1XHOA

Chorismate mutase from clostridium thermocellum cth-682
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
VWAIRGATTVSDNTADEIVAETQKLLKEMAEKNGLEEDDIISIIFTVTKDLDAAFPAIAARNMGWTSTALMCMNEIDVPGSLEKCIRVMMHVNTDKDKKDIKHVYLNGAKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chorismate mutase
publication title Away from the edge II: in-house Se-SAS phasing with chromium radiation.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Structural genomics, unknown function
total genus 26
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1xhoA00
3ZOPA 3M1XA 3L7QA 3ZO8A 2CVLA 2EWCA 1QU9A 1UI9A 3V4DA 3ZP7A 3QUWA 2CW4A 3LMEA 2OTMA 3KJKA 1UFYA 1JD1A 2B33A 2CHTA 1ODEA 1ONIA 3LYBA 5HP8A 2UYJA 1PF5A 1COMA 3ZP4A 1QAHA 1XHOA 2CWJA 3I7TA 2CSLA 3MQWA 5HP7A 1J7HA 1DBFA 1FNJA 3R0PA 4ZK7A 1X25A 4NWOB 3GTZA 2CHSA 2UYPA 3M4SA 2IG8A 2UYNB 1NQ3A 1FNKA 1QD9A 2UYNA 3K12A 2DYYA 3D01A 3I3FA 3K0TA 3KJJA 2UYKA 3VCZA 1XRGA
chains in the Genus database with same CATH superfamily
3F0GA 1U3LA 1VQ4F 3M84A 3SIUA 2YXZA 3S03A 3FPIA 3HKCA 1M90H 2R6R1 5EYPA 5GINC 4O4IA 5KX5B 5LA6B 5LYJB 3HAXD 4LNUA 5A2QM 3CCRF 3MBMA 3FD6A 5IT9M 3LWRC 4ZI7B 3J81M 2RHOA 3CD6F 4O4JA 1QVFF 5MN6A 5J2UA 4BT5A 1YJ9F 2RB9A 4YJ2A 4G4YA 4EB6A 2KG4A 2VAPA 1U43A 5CA1A 2DT4A 3LMEA 4M8IA 2Q1YA 3SIVA 4ZHYB 3WJQA 5IYZB 5EB1B 1IV4A 5KMGB 1RQ7A 2F9ZC 4RQOA 4WBNB 1IPAA 3WGNA 1KNJA 1SZQA 3C9RA 4TZZA 2QA4F 2OTJF 3CPWF 4U3JA 1KD1H 2Q1XA 1JFFB 3CCQF 2AIZP 3JARB 3HKBA 3I3FA 2H8EA 1VHAA 5LOVA 4O2BA 2CVLA 4EI8A 4NQ3A 3QUWA 3KE1A 5JH7A 5FJ4C 3VTIC 2HS3A 4B5CA 1TVKB 3QTYA 3JAWA 4X1YA 2CHTA 4U39A 1YHQF 3LYBA 1T0KB 1COMA 5LP6B 3ON1A 2CWJA 3D54A 4O4HA 3JVHA 5J2TB 3HTNA 2N48A 5BMVB 3NVKE 5FNVA 5FLXM 3PLAC 5G4UC 4NWOB 4BVSA 3I56F 2NMUA 1NQ3A 3RE3A 3F0EA 4I50B 1VQOF 3E22A 3CCEF 1DT9A 1H48A 1FSZA 2Z1EA 3ZOPA 5EIBD 4IIJB 5EWRA 1K8AH 4DXDA 1VQ8F 5EIBC 3AGKA 3V4DA 3ZP7A 1PXWA 3LWOC 4BT2A 2HVYD 4C8EA 3S06A 3OW2F 2BTOA 3RYFB 3JCMM 5IJ9B 5GIPC 4TV8B 3VI6A 2KTUA 4F6RA 5JVDA 4C8GA 2UYNA 3VMFB 3KJJA 4X1IB 4LCKA 1OAPA 4KWEA 3VOBA 2HP0B 2KGWA 3JALA 1UI9A 3WJRA 1XBIA 4ZHVA 5GONB 3HKCB 5GANK 3S0HA 2WALA 4O4IB 2RHJA 3HKEB 3N2GB 4IHJA 4TV9A 5AVMA 3RYIA 2ZOVA 1QAHA 3JAKA 3VYTC 3CC2F 2Z1FA 4DRXA 5MN4A 2K1SA 4ZOLA 2MQEA 4B62A 3BYQA 1H7MA 3GHZA 2IG8A 2QI2A 4X20B 4TUYB 1KNKA 5HY1A 1XV2A 3M1XA 3L7QA 1VQVA 5CA1B 4BVQA 3CC4F 3CXCF 2Z01A 3I55F 3FBAA 3G6EF 3P10A 2H6LA 4C8IA 1JN1A 3RYHB 4B46A 5CB4A 3JASB 1TUBA 1FFXB 2RHHA 3J7AR 4RHAA 1RLUA 1W57A 3LWQC 3IKEA 5JCOA 1K73H 2HRUA 3VIUA 3V7EA 3MCAB 3MCQA 1Z5VA 2Z1TA 2QTPA 4ZHWA 1VQ9F 1Q8RA 3HKBB 3C9UA 2HRYA 4HNAB 5LOVB 2HP3A 4C82A 4EI7A 4X1KA 3N2KA 1OFUA 3V3TA 3CMAF 1W41A 5EAZA 4FFBB 4I55A 5ITZB 4E6EA 2CW4A 5HY2A 3UT5A 3FFMA 4BY9D 2VGMA 1YQNA 2ZVYA 4O2AA 3WPXA 3TD5A 3J80M 2JNBA 3ZP4A 1U40A 4O4HB 4YJ3A 3F0DA 3U0OA 3O85A 5LXTB 3M4SA 1GO1A 2GVIA 1U3PA 1FNKA 1VQLF 1W2BF 5IJ0A 3D01A 4O4LA 4ERHA 3IEQA 5EZYA 2AIFA 5CA0B 5C8YB 3C9TA 1W581 1W55A 5EB0A 1SA0B 1Z5WA 3B6NA 5KX5A 1JD1A 4ZHQA 5LA6A 4BVRA 5LYJA 1JJ2F 4ZI7A 3ERNA 1Q7YH 3WPWA 1W3EX 3R0PA 4BT6A 1X25A 3JATB 1VQNF 1VQ6F 3JAMM 2CZWA 1YGYA 2I6DA 2L26A 2KTVA 3CMEF 3VOAA 3JALB 1IV2A 4BT4A 2QEXF 5LP6C 3P0ZA 5GIOC 4I4TB 1YJWF 1W5BA 5KMGA 1VQPF 3IR9A 4WBNA 3DDNA 2Z1UA 4G88A 4XCQA 4ZOLB 1VQ5F 1JFFA 1FNJA 3WGMA 4ZK7A 3JARA 3HKDB 2PMPA 3T80A 3ZO8A 2IAFA 3CCMF 1QU9A 3K14A 1Q81H 1YITF 2VGNA 3CG6A 1H47A 1TVKA 5CB4B 5EYPB 1UFYA 1W59A 2B33A 1ODEA 1E7KA 2AMTA 2UYJA 4LNUB 3CCJF 5J2TA 5HP7A 5BMVA 4PWTA 5JQGA 3OBWA 4O4JB 1R1MA 4BW0B 3MDOA 3GTZA 3K12A 3LWPC 5J2UB 4I50A 3RA6A 3G4SF 4YJ2B 3NMUC 4EB6B 2EWCA 1T0AA 3P4EA 4X3MA 3IMPA 3PAFA 3EORA 1VQ7F 5HWEA 1PF5A 3ESJA 3K2XA 3RYCA 3MQWA 2CSLA 1W5FA 2OZBA 2UZHA 4U3JB 1RLGA 4G4WA 5IJ9A 1VH8A 4TV8A 2OHWA 2BTQB 1X52A 2CHSA 2LCAA 4X1IA 1KQSF 5EZYB 3C8LA 2RHLA 2HP0A 1W5AA 5HY4A 3VO8A 5HY0A 4O2BB 3S0YA 5GONA 5JH7B 4X3LA 1GX1A 3GYQA 3V7QA 3JAWB 4X1YB 4EI9A 3CYQA 4ZHQB 3RA5A 4B45A 2LBXA 5EO3A 3HKEA 3N2GA 2FC3A 3E1YA 3F0FA 3KHNA 2G9IA 3S0WA 5G4VC 3CC7F 5FNVB 3IKFA 1VQKF 3WJPA 1NJIH 3VYUC 4X20A 4TUYA 3HWUA 2ALEA 2VAMA 3E22B 3OBYA 1X7PA 1W5EA 3CCVF 3N4YA 1K9MH 2R751 3NK6A 1M1KH 1ZWZA 2HS0A 3RYHA 5HXUA 3JASA 2LBWA 1FFXA 3IEWA 4BVTA 3I7TA 2HQSC 3CPQA 3WGLA 1Q86H 4R40B 2OTLF 4F6RB 5JVDB 2UYNB 1QD9A 2DYYA 3QHDA 4HNAA 1QVGF 2H8CA 1XRGA 3DC2A 1W40A 5HXZA 4FFBA 3WGJA 5ITZA 1KC8H 2OTMA 5IYZA 3CYPB 4IHJB 4TV9B 3RYIB 3Q8HA 1YI2F 3JAKB 3OONA 4DRXB 1IV3A 2P6YA 3D00A 1DBFA 5JQGB 3TD4A 1IV1A 2HS4A 5LXTA 4G4XA 4G4ZA 3WXMB 3FD5A 3CCLF 3S02A 3K0TA 2BO1A 2ZF8A 1Q82H 5CA0A 5B8FA 4C81A 1RA4A 5C8YA 4C4WC 1X7OA 1CK2A 1SA0A 4BT3A 2VAWA 5GAPK 3HJWC 3KJKA 2HX0A 4G4VA 1TUBB 2ZAUA 1GO0A 1JY8A 3NVIB 5HP8A 3E20B 2ZODA 3RYCB 4NUTA 1XHOA 1RQ2A 5LP6A 3NK7A 2YYEA 2IQQA 2BTUA 2GZLA 1CLIA 2FGYA 4BT7A 1VQMF 3JATA 3N4ZA 3CCSF 1NMUB 2UYPA 5MN5A 1CN7A 3F6MA 2VXYA 2ZVZA 3VCZA 2V9YA 3CCUF 3CB2A 3LWVC 3VYSC 4X1KB 3N2KB 1N8RH 4IIJA 1YIJF 5DCVA 3LDTA 3LFOA 4I55B 5JCOC 2LBTA 1GZ0A 3UT5B 3ELCA 1YJNF 4I4TA 4O2AB 1ONIA 3C9SA 3WGKA 1VK3A 3RYFA 4YJ3B 1J7HA 3G71F 2W8BC 3KIZA 1SDSA 1W42A 3TD3A 5IJ0B 2PHNA 4O4LB 2I6RA 2UYKA 3HKDA 1S72F 2GLZA
chains in the Genus database with same CATH topology
3ZOPA 3M1XA 3L7QA 3ZO8A 2CVLA 2EWCA 1QU9A 1UI9A 3V4DA 3ZP7A 3QUWA 2CW4A 3LMEA 2OTMA 3KJKA 1UFYA 1JD1A 2B33A 2CHTA 1ODEA 1ONIA 3LYBA 5HP8A 2UYJA 1PF5A 1COMA 3ZP4A 1QAHA 1XHOA 2CWJA 3I7TA 2CSLA 3MQWA 5HP7A 1J7HA 1DBFA 1FNJA 3R0PA 4ZK7A 1X25A 4NWOB 3GTZA 2CHSA 2UYPA 3M4SA 2IG8A 2UYNB 1NQ3A 1FNKA 1QD9A 2UYNA 3K12A 2DYYA 3D01A 3I3FA 3K0TA 3KJJA 2UYKA 3VCZA 1XRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOP A;  3M1X A;  3L7Q A;  3ZO8 A;  2CVL A;  2EWC A;  1QU9 A;  1UI9 A;  3V4D A;  3ZP7 A;  3QUW A;  2CW4 A;  3LME A;  2OTM A;  3KJK A;  1UFY A;  1JD1 A;  2B33 A;  2CHT A;  1ODE A;  1ONI A;  3LYB A;  5HP8 A;  2UYJ A;  1PF5 A;  1COM A;  3ZP4 A;  1QAH A;  1XHO A;  2CWJ A;  3I7T A;  2CSL A;  3MQW A;  5HP7 A;  1J7H A;  1DBF A;  1FNJ A;  3R0P A;  4ZK7 A;  1X25 A;  4NWO B;  3GTZ A;  2CHS A;  2UYP A;  3M4S A;  2IG8 A;  2UYN B;  1NQ3 A;  1FNK A;  1QD9 A;  2UYN A;  3K12 A;  2DYY A;  3D01 A;  3I3F A;  3K0T A;  3KJJ A;  2UYK A;  3VCZ A;  1XRG A; 
#chains in the Genus database with same CATH topology
 3F0G A;  1U3L A;  1VQ4 F;  3M84 A;  3SIU A;  2YXZ A;  3S03 A;  3FPI A;  3HKC A;  1M90 H;  2R6R 1;  5EYP A;  5GIN C;  4O4I A;  5KX5 B;  5LA6 B;  5LYJ B;  3HAX D;  4LNU A;  5A2Q M;  3CCR F;  3MBM A;  3FD6 A;  5IT9 M;  3LWR C;  4ZI7 B;  3J81 M;  2RHO A;  3CD6 F;  4O4J A;  1QVF F;  5MN6 A;  5J2U A;  4BT5 A;  1YJ9 F;  2RB9 A;  4YJ2 A;  4G4Y A;  4EB6 A;  2KG4 A;  2VAP A;  1U43 A;  5CA1 A;  2DT4 A;  3LME A;  4M8I A;  2Q1Y A;  3SIV A;  4ZHY B;  3WJQ A;  5IYZ B;  5EB1 B;  1IV4 A;  5KMG B;  1RQ7 A;  2F9Z C;  4RQO A;  4WBN B;  1IPA A;  3WGN A;  1KNJ A;  1SZQ A;  3C9R A;  4TZZ A;  2QA4 F;  2OTJ F;  3CPW F;  4U3J A;  1KD1 H;  2Q1X A;  1JFF B;  3CCQ F;  2AIZ P;  3JAR B;  3HKB A;  3I3F A;  2H8E A;  1VHA A;  5LOV A;  4O2B A;  2CVL A;  4EI8 A;  4NQ3 A;  3QUW A;  3KE1 A;  5JH7 A;  5FJ4 C;  3VTI C;  2HS3 A;  4B5C A;  1TVK B;  3QTY A;  3JAW A;  4X1Y A;  2CHT A;  4U39 A;  1YHQ F;  3LYB A;  1T0K B;  1COM A;  5LP6 B;  3ON1 A;  2CWJ A;  3D54 A;  4O4H A;  3JVH A;  5J2T B;  3HTN A;  2N48 A;  5BMV B;  3NVK E;  5FNV A;  5FLX M;  3PLA C;  5G4U C;  4NWO B;  4BVS A;  3I56 F;  2NMU A;  1NQ3 A;  3RE3 A;  3F0E A;  4I50 B;  1VQO F;  3E22 A;  3CCE F;  1DT9 A;  1H48 A;  1FSZ A;  2Z1E A;  3ZOP A;  5EIB D;  4IIJ B;  5EWR A;  1K8A H;  4DXD A;  1VQ8 F;  5EIB C;  3AGK A;  3V4D A;  3ZP7 A;  1PXW A;  3LWO C;  4BT2 A;  2HVY D;  4C8E A;  3S06 A;  3OW2 F;  2BTO A;  3RYF B;  3JCM M;  5IJ9 B;  5GIP C;  4TV8 B;  3VI6 A;  2KTU A;  4F6R A;  5JVD A;  4C8G A;  2UYN A;  3VMF B;  3KJJ A;  4X1I B;  4LCK A;  1OAP A;  4KWE A;  3VOB A;  2HP0 B;  2KGW A;  3JAL A;  1UI9 A;  3WJR A;  1XBI A;  4ZHV A;  5GON B;  3HKC B;  5GAN K;  3S0H A;  2WAL A;  4O4I B;  2RHJ A;  3HKE B;  3N2G B;  4IHJ A;  4TV9 A;  5AVM A;  3RYI A;  2ZOV A;  1QAH A;  3JAK A;  3VYT C;  3CC2 F;  2Z1F A;  4DRX A;  5MN4 A;  2K1S A;  4ZOL A;  2MQE A;  4B62 A;  3BYQ A;  1H7M A;  3GHZ A;  2IG8 A;  2QI2 A;  4X20 B;  4TUY B;  1KNK A;  5HY1 A;  1XV2 A;  3M1X A;  3L7Q A;  1VQV A;  5CA1 B;  4BVQ A;  3CC4 F;  3CXC F;  2Z01 A;  3I55 F;  3FBA A;  3G6E F;  3P10 A;  2H6L A;  4C8I A;  1JN1 A;  3RYH B;  4B46 A;  5CB4 A;  3JAS B;  1TUB A;  1FFX B;  2RHH A;  3J7A R;  4RHA A;  1RLU A;  1W57 A;  3LWQ C;  3IKE A;  5JCO A;  1K73 H;  2HRU A;  3VIU A;  3V7E A;  3MCA B;  3MCQ A;  1Z5V A;  2Z1T A;  2QTP A;  4ZHW A;  1VQ9 F;  1Q8R A;  3HKB B;  3C9U A;  2HRY A;  4HNA B;  5LOV B;  2HP3 A;  4C82 A;  4EI7 A;  4X1K A;  3N2K A;  1OFU A;  3V3T A;  3CMA F;  1W41 A;  5EAZ A;  4FFB B;  4I55 A;  5ITZ B;  4E6E A;  2CW4 A;  5HY2 A;  3UT5 A;  3FFM A;  4BY9 D;  2VGM A;  1YQN A;  2ZVY A;  4O2A A;  3WPX A;  3TD5 A;  3J80 M;  2JNB A;  3ZP4 A;  1U40 A;  4O4H B;  4YJ3 A;  3F0D A;  3U0O A;  3O85 A;  5LXT B;  3M4S A;  1GO1 A;  2GVI A;  1U3P A;  1FNK A;  1VQL F;  1W2B F;  5IJ0 A;  3D01 A;  4O4L A;  4ERH A;  3IEQ A;  5EZY A;  2AIF A;  5CA0 B;  5C8Y B;  3C9T A;  1W58 1;  1W55 A;  5EB0 A;  1SA0 B;  1Z5W A;  3B6N A;  5KX5 A;  1JD1 A;  4ZHQ A;  5LA6 A;  4BVR A;  5LYJ A;  1JJ2 F;  4ZI7 A;  3ERN A;  1Q7Y H;  3WPW A;  1W3E X;  3R0P A;  4BT6 A;  1X25 A;  3JAT B;  1VQN F;  1VQ6 F;  3JAM M;  2CZW A;  1YGY A;  2I6D A;  2L26 A;  2KTV A;  3CME F;  3VOA A;  3JAL B;  1IV2 A;  4BT4 A;  2QEX F;  5LP6 C;  3P0Z A;  5GIO C;  4I4T B;  1YJW F;  1W5B A;  5KMG A;  1VQP F;  3IR9 A;  4WBN A;  3DDN A;  2Z1U A;  4G88 A;  4XCQ A;  4ZOL B;  1VQ5 F;  1JFF A;  1FNJ A;  3WGM A;  4ZK7 A;  3JAR A;  3HKD B;  2PMP A;  3T80 A;  3ZO8 A;  2IAF A;  3CCM F;  1QU9 A;  3K14 A;  1Q81 H;  1YIT F;  2VGN A;  3CG6 A;  1H47 A;  1TVK A;  5CB4 B;  5EYP B;  1UFY A;  1W59 A;  2B33 A;  1ODE A;  1E7K A;  2AMT A;  2UYJ A;  4LNU B;  3CCJ F;  5J2T A;  5HP7 A;  5BMV A;  4PWT A;  5JQG A;  3OBW A;  4O4J B;  1R1M A;  4BW0 B;  3MDO A;  3GTZ A;  3K12 A;  3LWP C;  5J2U B;  4I50 A;  3RA6 A;  3G4S F;  4YJ2 B;  3NMU C;  4EB6 B;  2EWC A;  1T0A A;  3P4E A;  4X3M A;  3IMP A;  3PAF A;  3EOR A;  1VQ7 F;  5HWE A;  1PF5 A;  3ESJ A;  3K2X A;  3RYC A;  3MQW A;  2CSL A;  1W5F A;  2OZB A;  2UZH A;  4U3J B;  1RLG A;  4G4W A;  5IJ9 A;  1VH8 A;  4TV8 A;  2OHW A;  2BTQ B;  1X52 A;  2CHS A;  2LCA A;  4X1I A;  1KQS F;  5EZY B;  3C8L A;  2RHL A;  2HP0 A;  1W5A A;  5HY4 A;  3VO8 A;  5HY0 A;  4O2B B;  3S0Y A;  5GON A;  5JH7 B;  4X3L A;  1GX1 A;  3GYQ A;  3V7Q A;  3JAW B;  4X1Y B;  4EI9 A;  3CYQ A;  4ZHQ B;  3RA5 A;  4B45 A;  2LBX A;  5EO3 A;  3HKE A;  3N2G A;  2FC3 A;  3E1Y A;  3F0F A;  3KHN A;  2G9I A;  3S0W A;  5G4V C;  3CC7 F;  5FNV B;  3IKF A;  1VQK F;  3WJP A;  1NJI H;  3VYU C;  4X20 A;  4TUY A;  3HWU A;  2ALE A;  2VAM A;  3E22 B;  3OBY A;  1X7P A;  1W5E A;  3CCV F;  3N4Y A;  1K9M H;  2R75 1;  3NK6 A;  1M1K H;  1ZWZ A;  2HS0 A;  3RYH A;  5HXU A;  3JAS A;  2LBW A;  1FFX A;  3IEW A;  4BVT A;  3I7T A;  2HQS C;  3CPQ A;  3WGL A;  1Q86 H;  4R40 B;  2OTL F;  4F6R B;  5JVD B;  2UYN B;  1QD9 A;  2DYY A;  3QHD A;  4HNA A;  1QVG F;  2H8C A;  1XRG A;  3DC2 A;  1W40 A;  5HXZ A;  4FFB A;  3WGJ A;  5ITZ A;  1KC8 H;  2OTM A;  5IYZ A;  3CYP B;  4IHJ B;  4TV9 B;  3RYI B;  3Q8H A;  1YI2 F;  3JAK B;  3OON A;  4DRX B;  1IV3 A;  2P6Y A;  3D00 A;  1DBF A;  5JQG B;  3TD4 A;  1IV1 A;  2HS4 A;  5LXT A;  4G4X A;  4G4Z A;  3WXM B;  3FD5 A;  3CCL F;  3S02 A;  3K0T A;  2BO1 A;  2ZF8 A;  1Q82 H;  5CA0 A;  5B8F A;  4C81 A;  1RA4 A;  5C8Y A;  4C4W C;  1X7O A;  1CK2 A;  1SA0 A;  4BT3 A;  2VAW A;  5GAP K;  3HJW C;  3KJK A;  2HX0 A;  4G4V A;  1TUB B;  2ZAU A;  1GO0 A;  1JY8 A;  3NVI B;  5HP8 A;  3E20 B;  2ZOD A;  3RYC B;  4NUT A;  1XHO A;  1RQ2 A;  5LP6 A;  3NK7 A;  2YYE A;  2IQQ A;  2BTU A;  2GZL A;  1CLI A;  2FGY A;  4BT7 A;  1VQM F;  3JAT A;  3N4Z A;  3CCS F;  1NMU B;  2UYP A;  5MN5 A;  1CN7 A;  3F6M A;  2VXY A;  2ZVZ A;  3VCZ A;  2V9Y A;  3CCU F;  3CB2 A;  3LWV C;  3VYS C;  4X1K B;  3N2K B;  1N8R H;  4IIJ A;  1YIJ F;  5DCV A;  3LDT A;  3LFO A;  4I55 B;  5JCO C;  2LBT A;  1GZ0 A;  3UT5 B;  3ELC A;  1YJN F;  4I4T A;  4O2A B;  1ONI A;  3C9S A;  3WGK A;  1VK3 A;  3RYF A;  4YJ3 B;  1J7H A;  3G71 F;  2W8B C;  3KIZ A;  1SDS A;  1W42 A;  3TD3 A;  5IJ0 B;  2PHN A;  4O4L B;  2I6R A;  2UYK A;  3HKD A;  1S72 F;  2GLZ A; 
#chains in the Genus database with same CATH homology
 3ZOP A;  3M1X A;  3L7Q A;  3ZO8 A;  2CVL A;  2EWC A;  1QU9 A;  1UI9 A;  3V4D A;  3ZP7 A;  3QUW A;  2CW4 A;  3LME A;  2OTM A;  3KJK A;  1UFY A;  1JD1 A;  2B33 A;  2CHT A;  1ODE A;  1ONI A;  3LYB A;  5HP8 A;  2UYJ A;  1PF5 A;  1COM A;  3ZP4 A;  1QAH A;  1XHO A;  2CWJ A;  3I7T A;  2CSL A;  3MQW A;  5HP7 A;  1J7H A;  1DBF A;  1FNJ A;  3R0P A;  4ZK7 A;  1X25 A;  4NWO B;  3GTZ A;  2CHS A;  2UYP A;  3M4S A;  2IG8 A;  2UYN B;  1NQ3 A;  1FNK A;  1QD9 A;  2UYN A;  3K12 A;  2DYY A;  3D01 A;  3I3F A;  3K0T A;  3KJJ A;  2UYK A;  3VCZ A;  1XRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...