1XHZA

Phi29 dna polymerase, orthorhombic crystal form, ssdna complex
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
571
structure length
571
Chain Sequence
b'PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*TP*T)-3'
publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
total genus 144
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhzA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhzA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhzA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhzA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhzA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhzA06
3KK1A 1C0TA 1KVAA 3K57A 1WLJA 3B6OA 2F96A 3RR8A 2O4GA 3S3OA 2D5RA 4KKOA 1UWBA 1LW2A 3MEDA 3SV4A 4DFKA 3TAEA 2WOMA 3MEEA 3AO3A 5J2PA 4BE1A 1LWFA 3FFIA 3VQQA 1RBRA 3SQ4A 2PW9A 4GMJB 1D8YA 1XI1A 3AV9A 3HO1A 1NK5A 3ZT2A 4EP5A 1JXEA 1SUQA 3OYHA 3CFRA 4HUGA 2G8FA 5HBMA 3NCIA 2HW3A 1NJXA 1EXQA 5KI6A 3LP0A 3SQ1A 4DSIA 3MXIA 1VSMA 3JYTA 1TKXA 4N56A 3LWMA 1BIUA 4R5PA 5HRRA 3QLHA 4CF0A 1NKBA 3OYMA 1RT2A 4LD0A 5E41A 3K5NA 4CHOA 3C94A 1ITGA 1EX4A 1LW0A 4CEBA 3ZT3A 5HRPA 4DTXA 1EKEA 4LSLA 3HVRA 2BANA 4HTUA 3K58A 2KW4A 2QKKA 4FJ9A 4PUOA 3OJSA 4FLTA 1RDAA 2YNFA 3CM6A 2FC0A 4DF8A 1MU2A 4CEDA 3M8RA 2XY6A 4NYFA 3QIPA 3KD1E 2HNYA 2B4JA 5JS2A 3WNFA 3NE6A 2P5OA 3U3GA 3SUNA 2ZQBA 5KTQA 1WSEA 3DLEA 4DSEA 2KZMA 2ITGA 3HJFA 2HVHA 4RW8A 3V9SA 2IGIA 3NDKA 2LSNA 1DTQA 4O0JA 4KV8A 4DTJA 4DTNA 1N6QA 4FLZA 4CK3A 3ZT0A 3QEVA 4FJMA 3TANA 4KHUA 3DLKA 3ZT4A 4N5SA 4I9LA 2PY5A 2BDPA 1C1AA 2YHAA 3SZ2A 4DU3A 1QQCA 1WSIA 1JKHA 3TAPA 1W9HA 2RF2A 3V9WA 1X9WA 3LAMA 1HNVA 1VSHA 3HPGA 2G8KA 1HQEA 3V9ZA 4J2EA 1RT1A 4DLGA 4CGFA 1GOAA 1RBVA 3TABA 1JLQA 3RRGA 4RW6A 4IG3A 4KFBA 3AO1A 4M3XA 3DMJA 4M3YA 1A5VA 4Z0UA 4CJSA 4OPKA 2X74A 3VN5A 1BHLA 4DF4A 5C24A 2XO7A 3TAFA 3SPZA 3ASMA 4CGGA 2Y1IA 1UA0A 3ZSVA 1U4BA 3DLBA 3HT3A 2E4LA 3VQ4A 4K8ZA 3AVJA 2ZD1A 4KTQA 2OPQA 4GVMA 4BDPA 3WNHA 3KLGA 4KHNA 3M8SA 1HNIA 3O4NA 3DOKA 4CJVA 3DLRA 3QESA 1WAJA 3VQEA 3L2UA 1LAWA 3U3YA 4OJRA 2W42A 4W5OA 4BWMA 3V6DA 1HQUA 2YKNA 4M42A 2YKMA 3QNNA 4PA1A 4B8AB 4I7FA 1K6YA 3RMDA 4ELUA 2OPRA 3HM9A 3VQ8A 4K8XA 1T05A 3ISNC 2IDOA 1HMVA 3T1AA 3V9XA 1S1TA 3QNOA 4FJ7A 1HYVA 3S3NA 1TL1A 3K5LA 1RBSA 4ID5A 2GBZA 4M3RA 3SUOA 4KHWA 3LPTA 3EY1A 3P5JA 4WE1A 3NF6A 4FZYA 1S9GA 1Q8IA 1DTTA 4EP4A 2YV0X 3AVNA 2OPSA 1C6VA 4FLXA 4O44A 3NGZA 3NHGA 1NK8A 2YNGA 5CYQA 2OPPA 3TAQA 4E1NA 2DTUA 1F21A 3VA3A 4RW9A 2P51A 4AH9A 1TAUA 1T7PA 1S9EA 4FJJA 2QXFA 1QSSA 2A1SA 3ZSQA 4CJ5A 4CHYA 2HHUA 2YHBA 2IC3A 3VQ6A 4CFAA 1BQMA 3V4IA 2XY7A 5D3GA 1B9DA 4Z4FA 1BGXT 3VQCA 1TKDA 2HHXA 4GW6A 4CJPA 1ZBHA 4FZZA 5DK5A 4CESA 1S6QA 2VG5A 3NF9A 1KTQA 4JS5A 3V9UA 4DSKA 3OYIA 1SL0A 1C1BA 5J2QA 1YVUA 3LAKA 3HP6A 4Z4EA 4FM0A 3NAEA 3ZSRA 5C42A 3RR7A 1BQNA 3KLIA 4CHQA 1TGOA 3MXMA 1SL1A 3VQ7A 4DS5A 1I3AA 4AILC 1RDBA 4NCGA 4FLYA 4CJTA 5SZTA 1IH7A 3BGRA 3CG7A 3L2RA 2YNHA 4JRQA 3KKRA 2DFFA 4E19A 4CEAA 2KFNA 3OYGA 3LP3A 4B9MA 3IAYA 4KB1A 4MQ3A 3KIOA 4E7IA 3U6FA 4IKFA 1NOZA 1VSEA 4FJNA 3SCXA 3M8PA 2KTQA 4E7LA 4H4OA 3K5OA 1WAFA 4CEEA 1WSGA 3S3MA 4H8KA 1EP4A 4DQPA 3EYZA 2EHGA 4CK2A 3PO4A 3C6UA 3HK2A 1JL2A 4HUEA 4CJRA 3DLHA 2O4IA 3OYEA 4FJXA 4ICLA 3ZSWA 4BDYA 1T8EA 1L5UA 4CJ3A 3OJUA 4FZXC 4NCBA 2Y1JA 1TK5A 3QEPA 1VSIA 3KTQA 2KQ2A 1HJRA 3HL8A 4B08A 3AVIA 2IOCA 4KTWA 1D5AA 1NK4A 3LDSA 3SUQA 1WSJA 3AVMA 5CZ2A 2WONA 4C8LA 3KJVA 1NK6A 3D0PA 1XHZA 2D0AA 4O55A 4KB0A 2G8IA 1JLFA 1TL3A 4NCAA 2OYQA 1Y97A 3I0SA 3C95A 4OKKA 1QSLA 4B3OA 3L3VA 1G15A 1UA1A 3ZSZA 2G8UA 2HVIA 1NKCA 4CJLA 1Z25A 3F73A 1RILA 4FLUA 4TSXA 3F9KA 3OS0A 4DTPA 3C6TA 3IG1A 4DTMA 1U45A 4N76A 1ZBUA 4FJIA 1CZ9A 1S1VA 3LANA 5HRNA 4CERA 3NH1A 3QERA 3RWUA 4KHSA 3VQDA 1FKPA 3ALYA 3SNNA 4EZ6A 4DMNA 1RBUA 3TWHA 2HHTA 2Z1IA 3SYZA 4KREA 4FJKA 1D9DA 3ZSXA 4FK0A 1KSPA 1RNHA 3NH0A 1VSDA 4FK4A 3PX6A 1VSLA 4C8OA 1BCMA 4E3SA 4G1QA 4YNQA 2Z1JA 4CHZA 4C8NA 1IO2A 1C0MA 4OVLA 4ZTFA 4FJ8A 4CEQA 4M45A 2VWKA 1BI4A 5CYMA 4E1MA 4XIUA 5JS1A 4BACA 2ATQA 4B9VA 4CJWA 2PYLA 4O4GA 3L2WA 1IG9A 4J2DA 1J53A 5K14A 2KZZA 3AVFA 4RW4A 1WSHA 3HXMA 3MXJA 3QINA 1KLNA 1CXUA 1B9FA 1GOCA 4LH4A 5J2MA 1X9SA 2OZMA 4KHYA 3IS9A 4CIFA 1JLBA 4Q5VA 1L3UA 4OPJA 4UQGA 1KVCA 1WSFA 2RPIA 1ASUA 1QTMA 3PUFA 5HLFA 1XC9A 2B5JA 3OVNA 4CECA 4W5QA 4FJGA 3L3UA 3V1OA 2EX3A 3P1GA 4Y1DA 1YTUA 1U48A 2HHSA 4E7HA 4BWJA 3T3FA 1SL2A 3O3FA 4LY7A 1U04A 4LH5A 4F3OA 4J2AA 3AVAA 3LP2A 3DRPA 3HVTA 3OYLA 3ZSOA 2PZSA 2GV9A 3VA0A 2RN2A 4QAGA 2JLEA 3O3GA 4YFUA 4M3TA 3QEXA 4CEZA 3RTVA 1RTDA 4LSNA 4Z4HA 4B9UA 3QEWA 1GOBA 1KCFA 3L2QA 4OKJA 3AVGA 2XY5A 1J5OA 4ELTA 4ELVA 4OLBA 1VSKA 2F8TA 3QO9A 4FJ5A 4CGJA 1BISA 3AA2A 1QS4A 1SV5A 4O5BA 3OYKA 3SJJA 2G8WA 4CIEA 1FKOA 2DFEA 5J1EA 2G8HA 3RMAA 5EU7A 3K59A 5J2NA 3HYFA 3IRXA 1LV5A 1NOYA 4E0DA 2VG7A 4PY5A 5I42A 1ASVA 3KLHA 1QHTA 3AO5A 1QE1A 2HB5A 3NFAA 4M41A 5FROA 3ZCMA 5KGWA 3RRHA 3DM2A 4IDKA 1FK9A 1NK7A 1RT4A 3I8DA 1S1UA 3AO4A 3UIQA 4I9QA 3HPHA 3DOLA 4B9TA 4KRFA 4ZHRA 4AHVA 1HRHA 2X6NA 3I0RA 4I2PA 3M8QA 1S1WA 3NGYA 3PX4A 1YTAA 1UAXA 3LZJA 1NK9A 2F8SA 3ZSYA 3FI7A 2Z1GA 3AVCA 1SKRA 4CE9A 1LWEA 3AVKA 4Z4CA 1LAVA 4E7KA 5I3UA 4OKEA 4FK2A 3TAMA 1L3TA 3MEGA 4B9SA 4FVMA 3ZT1A 1ASWA 3LPUA 3OYJA 4BE0A 3SUPA 4Z4GA 1Q9YA 5CZ1A 3O3HA 3HPOA 4PQUA 2HNZA 4CFBA 5KRSA 1RBTA 2I5JA 3HP9A 5KGXA 2Z1HA 4CF9A 2IAJA 5HROA 4FYDA 1ZBIA 4DSLA 4FW1A 4HVJA 1A5XA 3K2PA 1IKWA 1A5WA 4F8RA 4OLAA 1QSYA 3TR8A 1UOCA 1VSJA 3VQPA 2HHVA 4RG8A 4RW7A 3QETA 4DQIA 2HHQA 1TKZA 4IFYA 1TKTA 4DQRA 1XHXA 3KK3A 4DTRA 1CZBA 1JLCA 2OZSA 2E6LA 4FM2A 1RT6A 3AO2A 4KHQA 4Z4IA 4FXDA 2IS3A 3D45A 5KRTA 4AHTA 4M3WA 4CGIA 2VWJA 1TK8A 1L3VA 1T03A 3SI6A 3VQBA 1Z26A 2NUBA 3T19A 3KLEA 1ZYQA 3NF8A 3AVHA 3NBPA 1N5YA 4JLHA 2G8VA 1C1CA 4OGEA 3P83D 4CEFA 3RMBA 4FM1A 3CFOA 3BDPA 1TVRA 1X9MA 2OA8A 1J9AA 2BE2A 3L2VA 3DYAA 3AA3A 3DLGA 3O4QA 5HP1A 3ULDA 4KO0A 1L3SA 3V1RA 4Y1CA 1YT3A 1EETA 2PYJA 3K5MA 1JLAA 4NYNA 3THVA 4DFJA 2P5GA 2P1JA 3L8BA 4DFPA 4KAZA 4W5RA 4AHRA 4CF8A 4F2RA 1BL3A 3E01A 4DWIA 3PY8A 1BI4B 4W5TA 1W0HA 2RKIA 1JLEA 4DTOA 1IKXA 4CJQA 2Q3SA 3NGIA 4ID1A 4KTZA 3NH2A 1J54A 4QCLA 2QKBA 1JL1A 1S1XA 4CF2A 3KLFA 3KK2A 4DTUA 3SPYA 3LZIA 1JXBA 4CJFA 3OYBA 2X6SA 4KI4A 1FXXA 2KFZA 1RT3A 3LALA 4HCBA 2R7FA 4F3TA 1RT5A 1RT7A 4HUFA 4MFBA 2HMIA 1RTJA 4CGDA 1VK0A 1CXQA 3AVBA 3QIOA 1R0AA 3VQ9A 3DRSA 1JLGA 2ZE2A 4DS4A 1KLMA 3OYCA 4EZ9A 1S5JA 3ITHA 5FDLA 3EZ5A 5C25A 1TV6A 2FBVA 1KFSA 3QEIA 4O0IA 2A1RA 4J2BA 1O1WA 4FW2A 3SQ2A 1U49A 1BIZA 3G0ZA 3NF7A 3PO5A 4FCYA 3CQ8A 2QK9A 1NKEA 1NJZA 1WN7A 1LWCA 5FRNA 4AHUA 3OYFA 1HPZA 4CHNA 2XHBA 1U47A 1D9FA 4IFVA 2ETJA 4CFCA 3RMCA 4CJUA 4PWDA 1B92A 3V1QA 4CIGA 1DLOA 5HRSA 5FRMA 1KFDA 1VRTA 4DG1A 1X1PA 3CFPA 2HHWA 4AHSA 4F2SA 2X78A 3VQAA 4CF1A 1TAQA 4C8KA 4AHCA 4CHPA 3V81A 1SKWA 2FBYA 1CLQA 1SKSA 4KPYA 1NJWA 4HCCA 3S9HA 5T7BA 1RTIA 4DQQA 2B6AA 4DSFA 1KRPA 4B9LA 2DY4A 4M3ZA 4CJEA 4DU1A 1S6PA 1IKYA 4CJKA 2BGGA 4M3UA 2YNIA 3LP1A 1BCOA 4JRPA 4CK1A 4H4MA 3OYAA 3KKSA 1HYZA 1RTHA 2DFHA 1RDCA 4FJLA 3MECA 4DTSA 4BDZA 3OY9A 3DI6A 5SWMA 1KVBA 1ZBLA 3OYDA 2E6MA 4DFMA 4E89A 4DLEA 2XY8A 4E7JA 3VQ5A 3PX0A 3CM5A 4FLWA 3WNEA 3OYNA 4B8CA 2D0BA 1RDDA 2D0CA 3AA4A 4CGHA 3KD5E 4I2QA 4DSJA 5CY4A 1HYSA 1REVA 3TAGA 4ZTJA 2GUIA 4IG0A 3OS1A 1C0UA 3MAQA 1ZBFA 3TARA 3CYMA 1I39A 4CFDA 2R7YA 2FBTA 4HHTA 4N41A 1IKVA 2VG6A 4N47A 4BE2A 4KI6A 1NJYA 2JGUA 4DQSA 4QOZB 4FLVA 3SV3A 1TK0A 2FBXA 4W5NA 1XWLA 4FJHA 3HSTB 4CJ4A 3B6PA 2AJQA 1RCHA 3A2FA 4L8RB 3SQ0A 1Q9XA 4JS4A 5DMRA 3PV8A 1NK0A 4Q0BA 3H08A 4C8MA 4OGCA 4F4KA 4CEOA 3OS2A 3LWLA 3AVLA 3TI0A 3G10A 3WNGA 1WNSA 4IBNA 4DU4A 3DRRA 3AA5X 4B9NA 3JSMA 4CCHA 2XRIA 2HNDA 1VSFA 1VRUA
chains in the Genus database with same CATH superfamily
4B3SO 1WLJA 5AZIB 1M5IA 1SA0B 1HR0K 2O4GA 3FZKA 3SV4A 4RAIA 1UWBA 1PIV4 3CC2N 3AE2A 2WOMA 5J2PA 3MDSA 3SQ4A 2PW9A 2L35A 3SJBC 2WLIB 3HKCA 1XUQA 4JI4O 4XH4A 3ZMSA 1IBKO 3ZT2A 4EP5A 1RUE4 1R094 3OYHA 3CFRA 2G8FA 5CHIA 2YICA 4NTWA 3AY9A 1NJXA 3CMAV 2IH1C 2WLHA 4DUYO 3C6AA 1VP7A 2VWBA 4DSIA 3LSSA 2O8BA 3AG3C 3LWMA 1BIUA 4LFAK 3ASNC 1VF6C 4TUYA 2MK3A 3VQWA 5L3BA 4DR4O 2UXDB 3A5LC 3ZEUB 5E41A 3K5NA 3C94A 1EX4A 4H5VA 4JV5K 3CC7N 3ZT3A 4FJ9A 1RDAA 4ISFA 3R66A 3ZS8C 2FC0A 1FW6A 1MU2A 1MG1A 2UUBB 2HNYA 5JS2A 2R074 2AGAA 3U3GA 3FFQA 4DSEA 2KZMA 4NVPA 3HJFA 2WU5A 1R3IC 3HKEA 1PNKA 2WQYA 1YTFD 1DTQA 2LSNA 4DV2B 3BZKA 4M3YA 1N6QA 2O8EA 3SYCA 3U11A 4CK3A 3G4SN 5J9PC 1K34A 3ATVA 5ADXA 5BREA 1FXKB 4LF8K 3HOTA 1FXVA 4DR7K 3F5WC 3SJQC 5BXZA 1NJIO 2F9WA 3R8EA 4NXNO 1WSIA 4X64O 5ELZA 1RP3B 4JI7B 1W9HA 4BR5A 1K9MO 1VSHA 1UFIA 3AARA 3Q7BA 3JD2A 4WFAL 4J2EA 3A5OC 1H8EG 2LP7A 3TTCA 4DLGA 2QWOA 2UXNA 1OCRB 2GTAA 1JPXA 4GZRB 1Q18A 1RGIA 1YXQA 1RMU4 1JLQA 4TV8B 4IG3A 4BRMA 3CIRA 4Z0UA 4OPKA 1EO1A 3VN5A 4MVOA 1ZUQA 1FJGO 1BHLA 2NRWA 4GV3A 2ITMA 3GB7C 5IJ0A 1H2MA 1OCZB 1NJIW 3O4WA 4MLHA 3TAFA 1M93A 3D7EO 2FF3B 3ZSVA 3AEEA 3RVCA 3VQ4A 4JN4A 3OMAB 3QB0A 4ZBMA 3B2EE 4R50A 4YHHB 4K8ZA 2ZD1A 2FB5A 3ATUA 1BUPA 3ZX3A 2ZNJA 1E3MA 1AL24 2FMLA 2Q73A 4ZHQB 3DOKA 1IXMA 4K25A 5C2FA 1WAJA 3VQEA 2ZR3A 5KAIZ 2JK5C 4H0LB 1PP9H 4IZ9A 4OJRA 4JYYA 2W42A 4I5SA 1BL8A 4JI0O 4PELA 4BWMA 3FLCO 5AQOA 5AQVA 4M42A 1GLDG 1QHAA 2OWOA 4DV1B 4PA1A 3J80O 4D7TA 3AEGA 1K6YA 1SAZA 3RMDA 2Q7EA 4ELUA 3VQ8A 5KQ8A 4JI2K 3JS6A 3CJAA 2YDEA 3CP1A 1QQMA 2HF4A 3WB1A 3ISNC 2IDOA 3V9XA 4DW0A 2QJ1A 3U10A 2E5LK 3P4QA 1VQLN 4B3SK 1AP5A 1NR1A 3L9DA 3ZX2A 4A5BA 4DR2O 3RYIA 3LPTA 2Q5ZA 2NRVA 3WEEB 1FS0G 2ASPA 2P9SB 1N32O 4JI4K 5GAEP 3BF3A 4QJFB 1IBKK 1Q8IA 1VQ8V 3ZYYX 4LC1A 4ILHA 1ATSA 4EP4A 1XMQO 2YNGA 5CYQA 2IJIA 3TAQA 2D4WA 4PKGA 2DTUA 2WAMA 5EY4A 4DUYK 1Z5WA 5BR8O 1YITV 2P51A 4A62A 1TAUA 2WA4A 3QO8A 4LFCO 2A1SA 4FOIA 2O8FA 3H1QA 4CHYA 1M57B 2YIBA 4GLXA 4RWUA 4IOXA 2HHXA 1BGXT 4O8UA 1DGSA 2ZE8A 3ZJZA 4CJPA 1ZBHA 3DGEA 2P9IA 3NF9A 4JS5A 1NKDA 4DSKA 1N36O 4WF9V 3LAKA 3FKSG 4DV6O 1RDUA 1I94B 2QWPA 3NAEA 2IU3A 1BQNA 1URFA 3ABLC 3P38A 4EIAA 4LWSB 1SL1A 2Q36A 3C3TA 1BDGA 4JYAB 1ZLZA 3FZHA 1QR9A 3CS5A 5CA0B 4X65B 1WB9A 4CS2A 5DECA 2OIGA 3K06A 1MSDA 4H44B 4RQEA 2YNHA 3KKRA 2DFFA 4CEAA 2KFNA 4JGSA 1KAYA 2FKXA 3OFNG 5M1OA 1VQON 4Q4V4 2WS3A 3I56V 4IKFA 3P4SA 2H3OA 3AG4C 4GKJK 1XMOB 1S3JA 3ML0A 3RYFB 1R6NA 5D5PA 4X64K 3AGKA 4H4OA 3K5OA 2P9UB 2EILB 1EP4A 4JAAA 2R70A 4DQPA 1L0VA 2EHGA 4UCVA 3PO4A 2ZIMA 5LP6A 5B3SB 4JI3O 4HUEA 4PI0A 2WTUA 1T8EA 4LF9O 4IIJA 4KP4A 4IGGA 3H1JH 1FJGK 3SMPA 5FNVB 3ENOA 4YY3B 5GIPA 3QEPA 5LA6B 5EYPA 3L75H 4X1KA 3HL8A 4PDWD 5CA1B 1SQBH 2IOCA 3CJCA 1B3QA 1D5AA 5MLCQ 5CZ2A 3Q4HB 3E8BA 3N2KA 3KJVA 3BUZB 4FWQA 2G8IA 4CS4A 4YSYA 4PDVA 4MVMA 1FD9A 1Y97A 5AQNA 1OCCC 2KB1A 4DR6B 1QSLA 1F51A 4LR3A 5D5QA 1UA1A 4J7KA 1Z25A 5JH7A 3L4IA 1UPGA 4CW7B 1P90A 3JBG4 1U45A 2K9PA 4JHDA 1CZ9A 1KXPA 3BAAA 4EEQA 2R064 3OMNB 3F9MA 3NH1A 5GTHZ 3TWHA 5IWAK 5IDJA 4JNEA 1J5EB 2HMPA 4DR2K 4KREA 1D9DA 5LL6Z 3K0GA 2DWEC 4BR6A 1Q82O 3NH0A 1N32K 3WFVA 3PX6A 1JOYA 1VARA 4EHTA 1HRV4 5CBFA 4E3SA 1O9GA 4G1QA 4DR4B 1OH6A 2QEXN 2YS8A 3JD1A 1LCUA 3APQA 3GE1A 3SJHA 4RWTA 1N33O 4ZTFA 1R3KC 5JS1A 2RS54 1NH2D 2P22C 4BACA 4NB5A 4LFCK 2F43G 3GDQA 4CJWA 2KZZA 4H13B 4J2DA 5K14A 2RNBA 2QWRB 5JJNB 3OA9A 2E1YA 1FXKC 4DUZO 4LBEC 1WSHA 4TV9A 3MXJA 4BC2A 2CH5A 5LJVA 3IS9A 2Q7HA 1KECA 4UQGA 1WSFA 1N36K 3ZETB 3ETGA 5KUMA 3OTOB 3DAWA 4CZFA 1OCRC 2QW9A 5CMUA 2B5JA 4CECA 2YC0A 5JLFA 2UUCO 1OH8A 3V1OA 2EX3A 3P1GA 1YTUA 1ASJ4 2P9PB 2V7YA 4E7HA 4R6ZA 2QM4A 3OAAG 1ZL8A 4PA6A 4LY7A 4QE7A 1Q7YO 2KKZA 4J2AA 1LOTB 3HVTA 4QE9A 3H3OB 3LP2A 4H5TA 4U3JA 3JARA 4MVUA 2PZSA 3C6HA 4ZOLA 3E83A 4QAGA 5IY5B 3KHYA 2LW1A 3BPZA 4Q20A 2JLEA 2ZF5O 4JKHA 3SUCA 1RM1B 2RJZA 2IM9A 4DV4B 5ADXH 4B9UA 4K0KB 4OKJA 5C15A 4OLBA 4ELTA 4BW9A 1VSKA 3QO9A 4JYCA 4MDAA 4RQFA 4O5BA 1ZBSA 4OPHA 4CIEA 3QO7A 4JI3K 1BT8A 2G8HA 5EU7A 4ASUG 3FGUA 3HYFA 1W7AA 3J7ZO 2VG7A 3WQTA 1MOFA 1ASVA 1HPMA 2ZGYA 3CQYA 1VQ6V 1TUBA 2QKAA 1VBC4 4DW1A 1KP2A 3RRHA 3E89A 4KBOA 1Y6XA 4QPKA 4M41A 3HKCB 2UXXA 3WU2Z 3CCEV 4JI0B 5JWPA 1S1UA 1NWKA 1YF5L 3HPHA 1VAZA 1V55B 1NGDA 4DV7O 4B9TA 1VQ9V 4KRFA 1HRHA 2RM24 5CB4B 3GWOA 2PAVA 1MWMA 2ODMA 1YTAA 1ESVA 3H9VA 5EC1C 3ZSYA 2Z1GA 1L8DA 1KKDA 1LAVA 1NTZH 1KYOF 1CPYA 1M57C 1L3TA 1TUYA 1GK9A 2ZGZA 1ZAUA 3ZHVA 3AE6A 3HPOA 2WU2A 3OR7C 3EFFK 3O9TA 4CFBA 5KRSA 5LJWA 3CMAN 3J81N 3HP9A 1WBBA 2Z1HA 1ROPA 1DT9A 5HROA 4FYDA 3VEOA 3HB3B 5FLXN 4G2KA 3G6EV 1XMQB 1A5XA 3SFDA 3UT5B 1QSYA 1H38A 3PJSK 2HHVA 4YJ3B 1YVNA 4DQIA 2ADPA 1E4GT 1TKZA 5CR4A 4DQRA 1BS3A 4B7EA 4EFBA 1AROP 3CXCU 4C23A 3MN9A 4KHQA 2O8EB 2CDYA 4FO0A 4UY8O 3RYHA 4CGIA 5FL7G 1L3VA 4DR5O 3SI6A 4OPAA 1YI2N 1HRI4 1NU1H 5C2TA 3NBPA 1SS3A 4DV6B 4JLHA 4OGEA 4EFHA 4DUZK 3RMBA 3BDPA 4OX9O 4O5FA 1RFYA 2CGLA 3AA3A 5BRHA 1SA0A 2EILC 3M7MX 1GM8A 2QWOB 2A9HA 3H1VX 5HP1A 3SYOA 2WLJA 1YT3A 1LUWA 5B3SC 2UXBB 3L8BA 3O1BA 1N0JA 4W5RA 2QI2A 3VR8A 2UUCK 1CP9A 4F2RA 1BEV4 3PY8A 4DTOA 3G6BA 2KG7B 1S72V 4FPBA 4CJQA 3RSEB 2Q3SA 3CC4V 1OOPD 1KD1O 2X6BA 2HHHO 4J7JA 3VEVA 3SPYA 1JXBA 4AQYO 2X6SA 4KI4A 1FXXA 3AAPA 3LALA 3FB7C 2R7FA 4BRIA 4F3TA 2MW2B 1RT7A 3FD9A 1XUPO 3SPGA 2RN9A 1R0AA 2JDIG 3DRSA 2ZE2A 4JASA 1G6UA 1OV9A 2V1DA 4MW8A 3EZ5A 1TV6A 2FBVA 3QBWA 4O0IA 4UFZA 3QEIA 1SQPH 4U3FH 2CTPA 3U8XA 1MZEA 4DV3O 4LP8A 4LF4O 1Q43A 2Q67A 3RYIB 2Q68A 4JYBA 5JVDB 3OYFA 2IW5A 2XHBA 1D4M4 3EE8A 1H2KA 4IFVA 4CFCA 4YTPA 4DV7K 1AR94 3R6MA 3CQXA 3V1QA 2WUSA 4CIGA 4CZKA 1O13A 3AE3A 1VRTA 3CFPA 1WB8A 2UXCB 2DN9A 3ZX6A 4JPRA 3KK7A 3CPWU 4XBFA 2X78A 2N05A 2ZNIA 3VQAA 1TAQA 2JVDA 4CF1A 1AP6A 3RWRD 4I6MA 3V81A 4TV8A 3RVZA 1VQ8N 3CCUV 4KPYA 4E1JA 2P9IB 5EIBC 2ZXWB 3B40A 4UVAA 1KRPA 4CJEA 2HBMA 1YITN 3LP1A 2HR3A 4CK1A 3MCPA 4H4MA 1HYZA 4GV9A 2O8DA 1N33B 5CE3A 2CUGA 2ZCEA 4DTSA 3VOUA 4ZHQA 1AILA 2E6MA 4E89A 4NR1A 1T6CA 2JWLA 4MO4A 4BR4A 2RMKB 3UKUA 2Q1NA 5JICA 3J8F4 4B8CA 2D0BA 1W97L 2D0CA 3FYEB 4HBNA 5J2TA 2YHXA 4CGHA 4QPJA 1BMFG 5IY5C 1GN3A 3E1YA 2XNDG 4RUEA 4C1NK 5BPNA 1NBMG 1RM1C 3AK1A 3LDCA 3N27A 5KHJA 4TWKA 1K5MD 3VRBA 2UXDO 3UKRA 5KPZA 1GLLO 1I39A 2W6JG 3AG1B 5GONA 1FYJA 1X3NA 2Q0UA 4KI6A 1Z7S4 3WB0A 5IYZB 3TETA 3VMFB 4QGPA 3T2MA 2P9SA 3I56N 3KKYA 4Z94A 3FYIB 4IIJB 1NENA 1SC5B 4J42A 3DC5A 1Q90D 4NXMO 1SKVA 2UUBO 1COV4 3PV8A 4BVPA 1NK0A 5L3FA 1MSWD 4CEOA 1WNSA 3VQYA 4B3MO 2F1MA 2HNDA 4B7KA 1YHQV 1V55C 2Q9LA 1OH7A 1Z5VA 1KB9F 4DV2O 3VF2A 1KVAA 4GCZA 3S3OA 4EZ6A 1LW2A 3VENA 4Q6GA 4XEIA 1L0NH 2EBOA 3AO3A 4BE1A 4YXWG 4CD3A 2CGJA 2O57A 4GMJB 5TKWA 3AV9A 1D8YA 4JI7O 3ZMUA 3HI0A 4JHDB 3WQUA 4HUGA 1OH5A 1SQGA 3KWIA 3NCIA 1OVQA 4Z1MG 1GLCG 4PJ0Z 1VSMA 4LNUB 3JYTA 1CEZA 5HFMA 4R5PA 2IJHA 2GUZA 2ZE5A 4DK0A 1RT2A 3FX7A 4BRCA 1ITGA 4CBUA 1ZC6A 2JWKA 2GWJA 4MDBA 4H0PA 1FKAO 5HRPA 2F9TA 1EKEA 4H5WA 3VOVA 4N21A 4DTXA 4YHHO 3RYFA 2QKKA 4M7XA 4FLTA 2P9UA 2YNFA 2R9AA 5CA3A 3QIPA 4C1NI 1NS1A 3KD1E 3NVKA 5M1KA 2A0LA 3NE6A 4TV9B 1VBE4 5KTQA 3PSIA 1S0VA 1XL6A 4DV1O 4DR1B 3JASA 3JD3A 4IEEA 1FXHA 2X7RB 4KH6A 2IGIA 5BN9A 3NDKA 4DTNA 4I50B 4FJMA 5EOYA 1VBA4 3N2GB 3RSEA 1JA8A 1EM1A 3OBYA 4N5SA 1BHBA 2PY5A 1N4CA 3JAMN 3H6EA 2PFUA 1C1AA 2YHAA 2AHYA 3Q4HA 1OHHG 3CRQA 4BIUA 4PA3A 2RF2A 3H45C 3K0SA 1X9WA 3LAMA 2Q69A 1HNVA 1VMGA 1ZL8B 2Y4UA 1HQEA 4FPAA 3V9ZA 2AHZA 2X0LA 3CCMN 1AR5A 3TTFA 4CGFA 1GOAA 3B77A 4ZOLB 4Q4W4 4OX9B 2W6KA 4BGBA 3AO1A 1GMGA 1A5VA 3TSUA 3NMUA 1VQ7V 4IJAA 2UXDK 4KHPB 4CH5A 1BO5O 3MN7A 3AG2B 5KHHA 3AVJA 3CJ1A 3CYOA 2DYRC 4GVMA 1THZA 3WNHA 3CXCM 4DV5B 3M8SA 1HNIA 3O4NA 4WCEL 4CJVA 1GRJA 3DLRA 3QESA 3L2UA 2GDSA 4KL1A 1I94O 4NB4A 1TUBB 1M4UA 4W5OA 3CEIA 1AR1B 2R9RB 1KMIZ 5M1QA 5LGUA 2YKNA 2UUBK 2YKMA 3QNNA 4PA4A 4B8AB 3EE9A 1K4CC 1KKCA 4JYAO 4JZGA 2YEVB 5B1BB 3UO3A 1IURA 4X65O 4X66O 2P9KA 1WA8B 1XNRB 3T4DA 2QWRA 1YDXA 4FJ7A 2YXLA 4X89A 1HYVA 4RTFD 4DV2K 3LL3A 1RBSA 3S3WA 1VQ6N 5AQYA 1T44A 3MWTA 3JAKB 4KHWA 2Q4PA 4MS2A 4BG8A 2BCCH 3A5MC 5JVHL 1PNMA 4LF5B 4FZYA 2P4KA 4LF4B 4JI7K 2YV0X 3RN4A 1C6VA 1VQ5V 4O44A 3NHGA 1VQ9N 4DO2A 2JGDB 2ZXWC 1NCQD 5EBWC 4QIWF 4AH9A 3SAHA 2P9PA 3AECA 4FJJA 2QXFA 4UCRA 4UB6Z 5KHIA 1YSCA 3WXKA 4CJ5A 4CH3A 4MT8A 1S3XA 4DHYA 5D3GA 4YY3O 2HBJA 1BQMA 2QWQA 3MX2A 3VQ6A 4CFAA 5A2QN 4CGDA 3V4IA 1PPJH 5IJ9A 1YJ9V 3ABMB 1RFQA 3O08A 4CESA 3LSQA 3ICXA 4PD4F 1KTQA 2VG5A 4CZMA 4LFBK 4YHHK 1VBB4 2NRHA 5AQIA 1F4MA 1SQFA 4FM0A 1W0KG 3RYHB 3VQXA 1ZTEA 4JI6B 1NMDA 1P8ZA 3RR7A 3G6EN 2JS3A 1O9HA 1TGOA 2BTQB 4A5UB 5LXTB 2E20A 3IDHA 3KLIA 4PDLA 4DS5A 2WWWA 3MHHC 1RDBA 1PL4A 5AFUH 4MTXA 3OBWA 4IXCA 1JCGA 4DV1K 2XAQA 1IH7A 3O8MA 4E19A 4U7NA 1BE3H 4YT0A 3EEQA 4GYCB 3AG1C 4B9MA 5LP6C 2ILMA 2IVNA 3VESA 3MCAB 3WT0A 3M6GA 3CRAA 3U6FA 4BRNA 1NOZA 3E8HA 5AQWA 4B1UB 3SCXA 3CPWM 3R3LA 4B3TK 3NXSA 2E3CA 1J5EO 1WAFA 4CEEA 5CB4A 1WSGA 3S3MA 3DJCA 4H8KA 3E9LA 3UB5A 3B09A 3K04A 2HKOA 4CJRA 2ETNA 3OYEA 1GTOA 2P7TC 3K08A 3CIPA 3S41A 4ICLA 1X3MA 4BDYA 3L74H 2XUMA 3OJUA 5H2FZ 3AE7A 4NCBA 2Y1JA 3FAVA 3UO2A 3FFKB 4PA7A 3KTQA 3HPLC 3F2KA 3DXMB 4DB3A 1S72N 2WA3A 3SYQA 3G71V 3CC4N 1NGAA 5KA6A 1A32A 4NXMB 4LH7A 3U4LA 3VF6A 4G28B 3UT5A 3SUQA 4BRGA 4JI8O 1VQMV 4C8LA 3W7UA 4YJ3A 1XHZA 5K1PA 2D0AA 4O55A 1RVF4 3OTOO 4IOCL 4UV8A 1I94K 3CXHF 4ABMA 3B8MA 4OKKA 4UB8Z 4B3MB 1M90O 4DK1A 1V4SA 3LDNA 5AQPA 2HJDA 4CJLA 3F73A 1RILA 4JYAK 3OS0A 2E8AA 3F9KA 3C6TA 3PN1A 4N76A 4X65K 1ZBUA 1HNXB 4FJIA 3EKSA 1Z2GA 3LANA 3IJ4A 4ZKIA 4KHSA 5L3CA 3L72H 4YJ2A 2GWKA 3ABVA 3A0HZ 2Z1IA 3SYZA 3IGAC 4CC6A 5I9EB 3ZSXA 3ZMVA 1KSPA 2F66C 4DV4O 1RNHA 4I6MB 1KP3A 1VSDA 1XMOK 2PLV4 1ATNA 4K0KO 2J4RA 4C8OA 3K03A 1WP8A 2IVPA 4IJNA 5AQGA 4YNQA 4CHZA 3O65A 3OTFA 2BE3A 4FIPC 4UV9A 4M45A 2VWKA 1K9MW 2ATQA 4B9VA 2KG7A 3BRCA 3P3NA 2O8DB 3AVFA 1YTFB 2VGNA 4RW4A 4YY3K 5IYDO 3KCXA 3QINA 1WOQA 1GOCA 5J2MA 3CCQV 3CCUN 4ICGA 3SAFA 3ASOB 4Q5VA 4OPJA 3CCVV 3ZHRA 2RPIA 3UKUB 4MLEA 4IEIA 5AQFA 5J2TB 4AI8A 4DR6K 4FJGA 3L3UA 1XILA 4L8JA 3UKRB 4DRXA 1PKXA 4BWJA 4JZ2A 2QWLA 3T3FA 5GONB 1IXBA 4LH5A 2OT5A 5B1NA 3WG7B 2GV9A 2PGGA 2YJEA 2RN2A 2DYSB 5JVDA 5CN0A 3IKMA 3UCSC 1ZSPA 1G99A 1RTDA 5AQTA 4YOVA 3R65A 2XY5A 3L2QA 1ENVA 1SERA 4ELVA 4CGJA 2AW9A 1SV5A 3P39A 5J1EA 4DR4K 1MDUB 3QFPA 1JR9A 2M6YA 2RMU4 1B06A 5EVZA 1IBMB 1NOYA 3ZCCA 5I42A 2P9NA 1M1KO 1QHTA 5C8YA 1AR84 1XQ8A 4GUNA 5IT9N 3TSQA 2WDRA 4BRHA 2OTJV 2ADQB 4I9QA 3OM3B 5BRFA 3X2QB 3J81O 3K9JA 4ZHRA 2ZE6A 1KFYA 1YHQN 4PKIA 4QS7A 2OANA 4X66B 4I2PA 1V54C 2HVKC 3NGYA 3CRMA 5FLXO 4CJ7A 3PX4A 2UXBO 1UAXA 3LZJA 5JMVA 1SF9A 2GUZB 3RVYA 1LWEA 4H03B 4CE9A 4Z4CA 5KPRA 1NVPB 3ZRWB 5M1NA 1XC3A 4B9SA 4TQFA 1ASWA 3A0RA 2RCVA 4X1YA 3CETA 5CZ1A 1I08A 3O3HA 2HNZA 4NXNK 3FE1A 1RBTA 2CGKA 1TUUA 3K79A 1DK1A 1HNWB 3ZRVA 2DQ0A 4DSLA 3K2PA 3E2EA 1T3VA 4DV4K 1VSJA 4CBXA 5AQKA 3T1CA 5IYZA 3EKUA 3MWPA 4RW7A 4U67L 4K0KK 1TKTA 1XHXA 1VEWA 3JASB 4I0XA 4O2BA 2P06A 2WFBA 1EWRA 3CHWA 3THWA 4Z4IA 1EBOA 5B5EZ 1PO14 2IS3A 2E75B 4M3WA 3GWKC 1T03A 1R3JC 3ENBA 3VQBA 1JCFA 3T19A 3AAQA 1YXBA 3FB5C 3AVHA 1ZYQA 4KHUA 4FVUA 4R7CA 4UCTA 4H0OA 5BPMA 4FM1A 4MVRA 3CFOA 4HTLA 2ZJRL 3ZHQA 3OHRA 1X9MA 2BE2A 5BZBA 4FWMA 3L2VA 3ZHUA 3O4QA 1RSOB 4F6EA 4JI0K 2B9ZA 4KO0A 1L3SA 3F7YC 1EN5A 4Y1CA 3HKBB 3K5MA 1JLAA 4NYNA 1AJQA 2F95B 4DFJA 3BY6A 4DFPA 1OCOB 2UXCO 3VTIA 1BL3A 3CMEV 3E01A 4W5TA 1W0HA 2RKIA 2QGNA 1L0LH 1JFFA 1C0GA 3VGMA 4LNUA 5DM7L 4CBWA 2ARHA 3I5DA 2QA4V 4QCLA 1XREA 2FSJA 1JL1A 1S1XA 2QKBA 3KK2A 4DTUA 2RHKA 4GB34 1SQKA 3LZIA 4CJFA 5A9GA 4JI2B 2KFZA 1MMMA 3J7AU 4HCBA 2F7TA 3THXB 1RT5A 1I5XA 1XMQK 4P30A 1VQ7N 4HUFA 3ETEA 2HMIA 1RTJA 5EIBD 1VK0A 4UCOA 4TQDA 3AVBA 3AK2A 4WCEV 3GL1A 3H1LH 1JLGA 3PSFA 3IC7A 4JKEA 3VQ9A 2P9KB 5FDLA 4PHZA 5C25A 1KFSA 4HNAB 5KA5A 1NQTA 5F1XA 5KQDA 1Y74A 2V4DA 1Q82W 2P4VA 3G0ZA 4HWIA 4JI8B 3G80A 3CJHB 2DMXA 4RCHA 1LWCA 1K8AO 4DV6K 1M9NA 4I50A 2ZR2A 4CHNA 2Q0OC 3N2GA 1D9FA 1IV0A 2Y0PA 2ETJA 2W41A 4FWLA 3K9AA 5KPTA 3VTHA 1KU9A 3UM7A 1KFDA 5HRSA 5FRMA 4DG1A 4DKWA 3OEHG 5E26A 1SZTA 1X1PA 1POV0 2HHWA 2JJ2G 2GTDA 4IOAL 1OCZC 2YXYA 1GLJO 2UUAO 2CK3G 1IJJA 3JAWA 3GG4A 5FPEA 4CHPA 1YVWA 2QWQB 1SKWA 4KX6A 1K8AW 5IJ9B 5M1FA 1T6DA 4QS8A 1GM7A 1VQ5N 3FZLA 3M1FA 3KVGA 4DQQA 4BR0A 1YJWV 2P90A 4M3ZA 2Q0AA 4W4LA 4H5RA 1IKYA 4X8AA 1P7BA 5EZYB 1TAEA 4M3UA 1BCOA 2E2PA 4CBCA 1AI5A 3EL2A 2YI8A 1Q7YW 4JK7A 4MO5A 2QWNB 2BSKA 4LF9K 1YJ9N 1K8KB 1WLEA 3IFXA 1NNEA 4DV0O 3O9OA 5LHGA 3CJ7A 1HUXA 2LJ2A 1K4DC 3OYNA 4FWPA 3VERA 3WG7C 2YEVA 4X20A 2DYSC 1N0NA 4DSJA 3TAGA 1WA8A 4ZTJA 4MVQA 3ZLJA 3SAGA 4YOTA 1B6QA 2ZE7A 4DQ8A 3SPHA 3TARA 4JKCA 5GAHP 3ABTA 4FK0A 4HHTA 2WDVA 3QICA 1IKVA 4WQ5C 3ETQA 1QQNA 3JAKA 2UU9B 2JGUA 4QOZB 1BZKA 4FLVA 4W5NA 4FJHA 1T5EA 4H5NA 4CJ4A 3B6PA 2JIZG 3HOSA 1VBD4 2UXCK 3FAVB 3LDOA 1KF6A 3OEEG 3EO3A 2JGDA 4Q0BA 2VQEO 2D1KA 4BC5A 2KSDA 3ZN0A 2XTAA 4J10A 1SESA 4OGCA 2YCHA 2BH1A 1VHXA 4DR1O 3WNGA 1K73O 3C65A 3DRRA 2AP1A 3AA5X 3FZMA 4B9NA 1H2LA 1BG3A 1VSFA 3GBTA 1VRUA 3X2QC 3KK1A 3K57A 2N04A 2F96A 4NKGB 4GKKB 3ULEA 2WP9A 1P84F 2D5RA 1R73A 1BSMA 2A41A 4KKOA 4X1IB 4A5AA 3MEEA 1NGCA 1N33K 1LWFA 2Q8VA 3VQQA 3G71N 3GQHA 1P49A 3DC6A 3HO1A 4A61A 1VQ4V 3HBTA 1NK5A 5FPNA 1TYQA 5LXTA 2BTQA 4FJCC 1JXEA 1SUQA 1VQMN 1M56B 3QMLA 4K43A 3QG5A 2NRRA 3LP0A 3SQ1A 3CWBH 4YJ2B 3MXIA 4N56A 2Y4TA 3LDEA 1F4NA 4BRKA 1HNZO 2A3ZA 1BHAA 3QLHA 2A6AA 3CHXA 2DE0X 3KWGA 3MMVA 1NKBA 1SRYA 3OYMA 4FOEA 4DXWA 1Q6UA 5K1XA 3DXRB 4R8CA 1LW0A 5GTIZ 5AZJA 4CEBA 1HKBA 4KHPO 3K9SA 3AE1A 3HRGA 1DGKN 2BANA 4WFAV 2Q31A 4LSLA 4HTUA 2EINB 2WSSG 1DTOA 3OJSA 4DV5O 4X62B 4ILGB 3FB8C 4CEDA 3M8RA 4NYFA 5AQHA 2B4JA 3HKDB 4O4JA 1K3EA 1YF2A 4M63C 3SUNA 3D3QA 1NEKA 3TXQA 4Q4Y4 3I55V 2VQFO 2PUSA 4CZHA 3SPJA 3V9SA 1AR74 4O0JA 3B4SA 3H46O 4KV8A 4BROA 4DTJA 4MTFA 1XNRO 4GX1A 4IL6Z 3W7SA 3DXMA 2HSTA 5GAGP 3ZT4A 4AM6A 4WYBA 3VGKA 1TUEB 2KQXA 1OCOC 1KD1W 3TAPA 3V9WA 1VRH4 1IG8A 4DRXB 3CCQN 4JAVA 4LF5O 3HPGA 2G8KA 1ILYA 3O6WA 3CCVN 4YORA 4H33A 2N74A 4ZI7B 2QXLA 4RW6A 3SMSA 3KCYA 4LF7O 4CJSA 4PI2A 4LF6B 2X74A 2B76A 1HKGA 2YIBD 1S5LZ 1ZOYA 5C24A 2ZDIC 2XO7A 5C10A 3ASMA 3BZCA 4CGGA 2UYTA 1UA0A 1U4BA 4K41A 2ACZA 3HT3A 2E4LA 1SQQH 4XDKA 5L3EA 5AFUA 4KHNA 3KLGA 2ASOA 2ZQMA 1G4YB 1WPXA 3ABKB 4PHTX 3U3YA 2FF6A 2P9NB 3ZX0A 5C8YB 4JI6O 3SJAC 2JS5A 1Y67A 1HQUA 1WPBA 2NRZA 3DXKA 3FB6C 5GW7A 1Q81O 4RUFA 4I7FA 2HG5C 4LCUC 3TJTA 4DR1K 2EWSA 4EB6A 4PL8A 4BG9A 4WFFA 3QNOA 1FPOA 1TL1A 3K5LA 3VBBA 3SYPA 4ID5A 4M3RA 1KBHA 3CD6V 4WQ4A 1YJNV 4FFBA 2NRXA 3E22B 5A2QO 4H0VB 4WE1A 4WFNL 1GM9A 2EJ7A 3MD0A 3NF6A 2OTJN 3SDLA 1OJHA 4DR5K 1VQKV 4X1YB 2OPSA 4FLXA 1ORQC 3AVNA 5KLVH 4H37A 2HOEA 1K97A 4E1NA 1F21A 3QDKA 3VA3A 1BQ0A 4OX9K 2E2NA 4BREA 1S9EA 4CC5A 1T7PA 1QSSA 2HEPA 2NR5A 2E74B 3D2EB 5AJ3K 3TGUH 2YHBA 2XASA 3KG2A 4YIPA 4YDUC 2XY7A 4Z4FA 3CX5F 4J9ZB 4O4LB 1B9DA 3IMXA 2UUAB 4GW6A 4I0XB 4JD2A 3AK3A 4O2BB 4JI5B 4FZZA 3SFEA 4KHPK 1S6QA 1XNQB 3O80A 3DTUB 5HFLA 3THWB 5L3DA 3OYIA 1SL0A 4J11A 1C1BA 1OVYA 3CF5L 1YVUA 3HP6A 5KHKA 4DV5K 1XBLA 4UXNA 3ZSRA 4BQLA 5JVGL 4WQ5A 3TTDA 5BMVA 3MXMA 2QSAA 1U2VB 3O9RA 1I3AA 2OIEA 3QO5A 3CCRV 4AILC 1GLEG 3FZFA 4CJTA 2HHHK 5SZTA 3IC9A 4YXDA 4AQYK 3CG7A 5J2QA 3L2RA 5IYBO 1K7DA 3CRRA 4JRQA 5LGNA 1LNQA 4GX2A 3OYGA 4YTMA 1HNXO 2IJKA 3IAYA 1XNRK 4JI1B 4MQ3A 3KIOA 2RQ6A 3SPIA 4L3QA 1VSEA 3VF4A 4DV0B 3M8PA 1JMKC 4XH1A 3VETA 4E7LA 2KTQA 2LO1A 5M1PA 3AG3B 3G67A 4DV3K 1RUC4 1NTMH 1JFFB 2P67A 4LF5K 4O4IB 4JTAB 4JKDA 3EYZA 4CK2A 5JQGA 4LF4K 2A3QA 5E1AC 1L3UA 3D36C 2VS0A 2Z3YA 3ZRWA 3L70H 1L5UA 1U96A 4CJ3A 3RT3C 2ATKC 2JEUA 4FZXC 2V52B 5LMUO 3CMEN 4GX5A 4MTGA 3IUCA 2KQ2A 1QU7A 3H1IH 4B08A 4HZ3A 3APOA 3P30A 5AR0A 1AI6A 4I9WA 1NK4A 2QA4N 1WSJA 4WFGA 3AVMA 2H88A 1OZ0A 1G8MA 2VQEB 3W7TA 1NLVA 1Y74B 4KB0A 2H89A 4NCAA 1IVSA 2Q6AA 1M56C 1F7YA 3C95A 1GN6A 1HJOA 3L3VA 2PF4E 2QTDA 3M99B 3W3DA 3ZSZA 1NKCA 2G8UA 3K3WA 4KH4A 4TSXA 4UVCA 3G25A 1KAXA 4J41A 3O9SA 1HDJA 1S1VA 1E79G 4CERA 3MK6A 3VQDA 1FKPA 1NGFA 3ALYA 4OO1J 3DLLL 1R084 1GLBG 1RBUA 2E2QA 2EINC 4DMNA 2A7WA 1ZP0A 2HHTA 1RSOA 4FJKA 3JAWB 1NMNA 1FFTB 1HW7A 2YXHA 4BQZA 3HKBA 5L3GA 1VSLA 1S5HC 1HNZB 2V7QG 4U7OA 2F4VB 2Z1JA 4C8NA 1IO2A 3WB2A 3OR6C 1QLNA 4E1MA 3A0IX 4XIUA 2YIDA 3ZBHA 3WXIA 2PYLA 4O4GA 3L2WA 1IBMO 1J53A 4PL7A 1AI4A 5C0YA 1NGJA 4OGQB 3HXMA 1I5YA 2BSKB 1CXUA 3GOIA 4BRLA 4P9PA 4FWSA 2OZMA 5AQQA 4CIFA 4GT1A 2ZDIA 3ZHTA 2ZT9B 4AM7A 2OCCB 3E9PA 3BCCH 1KVCA 1YJWN 4LFAO 4B3RB 3TU5A 5DN6G 3P4RA 5LMNB 4NXMK 4BRPA 4BRFA 2D0OA 1E4FT 4FSVA 3P32A 3THXA 2IIRA 4X20B 4BRDA 2VQFB 5GIOA 2NLJC 4JV5O 5HLFA 1XC9A 2QEXV 4WFBL 1N8RO 4B3MK 3E8FA 2OTLV 4HNAA 2YIAA 1S77D 3VEYA 5H1SQ 1U48A 1EWQA 1SL2A 3QVNA 3CPEA 1U04A 3FR0A 2K1EA 3AVAA 5AQRA 1HNXK 3RW0A 2FYUH 2W0XA 3CJHA 3VA0A 2DPNA 3TPQA 3O3GA 1VQPV 3CCEN 3E9OA 3A8YA 4M3TA 2FSKA 1S76D 5IT9O 1HNWO 2RS34 4BRAA 3ABKC 1NGIA 4LSNA 5AQUA 4Z4HA 1GOBA 1KCFA 3QEWA 1J5OA 3AVGA 4LF7B 1ZX3A 2F8TA 1H8HG 4FJ5A 2A40A 2G8WA 1BISA 3JYCA 3SJJA 4WBNB 1FKOA 1TA8A 2DFEA 5J2NA 3K59A 4GVEA 3IRXA 4PY5A 1MQTD 5H5NA 3KLHA 3ULEB 3K9KA 1R3LC 5JCOA 3AO5A 1RHI4 3ZCMA 1QZ5A 5KGWA 1QZ6A 5EZYA 1FK9A 4BC3A 1NK7A 1RT4A 2ZM6B 3AO4A 1GLAG 5AQZA 4EFEA 1HLUA 2B1IA 1TYQB 4YDUA 3UIQA 4Q4X4 2PBDA 3DOLA 4JK8A 1QCEA 4BAYA 4AHVA 4YOXA 3CCJV 5FPRA 4G9ZA 3I0RA 3M8QA 2QWNA 3SBGA 1K8KA 3LDPA 1NK9A 2F8SA 2H94A 3W0LA 3QNEA 2DWDC 4E7KA 4FK2A 3T1HB 3M5RA 4OKEA 2ITDC 3BABA 1VQ4N 3W7WA 1IBLB 4JKGB 3MN5A 3ZT1A 3LPUA 5AZJB 4BE0A 4Z4GA 3CB2A 5AQXA 4XH5A 1Q9YA 1SQXH 2GEMA 3B8NA 4PQUA 5BR8K 1RUF4 3JD74 3BP8A 2WLNA 2GHYA 1RUI4 2BTOA 4CF9A 3JCZA 5AG2A 1RDWX 1ZBIA 1VQNV 4OLAA 1A5WA 4JI2O 2LGWA 3JALA 1W2BU 3TR8A 4CVNE 4O4JB 5KHGA 2E5LO 4RG8A 3QETA 2CH7A 3OW2U 2H3GX 5LYJA 4DTRA 2Q7GA 1CZBA 1NGGA 2OZSA 1HWYA 1VF5B 4FM2A 5C93A 2E6LA 4B1VA 3D6RA 3PLAA 1CZAN 4FXDA 2FXUA 4BIZA 2GSMB 3D45A 1N34B 4NO7A 1AVMA 5KRTA 1TK8A 1IBMK 3D36A 2NUBA 3KLEA 2G8VA 3SGIA 3NF8A 1N5YA 4CEFA 1OCCB 3RYCB 1TVRA 3LUTB 3CI5A 3R9PA 2YHYA 3OT7A 2P9LA 2A79B 3DLGA 1KAZA 3I55N 1U6ZA 3ULDA 4X1IA 2QM8A 3V1RA 1EETA 3THVA 3L6QA 2AZ0A 4X66K 4KAZA 4AHRA 3LM9A 1EAH4 1YUWA 3THYA 3AEBA 1BI4B 1NGBA 2RE2A 1E1QG 5TKYA 4JKFA 3WXLA 1RUJ4 4GNIA 2IH3C 1YI2V 2CH6A 3NGIA 4FPPA 1M90W 3NH2A 5LHHA 3CSXA 4BC4A 4IDHA 2KKWA 3ZMZA 3OYBA 3VRAA 3DXRA 1HNWK 1RT3A 3C3SA 3DXKB 3E66A 3AGRA 3BY5A 4B1ZA 1CXQA 3DSQA 4JTDB 3QIOA 4EZ9A 2B5UA 4P9OA 1S5JA 3JD0A 5LMUB 4GKJO 4DR3B 3ITHA 3T1YB 1NM1A 4EB6B 3VR9A 1O1WA 2WLMA 4FW2A 3HKDA 2NNWA 3SQ2A 1U49A 3O9QA 2WBNA 5CBHA 2QTOA 1SS6A 2YHWA 1LUVA 3LNMB 3OTOK 2QDOA 1I7FA 2QK9A 3CQ8A 3PIPL 1NJZA 5KUKA 4FFBB 1RPOA 2WPDG 3BEHA 1XQSC 1P7GA 3D2FA 1Q6IA 2EIJB 1K5QA 4AHUA 1GO3F 1U47A 4ISEA 2FLOA 2WLKA 4CJUA 4PWDA 5KMGA 2XAJA 4MW3A 4K3AA 2UU9O 1VIBA 4F2SA 4LFBB 3CD6N 4KUMA 1YJNN 5H9CA 4JEPA 4C8KA 4AHCA 4ZI7A 3ZRSA 3AG2C 3CRCA 2VYPA 1QVFU 4JD2B 3OUFA 3T4ZA 5LOVB 1VQKN 5CBGA 3JSLA 4CH6A 5T7BA 2B6AA 2JEXA 4JKAA 1J5EK 4Y0WA 1S6PA 2OCCC 4CJKA 5EC2C 1EN6A 2JJ1G 3RBZA 1HR0B 2YNIA 1WUAA 5B8HA 4JRPA 5BMVB 3OYAA 4EHUA 5LGTA 4GKKO 3MECA 3MHSC 5B1BC 2I7NA 2ZWHA 2FL4A 1HX1A 4BDZA 3OY9A 3DI6A 1ZBLA 1KVBA 5BN8A 3JD4A 2WLLB 3OYDA 4DFMA 4B3TB 2ZD9A 5IWAO 2CTQA 2LGQA 3ID8A 3CM5A 4B1YB 3J7AP 4LC9B 3WNEA 5C2DA 5DM6L 1BOTO 1YQ3A 3TK1A 2Z5UA 4I2QA 4LFAB 1HYSA 1REVA 4TT3G 3CCRN 1MABG 4JI8K 4KFMA 2E2OA 4IG0A 3OS1A 1C0UA 3MAQA 2Z0AA 1NVPD 2QKSA 5LHIA 4JV5B 3J7YP 4JF3A 3U0ZA 3CYMA 2R7YA 5JQGB 4IT5A 4BE2A 1M1KW 1NJYA 4DQSA 3NVMA 3E22A 2FBXA 4L87A 1XWLA 4I55A 4CS3A 4CZZA 1NR7A 3A2FA 4O2AA 3H1KH 5B66Z 4X62O 2VGMA 1R1BA 3BA9A 3ABMC 2M7WA 5DMRA 1NBWA 5HL7L 3H3NO 2G38A 4NTYA 2BTFA 3H08A 4C8MA 1DF5A 3AVLA 1U97A 4HAMA 2RR14 3D2EA 3LDLA 2XRIA 3QBXA 4CCHA 3VEXA 4LF8B 4DR7B 4O4LA 1C0TA 2CE4A 2ZJPL 1FAFA 3B6OA 3ID6A 4JTCB 3C7NA 3HTVA 3RR8A 2F23A 2HBLA 4DFKA 3TAEA 4IYIA 3MEDA 1X4TA 1Y76A 3BA8A 4NLBA 1RPRA 1HXS4 3JCUZ 3FFIA 1RBRA 3E35A 3THOA 1XI1A 1DKGD 3Q7CA 1TVKB 3L73H 5H6RA 1U2VA 2HW3A 1YCIA 2Q0RA 5HBMA 3GQKA 1EXQA 5KI6A 1SZXA 2V51B 4H0TB 1KQSU 1PD3A 4UUJC 1MNGA 3T69A 1L1FA 1TKXA 5IYCO 4H0XB 1F23A 3E86A 4LF6O 5HRRA 3N4PA 4CF0A 4LD0A 3TCUA 5KX5A 3BVOA 3SYAA 4CHOA 3P3PA 3OGIB 3GVMA 2FBWA 3ZIAG 3HVRA 3K58A 2KW4A 1JJOA 2UU9K 4PUOA 1KUQA 1XDCA 3CCSV 2X5ID 1W59A 3CM6A 4DF8A 4YOWA 3R1XA 1VF6A 4O4IA 2Y69B 4YIOA 3M3ZA 2XY6A 1I0HA 4JKBA 5AQLA 1QNMA 1VF7A 5BY1A 3WNFA 2P5OA 2YX6A 1JJ2U 2XAHA 2ZQBA 2EIKB 1WSEA 4FMTA 3DLEA 5FPDA 4YTNA 2ITGA 4O4HB 5EX5A 2HVHA 4RW8A 4A2AA 2E5LB 4IHJA 2GBOA 5F2VO 4B3SB 2W6IG 2YSUB 4FLZA 2GX9A 3ZT0A 3A5NC 4FWNA 3SBTA 3QEVA 3TANA 5EBMC 3DLKA 1R6KA 4I9LA 1RUG4 2BDPA 1B04A 4GKKK 3SZ2A 4DU3A 1QQCA 1MZFA 1FFXB 4JI4B 2EIMB 1JKHA 1IBKB 2A5XA 4BIOA 3VPZA 4F4LA 4WFHA 2ZIOA 2DJVA 1RT1A 4WFBV 4DUYB 1RBVA 4I7ZB 3TABA 2Q2RA 4B1WB 3RRGA 4M3XA 4KFBA 4RHV4 3DMJA 4A2BA 4IO8A 3TSPA 3QF7A 1PNLA 4DF4A 5ITZA 2HLDG 4FWRA 2OTLN 4I4TB 1W2BM 1XL4A 5C12A 3SPZA 3J8AA 1PVC4 2Y1IA 3DLBA 3OW2M 3RGBA 3HM8A 4YOYA 2UXBK 4KTQA 5FPMA 4EAHD 2OPQA 4BDPA 4JI5O 4H0YB 2O8CB 1H8TD 1XNQO 3EXAA 1NH2B 1VQPN 1AR64 1LAWA 3CJBA 4J80A 2XOKG 4X62K 4XDJA 5J2UA 3CCMV 3V6DA 5GADP 3C90A 4O8KA 3ASOC 4E4EA 5JJEB 4WQ4C 2W0FC 2LQTA 4HYOA 1DF4A 2EIJC 1Q3EA 2OPRA 2QR4A 3EZWA 4YOUA 3HM9A 4EKWA 5BR9A 3CCLV 4K8XA 4PV1B 1X59A 5LY3A 1T05A 1HMVA 3T1AA 1S1TA 1Q5OA 3S3NA 4GKJB 4A59A 2VCPA 4JI1O 2GBZA 4NXNB 3UE5A 4X64B 3SUOA 3EY1A 3P5JA 3J80N 1S9GA 4P2ZA 2E1ZA 2LFRA 1DTTA 3NGZA 2EJRA 2QE7G 4MVZA 2R9IA 1NK8A 4XDLA 1BCCH 2DOSA 4J9YB 3MN6A 2OPPA 1YEWA 1PV0A 5E84A 3CCJN 4GV6A 4RW9A 1FJGB 4IWVA 4BVOA 2YI9A 3ZSQA 3JALB 4LF6K 4V19S 2HHUA 1IZ3A 3P4PA 3A8TA 2DW4A 2IC3A 3OD4A 3JATA 4MTOA 2CH7B 1E1RG 3VQCA 1TKDA 5LYJB 3QTCA 2HJFC 5DK5A 1QVGU 1GAXA 3V9UA 4NLCA 2W6LA 4Z4EA 1D2DA 3F5TA 5C42A 1VQNN 2YI1A 5JLHA 1P4RA 4CHQA 4WBNA 3VQ7A 1YZBA 2YJFA 4NCGA 4FLYA 2X6CA 3SLCA 1YAGA 1K92A 2P9LB 2O8BB 1S22A 3BGRA 4TUYB 3LP3A 2RDCA 1QLEB 4A57A 1YIJV 4CD1A 2PI5A 4KB1A 5IWAB 5GINA 4E7IA 4DR2B 4FJNA 1NTKH 2ASMA 5F2RA 2Y48A 3MX5A 1N32B 2NZTA 1Y4MA 3THYB 4MSWC 4X9QA 1K73W 2ZJQL 1GLFO 1QVFM 4K42A 3AEAA 2C2AA 1NU0A 3WUHA 2L6LA 3C6UA 3K0DA 3STLC 3AG7A 1JL2A 1COWG 3HK2A 3OUSA 5BR8B 2F4VO 3DLHA 1J95A 1Q86O 2O4IA 4FJXA 1PO24 4LFCB 1BA1A 4M7YA 3VGLA 3ZSWA 4TSFG 3HKEB 1UJWB 3C0BA 4JKGA 3SPCA 2QWMA 2XT9A 1TK5A 1PL0A 3CC2V 1AB3A 1VSIA 3LM2A 4BRQA 1HJRA 5KAFZ 3AVIA 4F6RA 1Y64A 2XAGA 3M8AA 1X9JA 4KTWA 3JAMO 1N36B 3EHBB 2QM7A 3LDSA 2UUAK 2WONA 4JI5K 1XNQK 1NK6A 3D0PA 1C0FA 1JCHA 1JLFA 2GTSA 4B3RO 1TL3A 5LMNO 1Q86W 2OYQA 4FFKA 3WXJA 4FL9A 5JJJB 1NT2B 3I0SA 5AZIA 4B3OA 3STZC 2CTRA 1G15A 5AQJA 1NG9A 4FZ0A 2VRZA 2OCHA 3D2FB 2HVIA 1Y66A 4FLUA 4DTPA 2WLIA 3IG1A 4DTMA 3CE2A 3CC7V 5B1AB 5KMGB 1H2NA 5IJ0B 1WJZA 4CZLA 5HRNA 3RWUA 3QERA 3AEDA 1WAZA 3SNNA 3RYCA 1YQ4A 1LR1A 2EZOA 4JI1K 1MA1A 3I33A 3SJCC 1GKFA 3SR2C 4DV0K 5BPLA 4MVSA 4E2LA 2Y69C 1BGYH 4FK4A 4N23A 3H01A 3ZEUA 3AE4A 1EV14 1BCMA 4JI3B 2EIKC 1C0MA 2H8PC 4OVLA 4LF9B 2XAFA 1KC8O 4CEQA 4PA9A 5CYMA 1BI4A 2KHOA 4FJ8A 2DYRB 2YUAA 2BOCC 5H6QA 5IE9A 3G4SV 3BEXA 3EN9A 4KH5A 1DEJA 1IG9A 4PDMA 1GN4A 1GH6A 2B1GA 1QQOA 1WB7A 2Y0IA 3AE8A 4C7UA 2JRIA 1KLNA 3LDDA 1B9FA 4LH4A 3TXSA 1X9SA 4KHYA 2EIMC 1JLBA 4JAUA 2ZM6O 1MWKA 3H1HH 1ASUA 2CGOA 5AQSA 3ABUA 1QTMA 2VQEK 1KC8W 3PUFA 1KQSM 1FXKA 1SETA 3OVNA 2IVOA 2LFSA 4W5QA 1NI8A 3BHPA 2EULA 2IU0A 3CERA 4UVBA 5DM6V 3AEIA 3IFRA 4Y1DA 2HHSA 3AE5A 3T1HO 1WBDA 4F3OA 4CZGA 3O3FA 3LDQA 1V9PA 2FTKA 1IBLO 2O8FB 3DRPA 3OYLA 4IYHA 4KXRA 3ZSOA 1US6A 3OMIB 2AXTZ 3OE7G 2BUPA 1NZ6A 2HP8A 4YFUA 4I55B 2FSNA 3QEXA 1Q81W 4O2AB 4CEZA 4R79A 3RTVA 2NRTA 3JXUA 4YSXA 1Z6RA 2QWPB 3UKMA 1H1VA 1EFRG 5JCOC 1JJ2M 1BA0A 3AA2A 1QS4A 3OYKA 2V7ZA 4FWOA 1HNZK 2F4VK 4DCHA 3RMAA 3EVKA 2D0PA 1LV5A 2LW7A 2IJJA 4E0DA 1VQLV 4PKHA 3C7NB 1N34O 1EN4A 5LOVA 4DUZB 5BRDA 1K5SA 1Y76B 3E8GA 3NR7A 1XOUA 1QE1A 1SZ2A 2HB5A 3NFAA 5FROA 4QNHB 3DM2A 4IDKA 4WFEA 2HWC4 2HBKA 3MDQA 3I8DA 4BGAA 4B3RK 2A42A 2X6NA 5LMNK 2AZ2A 3P31A 1S1WA 2WLLA 4ILJA 5AQMA 2UUCB 1JQ0A 4B1XB 2KLAA 5LP6B 3AEFA 3FI7A 2VQFK 4B9QA 3AVCA 3D3IA 4U7BA 1SKRA 4CI6A 5I3UA 3AVKA 3I8BA 3SK3A 3WEEA 1RUH4 5KX5B 3TAMA 2ZKOA 1H2SB 3AE9A 3MEGA 5E79Z 4FVMA 4D6TH 3OYJA 2AA4A 2OCEA 3SUPA 1D5NA 3ETDA 3U9DA 3LSUA 5EYPB 4X1KB 2QKCA 4TOIA 2I5JA 4BW5A 4JK9A 5EXWA 5KGXA 2IAJA 3ASNB 4CZEA 4FW1A 4HVJA 1JX9A 3UQ8A 1EQYA 1IKWA 4DYLA 4F8RA 1QR8A 3B8AX 3N2KB 4GX0A 1UOCA 3O9UA 3VQPA 4WF9L 4FK5C 2RS14 1SQVH 2HHQA 2D3OW 4LF7K 3W7XA 1G1XB 3ENHA 4IFYA 3KK3A 3ZRXA 1JLCA 3L0QA 3O1WA 3AO2A 1RT6A 2QM1A 3LNNA 4IHJB 5DEDA 4DR3O 5JH7B 3T1YO 1VQOV 3CCSN 1MA9B 4AHTA 2VWJA 1QLEC 4FWKA 1JCEA 1Z26A 4LWSA 3JSNA 1W0JG 1C1CA 3P83D 1IDSA 2Q97A 4CH4A 2OA8A 3HSCA 5CA0A 1J9AA 5LBQA 3HZ6A 3DYAA 4DV7B 2R72A 4JI6K 2ZM6K 1WP7A 2P6JA 5HOOA 2PYJA 4K35A 1R59O 2P5GA 2P1JA 3OGCC 2NLXA 2IBZH 1TVKA 5ITZB 2HF3A 4CF8A 4LFBO 4NTXA 1Z05A 4OXSA 2NNUA 4BY9C 4DWIA 3CJ9A 4IFEA 3T1HK 1JLEA 1EZVH 1IKXA 3U9ZA 1IBLK 2WDQA 1QVGM 4ID1A 2EZPA 4KTZA 1J54A 1OKJA 2HFEC 4CF2A 3KLFA 1BWFO 4BWAA 4D7SA 2GELA 5C3JA 5J2UB 1HR0O 2W40A 2CAZC 5FNVA 2HWB4 3HR0A 4G27B 3F7VC 3KZBA 5LA6A 4Z2WA 4MFBA 3KZIZ 5CA1A 1K33A 1NGEA 4DS4A 1KLMA 3OYCA 1NA1D 3ZN1A 4B3TO 4J2BA 2BOBC 2A1RA 3WXMB 4DR5B 3DWLA 5B1AC 1ZWIC 1D4XA 1AI7A 1BIZA 1N34K 3NF7A 4O4HA 3PO5A 4FCYA 1BU6O 4U3JB 3JARB 1NKEA 1RUD4 4BR7A 1WN7A 5FRNA 3S3XA 1HPZA 1H2GA 1EZJA 2X6AA 3PIOL 3RMCA 1R6TA 4GY2B 3CCLN 5B1OA 1ATRA 1B92A 3VQVA 1DLOA 4BR2A 1FFXA 1BQZA 4IO9L 1JVMA 2PI4A 2D2CB 3ZHSA 3A0BZ 4AHSA 5EK0A 1Q6HA 5TISZ 2A06H 2E88A 3L4QA 3VEWA 3JATB 1PM9A 2FBYA 2HVJC 3D8CA 3ZMTA 1XEQA 4BR9A 1QBZA 1CLQA 1SKSA 4NYKA 4QS9A 2HHHB 1NJWA 3S9HA 4HCCA 4ZIBA 1RTIA 4DSFA 1N8RW 2DY4A 5FPOA 4B9LA 1CXZB 4I4TA 2QTSA 4AQYB 2WC9A 1J6ZA 1ZXOA 4DU1A 2BGGA 4PDRA 1AJPA 4UCSA 2GUPA 3BFRA 4LF8O 1RTHA 4DR7O 1RDCA 4FZ1A 4LH6A 2DFHA 3KKSA 3P4IA 4FJLA 2DQ3A 4J7ZA 2O8CA 3BF1A 2CTWA 5SWMA 2PTMA 1HKCA 4DLEA 2XY8A 4E7JA 3VQ5A 3PX0A 3O5BA 4FLWA 3N4QA 5LMUK 3ZETA 4DR3K 4DV3B 1XMOO 3T1YK 1HP8A 3RFRA 3ABLB 4CZIA 1RDDA 3AA4A 2E76B 3KD5E 5CY4A 3T7ZA 1V54B 5EBLC 2ZINA 2GUIA 4ISGA 1AR4A 1ZBFA 3QFUA 1IX9A 2R044 4CFDA 2FBTA 5F0XA 4N41A 2VG6A 4N47A 1DLBA 2I7PA 2F93B 3L71H 4Z1VA 2ITCC 1YIJN 1NGHA 3SV3A 1TK0A 3AG4B 4X88A 1V4TA 3HSTB 2AJQA 4YSZA 1RCHA 4L8RB 3SQ0A 1Q9XA 1GN2A 5LL6Y 4JAXA 4W4KA 4JS4A 4CZJA 4J8FA 4F9OA 4F6RB 3VEZA 1AJNA 2NN4A 4AF1A 4UCUA 4F4KA 3OS2A 3LWLA 3TI0A 2CGNA 3G10A 4DR6O 3ZEDA 4IBNA 4DU4A 3JSMA 4RO2A
chains in the Genus database with same CATH topology
1WLJA 1M5IA 1SA0B 2O4GA 3SV4A 1UWBA 2WOMA 5J2PA 3SQ4A 2PW9A 3SJBC 3HKCA 3ZT2A 4EP5A 3OYHA 3CFRA 2G8FA 1NJXA 4DSIA 3LWMA 1BIUA 4TUYA 2UXDB 3VQWA 5E41A 3K5NA 3C94A 1EX4A 3ZT3A 4FJ9A 1RDAA 3ZS8C 2FC0A 1MU2A 2UUBB 2HNYA 5JS2A 3U3GA 3FFQA 4DSEA 2KZMA 4NVPA 3HJFA 3HKEA 2LSNA 1DTQA 4M3YA 4DV2B 1N6QA 3U11A 4CK3A 1WSIA 4JI7B 1W9HA 1VSHA 4J2EA 4DLGA 1JLQA 4TV8B 4IG3A 4Z0UA 4OPKA 3VN5A 1BHLA 5IJ0A 3TAFA 1M93A 3ZSVA 3VQ4A 3B2EE 4YHHB 4K8ZA 2ZD1A 2ZNJA 4ZHQB 3DOKA 1WAJA 3VQEA 4OJRA 2W42A 4BWMA 4M42A 2OWOA 4DV1B 4PA1A 4D7TA 1K6YA 3RMDA 2Q7EA 4ELUA 3VQ8A 3WB1A 3ISNC 2IDOA 3V9XA 2QJ1A 3U10A 3RYIA 3LPTA 1Q8IA 4EP4A 2YNGA 5CYQA 3TAQA 2DTUA 1Z5WA 2P51A 1TAUA 2A1SA 4CHYA 2YIBA 4GLXA 2HHXA 1BGXT 1DGSA 4CJPA 1ZBHA 3NF9A 4JS5A 4DSKA 3LAKA 1I94B 3NAEA 1BQNA 1SL1A 4JYAB 5CA0B 4X65B 4CS2A 2YNHA 3KKRA 2DFFA 4CEAA 2KFNA 4IKFA 1XMOB 3RYFB 5D5PA 4H4OA 3K5OA 1EP4A 2R70A 4DQPA 2EHGA 4UCVA 3PO4A 2ZIMA 5LP6A 4HUEA 4PI0A 1T8EA 4IIJA 5FNVB 4YY3B 3QEPA 5LA6B 5EYPA 3HL8A 4X1KA 5CA1B 2IOCA 1D5AA 5CZ2A 3N2KA 3KJVA 2G8IA 4CS4A 1Y97A 4DR6B 1QSLA 4LR3A 5D5QA 1UA1A 1Z25A 5JH7A 1U45A 1CZ9A 3BAAA 4EEQA 3NH1A 3TWHA 1J5EB 4KREA 1D9DA 3NH0A 3PX6A 4E3SA 1O9GA 4G1QA 4DR4B 4ZTFA 5JS1A 2P22C 4BACA 4CJWA 2KZZA 4J2DA 5K14A 5JJNB 1WSHA 4TV9A 3MXJA 3IS9A 2Q7HA 4UQGA 1WSFA 3OTOB 2B5JA 4CECA 3V1OA 2EX3A 3P1GA 1YTUA 4E7HA 2QM4A 4LY7A 4J2AA 3LP2A 3HVTA 4U3JA 3JARA 2PZSA 4ZOLA 4QAGA 3BPZA 2JLEA 2RJZA 2IM9A 4DV4B 4B9UA 4K0KB 4OKJA 4OLBA 4ELTA 4BW9A 1VSKA 3QO9A 4O5BA 4CIEA 2G8HA 5EU7A 3HYFA 2VG7A 1ASVA 1TUBA 3RRHA 4M41A 3HKCB 4JI0B 1S1UA 3HPHA 4B9TA 4KRFA 1HRHA 5CB4B 1YTAA 3ZSYA 2Z1GA 1L8DA 1LAVA 1L3TA 1ZAUA 3HPOA 4CFBA 5KRSA 3HP9A 2Z1HA 4FYDA 5HROA 1XMQB 1A5XA 3UT5B 1QSYA 2HHVA 4YJ3B 4DQIA 1TKZA 4DQRA 4EFBA 4KHQA 3RYHA 4CGIA 1L3VA 3SI6A 3NBPA 4DV6B 4JLHA 4OGEA 3RMBA 3BDPA 3AA3A 1SA0A 3M7MX 5HP1A 1YT3A 2UXBB 3L8BA 4W5RA 4F2RA 3PY8A 4DTOA 4CJQA 2Q3SA 3SPYA 1JXBA 2X6SA 4KI4A 1FXXA 3LALA 2R7FA 4F3TA 1RT7A 1R0AA 3DRSA 2ZE2A 1G6UA 3EZ5A 1TV6A 2FBVA 3QEIA 4O0IA 4UFZA 1Q43A 3RYIB 5JVDB 3OYFA 2XHBA 4IFVA 4CFCA 3V1QA 4CIGA 1VRTA 3CFPA 2UXCB 2X78A 3VQAA 2ZNIA 4CF1A 1TAQA 2JVDA 3RWRD 3V81A 4TV8A 4KPYA 5EIBC 1KRPA 4CJEA 3LP1A 4CK1A 4H4MA 1HYZA 1N33B 2ZCEA 4DTSA 4ZHQA 2E6MA 4E89A 4B8CA 2D0BA 2D0CA 4HBNA 5J2TA 4CGHA 5KHJA 1I39A 5GONA 4KI6A 3WB0A 5IYZB 4IIJB 1SKVA 3PV8A 1NK0A 4CEOA 1WNSA 3VQYA 2F1MA 2HNDA 1Z5VA 1KVAA 3S3OA 4EZ6A 1LW2A 4Q6GA 3AO3A 4BE1A 4GMJB 1D8YA 3AV9A 4HUGA 1SQGA 3NCIA 1VSMA 4LNUB 3JYTA 4R5PA 4DK0A 1RT2A 1ITGA 4DTXA 5HRPA 1EKEA 3RYFA 2QKKA 4FLTA 2YNFA 2R9AA 3QIPA 3KD1E 3NE6A 4TV9B 5KTQA 4DR1B 3JASA 2IGIA 3NDKA 4DTNA 4I50B 4FJMA 3N2GB 4N5SA 2PY5A 1C1AA 2YHAA 2RF2A 1X9WA 3LAMA 1HNVA 1HQEA 3V9ZA 4CGFA 1GOAA 4ZOLB 4OX9B 3AO1A 1A5VA 4KHPB 4CH5A 3AVJA 5KHHA 4GVMA 3WNHA 4DV5B 3M8SA 1HNIA 3O4NA 4CJVA 3DLRA 3QESA 3L2UA 4KL1A 1TUBB 1M4UA 4W5OA 1KMIZ 2YKNA 2YKMA 3QNNA 4B8AB 1XNRB 4FJ7A 2YXLA 1HYVA 1RBSA 3JAKB 4KHWA 4LF5B 4FZYA 4LF4B 2YV0X 1C6VA 4O44A 3NHGA 4AH9A 4FJJA 2QXFA 4UCRA 5KHIA 4CJ5A 4CH3A 5D3GA 3VQ6A 4CFAA 1BQMA 3V4IA 5IJ9A 4CESA 3ICXA 2VG5A 1KTQA 1SQFA 4FM0A 3RYHB 3VQXA 4JI6B 3RR7A 3KLIA 1O9HA 1TGOA 2BTQB 5LXTB 4DS5A 1RDBA 1IH7A 4E19A 4GYCB 4B9MA 5LP6C 3U6FA 1NOZA 3SCXA 2E3CA 1WAFA 4CEEA 5CB4A 1WSGA 3S3MA 4H8KA 4CJRA 3OYEA 4ICLA 4BDYA 3OJUA 4NCBA 2Y1JA 3KTQA 4NXMB 3SUQA 4LH7A 4C8LA 3UT5A 1XHZA 4YJ3A 2D0AA 5K1PA 4O55A 4OKKA 4B3MB 4DK1A 4CJLA 3F73A 1RILA 3OS0A 3F9KA 3C6TA 3PN1A 4N76A 1ZBUA 1HNXB 4FJIA 3LANA 4KHSA 4YJ2A 2Z1IA 3SYZA 4CC6A 3ZSXA 4FK0A 1KSPA 2F66C 1RNHA 1VSDA 4C8OA 4YNQA 4CHZA 3OTFA 4M45A 2VWKA 2ATQA 4B9VA 3BRCA 3AVFA 4RW4A 3QINA 1GOCA 5J2MA 4Q5VA 4OPJA 2RPIA 5J2TB 4FJGA 3L3UA 4L8JA 4DRXA 4BWJA 3T3FA 5GONB 4LH5A 2GV9A 2PGGA 2RN2A 5JVDA 1RTDA 2XY5A 3L2QA 4ELVA 4CGJA 1SV5A 5J1EA 1NOYA 1IBMB 5I42A 1QHTA 5C8YA 1XQ8A 4I9QA 4ZHRA 4X66B 4I2PA 3NGYA 3PX4A 1UAXA 3LZJA 4CE9A 1LWEA 4Z4CA 4B9SA 4TQFA 1ASWA 4X1YA 5CZ1A 3O3HA 2HNZA 1RBTA 1HNWB 4DSLA 3K2PA 1VSJA 5IYZA 4RW7A 1TKTA 1XHXA 3JASB 4O2BA 4Z4IA 2IS3A 4M3WA 1T03A 3VQBA 3T19A 1ZYQA 4KHUA 3AVHA 4UCTA 4FM1A 3CFOA 1X9MA 2BE2A 3L2VA 3O4QA 1L3SA 4KO0A 4Y1CA 3HKBB 3K5MA 1JLAA 4NYNA 2F95B 4DFJA 4DFPA 1BL3A 3E01A 4W5TA 1W0HA 2RKIA 1JFFA 4LNUA 4QCLA 2QKBA 1JL1A 1S1XA 3KK2A 4DTUA 3LZIA 4CJFA 2KFZA 4JI2B 4HCBA 1RT5A 4HUFA 2HMIA 1RTJA 4CGDA 5EIBD 1VK0A 4UCOA 4TQDA 3AVBA 3VQ9A 1JLGA 5FDLA 4PHZA 5C25A 1KFSA 4HNAB 2V4DA 3G0ZA 4JI8B 1LWCA 4I50A 4CHNA 3N2GA 1D9FA 2ETJA 5FRMA 1KU9A 5HRSA 1KFDA 4DG1A 1X1PA 2HHWA 3JAWA 4CHPA 1SKWA 5IJ9B 4DQQA 4M3ZA 2Q0AA 1IKYA 5EZYB 4M3UA 1TAEA 1BCOA 2YI8A 3OYNA 4X20A 4DSJA 3TAGA 4ZTJA 3TARA 4HHTA 1IKVA 3ETQA 3JAKA 2UU9B 2JGUA 4QOZB 4FLVA 4W5NA 4FJHA 1T5EA 4CJ4A 3B6PA 4Q0BA 4OGCA 3WNGA 3DRRA 3AA5X 4B9NA 1VSFA 1VRUA 3KK1A 3K57A 2F96A 4GKKB 2D5RA 4KKOA 4X1IB 3MEEA 1LWFA 3VQQA 1P49A 3HO1A 1NK5A 5LXTA 2BTQA 1JXEA 1SUQA 3QG5A 3LP0A 3SQ1A 4YJ2B 3MXIA 4N56A 3QLHA 3CHXA 1NKBA 3OYMA 5K1XA 1LW0A 4CEBA 4LSLA 2BANA 4HTUA 3OJSA 4X62B 4CEDA 3M8RA 4NYFA 2B4JA 3HKDB 4O4JA 3SUNA 3V9SA 2PUSA 4O0JA 4KV8A 4DTJA 3ZT4A 3TAPA 3V9WA 4DRXB 3HPGA 2G8KA 4ZI7B 4RW6A 4CJSA 4PI2A 4LF6B 2X74A 2YIBD 5C24A 2XO7A 3ASMA 4CGGA 1UA0A 1U4BA 3HT3A 2E4LA 4KHNA 3KLGA 3U3YA 5C8YB 3SJAC 2JS5A 1HQUA 1WPBA 4I7FA 4EB6A 3QNOA 1TL1A 3K5LA 4ID5A 4M3RA 4FFBA 3E22B 4WE1A 3NF6A 3AVNA 4X1YB 2OPSA 4FLXA 4E1NA 1F21A 3VA3A 1T7PA 1S9EA 4CC5A 1QSSA 2HEPA 2YHBA 2XY7A 4Z4FA 4O4LB 1B9DA 2UUAB 4GW6A 4O2BB 4JI5B 4FZZA 1S6QA 1XNQB 3OYIA 1SL0A 1C1BA 1YVUA 3HP6A 5KHKA 3ZSRA 5BMVA 3MXMA 1I3AA 4AILC 4CJTA 5SZTA 3CG7A 5J2QA 3L2RA 4JRQA 3OYGA 3IAYA 4JI1B 4MQ3A 3KIOA 2RQ6A 1VSEA 4DV0B 3M8PA 1JMKC 2KTQA 4E7LA 1JFFB 4O4IB 3EYZA 4CK2A 5JQGA 1L5UA 4CJ3A 4FZXC 2KQ2A 4B08A 1NK4A 1WSJA 3AVMA 2VQEB 4KB0A 4NCAA 3C95A 3L3VA 3ZSZA 2G8UA 1NKCA 4TSXA 1S1VA 4CERA 3VQDA 1FKPA 3ALYA 4DMNA 1RBUA 2HHTA 1RSOA 4FJKA 3JAWB 1HW7A 3HKBA 1VSLA 1HNZB 2F4VB 2Z1JA 4C8NA 1IO2A 3WB2A 4E1MA 4XIUA 2PYLA 4O4GA 3L2WA 1J53A 3HXMA 1CXUA 2OZMA 4CIFA 1L3UA 1KVCA 4B3RB 5LMNB 4X20B 2VQFB 5HLFA 1XC9A 4HNAA 2YIAA 1U48A 1SL2A 1U04A 3AVAA 3VA0A 3O3GA 4M3TA 4LSNA 4Z4HA 3QEWA 1GOBA 1KCFA 1J5OA 3AVGA 4LF7B 2F8TA 4FJ5A 2G8WA 1BISA 3SJJA 4WBNB 1FKOA 1TA8A 2DFEA 5J2NA 3K59A 3IRXA 4PY5A 3KLHA 5JCOA 3AO5A 3ZCMA 5KGWA 5EZYA 1FK9A 1NK7A 1RT4A 2ZM6B 3AO4A 3UIQA 4EFEA 3DOLA 4AHVA 5FPRA 3I0RA 3M8QA 1NK9A 2F8SA 4E7KA 4FK2A 3T1HB 4OKEA 3BABA 1IBLB 3ZT1A 3LPUA 4BE0A 4Z4GA 3CB2A 1Q9YA 4PQUA 2BTOA 4CF9A 1ZBIA 4OLAA 1A5WA 3JALA 3TR8A 4O4JB 5KHGA 4RG8A 3QETA 5LYJA 4DTRA 2Q7GA 1CZBA 2OZSA 2E6LA 4FM2A 4FXDA 3D45A 1N34B 5KRTA 1TK8A 2NUBA 3KLEA 2G8VA 3SGIA 3NF8A 1N5YA 4CEFA 3RYCB 1TVRA 3DLGA 3ULDA 4X1IA 3V1RA 1EETA 3THVA 4KAZA 4AHRA 1BI4B 3NGIA 3NH2A 3CSXA 2KKWA 3OYBA 1RT3A 1CXQA 3DSQA