2DZDA 1G9XA 1AM4D 1C4OA 4Z8YA 5FWXB 5FWYA 2OORA 1XD2A 2F2TA 4KLRA 4I3HA 1ONNA 1HR0B 1ZJJA 3IQGX 3SF8A 1R8SA 3LXRA 3T1VA 3RYHB 5E2BA 3N7UA 3HJBA 3NBKA 4IDNA 3DCIA 4CG1A 3M2PA 1PS0A 2JLAA 1P17A 5IAAA 4LCEA 1L5SA 1KO7A 1DQNA 1X1RA 2BEUA 3CF2A 4IUCS 4N48A 1USKA 1HFJA 2C5BA 2Z08A 3N0WA 3UCEA 2PMBA 4D0GA 3LE8A 3ZD9A 1CCWA 1D0SA 2OCDA 5EIWA 2JGIA 1LV7A 1VJDA 3Q7IA 4LJ4A 2QAGA 4KVAA 4RCZA 3WDMA 5AW0A 4MV7A 4YY3B 3NWJA 1N6LA 3DLPX 3CNEA 5FNZA 4ZEWA 1VJRA 2VHVA 1EEXB 1VKZA 5LQCA 2ZAMA 1EM8A 4PXSA 4E3ZA 4RS3A 4C7KA 1Q1AA 1E9DA 4EQ6B 2JIPA 4E5NA 3STXA 2YVQA 1E2UA 3H6HA 4BUCA 1MO6A 1AY0A 1F4PA 3GPBA 4IYJA 4A8PA 3BB4A 4DLBA 1Z3IX 3SJZA 3ZJTA 1Y89A 3LH5A 4MXDA 4C04A 2IEZA 2BTQA 1MAWA 2BH2A 4IV8A 5LU9A 1EK5A 2GA9A 4YV7A 3C1UA 1NXTA 1H6AA 2PT7A 1G5FA 5J3JA 3ZYCA 1NE2A 1IY9A 1LZLA 2FI1A 2JCBA 1AQLA 2EARA 3O2QB 4R2MA 5F76A 5IH3A 5CGQB 5JS8A 3LGSA 3P5SA 2YWRA 3GN2A 1F2UA 1MPTA 2R6ZA 4CG2A 4DSTA 1A9YA 3KSBC 4IDPA 1TQ6A 2WIBA 3N5CA 1YO6A 1ACMA 4G2NA 2JIQA 1ZCZA 1COZA 2IOYA 3FFWA 2Y1XA 5REQB 4PO3X 3UAGA 1L4GA 2WDPA 4AJOA 3OQNA 3KEMA 5ALDA 2HCBA 3V4SA 5DNUA 3PE6A 2RJOA 2PMCA 3L4KA 5C51B 3IIEA 3R9KA 3Q12A 4UTZA 4IZHA 2CB0A 1YE5A 2A1UA 4ADSG 1OLSA 1RLUA 2LRHA 3A4YA 2G83A 4MMXB 4QU8A 4W9NA 5AESA 1RHUA 3OZWA 1TU0A 4YCJA 4HUQB 4MV1A 4U6NA 4C4SA 4CLXA 5J2UF 3RYFA 2MTBA 5BSEA 1DRJA 1ONSA 5TMEA 2B4TO 1UC8A 3Q6NA 1U2GC 4OYRA 1IM8A 1AN9A 2P1DA 1SVKA 4U4AA 2BJHA 5ARDA 5KU1A 2IV7A 3TF5A 3H99A 4YNBA 2PE5A 3Q72A 3PICA 4REMA 5KHOC 2NADA 4ZVUA 1EHIA 1Q92A 2NU9A 2RIRA 5FYQA 3W4IA 2WAOA 1D07A 2DQYA 3GZTB 5HPYB 4TYPA 4RVHA 3RT7A 3MSXA 5FNVB 3RFVA 4JLUA 4PFQA 4FGSA 5KVCA 3WYAA 2C4WA 2WFLA 2X0RA 3O95A 3IMFA 1PJSA 3CB2A 1ZVJA 2AL7A 3K9LA 4XPIB 3OP1A 4BJ1A 4D02A 3ZD7A 1DBPA 3TQRA 1ZD8A 4V1CB 3DE0X 1KDRA 4O8CA 4Q3BA 4QA9A 5JC1A 4ER7A 3CRMA 5JZMA 4DR2B 2HMAA 4P4NA 1GPUA 4M37A 4K3UA 1ZH2A 4IIFA 1TCAA 1TJ5A 4AN1A 3N8KA 2FWPA 3ZNQA 1L4HA 1JJ7A 3O8QA 1WMSA 3CLSD 4Q9HA 4B5KA 3NHYA 4INOA 1SK8A 4P1ZA 1K66A 1UBTS 4X1YB 1A97A 1SUFA 1XCPA 2BGUA 2J33A 3JALA 4X0EA 1JR6A 2JGEA 3LSTA 1OLXB 1WR8A 3AL2A 1FFSA 1ABFA 3QOFA 4LBWA 2VF8A 3CPEA 1VDMA 4C3OB 2NOAA 3VOTA 2QPAA 3HMQA 2O7VA 2REXB 5B53A 4AJNA 2QTVA 3OIGA 1U0SY 3GT3A 5E9QA 1FSFA 1JRLA 1BXRA 1R5BA 4IY1A 3HWRA 1E6MA 3DMHA 1GADO 2Z09A 3VKVA 2IEAA 3TJRA 2IS6A 3KFXA 3S6JA 1TQHA 1AKUA 1WULS 4OKSA 3WBKA 2BKVA 2CLLB 1FU7A 4FILA 4KQFA 3NRCA 4F5DA 2H1OA 1WDMA 2ZM5A 3ZU4A 4BRWA 4IFBA 3N0RA 1I30A 1XZAA 4N4AA 1C9DB 4HI0E 4G5RA 3D8NA 3GH1A 3A9CA 4FSHA 2ZIXB 4RPJA 2OXEA 1NKTA 3BGWA 1XVIA 3D8BA 4Z2YA 3HBFA 5A3JA 3EYAA 4FFPA 4ATNA 1TMYA 1JPUA 1N6IA 2IQIA 3E9QA 3TLAA 3UXHA 1K27A 3KPJA 3LVRE 4RAQA 5EZYB 4D9NA 4GM4A 3GLIE 4ACBA 2D1FA 3P1JA 3EXHB 5JT1A 3MELA 5AVTA 2PH7A 3TZKA 3TYXA 2W5UA 4CIYA 3DGFC 2FF5A 3ILXA 3VBEA 1DADA 3KDPA 2ZXEA 3T7TA 3UCXA 2A59A 5BSKA 1XRRA 4NFYA 5KWEA 2JEZA 4DQKA 1V11B 3W5DA 3D2CA 2O6HA 4V1CI 4UTPA 2ZANA 4YMLA 5U9CA 3MVEA 4LF8B 1W85A 4TWZA 4S3MA 4YAUA 1SXGA 1J33A 1WZUA 1PFGA 4BWVA 4C7OB 4B3CA 1XSEA 2VZ9A 1QG4A 3L5OA 3TQTA 3VKFA 4COKA 1I94B 2ZWAA 4GMHA 1L5VA 1E4EA 4IXDA 4EMBA 3NYQA 1H8HA 4X7PA 1O6ZA 4NE7A 2P4UA 4YQYA 3HYNA 1A88A 4QGSA 4KQEA 4ECAA 2BAGA 4C05A 1B42A 1NPTO 3BH6A 4E70A 4F1JA 1NMQA 3N39C 4M7PA 5IASA 3I09A 1X0XA 2X5OA 4Q9KA 3O3CA 3EOBI 1UPUA 3K0CA 4ER3A 2TRSB 3K0AA 3S2EA 2IGBA 3N2KB 2BFDB 1HT0A 5LQNA 5CYGA 1GM5A 3CWQA 4QUJA 2WTBA 1JAYA 1VSVA 4KYUA 3ZU6A 2ZSBA 3FGZA 4DQVA 4OSOA 2JH9A 1GZ4A 1X70A 3FPJA 3CKMA 4MYTA 4ZXPA 3U81A 1JZSA 1FUYB 2Q6OA 4NCAA 2VNKA 4B3MB 4HCJA 4H7IA 3MD9A 3DOIA 4LTDA 1GAEO 2OY0A 2CV2A 4MH0R 2X7JA 3N2EA 3N3BC 4OPMA 5G3ZA 4YJ3B 2OOSA 4MAAA 4WBSA 1K8RA 5IMSA 3GGGA 5COQA 4KLCA 3H18A 3UJPA 1ZN7A 5JSZA 1HRDA 3KVVA 4KNYA 1IN1A 2RKOA 3JWEA 1RBMA 4MMZB 4I55B 4OHOA 4R1QA 1A3CA 3LFUA 5HMLA 1T1SA 4FDAA 5JJKA 1A8PA 4IDEA 3PDIA 2C07A 5IT0A 3LYHA 3RREA 1UDCA 4FE7A 3KYCA 3R76A 4A9AA 1YACA 2XUKA 3CGWA 5A3VA 5BSGA 4NZZA 1VMAA 3HGTA 3IALA 1SPBS 2VNAA 1L4MA 4UBNA 1E2HA 4JLMA 3PT9A 3WGTA 5LQJA 3QV2A 3T3PB 1PLLA 2FUEA 2XUGA 4ZKEA 3ZNOA 3CVWA 1YK0A 1Y9ZA 1VBNA 1CY2A 5CX1A 4TV8B 1XMXA 1H23A 2OM2A 3LXXA 1MH1A 2C3MA 3LYAA 1OIVA 1RAGA 3OE1A 4RGVA 3TGWA 3Q4GA 1RAAA 4HNRA 4Z9BA 5HF8A 4DM4A 4EECA 4XQEA 1SOUA 1ZBDA 2WHEA 3H7IA 5C3MA 1N2EA 4WLFA 4YS6A 1GYRA 1BXZA 1VG8A 1JIQA 1Z7WA 3LY5A 4MYHA 4PYIA 4QNMA 1QTQA 4OHYA 1T8SA 4MCHA 3IBYA 3UJ8A 3EIWA 4KODA 5AW9A 1C3OA 1HFEL 5JMOA 2B5VA 1D2RA 3C45A 4RPKA 4NBLA 1J8QA 2YXDA 4P82A 4DCOA 3FTFA 1OR8A 1IHYA 3EWAA 1MX1A 1SKBA 4Q7LA 1JH8A 2A4KA 3RVQA 4AP5A 4E5MA 3DWFA 3L07A 2QN6A 5K1ZA 4U2EA 4B4KA 1NJ2A 2RHBA 1DRUA 5FUYA 1E1QD 5HZGA 3B5IA 2ZVJA 3FWPA 4ZDWA 1W4AA 1H8ED 1DO8A 5EWJB 2OCYC 5I7AA 4B8WA 3ND9A 2HMSA 1JR4A 1IOLA 4TXLA 4B48A 5JR3A 3L1JA 4FSXA 2P8SA 3C7AA 3E2MA 1XTQA 4DMHA 5HRAA 4B80A 5KNLA 3LZDA 2W43A 2AF3C 1QYDA 1MNQA 1N1GA 1RBYA 4DY6A 4O1IA 1YQUA 2CVOA 1KEWA 1LDGA 3AI7A 1XRSB 3HE3A 3RI3A 3M5DA 3NWPA 3AHDA 3DFMA 4D79A 3OE5A 2ZB3A 1B26A 5DHQA 3HCDA 3WDKA 3BKXA 4FW9A 5CA0F 5I7SA 1VJCA 4GYJA 1QTIA 5DCWA 3RUEA 4G86A 1A5ZA 3NIDB 2Q9UA 2NM0A 4DLVA 4RM2A 4HJRA 1RI1A 4PVCA 4WKOA 1G2OA 3DR5A 4CDRA 3F5DA 3U44A 2ACKA 3TR6A 3ELUA 3TLMA 3NAGA 3B53X 3HXTA 5H5JA 4CDGA 1DAFA 5KTOA 5LMUB 2JK0A 1RAHA 4GLLA 3UMJA 1Z7BA 2OCLA 3EXEA 4C7BA 2AT1A 2XMRA 1TCBA 1E2KA 3WK7A 2H1FA 5JWOA 4PTLA 1KXZA 1JKFA 1FC0A 3OZBA 3O7MA 1DC6A 1X8JA 2Q0SA 2PU7A 4ZDKA 4B3GA 2FOIA 3OT1A 4ZREA 1T3LA 3LCCA 4TSFA 4EVQA 4JB2A 1E9RA 1AN0A 1K97A 1M1YB 1ZG3A 3LC0A 4FDVA 2I1WA 3LUBA 4O2BF 3NETA 4M1WA 4ZAWA 4M46A 2QN9A 1NG1A 1G19A 3F74A 3Q3IA 4RD6A 5FOWA 4D9MA 3WAJA 3COJA 4N3CA 5C8DA 2EP5A 4WNCA 1OXKB 2FE4A 4MSUA 1DGQA 3DT9A 1J5PA 4YJKA 1VL1A 1BNCA 4O2BA 5E0KB 1WAMA 1RYMA 2R2GA 2G28A 4GGPA 2H59A 1XZDA 4Y6RA 4BNNA 4FWTA 4QBHA 2GCGA 4TM7A 1MJGM 1XNGA 2FA9A 5C32A 1ID1A 2FWIA 3PC2A 5WRFA 2ZJ1A 1JVSA 4RHXA 3TPCA 4RKRA 3U9LA 1EUZA 2C2ZA 3OE7D 4JCCA 4MVCA 1M2HA 1SCUA 3GT0A 2ORED 1FXWA 3GXBA 2ZM6B 3M70A 3MUEA 1JLHA 3H5RA 4BO0A 3A1WA 2VPZA 2QVGA 3AVOA 4AJHA 1TAUA 3OJEA 1DS6A 2V6BA 5FWNA 4FPXA 3N0XA 1G60A 1G21B 1ZJZA 1N5KA 2C2BA 4NBRA 1QHHB 2R47A 1ZISA 3OFKA 4WL0A 2F8MA 2OC9A 2UZ1B 3LVFO 1BXGB 1SCNE 1WNFA 2ECKA 4IL5A 3E8XA 2HJ9A 2P4EA 3L0DA 3FVQA 2Q46A 5D84A 2C0QA 3W2IA 1LDNA 1JHZA 1H8EA 1MT0A 1CUHA 1FDIA 1Y8CA 1R6BX 2QUAA 1GUBA 2GBIA 3IP1A 3GI1A 3QENA 4PLWA 5CJJA 4JH0A 1V26A 2CEKA 4DOMA 5TIIA 1INLA 2OQVA 3KWFA 5C35A 1G9SA 3BTVA 4E0BA 3UYLA 2XUPA 1Y7HA 2DPMA 3BJIC 1T3GA 3FFXA 1KJJA