1XHZA

Phi29 dna polymerase, orthorhombic crystal form, ssdna complex
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
molecule keywords 5'-D(*TP*TP*TP*TP*T)-3'
total genus 144
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhzA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhzA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhzA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhzA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhzA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhzA06
4H4MA 3TAMA 3LPTA 1JLFA 1NJYA 2YNFA 2G8KA 2OZSA 3KK3A 5CYQA 4J2BA 4FLXA 2P1JA 4FJNA 4FXDA 4E1MA 3BGRA 4ICLA 3D45A 1VSJA 2HHXA 3VQ4A 3H08A 1KSPA 3SJJA 4KFBA 4LSNA 4EZ6A 1WNSA 3NGIA 4B8CA 3RTVA 1DLOA 3S3OA 3VQ9A 1L3VA 1GOCA 3K5MA 4BWJA 1ASVA 3QIOA 4DTNA 4CJRA 4ID1A 4AHTA 4CIFA 1RBRA 4UQGA 1TV6A 3WNFA 4F2SA 3MXIA 3KK1A 2I5JA 3DLHA 3SQ4A 3KKRA 3RRGA 3VQDA 2OA8A 1C0TA 2RKIA 4LH5A 4O0JA 3AA5X 1IH7A 1RTJA 5CZ2A 4E3SA 4HCBA 1TK0A 2QKKA 1I3AA 4O5BA 1EETA 1NK0A 3V9ZA 3L8BA 4HVJA 3OJSA 4DLGA 4CEOA 1ASWA 3QIPA 1QSLA 2QK9A 4CFDA 4KI4A 1VSDA 3V9UA 4AHVA 1RT3A 4N76A 3K5NA 2XY7A 3K59A 1ZBFA 3QESA 4JLHA 4DU1A 2KW4A 2RF2A 4W5TA 3HK2A 4KREA 4I9LA 1ZYQA 2OYQA 3G10A 3MAQA 1RT4A 2R7YA 3KD5E 5D3GA 5HLFA 1KLMA 3V81A 2WONA 4CJ5A 2PYLA 4PWDA 4E7JA 4B9UA 4XIUA 3OYHA 1TGOA 2EX3A 4AILC 2YKMA 2OPQA 2ZE2A 1IG9A 4QCLA 4DFJA 1NK9A 4DSFA 3LP3A 3HPHA 1A5VA 3IG1A 2PYJA 2KQ2A 5SZTA 1VSEA 3OYKA 1CLQA 4Z0UA 3CFPA 3V6DA 4B3OA 1NK7A 3MEEA 3ZT4A 1BIUA 1ASUA 4KHYA 3OJUA 3NHGA 1S1WA 3S9HA 3QINA 4CHOA 1HQUA 3KTQA 2HNYA 3CFOA 3LP0A 2BANA 2G8VA 3TABA 1RBTA 4HHTA 2QKBA 4BE2A 4DQPA 1YTAA 1HPZA 3AO3A 3CM5A 4AHUA 4J2EA 4C8OA 3P1GA 1U4BA 1WSHA 4CFAA 5J2QA 4F3TA 3ASMA 4CEBA 3SCXA 3NFAA 1TAUA 1T03A 3AVFA 3TWHA 4FLZA 4QAGA 1JXEA 1XC9A 3VQBA 1L3TA 1Z26A 1ZBUA 3E01A 1HRHA 4E19A 1NKEA 4F8RA 2YHBA 3QEXA 5CYMA 2QXFA 4ZHRA 1JLEA 1REVA 4KTZA 2VWKA 1C1CA 2VWJA 1DTTA 1SL2A 5C24A 1XWLA 1N6QA 4E1NA 1RTDA 1VSKA 1YTUA 4CJEA 3ZT3A 3IRXA 3HM9A 4E7LA 2HVIA 3KD1E 3HSTB 3OS2A 2X6NA 4I2PA 2HHUA 1MU2A 2DFHA 3BDPA 5CY4A 1IO2A 1TL3A 2B4JA 4DLEA 4FM0A 4CGGA 3NE6A 3OY9A 4Z4GA 1HYSA 3L2RA 4CEDA 5DMRA 2GUIA 3SI6A 2XRIA 4CJVA 1BCMA 4G1QA 1NJWA 1RCHA 1ZBIA 2Y1IA 1JKHA 1QTMA 2IDOA 3DOLA 3ZSRA 3VQAA 1NK6A 1S9GA 4Y1DA 1JL1A 2YNGA 4LY7A 4OKEA 3HT3A 4M3WA 3DOKA 2Y1JA 3OYGA 1LWCA 3KLGA 3RMBA 3MXMA 1Q8IA 2FBYA 1S9EA 5KRTA 3O4QA 4BDZA 4RW8A 4DTMA 4KHUA 1ITGA 3AVAA 4KV8A 1T05A 4Z4EA 4W5NA 3K58A 1BHLA 1B9FA 2Z1HA 3ALYA 4F4KA 4FJ7A 4CHQA 3LP2A 3OYNA 1HNVA 1TK8A 4F3OA 2HHSA 4DFMA 4AHRA 4FVMA 3EZ5A 2XO7A 4JRPA 2F8TA 1BIZA 3A2FA 3OYEA 1HYVA 5KGXA 1DTQA 4CJ4A 4IFVA 4CK3A 3RMAA 4RW4A 4FLVA 3EYZA 3NAEA 3OVNA 3SPZA 1WLJA 5FRMA 4FK4A 1BGXT 1S5JA 3HJFA 4CJQA 2RPIA 2YNIA 3DMJA 3VQ8A 3L3UA 3LPUA 4W5OA 3G0ZA 1B9DA 3VQPA 4DQSA 1FK9A 3AVJA 1IKXA 1BCOA 2Z1IA 3AA2A 4M3XA 4QOZB 4RW6A 3MEGA 4CECA 1LWEA 2D0AA 3NBPA 3ZSOA 3B6PA 5K14A 1CXUA 2PW9A 1CXQA 3V1QA 4N5SA 3LALA 3DLKA 3FFIA 1TKXA 4FJGA 3OYFA 2HW3A 2IGIA 4C8LA 4FM2A 4DF4A 1U49A 3M8SA 2OPSA 4DTOA 3PX0A 4Y1CA 5J2PA 4FJ8A 1TL1A 1BI4B 4CJKA 2HHVA 3V1OA 1JLQA 4CJSA 3KLHA 4DQQA 4KHSA 4CEAA 5E41A 4HCCA 1F21A 4KHQA 2FC0A 4KB0A 4NCGA 2AJQA 5KTQA 4Z4IA 3LP1A 1L3SA 3KLIA 4DQIA 5FRNA 4BE0A 4DSJA 3DI6A 4Z4HA 3TAGA 1NJZA 3VA3A 2P51A 3DM2A 3KIOA 2A1RA 2FBXA 3OYCA 2Z1GA 3V9WA 3SQ0A 4DTJA 2KZZA 1HNIA 1X9MA 3WNEA 2XY6A 1D9DA 2F96A 3OYMA 4DSKA 4K8ZA 2OPRA 1KRPA 1UWBA 4CEFA 3HPGA 1J9AA 3SUOA 3T19A 4AH9A 4EZ9A 2BDPA 3QNOA 2Z1JA 3S3MA 1VK0A 4E7KA 2XY8A 4B08A 4LH4A 4DTRA 1TVRA 1QSYA 4Q0BA 1D8YA 1I39A 1TAQA 3V9XA 2KFNA 1K6YA 3AO5A 3O4NA 3LWLA 4CGDA 2X74A 5HRNA 3DLEA 4JS4A 4DU3A 2D5RA 2P5GA 4N41A 4AHSA 4IFYA 3AA4A 2PY5A 2IOCA 3DLGA 4OLBA 3FI7A 3C95A 2E6LA 1SL1A 1GOBA 1UAXA 4C8KA 3VA0A 1C1AA 4B9SA 3PO4A 4OPJA 3QNNA 4DTPA 1S6QA 2HNZA 5KGWA 1JLGA 2YKNA 3QEVA 4DTSA 4CESA 4BDYA 4FLUA 1U45A 1WSJA 1A5XA 3VQ5A 3HP9A 3QLHA 1VSHA 3NF9A 1ZBLA 3IAYA 1RDCA 4E0DA 1RILA 4CJ3A 5KRSA 1A5WA 3NF6A 5HBMA 1QQCA 2HHQA 4DS4A 3ZSZA 3OYJA 3L2WA 4KTQA 4CFBA 3KLEA 1NK5A 1SV5A 2G8FA 3ISNC 3SUQA 3AVGA 3D0PA 1VSFA 3K2PA 1VSMA 2B5JA 4LD0A 4KI6A 4B9VA 1J53A 3HL8A 2B6AA 4CJPA 4W5RA 4DQRA 3SQ1A 1RDDA 3NCIA 4NYNA 3DLRA 4KHNA 1VSLA 3HVTA 1XHZA 1J54A 4M41A 2PZSA 3U3GA 5J2MA 3RR7A 3ZSWA 1SL0A 1C0MA 1Q9YA 2ATQA 5FROA 4YFUA 1NOZA 4HUEA 3OYIA 4CK2A 4RW7A 3ZSQA 4DTUA 2KFZA 1ZBHA 2DFEA 1S1VA 3I0RA 3S3NA 3LWMA 3K5OA 3O3HA 4L8RB 4TSXA 4CGFA 1QHTA 3KJVA 4O4GA 4WE1A 2XY5A 4M3TA 2HHTA 3QEWA 1KVAA 4MFBA 3SV4A 4FJ9A 2E4LA 4NCAA 4CGJA 4ID5A 3I0SA 1Q9XA 1LAVA 3CQ8A 4DSLA 1EKEA 4KHWA 4CJWA 1NOYA 1T8EA 3ZSXA 1WAJA 3LANA 1RDAA 3M8PA 1LV5A 4O44A 3VQQA 2R7FA 1BISA 3PY8A 1X1PA 5DK5A 3LZJA 4FW2A 5HP1A 4CCHA 1C6VA 1QS4A 4NYFA 3NGZA 1RT1A 4OKKA 1Y97A 4CF9A 1FXXA 1BQMA 4FLWA 3THVA 4KPYA 3I8DA 3NGYA 3QEPA 4M3YA 5HRRA 4CF1A 4CHNA 5C25A 1BQNA 2A1SA 4JRQA 1HYZA 3CFRA 1NJXA 4FK0A 3TAEA 4DU4A 5J2NA 3NF8A 4IBNA 2GBZA 2IS3A 3EY1A 3SNNA 4FJIA 1HJRA 1D9FA 5CZ1A 4OPKA 3AO4A 1HMVA 1CZ9A 1T7PA 4F2RA 4KAZA 1EP4A 4PUOA 4FZYA 1LAWA 4IG0A 3V1RA 1X9WA 1W9HA 5JS2A 3RMDA 4FJKA 3C94A 3O3GA 3P83D 5T7BA 3CM6A 1NKCA 1KFSA 4B9NA 3OYBA 4M3ZA 3DRRA 4FM1A 1TKZA 4K8XA 3KKSA 4CERA 4EP5A 4JS5A 3PX4A 1JLAA 3AVNA 3SYZA 4FLTA 1U47A 2HB5A 4YNQA 4FCYA 1S1TA 3TR8A 3VQ6A 3WNGA 3VQ7A 1WN7A 5I42A 3ZSYA 1KTQA 1RT6A 3AVBA 3AVIA 4NCBA 1RT5A 3B6OA 1QE1A 4M3RA 3K5LA 4H8KA 1VRUA 3L2QA 4FZXC 4FW1A 3AA3A 1XHXA 3OYLA 1RTIA 3TAQA 3PO5A 4B9LA 3CG7A 4OVLA 2LSNA 4HTUA 5HRSA 3RMCA 1JXBA 2YHAA 1C1BA 4H4OA 3DRSA 1L3UA 3HPOA 1IKYA 4B9MA 4B8AB 1NK8A 4Z4FA 1IKWA 1KCFA 2WOMA 3MECA 4CF2A 3LDSA 2O4IA 2YV0X 1KFDA 2D0BA 1GOAA 1LW0A 1TK5A 1JLBA 5FDLA 3HP6A 4M3UA 4PQUA 4DG1A 1SKWA 4IG3A 1XI1A 3SQ2A 3HYFA 1RNHA 3SUNA 1QSSA 1UA0A 3KLFA 1RBVA 4KKOA 4BE1A 4C8MA 4HUGA 1S6PA 3TANA 3ULDA 4FJJA 2G8WA 2EHGA 3AO2A 4M42A 1RTHA 3QERA 2GV9A 1KVBA 1YVUA 1WSEA 3NH2A 1FKPA 5SWMA 5JS1A 3F9KA 3L2VA 4CEZA 2HVHA 2X78A 3LZIA 1EXQA 3OYDA 4OGEA 1IKVA 1WSFA 2G8HA 1LW2A 4RW9A 4FJHA 3ZSVA 4J2AA 4J2DA 3TAPA 3PV8A 2OZMA 4ELTA 1RBSA 3MEDA 5EU7A 3ITHA 2NUBA 1RT2A 3V9SA 4CEQA 1FKOA 4CIGA 3NH0A 5KI6A 1U04A 3SPYA 2XHBA 2VG6A 3RRHA 1SUQA 4O55A 4Z4CA 4N56A 4CK1A 4R5PA 1NK4A 2KTQA 4DSIA 4FYDA 2IC3A 3CYMA 1YT3A 4FJ5A 3VN5A 4CEEA 2OPPA 1WAFA 1W0HA 2O4GA 4FLYA 3QO9A 1CZBA 4DS5A 3U3YA 2HMIA 2FBVA 4I7FA 1HQEA 4ZTJA 4KO0A 4E7IA 4CHZA 3O3FA 3V4IA 4DMNA 1KLNA 1EX4A 4OKJA 3TARA 4IDKA 4BDPA 1NKBA 3AVLA 4W5QA 1J5OA 1UA1A 4B9TA 3WNHA 5HRPA 5HROA 4OLAA 1R0AA 1RBUA 4CGHA 3DRPA 4GVMA 3OYAA 1BI4A 1KVCA 3OS1A 3SUPA 3QETA 4FJXA 1B92A 4FJLA 2FBTA 3RR8A 1X9SA 4BACA 2JGUA 2VG7A 2ITGA 2JLEA 3C6TA 3VQEA 3NH1A 1VSIA 3L2UA 1TKDA 4E89A 4PA1A 4C8NA 4CJFA 4CF0A 4DWIA 2F8SA 4CE9A 2ETJA 4Q5VA 3T3FA 2HNDA 2G8UA 4KRFA 4CJTA 3PUFA 1S1XA 3DYAA 3MXJA 4OGCA 3DLBA 4RG8A 3AVKA 2G8IA 3L3VA 2IAJA 4EP4A 4O0IA 4HUFA 3NF7A 4M45A 3M8QA 3JYTA 1UOCA 3PX6A 2DTUA 3NDKA 2X6SA 4E7HA 4DSEA 3IS9A 4GMJB 4CJLA 4DFKA 3TI0A 4KB1A 1TKTA 4ZTFA 2BE2A 3TAFA 3VQCA 3KK2A 4CIEA 3HXMA 2BGGA 4LSLA 1U48A 3SZ2A 3ZT2A 1N5YA 4OJRA 2HHWA 2D0CA 4DTXA 3LAMA 4I2QA 2KZMA 2ZQBA 4DF8A 4BWMA 1D5AA 5I3UA 1SKRA 3RWUA 4CJUA 1RDBA 4FZZA 4IKFA 2E6MA 2Q3SA 3C6UA 1G15A 2YNHA 1LWFA 2ZD1A 3JSMA 1JLCA 4CFCA 5J1EA 5C42A 2W42A 4FJMA 4N47A 3P5JA 3M8RA 3ZT0A 1WSGA 3AVHA 1Z25A 3ZCMA 1SKSA 4ELUA 4CHYA 1C0UA 3SV3A 3AVCA 1WSIA 2VG5A 1S1UA 2DY4A 4CGIA 3U6FA 3AVMA 3K57A 2DFFA 4FK2A 3LAKA 1BL3A 4DFPA 3AV9A 4AHCA 4ELVA 4CF8A 1RT7A 1L5UA 3QEIA 2P5OA 3T1AA 4PY5A 4KTWA 3ZT1A 4CHPA 3HO1A 4GW6A 1VRTA 2RN2A 1O1WA 3OS0A 3AO1A 3F73A 3UIQA 1JL2A 4I9QA 3HVRA 4MQ3A
chains in the Genus database with same CATH superfamily
1FD9A 5JQGB 1NJYA 4GX5A 3KK3A 4J2BA 2GTAA 2RDCA 2P1JA 3NVKA 4IYHA 4DB3A 5GAHP 4WYBA 2P9KA 1H38A 2FBWA 2HHXA 5ITZA 1KC8O 1K9MO 1K4DC 3JAKB 4B3TO 4L3QA 1GTOA 4DR7B 1PL0A 4F4LA 3LDLA 1ASVA 5A2QO 4ID1A 5L3GA 1W7AA 2XAHA 3OD4A 4UQGA 4CI6A 1DLBA 3PIOL 3OW2M 1FXKC 3D36C 2GX9A 3VQDA 2OA8A 3OTOB 1C0TA 2RKIA 4X8AA 3ZX2A 3OTOK 4MLHA 1TK0A 4R79A 4C1NK 1DKGD 3V9ZA 3ETGA 2B1IA 4IEEA 4DLGA 1I94O 2QK9A 1ASWA 3QIPA 1VQ9N 1N34O 3GG4A 2E2QA 1VSDA 3VESA 4WF9L 1XNRB 1ZBFA 3E8HA 5EYPA 4KREA 2RF2A 3AE4A 3JS6A 1HNWO 2Q0AA 4H44B 4I9LA 4X88A 5JQGA 3G10A 1PV0A 4YTNA 4MS2A 4DV0O 5HLFA 3OAAG 2VS0A 4NO7A 5CA1B 2V52B 3EL2A 4YDUC 1VQ7N 4YJ3B 1HW7A 2VGNA 1MMMA 2WLIA 1PIV4 3ABUA 1XQSC 4AILC 3AK3A 3HI0A 1IG9A 1NK9A 3ABKB 4DSFA 2FTKA 4DUZK 4LF9O 3CXHF 5IYZA 5KX5B 2KQ2A 1VSEA 5SZTA 3V6DA 5B3SC 2CAZC 3T1CA 1BIUA 1WAZA 5DN6G 4MTFA 4KHYA 3NHGA 3QINA 2QSAA 3CD6N 1RFYA 1HQUA 2UU9K 3KTQA 4BAYA 2PFUA 3LNMB 5EY4A 1RSOA 1YTAA 1HPZA 2CGLA 2P9IB 3MN5A 4J2EA 1K73W 3P1GA 3ZRSA 3VF4A 4YHHO 4JI6O 2DYRC 2VYPA 1Y64A 4CEBA 5J2QA 3SCXA 1TAUA 1T03A 4WFAV 3A5MC 1ROPA 2JIZG 4FLZA 3O8MA 4GVEA 4CZEA 2BOCC 1HKGA 4YIPA 1FW6A 5GIOA 1NKEA 4HTLA 2W0FC 3VPZA 4JK7A 3TTDA 2QXFA 1H2GA 2OCHA 3IGAC 5GAGP 4CBWA 4B3SB 4UVBA 4CH5A 1REVA 2VWJA 1DTTA 1YTUA 1RTDA 1VSKA 1MSDA 2ZJRL 3HM9A 3QO7A 3AG3B 3HSTB 4I2PA 1NR1A 5LHIA 3BDPA 2IJHA 4ABMA 3O9UA 3CEIA 4MSWC 4CGGA 4LFAK 3NE6A 5GAEP 5FPNA 1U6ZA 2L6LA 4I6MA 3L71H 4B3SO 4CJVA 1AB3A 4R6ZA 5IDJA 3UT5B 2JEXA 2QTSA 5BMVA 1VQKN 3P4RA 1JKHA 1JQ0A 5CB4B 1IVSA 2FSNA 2RE2A 3U9DA 1N8RO 4FPAA 5EBLC 3KVGA 1S72N 4YXDA 1SZ2A 4Y1DA 3MCAB 4M3WA 3A5LC 5B1AB 2Y1JA 1NGDA 1C0GA 4LH7A 5KRTA 3CHWA 4DV6B 3O4QA 4Z4EA 1N36B 2EIJB 3OR7C 3JCZA 3LUTB 1W0KG 4CH4A 3AVAA 1T05A 2VWBA 3OYNA 1HNVA 2HHSA 5E26A 4DFMA 4H13B 2EWSA 3EZ5A 3MD0A 2PF4E 4EB6A 4F6RB 2OIGA 3T1HB 2QM7A 2YHYA 3VEOA 4CJ4A 4EFBA 4YY3K 1XNRK 3C0BA 4RW4A 3A0IX 5AQFA 3EYZA 5JLHA 1P7GA 3NAEA 4KBOA 1NENA 1WLJA 5FRMA 1W0JG 2QE7G 1OVYA 1NH2D 2E2OA 2JK5C 3DMJA 4X64B 3BRCA 3LPUA 1YSCA 2LW7A 3LDDA 3VQPA 1KQSM 2P9IA 3UO2A 4PKGA 1BCOA 3S3XA 5JVGL 2P9LB 3AA2A 4M3XA 3AK2A 4GKKB 1EBOA 4KH4A 4CECA 3OMAB 4U7NA 2NRXA 1LUWA 3ZSOA 4I4TB 3B6PA 1NKDA 5K14A 2GWJA 4A2AA 2YDEA 3FFIA 2ETNA 3JSLA 1TKXA 1GLDG 2NLJC 3HBTA 3UE5A 1R3IC 3M8SA 1YJ9V 3ZN0A 1S22A 4Y1CA 2ATKC 4UCVA 4FJ8A 1TL1A 1BI4B 1AVMA 5M1OA 3AE3A 1SETA 4JAAA 4DQQA 3KLHA 4KHSA 2XAFA 2XASA 2NRRA 3JARA 3KZIZ 5KTQA 5GONB 2OTJN 4Z4IA 4OXSA 1KBHA 3P4IA 3KLIA 4Y0WA 5FRNA 5LOVA 4DSJA 2QWRB 4CZJA 3AEGA 4JKGA 1BOTO 2Y48A 3DM2A 3VA3A 2A1RA 4JI4K 3M6GA 3L72H 1NGIA 3D7EO 4DTJA 2KZZA 2WSSG 3T1YO 2P9PA 2YCHA 5LYJB 4FVUA 4FWQA 4O8KA 4DV0K 1KRPA 3RYHA 5KLVH 2F23A 2Y0PA 1J9AA 1V9PA 5KQDA 3ZN1A 3WXMB 5A9GA 4BRDA 1OCCC 4EZ9A 3BY5A 2Z1JA 1S3XA 4DTRA 1G6UA 1TVRA 3SJHA 1AP6A 2A7WA 4FJCC 4JNEA 2HEPA 4JKGB 1EO1A 1ESVA 3F5TA 3AO5A 4YSXA 2Q1NA 1H8HG 4CGDA 4DU3A 3DLEA 4N41A 1H8TD 2D5RA 3GWOA 5LOVB 3CCQN 3WB1A 1SZXA 3BEHA 3CRQA 4UCTA 2IOCA 3SR2C 3DLGA 4IFYA 3FI7A 2E6LA 1AI7A 2MW2B 5ITZB 3ULEB 4HBNA 2YEVA 1YCIA 4C8KA 1RVF4 3QNNA 4LF8O 1S6QA 4MVOA 5KGWA 1EWQA 3ABLB 3AE7A 1U45A 1S3JA 5AZJB 1A5XA 1TUUA 1SRYA 3GQHA 5JCOC 1LCUA 3HP9A 2ZINA 3QLHA 2LO1A 5LHHA 4H0VB 3TSUA 1ZBLA 4P30A 5KRSA 3MWTA 5AQUA 2E74B 2HHHB 1ZL8A 3KWGA 5C2DA 3OYJA 4YTMA 2G8FA 3CP1A 3H01A 3D36A 4X20A 4BRAA 3SUQA 3AVGA 3D0PA 1FXKA 1VSMA 2B5JA 2UXBO 1J53A 1HDJA 3HL8A 3RVYA 3T2MA 4CJPA 4W5RA 4JI0K 4U7BA 4NYNA 3FX7A 4KHNA 5IJ9B 1XHZA 1J54A 1KXPA 2PZSA 4M41A 3JAWA 2NRVA 3RR7A 1BUPA 1SL0A 3ZLJA 4YTPA 2WQYA 4YFUA 3LDEA 3AEBA 2JJ2G 4JGSA 1QQOA 3SLCA 4DTUA 4ZI7A 1OCOC 1S1VA 3HRGA 4PL8A 5AQMA 5LMNK 3K5OA 1FPOA 1NVPD 2Y69B 3X2QC 3W7UA 2XY5A 4M3TA 5KA5A 4GKJK 3H3NO 4MFBA 1AP5A 4KX6A 1YUWA 3JAWB 4DV5B 4PI2A 4MVZA 5JVDB 1YJWN 4NCAA 4Q4Y4 3E83A 4FL9A 4EHTA 3HKBA 1Q9XA 1NGJA 3CQ8A 4JI7B 5KHJA 1YQ3A 1FXKB 4P9OA 4X20B 3ZRWB 4TV8A 3M8PA 5CB4A 2P4VA 4B3TB 4MTXA 4UB8Z 3LZJA 1AR94 5HP1A 4CCHA 1C6VA 2ZE6A 1ATNA 4OKKA 4GB34 4WFNL 3THVA 1BQMA 2YXHA 2QM4A 3I8DA 1XDCA 3VERA 5HRRA 4CHNA 3VRBA 1JVMA 4CC6A 1HYZA 2LGQA 3TAEA 1VQLV 1K8KB 2FF6A 4DU4A 1VQMN 2IS3A 3WQUA 1LR1A 4OPKA 4F2RA 3H1JH 3AE5A 1LAWA 3ZRWA 1Y67A 1NGCA 1BA1A 1NBMG 4GLXA 3O3GA 1NKCA 4W4KA 1ZBSA 2ASPA 3OYBA 4M3ZA 3DRRA 4DR6O 2QEXV 2ZXWC 1S0VA 3THYB 4K8XA 5BPMA 3BY6A 4JS5A 3AVNA 1FFXB 3ASNC 3SYZA 4HZ3A 2R074 5JVDA 2GTSA 4O5FA 2P67A 4NKGB 5BPNA 2ZR3A 5I42A 2NR5A 1KTQA 1RT6A 1MDUB 3ASOB 2WS3A 4JYCA 4DV2O 4D6TH 3ZEUB 1MQTD 1IURA 4FW1A 2JGDA 3OYLA 4JYAO 1RTIA 4DR6B 1I7FA 2HJDA 4PA9A 3KWIA 4HTUA 1SA0A 4MT8A 1RUC4 3VQXA 2YHAA 3ABMC 1C1BA 4IJNA 4CVNE 1L3UA 2YICA 2YHWA 3HPOA 4BRCA 2VQFB 4B8AB 3FYEB 4QNHB 1IKWA 1KCFA 3F9MA 4YIOA 2PAVA 4ILJA 3VGMA 4UV9A 4XBFA 4GZRB 4DR1K 5CMUA 4FWKA 3HP6A 3QO5A 2ZCEA 4LF5K 2FMLA 2NNWA 4M3UA 4DV1K 4PQUA 3O80A 5KMGB 3AE1A 4K0KO 3ETDA 3G71V 4BROA 3SQ2A 3VOUA 3EZWA 1VP7A 3KLFA 3W7XA 3T4DA 3FD9A 3LL3A 5AQOA 1YJNN 4C8MA 1AROP 2I7PA 3GE1A 5EYPB 3CI5A 1YVUA 3IDHA 5AZJA 5JS1A 3I56N 3CCJV 2HVHA 3LZIA 1XQ8A 2P9LA 1J6ZA 1EXQA 4LR3A 3OYDA 2G8HA 1WSFA 2YEVB 4YXWG 1BSMA 2KKWA 3VTHA 1RHI4 3RN4A 2HWC4 1NQTA 1Q86W 3ZSVA 4BR2A 3NXSA 1GN3A 1ZXOA 3B4SA 3PV8A 1M57C 4Z1VA 4G2KA 1IG8A 2Y4UA 4UCRA 2PGGA 2GBOA 2UYTA 1FKOA 1L8DA 4CIGA 3SPYA 5JH7B 4ZOLA 3RRHA 2YX6A 4DV7K 3RYCB 1W97L 3QMLA 4XH5A 4YT0A 3ABKC 5AJ3K 4U3FH 5EIBD 4A2BA 2C2AA 1W0HA 2O4GA 4DS5A 1R3KC 1PPJH 4I0XA 1CEZA 4IFEA 2P9KB 1YEWA 4UY8O 1HQEA 2IJIA 3O3FA 4OKJA 1KP2A 3AVLA 3HKDA 1NKBA 3SAGA 4LFAO 4W5QA 1VHXA 3O9RA 1SF9A 4K25A 4L8JA 1UA1A 4JI1O 3OUSA 3CCVV 3WNHA 3H1LH 3P39A 5HROA 4Q4X4 4X1YB 2I7NA 3UT5A 4G9ZA 1T5EA 3CD6V 3EEQA 4CGHA 4UCSA 3DRPA 3OYAA 2UXDK 1BI4A 1KVCA 3DWLA 3QETA 2EILC 3ZMSA 4LF6K 2ITGA 3MX2A 4JAVA 1BO5O 1VMGA 3FZFA 1TKDA 4JV5O 1HP8A 4EFEA 3CMAN 3L9DA 3H9VA 1I5YA 2UUCK 1NGBA 4CJ7A 2PI5A 1C0FA 2KLAA 1M1KW 4J41A 1RM1B 1UFIA 3T3FA 2HNDA 2ZNIA 3SJAC 3CIPA 1TYQA 3PUFA 1GN2A 3BAAA 4DYLA 2IVOA 3ZX0A 2RHKA 3SPGA 3BABA 4WF9V 4HUFA 3CC7N 3AG3C 3E86A 1UOCA 3PX6A 2DTUA 2EIMC 1AILA 1AI4A 4GCZA 5D5QA 5E79Z 4K43A 4QGPA 3SYOA 3IS9A 4E7HA 3TI0A 3WU2Z 4UB6Z 4ZTFA 3CC4N 2W6IG 4BR6A 3OT7A 4CIEA 1VQOV 3HXMA 3SZ2A 2HHWA 4LP8A 4BW5A 1I08A 3LAMA 1VQLN 1EN6A 4IO9L 2QWQB 1VQNN 1NA1D 3C6UA 1RSOB 2OTJV 5AQXA 3K9KA 2ACZA 1N0NA 4CZFA 3J7AP 5ELZA 5C42A 2W42A 4KH5A 4N47A 3CCUN 2RMKB 3M8RA 4DR4K 3ZHQA 1BMFG 4IEIA 4UXNA 3AVHA 2UUBK 4ELUA 5LGTA 3SV3A 4F6EA 4IOXA 2VQEB 3RWRD 2VG5A 3U6FA 2ILMA 4GV3A 3F5WC 3ATUA 3AV9A 1RT7A 5BRFA 2LW1A 4OX9K 4YJ3A 1VRTA 2V4DA 1O1WA 4KAZA 1EFRG 3CJ9A 4MQ3A 2EZOA 3TTFA 1E1RG 3U9ZA 3JD74 3OGIB 4K0KB 5L3BA 4DR1B 1YXBA 4IHJB 3O9OA 3VBBA 3VR9A 3AEEA 4H0TB 4E1MA 2RR14 4WQ5A 4IT5A 3WXKA 1HR0K 2A5XA 4JI7K 2WP9A 3T1HO 2RNBA 1LUVA 2IW5A 3H08A 3VQ4A 1KSPA 1EQYA 2DQ3A 1F23A 4ZKIA 3NGIA 4B8CA 3K08A 1DLOA 5GIPA 3VQ9A 3ZRVA 4JI8B 1L3VA 3RYCA 2LP7A 4LF7B 3QIOA 4DR1O 1H2MA 4CIFA 1XEQA 3WNFA 2F66C 3MXIA 3L73H 1X9JA 2I5JA 3DLHA 3SQ4A 2EZPA 5FNVA 1VF5B 4O0JA 4K0KK 4HCBA 5CA0B 3OFNG 4LFBO 2EINC 1EETA 3C7NB 4PV1B 5F1XA 5IYCO 3E8BA 4I50B 1WPXA 3V9UA 1V55B 2PBDA 3FB7C 1KAYA 3QESA 4JLHA 3TETA 3J7YP 3CJCA 3HK2A 4CH3A 4U7OA 5LJWA 2Y69C 5LP6C 3B8MA 1YF2A 1RT4A 3IJ4A 4B1VA 1J95A 3R8EA 2R7YA 4MVMA 1VBC4 1KLMA 3V81A 4LFBB 4KHPO 4JAUA 1RDUA 4H33A 3OYHA 1P7BA 4QS8A 1MNGA 2WLIB 2OPQA 4DFJA 4PD4F 3E66A 4E4EA 1A5VA 1EM1A 3BZCA 3OYKA 3CFPA 4FOIA 1NK7A 1WLEA 1X3NA 4DRXB 3MEEA 3I55N 1ASUA 2E5LK 2ZIMA 1XMOB 3S9HA 4I55B 4PA3A 1GLCG 3J8F4 2W6KA 1L0VA 4B1YB 1DF5A 2BANA 4P2ZA 3E1YA 3LP0A 1P4RA 3SNNA 2G8VA 1G99A 2GHYA 4HHTA 1VQON 3THOA 3AO3A 1R084 3CM5A 3EE9A 5CE3A 4DR4B 2Q31A 1VQ5N 5FLXO 4C8OA 5LMNO 2WDQA 3VEYA 3J81O 2CH6A 1W2BM 1NGAA 3NFAA 1TK5A 1N36K 3AVFA 4RHV4 1YIJN 1XC9A 1NG9A 1Z26A 1ZBUA 2QR4A 1HRHA 3JBG4 2YHBA 3I5DA 3RVZA 1OVQA 1XC3A 1KECA 4ZHRA 2VWKA 1C1CA 3Q7CA 1NJIO 1WP7A 2D2CB 3B8NA 3JD2A 3JAKA 3IRXA 1VQ6N 3D2FB 3MHHC 2CGNA 4MVSA 4O4LB 2Q6AA 2P9NB 3OS2A 2X6NA 4BWAA 1MU2A 2CK3G 1Q7YO 1L1FA 2WU5A 2B4JA 3N2KB 4NLBA 3JD3A 1KD1O 5C2TA 3OY9A 3ZS8C 3C3SA 1HYSA 4NLCA 2N74A 4CEDA 2G38A 3SYAA 4X9QA 5DMRA 1W59A 5LMUO 3BF1A 4WFGA 4CD3A 2DPNA 3SI6A 2WPDG 2H8PC 3ABVA 3OA9A 1BCMA 1NJWA 1F51A 1RCHA 1ZBIA 5KHHA 1ZP0A 2UUBO 5LHGA 2IDOA 5AQRA 3DOLA 3R3LA 1S9GA 4MDBA 3HB3B 1M5IA 3DGEA 4EEQA 1LWCA 3MXMA 2FBYA 4KHUA 1OCRC 4W5NA 4KV8A 4JF3A 3APOA 3K58A 3LDCA 4F4KA 4JI4B 5EX5A 5C2FA 5LMUB 3LP2A 5L3DA 4FWSA 2R064 2A3QA 1P90A 4AHRA 4BVOA 4JRPA 2BTOA 3A2FA 2ZKOA 2BTQA 4JI5K 1PNLA 3RMAA 3QF7A 3K9SA 1JOYA 2QKSA 5KHKA 4O8UA 3OVNA 3OBWA 1D5NA 1N36O 2RPIA 5AZIA 4JN4A 3T1HK 1OH7A 4WFEA 3RYIA 1XBLA 1JMKC 1KKCA 3R6MA 3D2EA 3R9PA 1IKXA 4A5BA 4X1IB 1VEWA 4CGFA 3BP8A 3VGLA 2X7RB 2BUPA 1T6DA 4O4JB 2O8EB 2QWPA 3WB2A 5ADXA 3V1QA 4RWUA 1OH5A 1HXS4 4X64O 3CCUV 1ZL8B 1AI5A 3DLKA 4NB5A 3ZETA 3AG1B 2IGIA 1QR8A 4C8LA 4FJGA 3CIRA 2ZE8A 2OPSA 3PX0A 3O5BA 3DAWA 1JFFA 3EO3A 2X0LA 2QWLA 2CTPA 3CCLV 4CJKA 2HHVA 4XDJA 4DR7O 2LFSA 2EBOA 3RSEB 3V1OA 4M63C 4CJSA 4BIZA 2WUSA 4CEAA 4HCCA 5IY5C 4KHQA 4YOUA 3CC4V 4NCGA 1YHQN 5JICA 2Z3YA 3ABMB 3RBZA 2VQEO 3K06A 3CS5A 1Q81O 4X1KB 4X65B 3VENA 3DI6A 3TAGA 4CBUA 4WCEV 2E8AA 3KCYA 2WLLB 3U0ZA 2FBXA 4A59A 2DE0X 4DV2B 1L0NH 2NNUA 4IIJA 5MLCQ 1US6A 4GT1A 3E2EA 3BF3A 4PA7A 3CPEA 1IBMB 3ZX3A 4LF5B 4EAHD 3F7VC 1IBMK 1D9DA 4JYAB 1UWBA 4A57A 4DSKA 3HPGA 4YJ2A 3SUOA 5DM7L 1RP3B 5LYJA 4AF1A 4DR4O 3QNOA 2HVIA 4E7KA 3P3PA 2XY8A 4LH4A 2WDVA 1E1QG 1HNWB 1I39A 3SMSA 2KFNA 2ITDC 3O4NA 1WA8B 1ASJ4 4JS4A 2X74A 2HHHO 3VR8A 4AHSA 4AM7A 2PY5A 4BC5A 2H89A 4NTWA 1H2KA 3C95A 5C15A 5CHIA 1GOBA 1UAXA 1C1AA 1VBA4 4DK0A 1VQPV 3QEVA 1O9GA 4DTSA 2A40A 5FL7G 4BDYA 1KYOF 1NR7A 2UXBB 2DOSA 3W7WA 4TSFG 5KHGA 4UVAA 3NF9A 1XOUA 3ICXA 1P8ZA 4MLEA 1RDCA 4E0DA 3DJCA 5D5PA 4CJ3A 1A5WA 4FOEA 2ITCC 2HHQA 2HWB4 1KC8W 1K9MW 4KTQA 3ZMVA 1QLEC 1NK5A 3JYCA 3CYOA 5BRDA 2N04A 1I94B 3PJSK 2YXYA 5KA6A 2HSTA 3E22A 3ISNC 1VSFA 4KI6A 2A06H 4B9VA 3K0GA 2PI4A 1NM1A 5HFMA 3OR6C 1VRH4 2KG7A 4DUYK 3DLRA 4PL7A 4B3MO 4DK1A 3M1FA 3HVTA 3WUHA 3J7ZO 3U3GA 4DV5K 1C0MA 3CJ1A 4KHPB 5FROA 3T69A 2KSDA 2FSJA 3JSNA 1Q6UA 4KHPK 1E4FT 1NOZA 1UPGA 4PHZA 2ZGZA 3VEVA 1E3MA 1SQPH 4JKHA 2F95B 3ZSQA 3AEDA 4WQ4C 3S3NA 2B76A 3VGKA 1MZFA 5AQSA 4TSXA 5GW7A 1QHTA 3ZIAG 2X6CA 3FB8C 4DW0A 4F6RA 3P38A 4WE1A 3KJVA 5LMUK 1VQPN 4BY9C 5ADXH 2IJJA 3BVOA 4PELA 3J7AU 4FJ9A 5H6RA 3H46O 2HF3A 4MTOA 4DCHA 1PP9H 4ID5A 3CHXA 3I0SA 1PD3A 3L70H 3LM9A 1M90O 4DSLA 1EKEA 2DW4A 4KHWA 4JI2O 4CJWA 5F0XA 3ZSXA 1WAJA 5BR9A 2HVKC 1AR4A 5LBQA 2WFBA 4NB4A 5AQPA 3HOTA 3LANA 5H1SQ 2CUGA 1PM9A 4NXMB 4J8FA 5AQIA 4ILGB 1A32A 2DN9A 5BY1A 3SMPA 4O2AA 1Y97A 3RYFA 2Q68A 4I6MB 4CF9A 4KPYA 1BGYH 3G25A 1JCFA 2NRWA 4DKWA 4O4HB 5J2TA 4FWMA 4IXCA 4M3YA 4IDHA 2UUAO 1ZX3A 2YIBD 1BQNA 2A1SA 3CFRA 4RTFD 2QKAA 4BREA 1X9MA 5J2NA 3ZHTA 2O8FA 2GBZA 3OTOO 4JI0B 1D9FA 2UXCB 5CZ1A 1ENVA 1HMVA 3G6BA 3I55V 3QICA 4FZYA 1KKDA 3V1RA 1X9WA 2QDOA 1W9HA 3RMDA 1BEV4 3P4PA 1L0LH 3C94A 4IOCL 1AI6A 3N2GB 1U97A 3CM6A 1ZWIC 1KFSA 1WUAA 4HNAB 3KKSA 4CERA 1BS3A 2A9HA 4I9WA 4KFMA 4FLTA 4FCYA 5B5EZ 1KQSU 1RUD4 3FAVA 2AHZA 2H88A 2VQFO 2V51B 4J7KA 2Q7HA 1IV0A 2BH1A 3H1IH 1ATRA 5M1PA 1RUH4 3CCMN 1K5QA 1URFA 1K33A 4FZXC 1Y76B 4H03B 2PTMA 1JJ2U 1N33O 3STZC 3OMNB 4O2BB 4OVLA 4B9LA 3K03A 2LSNA 5HRSA 1NH2B 3RMCA 3D6RA 4FPBA 1IX9A 4DR5B 2Q36A 4LNUB 3DRSA 1IKYA 2RS14 4BRNA 1HKCA 4OPHA 1OHHG 3MECA 4JD2A 1YJ9N 5KX5A 2YV0X 1KFDA 5KHIA 4J11A 4PA4A 5AQZA 5CBGA 5EBWC 5GTIZ 1LW0A 2YHXA 1Q81W 1R3JC 5FDLA 4JI2K 3VMFB 4BR7A 1K73O 1PL4A 1LNQA 3M8AA 4ZHQA 4DG1A 1TVKA 2F43G 2WLJA 3AG4C 2V1DA 4FMTA 4OPAA 1OZ0A 2J4RA 3O6WA 4IWVA 1DF4A 3EN9A 1R3LC 2AGAA 2NRZA 3SUNA 3AK1A 4DR5K 1NZ6A 1UA0A 1QSSA 3N4QA 1S6PA 5FPEA 5FPRA 2G8WA 1AJNA 2DWEC 5KQ8A 5L3CA 4UVCA 5AR0A 2WLKA 2RM24 4ISGA 5IYDO 1QZ6A 2GV9A 4WFBL 1KVBA 4HWIA 1WSEA 1GO3F 3C65A 2AP1A 4MTGA 3F9KA 2QI2A 5DEDA 1DGKN 4DV7O 1NNEA 3HKEB 1S72V 3R1XA 4FFKA 1IKVA 2HHHK 4OX9B 1YQ4A 1V55C 3GQKA 2H3GX 3EKSA 3P31A 3KG2A 1YVNA 4FJHA 1MZEA 4WQ4A 5GADP 3ZMUA 3P30A 2ZWHA 2OZMA 4ELTA 3U10A 1SQGA 4IYIA 1QCEA 2NUBA 1U2VB 4CEQA 1NTMH 2YXLA 3CCJN 1Y76A 5LXTB 1SKVA 1QVGM 1KMIZ 1U04A 4WFHA 1Q86O 1TA8A 4JTDB 2XHBA 4PDLA 2YUAA 5AQLA 1SUQA 4Z94A 1JJ2M 1N4CA 4CK1A 4R5PA 2H3OA 1P84F 1VF6C 4FYDA 2O8BA 2P6JA 4MW8A 3VN5A 2O8CA 2OPPA 1WAFA 1YZBA 1CZBA 3ZRXA 3JCUZ 1N33K 2XAGA 5EOYA 1DGSA 4JV5B 4CHZA 5LP6A 1CPYA 3EXAA 2F1MA 2JWLA 4IDKA 3TARA 4BDPA 1EZJA 4LF9K 5JCOA 1J5OA 1MABG 1Z5WA 1IBMO 2ARHA 2FSKA 3K79A 4JI6K 4YOTA 3GDQA 4DW1A 2E2PA 2Q73A 3WG7C 1Z6RA 4BVPA 4B3RB 3OS1A 1M1KO 2CGJA 1R6NA 1B92A 3RR8A 2JEUA 2H94A 2CH7A 3VQEA 4BACA 2VQEK 2AA4A 4ZBMA 4C7UA 4PA1A 1XMOO 1M56B 2ZR2A 5LA6A 4H5WA 4CJFA 3SAHA 3THXA 5HOOA 1F4MA 4A61A 4DWIA 2F8SA 3AY9A 3AG7A 3E9PA 3Q4HA 1MWMA 4CJTA 3DYAA 4OGCA 2KQXA 1KD1W 4JI0O 1BZKA 4O0IA 4B1XB 4XH1A 4EHUA 4M45A 3M8QA 1T3VA 1GM8A 3ZYYX 3JYTA 1NEKA 3NDKA 2X6SA 2O8DA 4DFKA 4GMJB 4KB1A 1ATSA 2EJ7A 2YC0A 3AARA 2UUAK 1TKTA 3TTCA 3TAFA 1Y74B 4MW3A 1U48A 1N5YA 2JS3A 3SJQC 3CCVN 2KZMA 2E5LB 2ZQBA 4DF8A 4BWMA 1D5AA 5I3UA 1SKRA 2P9SA 2XT9A 4CJUA 2HP8A 2HVJC 4JI3O 1S5LZ 1LWFA 1I94K 1JA8A 1WP8A 4DUYO 1M9NA 4B3SK 4NXMO 3C6AA 4WBNB 3OTFA 3SGIA 3P5JA 3DXRA 4CS3A 3MN7A 3ZT0A 1WSGA 4TUYA 1VBD4 2P9UB 1Z25A 1AR5A 5LL6Y 1C0UA 2Q5ZA 3CJ7A 3SPCA 3AVCA 3CRRA 4CH6A 2UUAB 3AEAA 3K57A 2HF4A 3GVMA 3CCSV 1BL3A 1NTKH 2UXDB 4DFPA 1PNKA 2W0XA 3QEIA 1QVFM 2R72A 2UUBB 4PY5A 3W7TA 2Z5UA 1VIBA 2QW9A 1Y6XA 4H0LB 3ZT1A 4JTAB 2A0LA 3GBTA 4DUZB 3FLCO 3F73A 2KHOA 2QTDA 2QWMA 3VRAA 5IJ0B 3HVRA 2IJKA 3HM8A 2BE3A 4H4MA 3LPTA 1JPXA 2OZSA 4LBEC 4P9PA 1XL4A 2E20A 5CYQA 4FJNA 4FXDA 2YJEA 4R50A 2HOEA 3JD1A 2P4KA 3MWPA 3ENOA 3BGRA 4KH6A 1HWYA 4ICLA 3ZEDA 4DO2A 4JASA 4KFBA 4LSNA 4DV7B 1WNSA 3P4QA 3S3OA 1WA8A 3G67A 1TAEA 3K5MA 4DTNA 3CMEN 2ZDIA 4CJRA 3L75H 4AHTA 3ZMZA 1RBRA 2LJ2A 5EC1C 1HLUA 3AG1C 3SJBC 1NGGA 3KK1A 3VQWA 4RWTA 3F7YC 5JJEB 3RRGA 1GRJA 3KKRA 4LH5A 2E76B 3K9AA 4FWNA 1IH7A 1RTJA 3MCPA 4UUJC 2IU3A 2QKKA 1KAXA 2E2NA 4O5BA 3NR7A 3L8BA 4HVJA 1FFTB 5IY5B 1HJOA 1ZLZA 1QSLA 5CR4A 3QFUA 4CFDA 2Q7EA 2WA4A 3CJBA 5C12A 5B1OA 4KI4A 2A79B 1VQ5V 2XY7A 3WB0A 2E1YA 3VETA 1S76D 4W5TA 5J2UA 1OJHA 3DXKA 2OYQA 1ZYQA 4LF6O 3KD5E 2ZE5A 1HNZO 1VQ6V 1EWRA 2VGMA 2ZJPL 1I0HA 3HZ6A 3JALB 1Q82O 2WONA 2PYLA 1QQMA 3J80O 4E7JA 1NI8A 4I9QA 3JATB 2IM9A 4QCLA 3CJHA 5BR8O 2ZE2A 1VQ4V 5TKYA 3HPLC 3IFXA 4B3RO 3IG1A 4Z0UA 4BRKA 3L74H 3CX5F 4TUYB 1GH6A 3H45C 4EKWA 4JHDA 4H5VA 5B1BB 3H3OB 1WB8A 2P90A 4LFCB 2HNYA 3CFOA 2HBMA 4X1IA 4H5NA 3HKCA 2GDSA 3TABA 3KK7A 1HNXB 4BE2A 5M1QA 3LSQA 4QE7A 4JI2B 3PSIA 1AJQA 1U4BA 1IBLO 3ASMA 4NXNB 4F3TA 4H0OA 3ABTA 2F7TA 4H0YB 5B1AC 3TWHA 5C93A 4QAGA 2Q7GA 1JXEA 1XL6A 4Q6GA 3VQBA 1L3TA 1RUI4 1K5SA 1QLEB 4NVPA 1YXQA 4ZIBA 1UJWB 2VCPA 5CYMA 3QEXA 3QDKA 1YITN 4CBCA 1JLEA 4LCUC 4KTZA 5BN8A 1N6QA 1VQ7V 2QKCA 1SL2A 4UCUA 3SDLA 2D0PA 5LMNB 1BT8A 3KD1E 4DR3B 3JAMO 1VBB4 2HHUA 3BCCH 3HR0A 3E35A 4WCEL 2DFHA 5CY4A 1IO2A 3SFEA 4FM0A 4GX1A 2CH7B 4O4IA 4K35A 1WOQA 2YI9A 3OBYA 4Z4GA 2QTOA 2RJZA 4BRFA 1ILYA 1F7YA 3DLLL 2XRIA 4G1QA 1KU9A 5B1NA 1HR0O 1T44A 2D0OA 3SYQA 1NVPB 4PJ0Z 4QJFB 3ZSRA 4O4IB 2LGWA 3NMUA 1JL1A 4DUZO 2YNGA 4LY7A 4OKEA 3I56V 5EVZA 3DOKA 2UUCO 3A8YA 1GN6A 3KLGA 1KF6A 1Q8IA 1VF6A 1S9EA 4BDZA 1G8MA 1GM7A 1ITGA 4YY3B 1MG1A 2Z1HA 4J10A 1B9FA 1BHLA 1BU6O 3D2FA 3CCSN 3JASB 4CHQA 4FJ7A 2O8BB 3UM7A 1TUBB 2UXXA 1TK8A 1OH8A 1BE3H 4F3OA 3SPJA 2F8TA 5JMVA 2XO7A 2OCEA 1BIZA 2BSKA 3OYEA 3FZLA 5KGXA 4GV9A 2Q0UA 3G4SV 5KPRA 3UKUA 4CK3A 1K7DA 4RQEA 3SPZA 4QE9A 4WFAL 3HJFA 4FK4A 1S5JA 2QWOB 4DV6O 3EE8A 1OCOB 3VEZA 1NU0A 3VQ8A 3E8GA 1Q18A 1NT2B 3M99B 3WG7B 5CBHA 1B9DA 1FK9A 3CCQV 4RCHA 5BPLA 3HKCB 4QOZB 1FS0G 2Q0RA 3MEGA 1LWEA 1Z7S4 3APQA 3NBPA 3VQYA 1B06A 1CXUA 1OCCB 1CXQA 3AG2B 3JXUA 5LGUA 3MHSC 3ZHSA 4X66K 3THXB 4X66B 1Z05A 4DV2K 4BRIA 4FM2A 4DF4A 1EN5A 1U49A 1EV14 4JPRA 5EC2C 4ZHQB 4DTOA 2ODMA 2FF3B 4KP4A 3CPWM 5J2PA 4XDLA 2QEXN 2B5UA 4HAMA 1PNMA 4J9ZB 1G4YB 5DECA 4DV3K 2HG5C 3JALA 1JLQA 1YF5L 2RQ6A 4KXRA 4TV9B 1F21A 2BOBC 4H0PA 4KB0A 3UKMA 4CZGA 3DXKB 2L35A 3TU5A 3KZBA 1HNZK 4LC1A 3LP1A 1VQMV 2IH3C 4DQIA 2Q0OC 5JLFA 3CCLN 1Z2GA 3PLAA 1NJZA 4I50A 1J5EK 5F2VO 3KIOA 3CWBH 3CCRV 5JJNB 2JRIA 1GLBG 2Z1GA 3C7NA 3SQ0A 3ENHA 1HNIA 4XEIA 4Z2WA 5CA0A 4JI1K 3OYMA 4JI1B 3CSXA 4K8ZA 4CEFA 3AG4B 3RW0A 1SESA 3T4ZA 3O4WA 3UKRA 4I7ZB 5C3JA 5C8YB 3CMAV 3S3MA 5GINA 1QSYA 4Q0BA 4LWSB 2N05A 1MSWD 1TAQA 1K6YA 3LWLA 3CB2A 5HRNA 1HNZB 2XTAA 3C90A 3EHBB 5JJJB 3B8AX 3PN1A 4LFBK 4OLBA 4WFBV 1AR84 3LNNA 4YOYA 1KFYA 2NZTA 1SL1A 3LDNA 3GOIA 3VA0A 1GAXA 3P3NA 2WLMA 1QLNA 4B9NA 4DTPA 4JI8O 2QWNB 4B9SA 4TV9A 4CESA 3FB6C 1BQZA 3BA9A 4J7JA 1FKAO 3OM3B 1BHBA 4FLUA 1SS6A 3A5NC 3Q7BA 1WSJA 2BCCH 2XAJA 1FJGO 1VSHA 1D4M4 3IAYA 2HR3A 1SQQH 4RUFA 2DQ0A 2JS5A 2CH5A 2GWKA 3SPIA 1P49A 1QQCA 1HX1A 2NRHA 3CJAA 4ISEA 3W7SA 4DS4A 2AXTZ 1QR9A 3ZSZA 4DHYA 2OT5A 4MO4A 2Q97A 4CFBA 1GLAG 3ZHRA 2OWOA 5KAFZ 1V4SA 4B3TK 3P32A 4OX9O 1JX9A 1RPRA 4JYBA 1YJNV 3D8CA 3K2PA 3A8TA 3SJCC 4JKDA 3U11A 1YTFD 3H1VX 2B6AA 4BG9A 4YHHB 3NCIA 2WAMA 1H2NA 1VQKV 2RN9A 3WEEB 3ZSWA 1CXZB 2PUSA 2ATQA 1Q9YA 3AE6A 1Y66A 4FO0A 1N0JA 2F9WA 2Q4PA 2Y0IA 3EFFK 4JI7O 2W6LA 4B7EA 3ENBA 3OYIA 2KFZA 1FXVA 2DFEA 5FPDA 4X62O 3K9JA 1ZBHA 3VF2A 2W6JG 3W0LA 3O3HA 4L8RB 1Q3EA 3CPWU 4YOVA 4YOXA 2UXNA 4O4GA 3TGUH 1D4XA 2HHTA 3AEIA 1RUJ4 1KVAA 3AE8A 1TUBA 3WEEA 2FKXA 1WBDA 1SAZA 3CCEN 2O8DB 4CGJA 4NTYA 1GLJO 4UFZA 1POV0 4UCOA 4D7SA 2D4WA 1Q6IA 1RPOA 1NOYA 4TWKA 1I5XA 3ZMTA 4MO5A 2ZDIC 1TYQB 4JKCA 2D1KA 4IJAA 4O44A 1LV5A 2R7FA 5EZYA 3PY8A 1X1PA 4FW2A 1GK9A 1RT1A 1N32K 3TK1A 4BQLA 4FLWA 4O4HA 5FLXN 3H1QA 4J7ZA 2RS34 1WJZA 4YY3O 3NGYA 3QEPA 4JRQA 5E1AC 1ZSPA 4O2AB 5C25A 4FK0A 3AEFA 3F2KA 1NJXA 1MA1A 5EK0A 4IBNA 2ZQMA 4CZKA 3AGKA 2QWNA 4FJIA 1HJRA 1AJPA 3AO4A 1CZ9A 1M56C 3NVMA 4IG0A 1AL24 2ZM6O 3P83D 2Y4TA 1RM1C 4GY2B 4FM1A 4RUEA 5AG2A 5HFLA 3E89A 2YJFA 5AQQA 1ORQC 3BEXA 3O9TA 1S1TA 3WNGA 5C8YA 1JCEA 1WBBA 2EJRA 1SERA 3VQ7A 1WN7A 4PKHA 2EIMB 3ZSYA 5M1KA 3AVIA 3AVBA 4NCBA 3SFDA 5FPOA 4ZOLB 1MWKA 2GUPA 4M3RA 3K5LA 4E2LA 1O13A 4GKKO 1VRUA 4H8KA 3VQVA 4GV6A 3ZJZA 4JKFA 5IT9N 2WLLA 2D3OW 3O9SA 5LY3A 5BR8B 4FPPA 4FSVA 2F93B 2ZT9B 1JXBA 3QVNA 1M57B 3QG5A 4H5RA 4H4OA 2OCCC 1OKJA 4CF2A 4J80A 3AAPA 5AQHA 3LDSA 2Q9LA 4M7XA 2O4IA 1NGEA 1X4TA 4PKIA 4GUNA 2D0BA 4TQFA 2XOKG 1GOAA 1EZVH 4LFCO 1JLBA 4H0XB 4EFHA 2KB1A 3MX5A 1SC5B 3CXCM 4YSYA 4QPKA 2ZD9A 1N34B 1R59O 4IG3A 3RVCA 4JV5K 4WFFA 4K42A 4LF4B 4X65O 3GB7C 1M4UA 5KUKA 3ULDA 3AO2A 4M42A 1XUQA 2O8EA 3QERA 2P22C 4R8CA 4LF8K 1FXHA 3NH2A 1FKPA 1NBWA 3GWKC 1QVGU 1RDWX 5IE9A 2X78A 1PVC4 4OO1J 2DMXA 5BXZA 4CC5A 3N4PA 3D2EB 4JTCB 1LW2A 4LNUA 3ZBHA 4J2AA 4LF9B 2EILB 4X66O 1SA0B 3TAPA 1KP3A 2CTQA 2QWOA 3MN6A 5KPTA 4B7KA 3QNEA 5EU7A 3ITHA 5EXWA 1RUE4 4PDMA 4LWSA 4V19S 1YVWA 5KI6A 2BTQB 2OANA 2VG6A 5AQKA 4O55A 2WU2A 4PDVA 4DV4K 2IC3A 2QXLA 1NS1A 3JASA 4FJ5A 4CEEA 4QIWF 3QO9A 2B9ZA 3H6EA 5F2RA 2Z0AA 4CZIA 3U3YA 2HMIA 4PDRA 2Q67A 3HOSA 1K34A 3DC5A 4RQFA 2PLV4 3OE7G 4HNAA 4E7IA 2EINB 1HPMA 4TQDA 4DMNA 1KLNA 1IBKO 4PUOA 4BR4A 2NLXA 3DXMB 4B9TA 4DR2B 5H5NA 5IJ0A 4GYCB 2IIRA 1K8KA 3M5RA 4GVMA 2UXCK 1V54C 4LF4K 2JVDA 1XMQB 3TJTA 4DR3O 4BC2A 3OGCC 2VG7A 3X2QB 2JLEA 3C6TA 3L2UA 3NH1A 1VSIA 3N2KA 5AQWA 3PIPL 3M7MX 4CF0A 3SYPA 4LFAB 2EULA 3CRMA 4GKJO 4CE9A 3C3TA 4Q5VA 2G8UA 4KRFA 3TPQA 4TV8B 3AGRA 3G6EV 1OH6A 1VF7A 2HLDG 1HNXO 3DLBA 1NTZH 3ZHUA 4WBNA 4ICGA 3AVKA 2VQFK 3KHYA 1R6TA 5M1NA 4JI3K 4B1WB 5K1PA 1GN4A 4MVUA 1XNQO 2ITMA 4Q20A 3HKBB 4NXNO 2IVPA 3IFRA 4XH4A 2V7QG 5H6QA 1HKBA 4ILHA 1B6QA 3RYIB 4CJLA 2A3ZA 4DV5O 1LOTB 4F9OA 1XMOK 1WB9A 2F4VK 1XREA 2BE2A 4FFBB 5H9CA 2HJFC 2UU9B 4LSLA 2VRZA 4FFBA 3T7ZA 2FXUA 2XAQA 3TCUA 3RWUA 1RMU4 4HYOA 4LH6A 1RDBA 3L6QA 1G15A 2YNHA 5KUMA 3O08A 4CFCA 2HBLA 5J1EA 4CZMA 4I55A 4FJMA 4JHDB 4AQYK 3AECA 1SKSA 3CMEV 4CHYA 2MK3A 2ZXWB 5E84A 1WSIA 4AM6A 3RGBA 1HUXA 3MMVA 4DR5O 5CN0A 2DFFA 1R6KA 3LAKA 3ATVA 1H2SB 3I8BA 1R094 3JATA 1L5UA 3G80A 3PSFA 2QGNA 2R9AA 2X6AA 1BHAA 3WXLA 4PI0A 1AR74 3MN9A 5I9EB 1JL2A 4L87A 4Z4FA 4FK5C 3TAMA 5IT9O 4DR3K 4YSZA 1JLFA 3K3WA 2YNFA 1KAZA 3DXMA 2G8KA 4FLXA 4JKEA 5LP6B 4MDAA 4H5TA 3BPZA 3FZKA 4ASUG 3D45A 4PHTX 3SAFA 1VSJA 1NWKA 3QBXA 3JD0A 1HNXK 2O8CB 1QU7A 3SJJA 3T1YK 4EZ6A 3FFKB 4OGQB 1N32O 5TISZ 3IUCA 1GOCA 2JDIG 4BWJA 3RTVA 3FYIB 4EIAA 3VF6A 3CF5L 4NXNK 4B3MK 3O65A 2ZNJA 1TV6A 4F2SA 2F4VO 4IOAL 4FWOA 2CE4A 3WT0A 4YJ2B 3AA5X 5CZ2A 4E3SA 4DXWA 4WQ5C 1I3AA 3T1YB 1YIJV 4DV3B 1NK0A 2FYUH 2ZM6B 1NLVA 2OIEA 1VARA 2ZF5O 3OJSA 2ZM6K 1Q6HA 1N32B 4CEOA 4CZHA 2ADQB 3DSQA 3HKEA 2R9IA 2QWRA 4BC3A 4X1KA 1RT3A 4IO8A 3K5NA 4AHVA 4N76A 4B3RK 2DYSC 3K59A 2ASOA 4DU1A 1SQBH 2KW4A 3L4QA 1FJGK 3MAQA 2XUMA 3TXQA 4DRXA 3CC7V 5D3GA 3SPHA 1IBKB 4DV4O 1K8AO 4UV8A 4CJ5A 3OHRA 4N23A 4GKKK 4PWDA 3AG2C 4A5UB 3CJHB 5DM6L 4B9UA 4BIUA 4XIUA 1TGOA 2EX3A 2YKMA 2YI8A 2X5ID 3CC2V 4X62B 1YTFB 1V4TA 3LSUA 3B2EE 3ZETB 3LP3A 3HPHA 2UXBK 5KPZA 2PYJA 1FJGB 1BL8A 2WLHA 1CLQA 3CERA 4JD2B 4B3OA 3ZT4A 1SQXH 4I4TA 4DV0B 3WQTA 1OCZB 3CRCA 3DXRB 4FIPC 3FZMA 2M7WA 1S1WA 3LM2A 4CD1A 3OJUA 4CHOA 1YI2N 5L3FA 1JR9A 3FKSG 4JYYA 3A0BZ 4O2BA 3DC6A 1RBTA 1IBKK 2QKBA 2X6BA 1YI2V 4DQPA 4AHUA 2WA3A 1WSHA 4CFAA 4X65K 3A5OC 3O1BA 4G28B 3STLC 1K5MD 2RS54 3QO8A 1N8RW 3SK3A 3E01A 4CBXA 1IZ3A 4E19A 4F8RA 2EIJC 3SUCA 2UU9O 3G6EN 1TUYA 4FWPA 1IXMA 3AE2A 4JI5B 3N2GA 3ZX6A 2HBKA 4FZ0A 1XWLA 5C24A 4E1NA 2HBJA 3ZT3A 1HR0B 4CJEA 2WC9A 4E7LA 3Q4HB 2W41A 4DUYB 2CGKA 1COWG 4Q4V4 2A6AA 1O9HA 2R044 3H1HH 1TL3A 4DLEA 3CXCU 3DTUB 2CTWA 3IC7A 3LSSA 4IHJA 4JZGA 3L2RA 2WBNA 2GUIA 5BMVB 1VQ8V 2W40A 4GX0A 5KAIZ 5JVHL 4DR7K 1RUF4 2WLNA 3QB0A 2OCCB 5EZYB 1MA9B 4BGBA 2Y1IA 1QTMA 3ID8A 3VQAA 3UQ8A 5AQGA 1NK6A 3HKDB 4R7CA 3HT3A 5LGNA 3G4SN 2V7ZA 5AQTA 3OYGA 4LC9B 3RMBA 5IYBO 4DTMA 4Q4W4 4BRMA 4RW8A 1PO24 1PO14 2AHYA 4QPJA 2P9UA 2F9TA 3ALYA 2E5LO 4FVMA 2EIKB 1ZAUA 1NMDA 4KL1A 1HYVA 3H1KH 1DTQA 4C1NI 4IFVA 5LXTA 3FGUA 2QWQA 4FLVA 1U2VA 1G1XB 5K1XA 1BGXT 4CJQA 2YNIA 3VEWA 1VQNV 3L3UA 5IWAK 4A5AA 4W5OA 3G0ZA 4DQSA 1R73A 2HMPA 3OEEG 3CQYA 3AVJA 1R1BA 2DJVA 2HKOA 3ID6A 2KG7B 2Z1IA 1GM9A 4RW6A 1FYJA 4TT3G 2FL4A 4NYKA 1ZOYA 2D0AA 4LF7K 3O1WA 2PW9A 1H1VA 3S3WA 4BRHA 5CA3A 4N5SA 3LALA 4NTXA 4M7YA 4BR0A 5BRHA 4D7TA 3OYFA 2HW3A 4JZ2A 1Q43A 1J5EB 2GSMB 5AQJA 3R65A 3TXSA 3R66A 5JWPA 4I5SA 4B1ZA 2P06A 2AZ0A 5CA1A 3SYCA 5AQNA 5E41A 2YS8A 5TKWA 4DV1B 2FC0A 4CW7B 1Z5VA 2AJQA 2OTLN 1L3SA 3ML0A 1DEJA 3TSQA 1YDXA 1XMQK 4BW9A 4BE0A 4BRLA 1IBLK 4Z4HA 4I0XB 2P51A 4X89A 3OYCA 1SQFA 3V9WA 1BG3A 2FLOA 3WNEA 4DV3O 2XY6A 2F96A 3UKRB 2OPRA 5AFUH 3FZHA 1TUEB 1OOPD 5FNVB 1AR1B 4BR9A 4C23A 3T19A 5JH7A 3W3DA 4AH9A 3FAVB 5EIBC 2BDPA 3UB5A 1VK0A 1CZAN 1S5HC 4B08A 2JWKA 1VQ4N 1AR64 4YDUA 1IBLB 1HRV4 1FFXA 1D8YA 2QJ1A 1NCQD 3V9XA 3PO4A 2P5GA 4G27B 4GX2A 1SQKA 5HL7L 3AA4A 1QBZA 2LFRA 1QHAA 4OPJA 2HNZA 1JLGA 2YKNA 2O8FB 3OEHG 4Z1MG 4NXMK 1VAZA 3RSEA 3JAMN 3VQ5A 4JAXA 1JFFB 4LF4O 2DYRB 2ZGYA 1RILA 1ZTEA 3RYFB 1QVFU 2Q2RA 3NF6A 2ADPA 2AW9A 4FZ1A 5HBMA 4CZLA 1NU1H 4CS4A 1BWFO 2E75B 3L2WA 4GNIA 3KLEA 4LFCK 2ASMA 3VOVA 5KMGA 1SV5A 1TVKB 1M93A 1DT9A 3FFQA 1B04A 4LF8B 1OCRB 4LD0A 4RO2A 1K92A 4MVRA 4DQRA 3SQ1A 3L0QA 1RDDA 3J81N 3JD4A 3LDOA 4BQZA 1VSLA 1RGIA 3MK6A 2NN4A 5AFUA 3U4LA 4A62A 5J2MA 5B66Z 4U67L 4BG8A 3K0DA 3CE2A 2NRTA 3AAQA 4GKJB 1HRI4 2A41A 4HUEA 1THZA 4CK2A 4RW7A 2JGDB 2IBZH 3I0RA 3UKUB 5M1FA 3LWMA 2QA4N 4MVQA 2DYSB 4PDWD 1JJOA 2WWWA 2YIBA 1XILA 2BSKB 5EBMC 4IL6Z 3UO3A 2V7YA 3QEWA 4AI8A 4JK8A 3SV4A 1GLEG 1ZC6A 1QNMA 2CGOA 3C6HA 3S41A 4ISFA 1BQ0A 2E4LA 3J80N 1H8EG 1BCCH 3THWB 3ZHVA 2HFEC 1SS3A 2R9RB 1LAVA 1JCHA 1B3QA 4X62K 1T8EA 3ASOC 5J9PC 1Q90D 2LQTA 4JI3B 3G71N 1W2BU 1RDAA 2GELA 1KUQA 4JI6B 2GTDA 3VQQA 5B3SB 1BISA 5DK5A 1GLLO 1OCZC 4FWRA 1ZUQA 1QS4A 3CQXA 4NYFA 3NGZA 2Q69A 3MDQA 1K3EA 1FXXA 5J2TB 3ETEA 3I33A 1NGHA 2P7TC 1DK1A 3RT3C 2GEMA 1NGFA 4CF1A 1V54B 3EVKA 2GUZB 3D3IA 4U3JA 1NMNA 1YAGA 2UXDO 3NF8A 3LDQA 3EY1A 1J5EO 4JEPA 1KB9F 3N27A 3FE1A 3U8XA 1F4NA 5AQYA 1T7PA 4J42A 1EP4A 4FJKA 1K8AW 5JS2A 3BHPA 5B8HA 2RCVA 1E4GT 4AQYB 2QM1A 3CCMV 5T7BA 4JYAK 4TOIA 1GKFA 2QM8A 1TKZA 2RMU4 4EP5A 3PX4A 1JLAA 1U47A 4BRPA 2HB5A 2M6YA 3BZKA 4YNQA 1K4CC 2YIAA 3TR8A 1IXBA 3SBTA 1X59A 1M90W 1GMGA 2A42A 3VQ6A 3VTIA 3WXIA 1HNWK 2K9PA 3E9OA 4IZ9A 5FPMA 4B9QA 3L4IA 3CCRN 1RT5A 3B6OA 1QE1A 3CETA 2P9PB 4IIJB 3L2QA 4BRQA 2O57A 3AA3A 1XHXA 3GL1A 3BUZB 1WPBA 1OV9A 3UCSC 1YHQV 2UUCB 3EKUA 5LJVA 1VQ9V 5BR8K 3IMXA 3CG7A 3TAQA 3PO5A 4JI8K 4DR6K 3OW2U 2QA4V 2F4VB 1Q5OA 2CTRA 4YORA 5GONA 3QBWA 1E79G 4CZZA 4B9MA 4QS9A 1NK8A 3JARB 2WOMA 3OMIB 4JKBA 3OUFA 1CP9A 3A0RA 3SBGA 1MOFA 1BDGA 3E22B 5CBFA 1IDSA 4H37A 4JK9A 1SKWA 1N33B 3E9LA 1NJIW 1XI1A 2Q8VA 3KKYA 4PA6A 1RNHA 1SQVH 3HYFA 1RBVA 4KKOA 4YHHK 4BE1A 4HUGA 3TANA 4FJJA 2EIKC 2EHGA 4LF6B 3FR0A 4DR2K 5J2UB 1RTHA 5IWAB 4N21A 4DV4B 1YJWV 1N34K 5L3EA 5SWMA 1WB7A 4CEZA 3HTVA 1GLFO 4BGAA 5BN9A 3L2VA 4LF5O 4OGEA 4BR5A 4JI5O 4LF7O 3ULEA 3HSCA 2BTFA 4RW9A 1D2DA 4J2DA 2R70A 4X64K 3P4SA 4E1JA 1VQ8N 3TSPA 5GTHZ 1RBSA 2ZJQL 1Q82W 3MEDA 3V9SA 1JCGA 1RT2A 2YI1A 2XNDG 5IWAO 1S77D 3ZEUA 3NH0A 4XDKA 1EAH4 3ETQA 3WFVA 3VEXA 4CS2A 1PKXA 3B09A 3RYHB 4EB6B 4K41A 4K3AA 4Z4CA 4N56A 1NK4A 2KTQA 4DSIA 1SZTA 3CYMA 1YT3A 1XNRO 2E3CA 4FLYA 1XMQO 2WTUA 1T6CA 3IC9A 2FBVA 3LDPA 2IU0A 4BIOA 4I7FA 3WXJA 4DQ8A 4NR1A 1YITV 4KO0A 4DV6K 5BREA 3V4IA 3THYA 1EX4A 4ZTJA 5B1BC 5LL6Z 2ZE7A 5DM6V 4BRGA 5HRPA 4OLAA 1R0AA 3ZCCA 3KCXA 3E8FA 1RBUA 2GUZA 1DTOA 4U3JB 1XUPO 2ZIOA 2AZ2A 3SUPA 5C10A 4FJXA 1RUG4 1H2LA 4FWLA 1COV4 4FJLA 2FBTA 1X9SA 2JGUA 3K0SA 5C0YA 1IJJA 3QFPA 5H2FZ 4E89A 4C8NA 4W4LA 4YOWA 1BA0A 1Y4MA 3AE9A 3BA8A 3MDSA 4KUMA 4O4LA 3RFRA 4DR2O 2QWPB 2ETJA 2P9NA 4O4JA 1Q7YW 1S1XA 3MXJA 3ASNB 3IKMA 4RG8A 3FB5C 2E88A 2G8IA 3L3VA 2E1ZA 2IAJA 4EP4A 2UXCO 2YIDA 1RFQA 2B1GA 3CC2N 3NF7A 1X3MA 3THWA 3BFRA 4DSEA 2P9SB 2OTLV 1U96A 2DWDC 2BGGA 5AZIB 3VQCA 3KK2A 3O9QA 3ZT2A 4OJRA 2D0CA 1Y74A 4DTXA 4I2QA 2FB5A 2K1EA 3ABLC 4JI4O 3J8AA 1VBE4 1K97A 4ZI7B 1QZ5A 4FZZA 4IKFA 2E6MA 2Q3SA 4JKAA 3M3ZA 1XNQB 2ZD1A 4B1UB 3B40A 3JSMA 1XNQK 1JLCA 4B3MB 2WDRA 2KKZA 3B77A 4IGGA 4DV1O 5AQVA 3ZCMA 3CRAA 5IJ9A 3D3QA 1FAFA 5IYZB 1S1UA 5BZBA 5LA6B 4CGIA 2DY4A 3AVMA 2YSUB 4FK2A 4J9YB 4QS7A 4ELVA 4AHCA 4BC4A 4CF8A 2CDYA 3A0HZ 3QTCA 3CCEV 2JJ1G 2P5OA 3T1AA 1EN4A 4RAIA 1QQNA 4KTWA 5A2QN 4GW6A 4CHPA 2IVNA 2RN2A 3HO1A 3K04A 3AO1A 4AQYO 3OS0A 3UIQA 4X1YA 2IH1C
chains in the Genus database with same CATH topology
5JQGB 1NJYA 3KK3A 4J2BA 2P1JA 2HHXA 5ITZA 3JAKB 4DR7B 1ASVA 4ID1A 4UQGA 3VQDA 2OA8A 3OTOB 1C0TA 2RKIA 1TK0A 3V9ZA 4DLGA 2QK9A 1ASWA 3QIPA 1VSDA 1XNRB 1ZBFA 5EYPA 4KREA 2RF2A 2Q0AA 4I9LA 5JQGA 3G10A 5HLFA 5CA1B 4YJ3B 1HW7A 4AILC 1IG9A 1NK9A 4DSFA 5IYZA 5KX5B 2KQ2A 1VSEA 5SZTA 3V6DA 2CAZC 1BIUA 4KHYA 3NHGA 3QINA 1HQUA 3KTQA 1RSOA 1YTAA 1HPZA 4J2EA 3P1GA 5J2QA 4CEBA 3SCXA 1TAUA 1T03A 4FLZA 1NKEA 2QXFA 4B3SB 1REVA 4CH5A 2VWJA 1DTTA 1YTUA 1RTDA 1VSKA 3HM9A 3HSTB 4I2PA 3BDPA 4CGGA 3NE6A 4CJVA 3UT5B 5BMVA 1JKHA 5CB4B 4Y1DA 4M3WA 2Y1JA 4LH7A 5KRTA 4DV6B 3O4QA 4Z4EA 1N36B 3AVAA 4CH4A 1T05A 3OYNA 1HNVA 2HHSA 4DFMA 3EZ5A 4EB6A 4F6RB 3T1HB 4CJ4A 4EFBA 4RW4A 3EYZA 3NAEA 1WLJA 5FRMA 3DMJA 4X64B 3BRCA 3LPUA 3VQPA 1BCOA 3AA2A 4M3XA 4GKKB 4CECA 3ZSOA 4I4TB 3B6PA 5K14A 3FFIA 1TKXA 3JSLA 3M8SA 4Y1CA 4UCVA 4FJ8A 1TL1A 1BI4B 4DQQA 3KLHA 4KHSA 3JARA 5KTQA 5GONB 4Z4IA 3KLIA 5FRNA 5LOVA 4DSJA 3VA3A 3DM2A 2A1RA 4DTJA 2KZZA 5LYJB 1KRPA 3RYHA 1J9AA 1V9PA 4EZ9A 2Z1JA 4DTRA 1G6UA 1TVRA 2HEPA 3AO5A 4DU3A 4CGDA 4N41A 3DLEA 2D5RA 5LOVB 3WB1A 4UCTA 4IFYA 2IOCA 3DLGA 3SR2C 3FI7A 2E6LA 5ITZB 4HBNA 4C8KA 3QNNA 1S6QA 5KGWA 1U45A 1A5XA 5JCOC 3HP9A 3QLHA 2ZINA 1ZBLA 5KRSA 2HHHB 3OYJA 2G8FA 4X20A 3SUQA 3AVGA 3D0PA 1VSMA 2B5JA 1J53A 3HL8A 4CJPA 4W5RA 4NYNA 4KHNA 5IJ9B 1XHZA 1J54A 4M41A 2PZSA 3JAWA 3RR7A 1SL0A 4YFUA 4DTUA 4ZI7A 1S1VA 3K5OA 2XY5A 4M3TA 4MFBA 3JAWB 4DV5B 4PI2A 5JVDB 4NCAA 3HKBA 1Q9XA 3CQ8A 4JI7B 5KHJA 4X20B 4TV8A 3M8PA 5CB4A 4B3TB 3LZJA 5HP1A 4CCHA 1C6VA 4OKKA 3THVA 1BQMA 2QM4A 3I8DA 5HRRA 4CHNA 4CC6A 1HYZA 3TAEA 4DU4A 2IS3A 4OPKA 4F2RA 1LAWA 4GLXA 3O3GA 1NKCA 3OYBA 4M3ZA 3DRRA 4K8XA 4JS5A 3AVNA 1FFXB 3SYZA 5JVDA 5I42A 1KTQA 1RT6A 4FW1A 3OYLA 1RTIA 4DR6B 1I7FA 4HTUA 1SA0A 3VQXA 2YHAA 1C1BA 1L3UA 3HPOA 2VQFB 4B8AB 1IKWA 1KCFA 3HP6A 2ZCEA 4M3UA 4PQUA 5KMGB 3SQ2A 3KLFA 4C8MA 5EYPB 1YVUA 5JS1A 2HVHA 3LZIA 1XQ8A 1EXQA 4LR3A 3OYDA 2G8HA 1WSFA 2KKWA 3ZSVA 3PV8A 4UCRA 2PGGA 1FKOA 1L8DA 4CIGA 3SPYA 5JH7B 4ZOLA 3RRHA 3RYCB 5EIBD 2O4GA 1W0HA 4DS5A 1YEWA 1HQEA 3O3FA 4OKJA 1NKBA 3AVLA 3HKDA 4W5QA 1UA1A 4L8JA 3WNHA 5HROA 4X1YB 3UT5A 1T5EA 4CGHA 4UCSA 3DRPA 3OYAA 1BI4A 1KVCA 3QETA 2ITGA 1TKDA 4EFEA 3T3FA 2HNDA 2ZNIA 3SJAC 3PUFA 3BAAA 4HUFA 3BABA 1UOCA 3PX6A 2DTUA 5D5QA 4E7HA 3IS9A 3TI0A 4ZTFA 4CIEA 3HXMA 3SZ2A 2HHWA 3LAMA 3C6UA 5C42A 2W42A 4N47A 3M8RA 3AVHA 4ELUA 3SV3A 2VQEB 3RWRD 2VG5A 3U6FA 3AV9A 1RT7A 4YJ3A 1VRTA 2V4DA 1O1WA 4KAZA 4MQ3A 4K0KB 4DR1B 4IHJB 4E1MA 3VQ4A 3H08A 1KSPA 3NGIA 4B8CA 1DLOA 1L3VA 3VQ9A 4JI8B 3RYCA 4LF7B 3QIOA 4CIFA 3WNFA 2F66C 3MXIA 2I5JA 3DLHA 3SQ4A 5FNVA 4O0JA 4HCBA 5CA0B 1EETA 4I50B 3V9UA 3QESA 4JLHA 3HK2A 4CH3A 5LP6C 1RT4A 2R7YA 1KLMA 3V81A 4LFBB 3OYHA 2OPQA 4DFJA 1A5VA 3OYKA 3CFPA 1NK7A 3MEEA 4DRXB 1ASUA 2ZIMA 1XMOB 3S9HA 4I55B 3LP0A 2BANA 2G8VA 4HHTA 3THOA 3AO3A 3CM5A 4DR4B 4C8OA 3NFAA 3AVFA 1XC9A 1Z26A 1ZBUA 1HRHA 2YHBA 4ZHRA 2VWKA 1C1CA 3JAKA 3IRXA 4O4LB 3OS2A 2X6NA 4BWAA 1MU2A 2B4JA 3N2KB 3OY9A 3ZS8C 1HYSA 4CEDA 5DMRA 3SI6A 1BCMA 1NJWA 1RCHA 1ZBIA 5KHHA 2IDOA 3DOLA 1S9GA 1M5IA 4EEQA 1LWCA 3MXMA 2FBYA 4KHUA 4W5NA 4KV8A 3K58A 4F4KA 4JI4B 5LMUB 3LP2A 4AHRA 4JRPA 2BTOA 3A2FA 2BTQA 3RMAA 3QF7A 5KHKA 3OVNA 2RPIA 3RYIA 1JMKC 1IKXA 4X1IB 4O4JB 3WB2A 3V1QA 3DLKA 4FJGA 2IGIA 4C8LA 2OPSA 3PX0A 1JFFA 4CJKA 2HHVA 3V1OA 4CJSA 4CEAA 4HCCA 4KHQA 4NCGA 4X1KB 4X65B 3DI6A 3TAGA 3U0ZA 2FBXA 4DV2B 4IIJA 1X9MA 1D9DA 1IBMB 4DSKA 4LF5B 4JYAB 1UWBA 3HPGA 4YJ2A 3SUOA 5LYJA 3QNOA 2HVIA 4E7KA 2XY8A 4LH4A 1HNWB 1I39A 2KFNA 3O4NA 4JS4A 2X74A 4AHSA 2PY5A 3C95A 1GOBA 1UAXA 1C1AA 4DK0A 3QEVA 1O9GA 4DTSA 4BDYA 2UXBB 5KHGA 3NF9A 3ICXA 1RDCA 4E0DA 4CJ3A 5D5PA 1A5WA 2HHQA 4KTQA 1NK5A 1I94B 3ISNC 3E22A 1VSFA 4KI6A 4B9VA 3DLRA 4DK1A 3HVTA 3U3GA 1C0MA 4KHPB 5FROA 3JSNA 1NOZA 4PHZA 2F95B 3ZSQA 3S3NA 4TSXA 4F6RA 1QHTA 4CGFA 3KJVA 4WE1A 4FJ9A 4ID5A 3CHXA 3I0SA 4DSLA 1EKEA 4KHWA 4CJWA 3ZSXA 1WAJA 3LANA 4NXMB 4O2AA 1Y97A 3RYFA 4CF9A 4KPYA 4O4HB 5J2TA 4M3YA 1BQNA 2YIBD 2A1SA 3CFRA 5J2NA 2GBZA 4JI0B 1D9FA 2UXCB 5CZ1A 1HMVA 4FZYA 1X9WA 3V1RA 1W9HA 3RMDA 3C94A 3N2GB 3CM6A 1KFSA 4HNAB 3KKSA 4CERA 4FLTA 4FCYA 2Q7HA 4FZXC 2PTMA 4B9LA 4O2BB 4OVLA 2LSNA 5HRSA 3RMCA 4DR5B 4LNUB 3DRSA 1IKYA 3MECA 5KX5A 2YV0X 1KFDA 5KHIA 1LW0A 1TK5A 5FDLA 4ZHQA 4DG1A 1TVKA 3SUNA 1QSSA 1UA0A 1S6PA 5FPRA 2G8WA 2GV9A 1KVBA 1WSEA 3F9KA 3HKEB 1IKVA 4OX9B 4FJHA 2OZMA 4ELTA 3U10A 1SQGA 2NUBA 4CEQA 2YXLA 5LXTB 1SKVA 1KMIZ 1U04A 1TA8A 2XHBA 1SUQA 4CK1A 4R5PA 4FYDA 3VN5A 2OPPA 1WAFA 1CZBA 1DGSA 4JV5B 4CHZA 5LP6A 3TARA 2F1MA 4IDKA 4BDPA 5JCOA 1J5OA 1Z5WA 4B3RB 3OS1A 1B92A 3RR8A 4BACA 3VQEA 4PA1A 5LA6A 4CJFA 4DWIA 2F8SA 4CJTA 3DYAA 4OGCA 4O0IA 4M45A 3M8QA 3JYTA 3NDKA 2X6SA 4DFKA 4GMJB 4KB1A 1TKTA 3TAFA 1U48A 1N5YA 2KZMA 2E5LB 2ZQBA 4DF8A 4BWMA 1D5AA 5I3UA 1SKRA 4CJUA 1LWFA 4WBNB 3OTFA 3SGIA 3P5JA 4CS3A 3ZT0A 1WSGA 4TUYA 1Z25A 1C0UA 3AVCA 4CH6A 2UUAB 3K57A 1BL3A 2UXDB 4DFPA 3QEIA 2R72A 2UUBB 4PY5A 3ZT1A 3F73A 4DUZB 5IJ0B 3HVRA 4H4MA 3LPTA 2OZSA 5CYQA 4FJNA 4FXDA 3BGRA 4ICLA 3ZEDA 4KFBA 4LSNA 4DV7B 1WNSA 3S3OA 3K5MA 1TAEA 4DTNA 4CJRA 4AHTA 1RBRA 3SJBC 3KK1A 3VQWA 5JJEB 3RRGA 3KKRA 4LH5A 1IH7A 1RTJA 2QKKA 4O5BA 3L8BA 4HVJA 1QSLA 4CFDA 2Q7EA 4KI4A 2XY7A 3WB0A 4W5TA 5J2UA 1ZYQA 2OYQA 3KD5E 3JALB 2WONA 2PYLA 4E7JA 3JATB 2IM9A 4QCLA 2ZE2A 3IG1A 4Z0UA 4TUYB 2HNYA 4LFCB 3CFOA 4X1IA 3TABA 3HKCA 1HNXB 4BE2A 4JI2B 1U4BA 4F3TA 3ASMA 4NXNB 3TWHA 4QAGA 2Q7GA 1JXEA 1L3TA 4Q6GA 3VQBA 4NVPA 4ZIBA 3QEXA 5CYMA 1JLEA 1N6QA 4KTZA 1SL2A 4UCUA 5LMNB 3KD1E 4DR3B 2HHUA 2DFHA 5CY4A 1IO2A 4FM0A 4O4IA 4Z4GA 2YI9A 2RJZA 2XRIA 4G1QA 1KU9A 3ZSRA 4O4IB 1JL1A 2YNGA 4LY7A 4OKEA 3DOKA 3KLGA 1Q8IA 1S9EA 4BDZA 1ITGA 4YY3B 2Z1HA 1BHLA 1B9FA 4FJ7A 3JASB 4CHQA 1TUBB 1TK8A 4F3OA 2F8TA 2XO7A 1BIZA 3OYEA 5KGXA 4CK3A 3SPZA 3HJFA 4FK4A 1S5JA 3VQ8A 1NT2B 1B9DA 1FK9A 3HKCB 4QOZB 3MEGA 1LWEA 3NBPA 3VQYA 1CXUA 1CXQA 4X66B 4FM2A 4DF4A 1U49A 4ZHQB 4DTOA 5J2PA 3JALA 1JLQA 2RQ6A 4TV9B 1F21A 4KB0A 3LP1A 4DQIA 1NJZA 4I50A 3KIOA 5JJNB 2Z1GA 3SQ0A 1HNIA 5CA0A 3OYMA 4JI1B 3CSXA 4K8ZA 4CEFA 5C8YB 3S3MA 1QSYA 4Q0BA 1TAQA 1K6YA 3LWLA 3CB2A 5HRNA 1HNZB 5JJJB 3PN1A 4OLBA 3LNNA 1SL1A 3VA0A 4B9SA 4B9NA 4DTPA 4TV9A 4CESA 3BA9A 4FLUA 1WSJA 1VSHA 3IAYA 2JS5A 1P49A 1QQCA 4DS4A 3ZSZA 4CFBA 2OWOA 3K2PA 3SJCC 3U11A 2B6AA 4YHHB 3NCIA 3ZSWA 2PUSA 1Q9YA 2ATQA 3OYIA 2KFZA 1ZBHA 2DFEA 3O3HA 4L8RB 1Q3EA 4O4GA 2HHTA 1KVAA 1TUBA 4CGJA 4UFZA 4UCOA 4D7SA 1NOYA 1LV5A 4O44A 2R7FA 5EZYA 3PY8A 1X1PA 4FW2A 1RT1A 4FLWA 4O4HA 3NGYA 3QEPA 4JRQA 4O2AB 5C25A 4FK0A 1NJXA 4IBNA 4FJIA 1HJRA 3AO4A 1CZ9A 4IG0A 3P83D 4FM1A 1S1TA 3WNGA 5C8YA 3VQ7A 1WN7A 3ZSYA 3AVIA 3AVBA 4NCBA 5FPOA 4ZOLB 4M3RA 3K5LA 4H8KA 1VRUA 3VQVA 5BR8B 2F93B 1JXBA 3QG5A 4H4OA