1XHZA

Phi29 dna polymerase, orthorhombic crystal form, ssdna complex
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*TP*T)-3'
publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
total genus 144
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhzA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhzA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhzA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhzA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhzA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhzA06
1BISA 1UWBA 1B92A 1HMVA 3SI6A 1F21A 1RTHA 3T1AA 3V1QA 4KO0A 4KB0A 2HNYA 3LP2A 4CF0A 3HK2A 4Y1CA 4Q0BA 4Z0UA 4CGDA 1KVAA 4CJ5A 1IO2A 1Q9YA 4B9MA 4Y1DA 1BCMA 4Z4CA 1CLQA 3TR8A 2X6SA 3DLRA 4FLVA 2YNIA 3OVNA 1VSMA 3KKSA 4CERA 3VQ4A 2A1RA 4AHVA 3SV4A 1LW0A 3IRXA 2ETJA 1TKTA 2X78A 4DFMA 1ZBIA 1L5UA 4FLZA 2DFFA 4AHTA 3TI0A 1RT1A 4FLTA 4K8XA 2KFNA 1GOCA 3SQ4A 2XY5A 1C6VA 3ZT1A 2Y1IA 3ASMA 4ID5A 5FRMA 1VSLA 4ELVA 3L2UA 4ZTFA 3OYHA 3KK1A 1XHXA 1SKSA 5HRPA 1S5JA 4AHRA 1WSHA 5HRNA 3ZSYA 4DSFA 2OZMA 4FK2A 1YTUA 5K14A 2W42A 1NOYA 3K58A 1B9FA 4HUGA 4CGHA 3PV8A 1RT3A 1QTMA 4DQIA 1WSFA 4M42A 4KHNA 3FI7A 1CXUA 3IG1A 3G10A 3TAMA 3L2QA 1FKOA 4CK1A 4DTPA 1QSYA 3BDPA 3S9HA 4EZ9A 4FJKA 4CGJA 1L3SA 1RTIA 3DRSA 3RMAA 1IG9A 3V4IA 3SQ2A 2OPRA 2Z1JA 3AA5X 3KLGA 4L8RB 2I5JA 1QQCA 1S9EA 3HYFA 3LZIA 4O55A 3PO4A 4AHUA 3V6DA 2FBXA 3DI6A 4EP4A 2OA8A 2RN2A 4DFKA 3O3HA 3TANA 4FJ8A 3NF6A 4M3ZA 4CK2A 4JRPA 3TAFA 3T19A 3VQQA 2HHXA 4FJGA 1Z25A 4JS5A 1CXQA 4W5RA 1TK0A 4B9LA 2E6LA 1RT7A 3SPZA 3M8SA 4E7JA 4M41A 1U4BA 4MQ3A 3K5OA 1IKXA 1CZ9A 3KLFA 4B9VA 4HTUA 4DTUA 3RR8A 4CF1A 4C8KA 4ZTJA 4FZZA 1JLCA 4CF8A 3L2RA 3I0RA 3NDKA 2WONA 1UA0A 4DSLA 3NGIA 2G8VA 1TKXA 1C1AA 3OYNA 1TL1A 1HPZA 1L3UA 2EX3A 1JXEA 1XWLA 3L8BA 4E7LA 1TKDA 4B9TA 4OLAA 4CJRA 2OYQA 3QEIA 4K8ZA 3HP6A 3HVRA 4GVMA 4DS4A 3WNGA 2IOCA 3DRPA 1J53A 1J9AA 3A2FA 4DLGA 5FRNA 2HHQA 3AVLA 3H08A 3ZSQA 4BACA 3DLBA 1HNVA 2B4JA 2VG5A 4CHNA 4OKJA 4FK4A 2HHVA 1C0UA 3QERA 1D9FA 1JLEA 5HROA 3TAPA 1S9GA 2X74A 1NK5A 1QSSA 4DQPA 4FLXA 2PYJA 1RDBA 5CYQA 3NF9A 4ELTA 4BE0A 3O4NA 4FW1A 4E7IA 4DTMA 1WAJA 3OS0A 3OYKA 4B8CA 4CGIA 1U49A 3ZSVA 3KKRA 4CF2A 3C6UA 3OS2A 2ZQBA 4B9NA 1A5VA 3SQ0A 1I39A 5J2MA 3OYFA 1RDDA 1BQMA 4CJEA 3RMDA 4AH9A 4CFBA 1X9MA 4N76A 4DQRA 4M3UA 2HHTA 4DSKA 3QETA 2RF2A 2B6AA 2YNFA 4NYNA 4CEOA 1FK9A 1UAXA 4RW6A 4Q5VA 4KKOA 3SV3A 1S1VA 3U6FA 3L3UA 5HBMA 4DU3A 4CCHA 2G8UA 3KD5E 2Z1IA 4DSEA 4Z4GA 4M3TA 3RTVA 2QKBA 4E0DA 4OPKA 3AVCA 2NUBA 4FM1A 4GW6A 5I3UA 2HNZA 4FJ9A 1N5YA 1LWFA 3JYTA 4DTJA 1RT5A 2YKNA 3K5NA 3E01A 1U47A 1XC9A 4J2BA 1U48A 2IC3A 3OYLA 3KK2A 4DQQA 1EKEA 2P5OA 1KTQA 3NFAA 1VSFA 3TABA 5FDLA 3S3NA 3PX6A 5C24A 2DFEA 4HUEA 1QS4A 4Z4HA 4PUOA 1RBSA 1VSHA 3ZCMA 4B8AB 4XIUA 4DLEA 4NCBA 3NCIA 1C0TA 2OPSA 3C94A 4O0JA 5EU7A 4ZHRA 3NHGA 3VA0A 2HHUA 3KLHA 1X9SA 4CIEA 2KZMA 4FVMA 4CEBA 1KLNA 4DFJA 1WAFA 2PYLA 4J2EA 2XY7A 3AO1A 2HB5A 3OYMA 3CQ8A 4I9QA 2FBYA 3AVMA 2BGGA 3ZT0A 2QKKA 3CM6A 1RBRA 1RDAA 1W0HA 3VQPA 3CFOA 3F9KA 4FJ5A 3DOKA 3DLHA 1RBUA 2VG6A 3AVAA 3K57A 1IKVA 2QXFA 5CZ2A 1QSLA 4Z4IA 3QLHA 1WSJA 4FJXA 3QEVA 1Y97A 3LWMA 3ZT2A 2VWKA 1REVA 3WNFA 4E1NA 1TGOA 1JLFA 1RBTA 3KJVA 4DTXA 3HJFA 1ASUA 4E3SA 2E4LA 3SQ1A 3LAKA 2O4IA 3KIOA 1BIUA 5HP1A 1VSDA 3PO5A 4G1QA 5T7BA 2VWJA 1IH7A 1XHZA 4IG0A 3AA2A 4CJUA 4F3TA 1T8EA 3AO3A 4CE9A 4F4KA 4RW4A 3LWLA 3C95A 3F73A 4KPYA 1JL2A 4YNQA 4BDYA 4KHYA 1O1WA 1RT2A 3BGRA 1W9HA 4N47A 4CECA 4CJVA 3M8PA 2KZZA 3VQ9A 4DTNA 1A5XA 2D5RA 3CYMA 1T05A 2D0BA 4IKFA 4CHZA 4RG8A 4FW2A 2P51A 4DU1A 4DSIA 4BWMA 1J5OA 1IKWA 3O4QA 4N41A 4CJ3A 3QNNA 4AILC 3VQCA 3K5LA 4TSXA 1EX4A 1JXBA 2BANA 3AVBA 4UQGA 4EP5A 3SUPA 3QEXA 4NYFA 4CEQA 1VSKA 4IDKA 3VQDA 4CFCA 1JLAA 2HVHA 4DFPA 3V9SA 4KHWA 2G8KA 3RRGA 4FXDA 3LP3A 3ZSRA 1NJWA 1YVUA 3CFPA 3KD1E 2F8TA 3I0SA 5J1EA 1WN7A 3AVKA 4FJJA 3SNNA 4CEZA 4NCGA 2RPIA 4FZYA 1TK5A 2JLEA 3HPOA 1S1WA 2DY4A 4BWJA 1WNSA 3RMBA 1HYSA 3HM9A 3DOLA 1KRPA 3AVFA 3V1OA 3M8RA 2HHWA 1XI1A 1RILA 1HYVA 1RNHA 4CJPA 4DF4A 3NH0A 3VQEA 4CHOA 3HP9A 5J2PA 2PZSA 3LDSA 3SUQA 3S3OA 1KCFA 4F8RA 2F96A 4DTRA 2HMIA 3LZJA 3HL8A 3KK3A 4E7HA 3VQ8A 1WSEA 4IG3A 5DK5A 2B5JA 3MXJA 1KLMA 3CM5A 4KREA 1LAWA 1TKZA 2D0AA 4OGCA 4DQSA 4CIFA 1LWCA 3B6OA 3O3GA 3OS1A 4IFVA 5KGWA 1Q8IA 3HSTB 4MFBA 4CHYA 3NE6A 5C25A 3DLEA 1TAQA 1NK8A 3NGZA 1N6QA 2YKMA 4BE1A 3DRRA 3MECA 3ZT4A 2GV9A 4BDZA 3QIPA 3AVGA 2FC0A 1UOCA 4OGEA 4R5PA 3TAGA 1NKCA 4W5QA 2JGUA 4Z4FA 4HUFA 1ZBLA 3ZSXA 4DSJA 1BL3A 3DLGA 3DYAA 3MEDA 3AO4A 4C8NA 4FYDA 1EXQA 2VG7A 1L3VA 1HRHA 4ELUA 3TARA 3VA3A 4H8KA 1BQNA 4CHQA 4DS5A 3ITHA 4ICLA 1S1UA 4DTSA 3L3VA 2XY6A 2Z1GA 3U3GA 4W5TA 2BE2A 3VQ5A 3ISNC 3AVHA 2OPPA 1RT6A 2DFHA 2G8IA 1TVRA 2EHGA 3V1RA 3OJUA 4DTOA 3ZSZA 4CGGA 1NJZA 2G8FA 3L2VA 1SL2A 5KTQA 4F2SA 4RW7A 3UIQA 4W5OA 1S6PA 3IS9A 5CY4A 1KFDA 2IGIA 4J2AA 1ZBFA 2KTQA 3HO1A 2XY8A 1LW2A 1U04A 3KLIA 5DMRA 2HNDA 5KRTA 2Q3SA 4WE1A 5JS2A 4CFAA 1SKWA 5SZTA 2BDPA 3LALA 3NF8A 1NK0A 4CJSA 4DWIA 3LP1A 4FJIA 4CJWA 1FXXA 3THVA 3CFRA 2XRIA 4FJHA 3DM2A 1NK6A 3RMCA 1A5WA 1VSEA 4KV8A 4AHSA 3OYJA 3ZT3A 3C6TA 1SKRA 4DMNA 4CEDA 2R7FA 4F2RA 1Z26A 3EY1A 4NCAA 1VRUA 1BCOA 3OYCA 4AHCA 4KTQA 4J2DA 4FK0A 1KFSA 2KQ2A 3D45A 3HPHA 1DLOA 2P1JA 5J2QA 3QEWA 4PA1A 1KSPA 5HRSA 4KI6A 4FLUA 3SYZA 3AV9A 1TL3A 1UA1A 2PW9A 4CJTA 4N5SA 5CZ1A 3P5JA 4KTWA 3ULDA 3QIOA 3TAQA 4OVLA 3OYGA 1C1CA 4KTZA 3I8DA 2QK9A 1ZBUA 2WOMA 5KRSA 3B6PA 2G8WA 1SL1A 1RDCA 4BDPA 3LPUA 4C8OA 1TV6A 4JLHA 1RT4A 3TWHA 2HW3A 1QE1A 4QOZB 5E41A 2YV0X 2ITGA 1ITGA 4KHSA 3NGYA 1Q9XA 4KRFA 3LANA 4W5NA 3OYEA 1I3AA 1EETA 1GOAA 3SCXA 1SL0A 4HCCA 3HXMA 3VQ6A 4LSLA 3OYAA 3MAQA 1ASVA 4YFUA 1C1BA 2YNGA 4CGFA 2ZE2A 1CZBA 4DU4A 5D3GA 3OY9A 4I9LA 3MXIA 1NK7A 4DF8A 4O44A 1R0AA 3V81A 2Y1JA 4FJMA 2YHAA 3EZ5A 3VQAA 4OPJA 1HJRA 1BHLA 1X1PA 3AO5A 4CEEA 4FCYA 3LPTA 4RW8A 1SV5A 2XHBA 5KGXA 3G0ZA 4CJLA 3V9UA 1NK4A 1NK9A 3PY8A 4FLYA 1RTJA 2O4GA 1JLGA 3HVTA 1ZBHA 5HLFA 4PWDA 3VQBA 1SUQA 4E7KA 4O4GA 3FFIA 4IFYA 1X9WA 3RWUA 4B9UA 3SPYA 1ASWA 4M3WA 1WLJA 2IAJA 1J54A 2KFZA 1KVBA 3S3MA 4FM0A 4LH5A 1NKEA 2GBZA 3QINA 4FJLA 4OJRA 4CJQA 3P1GA 1DTTA 4KB1A 3V9XA 4DG1A 4KFBA 5HRRA 3P83D 3D0PA 2FBTA 3T3FA 4FLWA 3DMJA 3OJSA 1NJYA 1D8YA 4FJNA 1YT3A 4KHUA 3K2PA 4M45A 3ZSOA 3JSMA 3NAEA 2G8HA 1JKHA 2AJQA 4GMJB 1IKYA 3QNOA 1ZYQA 5FROA 2RKIA 3NBPA 3NH2A 3WNEA 3OYIA 4H4MA 3LAMA 4FM2A 1S1XA 3QEPA 4CJKA 5I42A 3ZSWA 5SWMA 1NKBA 2R7YA 3U3YA 2IDOA 1QHTA 1JLBA 4O0IA 4M3XA 3K59A 1BI4A 1VRTA 4E19A 3CG7A 3EYZA 4JRQA 3V9WA 1C0MA 1LWEA 4CFDA 3SZ2A 4KHQA 4M3YA 4FJ7A 4LY7A 4E89A 4I2QA 4C8LA 2PY5A 4EZ6A 1HQEA 3NH1A 1G15A 5KI6A 2D0CA 1GOBA 4N56A 1RCHA 4I2PA 4M3RA 2IS3A 4PY5A 3SJJA 2OZSA 1RTDA 1JL1A 4O5BA 1RBVA 1HQUA 4OKKA 3LP0A 3MEEA 5JS1A 1S6QA 2YNHA 3SUNA 3AVIA 4CEAA 2E6MA 1TK8A 3OYBA 2HHSA 2ATQA 1DTQA 2LSNA 3AA3A 3TAEA 2X6NA 3OYDA 3O3FA 3MXMA 4CESA 4OLBA 3AVJA 4B08A 1VK0A 1FKPA 4LSNA 5J2NA 3SUOA 3AA4A 4B9SA 3KTQA 3AO2A 1D5AA 3NF7A 4E1MA 2XO7A 2FBVA 2GUIA 1LAVA 3M8QA 1T7PA 4BE2A 4KAZA 3WNHA 1JLQA 4C8MA 3QESA 3HPGA 4CJ4A 1U45A 4CJFA 1B9DA 3IAYA 2HVIA 4CHPA 1WSGA 4I7FA 5CYMA 4LD0A 4F3OA 3RRHA 3RR7A 1K6YA 3MEGA 4QCLA 2OPQA 4PQUA 1WSIA 3PX0A 4HCBA 3ALYA 1D9DA 1KVCA 2Z1HA 1BIZA 3KLEA 4RW9A 3VN5A 4HHTA 1S1TA 4CIGA 4CK3A 4B3OA 1NOZA 1VSIA 2P5GA 2ZD1A 3VQ7A 1YTAA 3L2WA 1EP4A 2YHBA 4CEFA 1VSJA 5C42A 1MU2A 4H4OA 4KI4A 1HNIA 4QAGA 3HT3A 4LH4A 1T03A 4FZXC 3DLKA 2A1SA 3PUFA 4OKEA 3V9ZA 1TAUA 4CF9A 1BI4B 4HVJA 1HYZA 4ID1A 3AVNA 3K5MA 4JS4A 1L3TA 1LV5A 3QO9A 2F8SA 2KW4A 2DTUA 3PX4A 4Z4EA 1BGXT 4IBNA 1NJXA
chains in the Genus database with same CATH superfamily
5LJWA 4FO0A 3SI6A 3CCUN 1V55B 3LP2A 3HK2A 1KQSM 3K9AA 4R7CA 3SPCA 2IIRA 3LDNA 1CLQA 1A32A 1BCMA 4BG8A 4GT1A 2UXCB 3TR8A 3WT0A 4Z4CA 5LHIA 3G6EN 4UB6Z 3OVNA 4CH3A 3RSEA 1N33O 1AI4A 3HR0A 4JZ2A 4AHVA 2V4DA 4JKBA 4DR7K 4ISGA 1OCOB 2JJ1G 2WA3A 1TKTA 1NENA 1MOFA 4U3JA 3ASNB 2LGQA 4K8XA 1FFXB 4EFEA 1SKVA 1NGDA 1V54C 2FL4A 3VOUA 3EN9A 1JPXA 4DR4O 4IOXA 5C12A 3B8NA 2Y1IA 4FPPA 2H3OA 4JI6B 1VSLA 3A5LC 1SKSA 4LF7O 3BEXA 5JQGA 3MDQA 4MVSA 1PM9A 3ZYYX 2NRRA 3OYHA 4AHRA 5HRNA 3LSQA 3ZSYA 1SQPH 1YSCA 4JI1K 1AJQA 3WXKA 4QPKA 1NOYA 3K58A 1MNGA 4BR0A 4NR1A 1SAZA 4CGHA 1S22A 4XH1A 1EV14 3AGKA 4N23A 1KUQA 1GM7A 5HFLA 3IDHA 4KHPK 2LFRA 4KHNA 4JI3B 1CXUA 2Q97A 4DKWA 4EB6A 3G10A 3IG1A 4A2BA 5HOOA 1YQ4A 3VRAA 1KP2A 3BVOA 3H1LH 4CK1A 4FJKA 3S9HA 2D1KA 1GLAG 2XAJA 1RTIA 1NU1H 3DRSA 1L3SA 2M6YA 3SQ2A 1JJOA 2CTWA 5JICA 5CN0A 5BY1A 3ZMVA 1NH2D 3AA5X 3VPZA 1CXZB 2WC9A 1S9EA 3HYFA 4P9OA 4QE7A 2CGKA 5AQYA 3LZIA 5IT9O 1YDXA 4X89A 3CCRN 3V6DA 2FBXA 4Q4Y4 2BTQA 1JVMA 3MHHC 2RN2A 1OH7A 2UXBO 1VQPN 1K5SA 3O3HA 3NF6A 4M3ZA 1VQ9V 2O8CA 5KQDA 4AM6A 4JRPA 2JEUA 2E3CA 3J8F4 3VQQA 3QEPA 5EYPB 2HKOA 5KPRA 2EBOA 4DV5B 4J7KA 2GDSA 4RWUA 4LP8A 3S3XA 4E7JA 4RQEA 3KLFA 3OMAB 2CH6A 2OT5A 4H5NA 2D0PA 3K9SA 4C8KA 1X59A 3L2RA 3I0RA 5AQLA 2P6JA 3PJSK 3NGIA 5LGTA 3VEYA 4KH6A 1SQKA 1TVKB 3W7WA 1K9MW 3B09A 3H9VA 3M7MX 3QB0A 4BRCA 1L3UA 4B9TA 4YTPA 3ETDA 4CJ7A 3BY6A 1TKDA 3MWPA 1URFA 2KQXA 3J7YP 3GB7C 2IVNA 4DS4A 1XL4A 4MVQA 2E5LB 1J5EO 4TWKA 5EBLC 2GWJA 3VF4A 1OOPD 3ASOC 2HHQA 3H08A 3CCMN 4FK4A 1HNVA 5EZYB 2B4JA 5A2QO 1M56B 4OKJA 2ZT9B 1C0UA 3RGBA 4CHNA 2EIMC 3VR9A 2A7WA 3CRCA 4YOXA 3TAPA 1S9GA 1NK5A 1ZL8B 4DQPA 3APQA 3WG7B 4FLXA 3SAHA 1CZAN 4ELTA 2XUMA 1XMQO 4B3SK 3O4NA 4FW1A 2UXDO 3ABMB 1RUJ4 2WLHA 4IIJB 4UVAA 3Q7CA 4CZFA 4JI0K 3KKRA 4D7TA 1E79G 2BH1A 1HW7A 3OS2A 5BMVA 5IJ0B 3SQ0A 1NNEA 3RMDA 3OYFA 1RDDA 1BQMA 2JDIG 2GUZA 2N74A 3HKBA 5JH7B 3TTCA 4DQRA 4X64O 1VIBA 4CI6A 4DSKA 4M3UA 2ASPA 2CGNA 2X5ID 2YX6A 4NYNA 3WXLA 1NJIW 1UAXA 2HLDG 2OTJN 4DR6O 3BUZB 2AZ2A 3U6FA 3AE3A 3JCZA 1R094 4LC9B 4CCHA 1SZXA 3KD5E 2O8EB 4X66O 4DK0A 4CC5A 4BC3A 3RTVA 4M3TA 1IBMB 4BRDA 4DR2K 1K5QA 1OZ0A 2HNZA 5IWAB 2V51B 4DTJA 4BIZA 2NNUA 3KK2A 4LFAO 4UCSA 1KTQA 2ZF5O 1VSFA 3TABA 1H8TD 4LF9B 1OCRB 4LC1A 2KB1A 3R65A 5C24A 1JOYA 5AQNA 4J80A 1NQTA 3ZCMA 4I6MA 4XIUA 4MTGA 4JI8O 3NCIA 5EY4A 3Q4HB 1MG1A 2OCCC 3NHGA 4G9ZA 5AZIA 2ZR3A 1NTZH 2AHYA 5B1BB 1X9SA 1FFTB 4A5UB 3SFEA 2A0LA 4QJFB 4YJ2B 3CMAV 1RDUA 1F4MA 3AG1C 1TUEB 3H45C 3IMXA 2Y0IA 3EKUA 2QKKA 3CM6A 3VQPA 3OMNB 4LH6A 5JCOA 3DOKA 1K97A 2F23A 1FW6A 4IOCL 4LF5B 4ZHRA 3NVKA 3QLHA 2RDCA 4X88A 1NGEA 3UT5A 1IG8A 3AE5A 2DW4A 1WPXA 3LWMA 1T5EA 2DOSA 1M1KW 1WB8A 2VWKA 4B3RK 3WNFA 1TGOA 2VS0A 2WLIB 3SYCA 3ZHRA 3HJFA 1OVQA 3SQ1A 4X62B 1VSDA 1IH7A 4IG0A 2P9LA 4Q4V4 1HR0O 3T2MA 4BVPA 4I50B 3HKCB 4LF6O 1IJJA 4WQ4A 1H2NA 4PD4F 1XILA 1M90W 1CP9A 1W9HA 1N0NA 4G28B 4CJVA 3BZKA 2QM7A 3E35A 1T05A 1A5XA 2KZZA 1KD1W 2D0BA 2W41A 4RG8A 4CHZA 4GX2A 4DSIA 4A5AA 4DW0A 5KHHA 4AILC 3QBXA 4MO5A 2EJRA 4MTOA 2BSKA 2BANA 4TSXA 2ZJPL 1O9GA 4FWNA 1R1BA 4JASA 4CEQA 4EIAA 4IDKA 4B3TK 3VRBA 1S72V 2W6KA 4HTLA 3ABKB 1VBE4 2EULA 4OGQB 3CFPA 2R70A 4JYYA 5BR8O 3BY5A 4DV3O 1ORQC 1K73O 1WN7A 1NGBA 1B06A 4CEZA 5AQOA 1RUD4 2B1IA 5CA3A 1XMQK 3DXRB 3CPWM 3BA8A 3SJQC 1S1WA 1QHAA 3O80A 1HYSA 5LP6A 1KRPA 2QJ1A 1B3QA 1HYVA 4CJPA 3SUQA 3VQEA 5J2PA 3HP9A 2QK9A 3LDSA 1KCFA 4F8RA 4GKKK 1T44A 3TPQA 1WB7A 1XNRB 2FKXA 3DXKA 1ZC6A 2VQEB 3HL8A 3KK3A 4Z1MG 4E7HA 4Z2WA 1WSEA 4XDJA 1VQ6N 2P9UA 1LAWA 2D0AA 4CZKA 5C2DA 1NGIA 4E1JA 1LWCA 3O3GA 3OS1A 2GHYA 3CCVN 4JYCA 3T1HK 3HSTB 4FPBA 3NE6A 1YJWN 4CVNE 3DLEA 2NNWA 3AE2A 1TAQA 5EC2C 1N36K 4BE1A 3CJHA 5B3SC 3CI5A 3DRRA 3WEEB 1VMGA 3R3LA 3ZIAG 1RHI4 4MLHA 3JALB 2UUAB 5CMUA 1ZBLA 4DSJA 3DYAA 3MEDA 4FOIA 2E88A 4C8NA 5BN8A 4CBXA 2F4VK 4TOIA 3VA3A 2CGOA 4O4LA 4H8KA 4DS5A 1W2BM 4DUZO 1S1UA 1XNQK 4DQ8A 4U7OA 4W5TA 1DTOA 1SQFA 1YI2V 2PI5A 4IDHA 4A61A 1K5MD 2OPPA 1RT6A 4JI8K 2ZE7A 3JSLA 2EHGA 1BG3A 3CETA 1AR5A 4BC5A 2HMPA 1OH5A 1HNZK 1RUH4 4RW7A 4NXNO 4JGSA 5LMNB 2Q67A 1OCZC 2IGIA 2KTQA 5M1KA 3BF1A 3MX2A 1R73A 3VGMA 1KKDA 2Q68A 5KRTA 2N05A 1NTKH 1HNWK 1J6ZA 2Q3SA 4WE1A 2BDPA 3G67A 2DYSB 1VHXA 4DV0B 3NF8A 3EL2A 2ZXWB 4C23A 3APOA 1FXXA 4WFAL 3THWB 4JI4O 2QWPA 1IVSA 2XRIA 3C6AA 2P9KB 3ZHVA 1Y76B 1A5WA 4KV8A 4AHSA 3ZT3A 3C6TA 4JKHA 1VQ4N 2KHOA 2PF4E 4WBNB 3BEHA 1YVWA 5KUMA 3EY1A 4ICGA 4LFCK 4KTQA 4AHCA 2ZR2A 1KFSA 3D2FB 1TYQB 1VQ5V 4RO2A 1DLOA 2JWLA 2P1JA 3D45A 5JVDB 3TETA 2ATKC 4CH6A 3AV9A 4F6RA 1UA1A 4CJTA 2OWOA 5CZ1A 4M63C 4N5SA 4MVUA 3HOSA 2GX9A 1IDSA 4JD2B 4C7UA 1LNQA 2Z0AA 1WB9A 3OYGA 1V55C 1KU9A 4RUFA 4KTZA 3WXJA 1M57B 2NRZA 2WDQA 1ZBUA 2WOMA 1GN6A 3B6PA 5KRSA 3VEOA 4BDPA 2HBKA 3VTIA 2LJ2A 4HYOA 4JTDB 3OM3B 1Q7YW 4BY9C 4IT5A 1RMU4 2HW3A 2ZIOA 2QSAA 1HNXO 1QQOA 3E9OA 3CF5L 2YIAA 3NGYA 1OCOC 4W5NA 5H6QA 1YEWA 2F9TA 3ASNC 1GOAA 3AEDA 3SLCA 1BQ0A 4O4JB 4P2ZA 1FXKA 3HXMA 2UYTA 3A0BZ 3ZMTA 4K35A 4YFUA 2YNGA 5IE9A 3L4IA 1IBLO 1R3LC 3JAKA 2P9IB 4DU4A 1NM1A 3SJCC 3ZHUA 1GAXA 3ZETA 3ZX3A 2VWBA 2BCCH 2YXLA 2YHAA 4DV7K 1BHLA 3LPTA 4RW8A 3UKMA 4FIPC 1N33B 1SV5A 4NXMO 2A42A 5KGXA 2EZOA 1R6NA 3TCUA 4PA9A 4CJLA 3V9UA 3PY8A 4FLYA 1AL24 2ZE5A 1V9PA 3AEIA 1ZBHA 4CZLA 4BR7A 3THXB 1ATNA 3CSXA 1RGIA 4ISFA 3ZRWA 4DR4B 3S41A 3H3OB 4IEEA 3K0GA 5FL7G 4JV5B 3D2EB 3J80N 1H1VA 1GK9A 2GBZA 4BREA 1AR4A 3JATB 4OJRA 4MSWC 4LF7B 4CJQA 2W6IG 2XT9A 3G71V 3RYCA 1BU6O 3D0PA 1Y4MA 1QZ5A 2FBTA 3KK7A 4FJNA 4OO1J 3TTFA 1NGGA 2Q73A 1EWRA 1ZYQA 5FROA 2RKIA 1PVC4 3NBPA 3NH2A 1KECA 5JJNB 3WNEA 4H4MA 3OYIA 1H2LA 3T1YO 1I94K 3LAMA 5A9GA 4WFNL 4NO7A 5CA0A 2YICA 3CXHF 4A5BA 1VRTA 1SQQH 4E19A 4JRQA 1OH6A 2Q7EA 1C0MA 1JCHA 4CFDA 4KHQA 1P4RA 1GH6A 4FJ7A 4BRLA 5C93A 1FJGO 2UXCK 4EZ6A 3CEIA 3RYFA 5KI6A 1GM8A 1QR9A 4NKGB 1K8AO 3PIOL 1FXHA 2HBJA 2RHKA 4DV2K 2UXBB 4DO2A 1VARA 1NR7A 3JAWB 2QWQA 5E79Z 4ZOLB 3D36C 5IWAO 2P9NB 4O5BA 4R79A 1RTDA 1VQNN 4OKKA 4DV1O 5JS1A 2YNHA 4JHDA 2Q8VA 1W59A 1HX1A 4JI6K 3C3TA 4X20A 4DCHA 4LF9O 1Q81W 1DTQA 2H3GX 1M56C 1VK0A 2QWRA 4B9SA 4O2AA 1JMKC 1Z6RA 3NF7A 3H1JH 3UO3A 2GUIA 3CC7N 1LAVA 1DK1A 1MA1A 3L73H 1ZXOA 1QR8A 3DGEA 4KXRA 4K0KO 1OH8A 3JXUA 2WDRA 4CHPA 3CJ7A 1OVYA 1I08A 4JI3K 3SPGA 3OUSA 4F3OA 1J5EB 5FPNA 4QCLA 2KG7B 1KBHA 2I7PA 2OPQA 3MEGA 4PQUA 4HCBA 2DQ3A 2YCHA 1NH2B 3VF6A 3KLEA 1D9DA 1S1TA 3E2EA 4B7EA 5AQJA 2P5GA 2J4RA 3BF3A 3VGKA 4I9WA 1YTAA 1EP4A 2YHBA 3OT7A 1PP9H 5LA6A 2UXDB 3E66A 4K25A 2WLLB 2ACZA 4BIUA 3N2GA 3R1XA 4W4KA 3D8CA 1HNIA 1KAYA 4F6EA 4LH4A 4QAGA 4DRXB 3QFPA 4Z1VA 4ZIBA 3AE6A 3WQTA 4CF9A 5DECA 4HVJA 4YXDA 1L3TA 4FFBB 3K5MA 2WFBA 3AVNA 1ATRA 3FZLA 1VQLV 3THYA 1LV5A 2F8SA 4DV5K 3JBG4 1NS1A 4RQFA 3RYIA 4JKGB 1PO14 5IYBO 1UWBA 3P32A 1F21A 5BR9A 1AR1B 4DR6B 2YI1A 4XH4A 3V1QA 4CF0A 3O5BA 5TISZ 4Z0UA 1Q82W 3O65A 3MMVA 1IO2A 3DC5A 5F2RA 3D6RA 2P9PB 5ITZB 4LWSB 1WPBA 3F5TA 3CRRA 4X66B 4FLVA 2YNIA 1VSMA 3KKSA 4CERA 4IYIA 4JF3A 2P9SA 5C10A 2LO1A 3GG4A 2ETJA 4UUJC 4IWVA 2P4VA 1RSOB 4FLZA 1VQKV 2DFFA 5CBGA 4YJ3A 3TI0A 3PSIA 2GEMA 2E5LK 2E8AA 1OJHA 1GOCA 4KBOA 1F23A 1QNMA 4LFAB 2CGLA 3QICA 3VERA 4TV9B 1L0VA 1KC8W 3M8AA 4PELA 1BA1A 4R8CA 1NMDA 3ASMA 2DJVA 4ID5A 2ZE8A 4UB8Z 4ZTFA 3KK1A 2CAZC 1YTUA 5LGNA 3MN5A 5K14A 2W42A 2RM24 3ID6A 5I9EB 3AG4C 1CPYA 5J2UB 3MCPA 3PV8A 4B1XB 1Q5OA 4ISEA 1QTMA 3UKUB 4M42A 3P4RA 1ZAUA 1UFIA 1IXMA 3GBTA 4RWTA 2F95B 3TAMA 3MHSC 5GAEP 3L2QA 2A3ZA 5LOVB 5LGUA 1U2VB 5AZJB 3RYHB 3R66A 4I0XA 4O5FA 3BDPA 4EZ9A 3HKEA 4NTYA 2ZM6O 3UKRB 1VAZA 3T1AA 3L6QA 3AGRA 3KVGA 4L8RB 4XEIA 2I5JA 5LYJA 4FWSA 4GUNA 4H0OA 1YQ3A 3PO4A 4AHUA 1B04A 4AQYO 5GIPA 1IBMK 2OA8A 5FPOA 2UXXA 4KP4A 2QTSA 5L3FA 1T3VA 4DFKA 1MZEA 4AF1A 5IWAK 2E20A 4DXWA 2UUAO 1F51A 2HVJC 3DC6A 3T19A 3OFNG 1HR0B 1CXQA 1THZA 3FR0A 1RT7A 3M8SA 1EM1A 4M41A 1U4BA 3CCLN 5EIBD 5H2FZ 4LF6B 1IKXA 3RSEB 4HWIA 5AQQA 5H1SQ 2Q0AA 1M5IA 4WFEA 3HZ6A 1TKXA 1ZWIC 4H13B 1C1AA 1ZBSA 3OYNA 1IV0A 5AQFA 4U3JB 3SBTA 4KFMA 2EX3A 3F5WC 3L8BA 4OLAA 5M1OA 2CH7A 2XASA 4CJRA 1LOTB 1XEQA 3BZCA 2QR4A 3CRAA 3ZN1A 4K8ZA 3QEIA 4GVMA 2XAFA 1N8RO 3M3ZA 3K04A 5JQGB 3A2FA 5LXTA 2NLXA 5JMVA 4CZGA 5F1XA 2JRIA 2Q7HA 5BR8B 4LF4O 4DV3B 3AAPA 5FLXO 4LF5K 2X6AA 3CX5F 2E2NA 3W0LA 5HROA 3CQYA 1RDBA 5LL6Y 4BE0A 1YXBA 1COWG 3H01A 4OPAA 1WAJA 1Z5WA 4EB6B 4CGIA 1U49A 3ZSVA 3L72H 1AR64 3C6UA 1A5VA 4X62K 1I39A 1X9MA 2ZDIC 1YJNV 4IOAL 5CR4A 3SMPA 3IC7A 1QQMA 2L6LA 3TXSA 2F9WA 4RW6A 3H3NO 2E76B 5FPEA 4KKOA 5L3EA 4GV3A 3SFDA 4CZJA 2BTQB 4DU3A 2Z1IA 3AEBA 4DSEA 3CC2N 2MK3A 1AP5A 5FLXN 2O8CB 2NUBA 1OHHG 4JK9A 4FM1A 1E4GT 4LF8O 3L70H 2JS3A 1N5YA 4IO9L 4YOWA 3K5NA 1U47A 2H8PC 4PV1B 3RFRA 4PKHA 4J2BA 2ZNIA 4DQQA 2A9HA 4DUZB 1RDWX 4LR3A 1Y6XA 2Y69B 1CEZA 2B5UA 2V7ZA 2Y0PA 1RVF4 4Z4HA 2W6JG 1M93A 4UCVA 1RBSA 4DLEA 5E1AC 1YZBA 2FF3B 2Z3YA 3VA0A 4NXNB 2QM4A 1KB9F 4BRKA 2RR14 2DE0X 1RFYA 5EBMC 3GL1A 4LH7A 3AE9A 1NLVA 4B1VA 1Y74A 2C2AA 3R6MA 3ZJZA 4FPAA 4DFJA 4RHV4 3GWOA 4DW1A 3MCAB 2RMKB 3OEHG 4I9QA 1R59O 1EQYA 1XNRK 2FBYA 2QKCA 3K08A 3ZT0A 2VQEK 3JASA 2PFUA 1RDAA 3VR8A 1JX9A 2CE4A 2CDYA 5H5NA 4JV5O 4FJ5A 1US6A 1RBUA 2VG6A 3AVAA 4JI4B 5CZ2A 4DR5B 4UVBA 3FZHA 4FJXA 4JI2O 5BMVB 3ZT2A 4JYAO 2WU2A 3A8YA 1REVA 3ABVA 5C3JA 1JLFA 4H44B 2FSNA 2GUZB 3HKBB 1ASUA 3THOA 5B8HA 4YY3O 3LAKA 2UUAK 3KIOA 1BIUA 5HP1A 1QCEA 1ROPA 1GLLO 3ENHA 1QLEC 3PO5A 2YJFA 3PLAA 3SYAA 4J7ZA 1XHZA 4JN4A 2JK5C 3UE5A 3AA2A 1RUE4 3JD3A 5LHGA 4OX9O 4CE9A 4PL8A 3LWLA 2QEXV 2E74B 3C95A 4H0YB 3F73A 1JL2A 3GOIA 4KPYA 4KHYA 1N32O 3N2KA 3M8PA 1YTFD 4IKFA 5ADXA 2HBMA 5LMNK 4BWMA 1BHAA 1J5OA 1HNXB 1Q86O 4CJ3A 3QNNA 3K5LA 4YDUC 3AVBA 4UQGA 1QVFU 1EN4A 3EKSA 4NYFA 4CFCA 1K4CC 3VQDA 1AROP 1R6KA 2FMLA 3MD0A 5K1PA 4DUYO 4DV0K 3RRGA 2BTFA 1QQNA 3RW0A 3NXSA 3I0SA 4I4TA 1IBLB 5AQRA 5AZIB 2QWOA 2RPIA 4JKAA 4FZYA 3QO5A 4YSZA 4PDVA 4J9YB 3E89A 1R084 4Z94A 2JLEA 2RE2A 4NXMB 1LR1A 4BWJA 3HM8A 3HM9A 3V1OA 4X65O 1RILA 3VEWA 3FI7A 3QFUA 2IBZH 2ZCEA 4CHOA 2ZE6A 1YHQV 1IBKO 4DTRA 2HMIA 4K42A 3LZJA 4H33A 2UUBO 1YF5L 3UT5B 2IJKA 3DSQA 5BPNA 1VQPV 5GONA 1JJ2U 4DQSA 1RPRA 4YOYA 4CIFA 3B6OA 2QGNA 3BP8A 2IH3C 4MFBA 3B8MA 5C25A 2QM8A 4UVCA 5CBHA 2ZWHA 4PDWD 3ZEDA 4H5RA 3NGZA 2IJJA 4LNUA 4GCZA 4DV6O 3ZT4A 3AVGA 2P9LB 2FC0A 1NKCA 4YT0A 4Z4FA 1LUWA 3T1YB 4HUFA 2QDOA 3ZSXA 5GINA 2P22C 1BL3A 3DAWA 3DLGA 5JJJB 2ITCC 3NR7A 1EXQA 2A41A 1IXBA 1L3VA 4ELUA 3E8BA 2AGAA 1VP7A 1Y66A 2W0XA 3ETQA 3SMSA 2XY6A 4X9QA 5HL7L 1SRYA 2Z1GA 2BE2A 2LP7A 3CJAA 4MDBA 3VQ5A 3ISNC 3AVHA 5AQIA 5AG2A 5C15A 1FJGB 1TVRA 2BSKB 3V1RA 4DTOA 3N27A 1N33K 4E2LA 3CCMV 5AR0A 4F2SA 2EINC 3AG2C 3UIQA 4W5OA 4B1YB 4CBWA 1AB3A 4WF9L 5F2VO 4J2AA 5CY4A 3CMEV 3QNEA 1RM1C 2NR5A 3HO1A 5L3GA 1NMNA 2XY8A 1P8ZA 3SPIA 1WAZA 4DV1B 1U04A 5DMRA 4C1NK 4CW7B 4YORA 4DR4K 2ZJQL 4JAUA 2D0OA 5SZTA 1SKWA 3LALA 1L0LH 4X1IA 2FXUA 4FJIA 4H0TB 3THVA 4LF7K 4UCRA 4FJCC 2EIKB 1H38A 1GTOA 4FJHA 3DM2A 3BABA 3KKYA 4TT3G 4CS3A 4JI7O 5LP6B 3VQYA 5FPMA 3OYJA 3EEQA 5M1PA 1SKRA 4YOTA 2XTAA 2O8DA 2O8BA 1FKAO 4PKIA 3LNMB 1NGCA 1PNKA 1VRUA 4K0KB 1BCOA 1E4FT 3SYOA 1U6ZA 3DXKB 5AQXA 2HJDA 3HPHA 5IJ9A 3TJTA 1ZLZA 4ZKIA 2DMXA 4PA1A 1TUYA 2P9UB 3FZKA 4FLUA 5C2FA 2B76A 2JWKA 1TL3A 1RUF4 3QIOA 4OVLA 3ZMZA 4I55A 3I8DA 4CBCA 3K03A 3CJHB 3OBWA 2G8WA 1WA8B 1RDCA 3ZX6A 3LPUA 3O1BA 4JLHA 2YSUB 5FNVA 4QOZB 5E41A 4R6ZA 2EILB 2YEVA 3JCUZ 2ITGA 2UXBK 3X2QB 4O4LB 4KRFA 3LANA 4BR9A 1I3AA 2A6AA 4F9OA 1EZJA 2DYRC 5CBFA 1XQ8A 3SYPA 3ETGA 3D36A 2AP1A 3P39A 2OIGA 3CCEV 2HF4A 4CGFA 5D3GA 1YIJV 4QS9A 4I9LA 3HPLC 4FOEA 1NK7A 4DB3A 2ETNA 1DF4A 2N04A 5AQUA 4A59A 4BR4A 3EZ5A 4OPJA 4JAAA 1HJRA 4CEEA 4UCTA 1X1PA 1S72N 4ILGB 3M8RA 4X1KA 4NTWA 1BGYH 2WUSA 1RUC4 1NK4A 3MN6A 2Y48A 1RTJA 2O4GA 1IZ3A 2M7WA 3EO3A 2YXYA 1NGHA 2YS8A 2RQ6A 5HLFA 4J10A 1NR1A 4PWDA 4CC6A 2WU5A 1RPOA 1J5EK 2QWPB 4BROA 4O8UA 3RWUA 4B9UA 1YCIA 3ZRVA 1WLJA 4FK5C 1GLEG 1KVBA 3BHPA 4X1YA 1NKEA 5IYDO 3QINA 2R044 3ZHQA 5LMUO 1JCGA 2WBNA 3OHRA 5HRRA 3I56N 4KHWA 1NJYA 2UXDK 2LW1A 1XOUA 4M45A 2G8HA 1ENVA 4F6RB 1BT8A 3TU5A 4BR6A 3LUTB 5C8YA 1S1XA 4CJKA 4YSYA 4X64K 1HP8A 3U3YA 2QM1A 1NKDA 4R50A 3GVMA 3K59A 3HKDA 1HPMA 3CG7A 4DR6K 1NCQD 2ZM6B 4MT8A 2DN9A 5IY5B 5KX5A 4M3YA 3H1QA 4J42A 1AJNA 3ICXA 4O4IA 4X66K 1G15A 3N4PA 1GOBA 3AE1A 4AQYB 1U97A 4M3RA 1EFRG 1Q90D 1FYJA 2IS3A 4PY5A 1FXKB 1QVGU 1G6UA 1NU0A 1RBVA 1P90A 1YI2N 3K3WA 1G4YB 1GKFA 3FAVA 3JAKB 1S6QA 3RN4A 4BRFA 1H8EG 3ZETB 5KPZA 4LFAK 3MK6A 3OYBA 3J81N 5C0YA 3ZRXA 4D6TH 2ATQA 3ID8A 3TAEA 2X6NA 3AVJA 4PDMA 2Z5UA 3JSNA 1IURA 2QI2A 4V19S 1DLBA 4BW5A 1D5AA 4MW3A 4B1ZA 1MSWD 2XO7A 4FSVA 2FBVA 3M8QA 4DHYA 1T7PA 1KF6A 1JLQA 4C8MA 3QESA 2IW5A 1SERA 1PL0A 4BRQA 3ZRWB 2UU9O 4CJ4A 1B9DA 1MABG 2QTDA 3FZFA 1WSGA 1PIV4 3VQXA 3PIPL 3CCQV 4PDRA 1YJWV 5CYMA 4LD0A 3RRHA 3RR7A 2W0FC 4MDAA 1VQ8V 3RYCB 4LF4B 3ALYA 1KVCA 2Q5ZA 3EFFK 3VN5A 3ZS8C 2RCVA 2BUPA 4DR5O 2JJ2G 3JD74 4ZHQA 1VSIA 3HKCA 3T69A 2ZD1A 1X4TA 3JARA 4FL9A 3JS6A 5ADXH 2EIJC 1MU2A 1NI8A 1OCCC 2Y4TA 4KI4A 5CA0B 3OTOO 3BRCA 2QWNA 3HT3A 1T03A 1MMMA 1HKGA 4FZXC 4OKEA 2A1SA 3V9ZA 1TAUA 1AI5A 2WLMA 5CE3A 1EZVH 1FXVA 2A79B 5GADP 2DTUA 4MVZA 3BFRA 3QO9A 1HR0K 1N6QA 4IBNA 1NJXA 4LF6K 4Q4X4 3K9JA 3KCXA 3RYFB 4E4EA 4KB0A 3A0RA 3W7XA 1GN3A 3KHYA 1MQTD 3VMFB 1KVAA 5CA1B 2Q36A 4CGDA 4B9MA 3E8HA 4Y1DA 3C3SA 4BRAA 2QWQB 4BW9A 3F9MA 4U3FH 1YJ9V 2FBWA 2A1RA 2RS14 2FYUH 4WF9V 3SV4A 4JHDB 2ILMA 4LF8B 1LW0A 3J80O 2X78A 4JI5O 4DFMA 1ZBIA 2JIZG 5KQ8A 4X20B 2AHZA 2VQFB 1K8KB 2ZD9A 1D4M4 4KH5A 2HHHO 4FLTA 2KFNA 4JEPA 2W40A 5LY3A 3SQ4A 1KP3A 2XY5A 3A5MC 4O2AB 5BR8K 4DV3K 4BQZA 1VQMV 3L2UA 1PPJH 4GLXA 1K9MO 3L0QA 3I5DA 3IC9A 4L87A 5HRPA 3CD6N 3SJBC 3OD4A 1YITV 2H88A 4FK2A 4ZI7A 3KZIZ 3U9DA 5AQGA 4YHHO 1HKBA 2DQ0A 3RWRD 1MSDA 3D7EO 1GLJO 1JQ0A 1Z05A 2YJEA 4DQIA 1WSFA 1W97L 4LFBO 3ZEUB 3ZRSA 1BZKA 3VBBA 2E2PA 3SPHA 4GV9A 3O9UA 2FF6A 2XNDG 4CGJA 1IG9A 3ZLJA 2QKAA 5LA6B 2ZDIA 1AP6A 4BGAA 3V4IA 4Q0BA 1PNLA 3RVYA 2LQTA 4DR1O 1ZUQA 4JI2B 3CJ9A 5KMGA 1QQCA 3FYEB 4QS8A 1VF7A 3MN7A 4JYAB 4EFBA 1I5XA 2RJZA 3CXCU 3THYB 2HHWA 4DR2B 4YY3B 3RYIB 2GTDA 4FJ8A 3P3PA 2RS34 3MN9A 3EXAA 1NJIO 3VQWA 2HFEC 3TAFA 1YAGA 2HHXA 1SS3A 2OCHA 2AZ0A 1TK0A 4DUZK 2E6LA 3FB8C 4OX9B 1OKJA 3TK1A 3CERA 5MLCQ 1VEWA 2I7NA 2P4KA 3K0DA 3SPZA 3O9RA 1C0GA 4DTUA 3RR8A 4CF1A 1QZ6A 4ZTJA 2FLOA 4CF8A 1N32B 2P9SB 1UA0A 4FZZA 1NBMG 2G8VA 5KAFZ 4B3MO 4NXNK 1TL1A 1HPZA 4QNHB 3E9LA 4N21A 2WDVA 5KA6A 2WTUA 2IM9A 1BO5O 3CRQA 3HP6A 3HVRA 4JKEA 1ASJ4 2A40A 4DUYB 1G8MA 4FWQA 1HWYA 2OIEA 1J9AA 3ASOB 2P67A 5FRNA 3EVKA 5JVDA 1NTMH 3J7AP 2OTLN 2VG5A 2HHVA 4JI4K 4CZMA 3QERA 4AI8A 1NG9A 1JLEA 1K34A 2X74A 1AI7A 4TUYA 3FLCO 3ULEA 1QSSA 3WG7C 5DM6L 3IFRA 1PV0A 3ABMC 5EK0A 3OS0A 4DTMA 4B8CA 3TSPA 2CUGA 4EHTA 1BEV4 4X65B 4B9NA 2ZQBA 4CZEA 5AFUA 4I0XB 2CK3G 3HKEB 4CJEA 2Q9LA 3CCJN 1KYOF 4CFBA 1IBKB 2CH5A 5CB4A 2HHTA 3E22B 3AY9A 2UUBB 4DK1A 2RF2A 2B6AA 1BE3H 2IJIA 3CE2A 5M1FA 2YNFA 5LYJB 1M1KO 1FK9A 3AEEA 5GTHZ 1YTFB 4G27B 1Z7S4 3SV3A 1S1VA 3T1CA 2IVPA 5B1OA 3L3UA 2ZJRL 5F0XA 5HBMA 1SA0A 2QW9A 2JGDB 4JKFA 4Z4GA 4FWOA 4BRMA 1HNXK 2QKBA 4E0DA 4OPKA 3JAMO 4DV6B 2GBOA 5AQKA 2WWWA 4FJ9A 5C2TA 3ZMSA 2YKNA 3W7UA 3E01A 1TA8A 3HB3B 3FB5C 3L71H 3CC7V 2NN4A 4YDUA 3U8XA 1VQOV 1XC9A 3WXMB 3LDCA 4CD3A 3TGUH 1M90O 4FFKA 2P5OA 3NFAA 3E8FA 5FDLA 4KL1A 1W0KG 2F93B 1OCRC 2P90A 1KAZA 3EE8A 3S3NA 3PX6A 1KD1O 1IBLK 4IL6Z 4HUEA 4B8AB 3AEFA 2HF3A 4CBUA 2HP8A 3CC4N 1VQKN 2CH7B 4K43A 3L4QA 1C0TA 2OPSA 3C94A 4O0JA 3JATA 5EU7A 3ENBA 4NXMK 3CJBA 1O13A 3KLHA 4UY8O 2HHUA 5B1BC 1NWKA 4FVMA 4Q20A 1JFFB 3FD9A 1WAFA 5LXTB 3QO7A 3AG1B 4J2EA 2XY7A 4GKJO 1AR94 3CQ8A 2HB5A 1SQBH 2D4WA 4WQ5C 3TSUA 1EWQA 2BGGA 3BCCH 2E2OA 1RBRA 3G4SV 4O2BA 3JAMN 5IYZA 1ZTEA 3ZCCA 3CFOA 3K0SA 3W7SA 5J2TB 4WFAV 3OBYA 3R8EA 3K57A 1IKVA 4C1NI 3MX5A 1QSLA 1NVPD 4DV4O 4JI7B 4MO4A 1Y97A 1WBBA 2E75B 5BRFA 2EWSA 4E1NA 4MS2A 1RBTA 4B7KA 4CZZA 3LDEA 4A62A 2O4IA 3T1YK 3OR7C 3QO8A 2XOKG 2UUCO 3H6EA 2VWJA 5GW7A 4HNAA 4DR3O 1XMOO 2WAMA 3FKSG 4B1UB 4CJUA 4F3TA 1NA1D 3AO3A 1N34O 1JA8A 3HOTA 2R074 2NRTA 3OAAG 1S5HC 2V1DA 4BDYA 1RT2A 4HZ3A 3BGRA 4N47A 1FJGK 5DN6G 2Q69A 4DTNA 3AE4A 3CPEA 3STLC 3H46O 4FW2A 2P51A 4DU1A 2VGMA 2IVOA 2AXTZ 4N41A 1VBB4 2W6LA 3VQCA 1MWMA 4JYBA 2XAQA 4GYCB 4PHZA 3T7ZA 3QEXA 1L1FA 1T6CA 1SC5B 4DV1K 4DFPA 1YF2A 2Q0OC 2F66C 3ABKC 2ASOA 4IXCA 3V9SA 3R9PA 4FXDA 3ZSRA 2R9AA 1NJWA 3P4PA 4LF9K 3KD1E 3AG7A 1HRI4 5J1EA 1LUVA 3RVZA 1BHBA 3SNNA 5BRHA 2WLKA 1W0JG 1Y74B 3A5NC 4JI1O 1TK5A 3I55N 1Q43A 3HPOA 2DY4A 4K0KK 4G2KA 2HOEA 3DOLA 4IFEA 3AVFA 3JASB 3B4SA 2CGJA 1RNHA 1S76D 4DF4A 1EBOA 3RVCA 4KHPO 1SZTA 3S3OA 3GWKC 1S3JA 3JD4A 4NLBA 2F96A 5FPDA 1VQ7V 4JNEA 4IG3A 2B5JA 3MXJA 5EBWC 3OEEG 2QA4V 1FPOA 3CM5A 1VF6C 1TKZA 5EXWA 4TQDA 5LMUB 4GY2B 2MW2B 3AG3B 4IFVA 5KGWA 1Q8IA 3NVMA 1DT9A 4IYHA 1YJNN 1NK8A 5B3SB 2YKMA 2NZTA 4L8JA 3QIPA 4PA7A 4H0VB 1UOCA 4R5PA 4FZ0A 3TAGA 2JGUA 3CCSV 1HLUA 2VGNA 3QVNA 3AE7A 2VCPA 4UXNA 1AJPA 2NRVA 3AO4A 3C7NA 5TKYA 1HRHA 1K7DA 3QG5A 3N2KB 3SGIA 3OW2U 4ICLA 2HWC4 2Q4PA 2KSDA 1Q7YO 3U3GA 4WFBL 2X6BA 3ATUA 3FFQA 3SYQA 3DWLA 2O8FA 1J95A 2G8FA 3ZSZA 1NJZA 2YXHA 1K73W 1ATSA 3OGIB 3SK3A 3L2VA 1PKXA 5KTQA 3DXMA 1JJ2M 3LSSA 1OCZB 2X7RB 2YIBA 3IS9A 4IJNA 1KFDA 4BRGA 4JKDA 5AQPA 1ZSPA 2VQFO 2E1ZA 4H5TA 2GELA 4I4TB 1ZX3A 1LW2A 3ZBHA 3KLIA 2RMU4 2QWOB 5JS2A 4CFAA 2DYSC 1GN4A 2KKWA 1NK0A 4CJSA 4FWKA 2ZXWC 1K4DC 3LP1A 2CTQA 4CJWA 3OGCC 3G80A 3CFRA 3SR2C 2ASMA 1Q6IA 4TV8A 1NK6A 1VSEA 1XC3A 3AE8A 4JK8A 4ILHA 5LJVA 4KUMA 3U4LA 5LHHA 4DMNA 4CH4A 4B3SO 3IUCA 1GM9A 1Z26A 4GZRB 4F2RA 4NCAA 4BIOA 3OYCA 4FK0A 4JI0O 2UU9B 4J2DA 2BOBC 4UFZA 5BREA 3CIRA 2FSKA 5GONB 4QPJA 4NLCA 4NYKA 3L9DA 1GLDG 5EIBC 1HXS4 2PW9A 3P5JA 4F4LA 1SESA 4KTWA 3ULDA 1BCCH 2E2QA 2ZIMA 2ZM6K 1O9HA 4H0LB 4O4HA 1C1CA 2WP9A 1BSMA 1EN6A 1M57C 4LNUB 1E3MA 4NB5A 5AQHA 1ZP0A 4C8OA 1TV6A 3VTHA 3ZHSA 3TWHA 4AQYK 5KPTA 3PSFA 3CCUV 1SF9A 2YV0X 3OTOB 4FZ1A 1ITGA 2Q2RA 3SBGA 4DR2O 2QEXN 4DV2B 2EZPA 3K9KA 3OYEA 2GTSA 2QE7G 3E86A 3G6EV 4WYBA 1D2DA 3J7AU 5B5EZ 4MVRA 1Q6UA 3OW2M 1V4SA 3P30A 3MAQA 1ASVA 3FZMA 3P4IA 3OYAA 1C1BA 1WBDA 2ZE2A 4U67L 3OY9A 3MXIA 2G38A 3M6GA 1WP7A 2VYPA 3NMUA 4DF8A 1R0AA 4FJMA 1P84F 1KFYA 4JK7A 3VQAA 1VQ9N 3AO5A 4FCYA 2YI9A 4BC2A 2NRWA 3G0ZA 1DGKN 3LDPA 5AQVA 4FWMA 1JLGA 4JI5B 1RP3B 4GNIA 1COV4 3VEVA 1PL4A 4XDKA 4X1IB 1SUQA 4O4GA 5AFUH 2HHHB 3TTDA 3VQBA 4E7KA 3PN1A 1Q81O 1JCEA 3QTCA 4IFYA 3C90A 1X9WA 2P06A 3SPYA 4M3WA 4I6MB 4LF4K 5H6RA 1TUBA 3S3MA 3H1HH 2LGWA 4FJLA 2O8DB 4OXSA 2O8BB 5KA5A 3H1VX 3V9XA 4ILJA 2UXNA 3P83D 4IHJA 3DMJA 3T4DA 3VOVA 3M99B 5IJ9B 1YHQN 1D8YA 2HSTA 4IGGA 3ZSOA 4B3RO 4YHHB 3NAEA 2AJQA 1S0VA 4GMJB 5BRDA 1KMIZ 1IKYA 4WCEL 3QNOA 1XREA 4LFBB 2FSJA 1L0NH 4FM2A 4MTFA 1GN2A 1BUPA 4CZIA 4I55B 5SWMA 2X0LA 3CCRV 2R7YA 5I42A 1K92A 2IDOA 1OV9A 1QHTA 4WFFA 1JLBA 4O0IA 2ARHA 4M3XA 1BI4A 5M1QA 3EYZA 5AQWA 5BN9A 2ZKOA 3V9WA 1LWEA 1B6QA 3SZ2A 5FNVB 1BL8A 4DR1B 2YEVB 2GSMB 4E89A 4NTXA 3P38A 2PY5A 1HQEA 2R9RB 3NH1A 4QE9A 5K1XA 1RCHA 4DYLA 2A5XA 4I2PA 4PHTX 4M7XA 4LF8K 2AA4A 4YTMA 4BRHA 3SJJA 2VQFK 1JL1A 3ABLB 5AQZA 4B3TO 2IJHA 3MEEA 5IT9N 3LDLA 3FB6C 1PNMA 3UCSC 2E6MA 3O6WA 4MVOA 1BA0A 4CEAA 1Q82O 2NLJC 1YVNA 1V4TA 2LSNA 3AA3A 1VBA4 4IO8A 3OYDA 3O3FA 1FFXA 4X1KB 5H9CA 4CESA 2PTMA 4B08A 3MXMA 1FKPA 4PI0A 3CMEN 3AA4A 5TKWA 4UCUA 4M7YA 1S77D 4KX6A 4QS7A 3A8TA 4B3MB 1R3KC 4BE2A 2YIBD 1NZ6A 3WNHA 1QVFM 3LM2A 1KC8O 3LDDA 2HVIA 4I7FA 4QIWF 4X1YB 3AK2A 4MTXA 4GKKO 1K6YA 3FE1A 4JV5K 4YOVA 1EN5A 3PX0A 3ZX0A 4AM7A 1R3IC 2Z1HA 1BIZA 4HHTA 4B3OA 1AILA 1I7FA 3CMAN 3SAGA 4JI2K 1NOZA 4H03B 3T1HO 3M5RA 4JYAK 4CEFA 2OTJV 2V52B 5C8YB 5A2QN 1M9NA 3M1FA 4H4OA 5C42A 1N36O 4YY3K 4Q6GA 3BAAA 3PUFA 3HKDB 1LCUA 4YOUA 4ID1A 1K8AW 3QMLA 1TAEA 4JS4A 3D3IA 3KZBA 5KX5B 3CHWA 4BRIA 3PX4A 1KAXA 4OX9K 4Z4EA 2F4VO 2H89A 2JVDA 4RCHA 4O4IB 1BISA 1B92A 1HMVA 3GE1A 1XNQO 1RTHA 3A0IX 2F7TA 3CIPA 4WFBV 2XAGA 2HNYA 3O4WA 4KO0A 4Y1CA 2GTAA 5EYPA 1F7YA 3SJHA 1N32K 4CJ5A 4OPHA 1SS6A 1Q9YA 3EZWA 3W3DA 3OR6C 2VRZA 2X6SA 3DLRA 4ABMA 3E83A 4RUEA 1NBWA 3VQ4A 1HNZO 3CPWU 4CS4A 3FAVB 2WA4A 1Y67A 1HDJA 4BR2A 5B1NA 3IRXA 3CCEN 2CTRA 1H2KA 4PDLA 1H2GA 4H0PA 4AHTA 4D7SA 1YIJN 1TVKA 3P3NA 1WUAA 3WQUA 1L5UA 2YI8A 1RT1A 1XQSC 4DUYK 4QGPA 5GAHP 1HNWO 1WOQA 1Q6HA 1C6VA 3STZC 4RTFD 3ZT1A 4TQFA 2R064 3FX7A 1F4NA 4EFHA 3WFVA 5FRMA 4ELVA 4MLEA 1XHXA 1S5JA 3C0BA 2QKSA 1WSHA 4DSFA 5JWPA 2OZMA 5EZYA 2IH1C 3AG4B 1B9FA 5L3DA 4HUGA 4P30A 2RS54 1ZL8A 5AQSA 4X65K 4LFCO 3Q7BA 1RT3A 4GX1A 4GKJB 2Q6AA 3FYIB 5BZBA 5B1AB 1IBKK 1MZFA 4IIJA 3ZMUA 3I8BA 1FKOA 2UUBK 3FB7C 4ZHQB 5IJ0A 4DTPA 1QSYA 1W2BU 5E26A 3RMAA 3CYOA 3JYCA 3JARB 5JH7A 4DV4B 3B40A 2OPRA 1GLCG 2Z1JA 3KLGA 2QWNB 4IEIA 3L75H 3SAFA 4O55A 4NB4A 4DV6K 3DI6A 4EP4A 4IJAA 3J81O 1SETA 3AARA 4J11A 5DEDA 2O8EA 3TANA 1NGAA 4CK2A 2UUCB 2LFSA 3UM7A 1YUWA 3T4ZA 4DR3B 1XMOB 4FJGA 1Z25A 4JS5A 4N76A 4W5RA 2FTKA 4IZ9A 1N34B 4B9LA 2ODMA 1AR74 3N4QA 4MQ3A 1S3XA 3K5OA 1CZ9A 4B9VA 4HTUA 2ZGYA 2QWLA 3W7TA 3J8AA 1BS3A 2ADQB 1JLCA 4DSLA 2D3OW 2WONA 2PI4A 3NDKA 4CD1A 4DV7O 1RUG4 4EKWA 4LBEC 4HAMA 3IKMA 2A3QA 3JD0A 5L3CA 1JXEA 1XWLA 4E7LA 1KXPA 3Q4HA 4DR7B 2PAVA 1I5YA 2OYQA 3CJCA 3WXIA 3K06A 4BGBA 3KWGA 3I56V 5EX5A 4J9ZB 3WNGA 4CS2A 2IOCA 2OANA 3DRPA 4YJ2A 3QBWA 1J53A 4DLGA 2YDEA 2B1GA 2NRHA 2ADPA 1NVPB 3QF7A 4ZI7B 3AVLA 3ZSQA 4BACA 4L3QA 3DLBA 4WQ5A 1D4XA 1H2MA 3UQ8A 3LM9A 1D9FA 4JI7K 3LDOA 1YXQA 3AG3C 5JLHA 1GLBG 2PYJA 4BRNA 5CYQA 3CCQN 4JI1B 3NF9A 5J9PC 3GDQA 1WLEA 1VQ6V 4E7IA 5IYCO 3OYKA 1VQ8N 1WA8A 4CF2A 4WCEV 4YTNA 2V7YA 3CCVV 2PBDA 4KHPB 1BDGA 5J2MA 1I94O 4Q4W4 2WLIA 3CQXA 3C65A 4AH9A 5D5QA 2WSSG 1P49A 3QETA 5GTIZ 2F1MA 4UV9A 5KMGB 4CEOA 4Q5VA 3D3QA 1VQ5N 4I50A 1Y64A 2KLAA 2HJFC 2G8UA 3O1WA 2UXCO 3SUCA 3MWTA 1QBZA 3A5OC 4FWLA 3AVCA 1TUUA 3VENA 4GW6A 4BC4A 4BG9A 5I3UA 3HRGA 4DV2O 4GB34 1LWFA 3JYTA 2YUAA 1RT5A 4ASUG 4J41A 2E1YA 2XAHA 1U48A 2IC3A 3HSCA 3ABUA 3OYLA 1EKEA 1JCFA 4A57A 2Q31A 2Y4UA 1R6TA 1YJ9N 4JI6O 3QDKA 3RBZA 2Y69C 4YIOA 2DFEA 1N8RW 1QS4A 4PUOA 5JJEB 1VSHA 4NCBA 4FWRA 1RUI4 4RAIA 2KKZA 3CJ1A 5AJ3K 1UJWB 1G1XB 3IJ4A 3IGAC 4CIEA 2IU0A 2KZMA 4CEBA 1QVGM 1KLNA 2PYLA 4Y0WA 1VQMN 3DXRA 4U7NA 5BXZA 3AO1A 3OYMA 4JI3O 1HJOA 3F7YC 1VQ4V 1YITN 3AVMA 1V54B 2QWRB 3S3WA 4FWPA 1W0HA 4TUYB 3HBTA 3ULEB 1VRH4 3F9KA 1FD9A 1K3EA 2HEPA 3DLHA 5LMUK 4MW8A 2GWKA 4BAYA 2QXFA 3DJCA 5EVZA 4JAVA 4Z4IA 2EJ7A 1WSJA 4GVEA 3QEVA 1BOTO 1VF6A 4A2AA 4B3SB 4DTXA 1BMFG 1FS0G 3KJVA 2YHWA 5KLVH 4JI0B 5CB4B 5ELZA 4E3SA 2E4LA 1RFQA 2F43G 4PA3A 1QLEB 4G1QA 5T7BA 3G71N 1SQXH 2BE3A 4H37A 3WEEA 4CH5A 1T8EA 4DV5O 1SZ2A 4F4KA 1AI6A 4RW4A 1SA0B 3AEAA 3JALA 4GX5A 3AK1A 3G25A 4YNQA 2A06H 2QWMA 4PI2A 1O1WA 2HBLA 3SJAC 4CECA 3N2GB 4JAXA 3VQ9A 2D5RA 3CYMA 4KI6A 2HVKC 1BWFO 4WFHA 5B66Z 3H1IH 4XBFA 1IKWA 3O4QA 1KKCA 2DPNA 2WLJA 1EX4A 1JXBA 4KH4A 3CD6V 1AR84 4EP5A 3SUPA 2FB5A 2RN9A 1VSKA 1D5NA 1JLAA 2HVHA 2E5LO 2G8KA 3FFKB 2D2CB 2R72A 4BQLA 3LP3A 1EAH4 1DGSA 3LNNA 1MDUB 1YVUA 2F8TA 3LSUA 1DF5A 3O08A 3AVKA 4FJJA 4NCGA 3IFXA 3F2KA 2PUSA 3P31A 2P7TC 1X3MA 1K33A 3P4QA 3THWA 2WS3A 2ZGZA 1GO3F 4YJ3B 5LBQA 2P9KA 1WNSA 1Y76A 3TXQA 3RMBA 2UU9K 3CS5A 4TSFG 1FAFA 3G6BA 3O9QA 1XI1A 4JTAB 3B8AX 3O8MA 4O2BB 5IYZB 2JS5A 3O9OA 1NGJA 5GIOA 3NH0A 4WBNA 2PZSA 5JCOC 3TSQA 5DM7L 4ZBMA 4JZGA 4I7ZB 3D2FA 1TYQA 4YXWG 3VQ8A 5DK5A 2PGGA 2K9PA 1KLMA 3ENOA 2ITMA 4KREA 4OGCA 4DR5K 2EIMB 3FGUA 1VBD4 2PLV4 3VESA 1IX9A 5D5PA 1HUXA 4JD2A 2ZQMA 4CHYA 3DLLL 1EO1A 2Q0RA 2HG5C 3B2EE 2ZINA 5CHIA 4BVOA 4B3RB 5KHIA 3OTOK 1MA9B 5CA1A 1PD3A 4HNAB 1IBMO 2GV9A 3ATVA 3MECA 4BDZA 1GLFO 4OGEA 4W5QA 3K79A 2ITDC 3ABLC 4FVUA 1NEKA 1Q86W 4WQ4C 4K41A 4FYDA 2VG7A 3E9PA 3TARA 2IU3A 5M1NA 1BQNA 4P9PA 3EHBB 3ITHA 1K8KA 4CHQA 3KCYA 4EEQA 4DTSA 3L3VA 1ILYA 2QXLA 1POV0 1VQNV 4O4JA 4XDLA 1H2SB 2DFHA 2G8IA 4BR5A 4YIPA 3OJUA 4CGGA 3E8GA 2P9IA 1SL2A 3CXCM 1VQON 2EINB 3AG2B 1QLNA 1VQLN 2OTLV 2DWDC 1DKGD 3UB5A 1S6PA 4JI5K 1ZBFA 1RM1B 2HHHK 1I0HA 2OCEA 4B3TB 2HNDA 3B77A 4FMTA 4U7BA 5KHJA 3OUFA 1T6DA 3JD2A 2LW7A 4HBNA 3ZEUA 4DWIA 3THXA 1C0FA 1WJZA 1P7BA 4WFGA 4LF5O 1AVMA 1R3JC 2EIKC 1Q3EA 3HI0A 1X3NA 3CCJV 3RMCA 5LP6C 3D2EA 1E1RG 4H5WA 2OCCB 5EOYA 1XMQB 4CEDA 4EAHD 4YHHK 1XBLA 4BWAA 2R7FA 5GAGP 1L8DA 3G4SN 3GQKA 5KHKA 3VF2A 2KQ2A 3U10A 4LFBK 5J2QA 3QEWA 1KSPA 4X62O 3O9SA 5HRSA 3P4SA 3A0HZ 4PL7A 3SYZA 1SQVH 1SQGA 4GKKB 4X64B 4XH5A 1S5LZ 3JD1A 3ETEA 5L3BA 1DEJA 3TAQA 1VF5B 4X8AA 2YHYA 3I33A 4DR1K 2B9ZA 4JTCB 3U0ZA 1SL1A 3T1HB 5AQTA 1RT4A 1QE1A 3VGLA 1PO24 2EILC 1N36B 3AK3A 3C7NB 2O57A 3O9TA 3X2QC 4KHSA 1Q9XA 3CC4V 3C6HA 3VEXA 5KHGA 1H8HG 4EHUA 1EETA 3SCXA 1Z5VA 1SL0A 3AECA 2DYRB 3UO2A 4HCCA 3VQ6A 2O8FB 3JAWA 2F4VB 3CWBH 4LSLA 4ZOLA 2P9NA 3LDQA 1XNQB 5FPRA 5EC1C 1CZBA 3MDSA 5BPLA 5BPMA 3DXMB 4O44A 3V81A 4JI8B 2Y1JA 5JVHL 4B3MK 2Q7GA 3WUHA 3VQVA 1JR9A 2XHBA 1HNZB 2L35A 2QTOA 4I5SA 1NK9A 1BQZA 2ZNJA 1E1QG 4DR7O 3HVTA 2WLNA 2YIDA 3L74H 5B1AC 4K3AA 3FFIA 1HNWB 1XNRO 3HTVA 1ASWA 3AAQA 4PJ0Z 4TV8B 2VQEO 2IAJA 1J54A 3F7VC 3LL3A 3CRMA 2KFZA 4FM0A 4LH5A 2WPDG 2GUPA 3VEZA 3P1GA 3E22A 1Z2GA 3J7ZO 2DWEC 1DTTA 1NT2B 4KB1A 2KG7A 1GMGA 4KFBA 4DG1A 4H5VA 3T3FA 4FLWA 3OJSA 4KHUA 1YT3A 1UPGA 3K2PA 1XL6A 3U11A 3JSMA 1VQ7N 1JKHA 3WB2A 1HRV4 4LFCB 5JLFA 2HR3A 2QA4N 2JGDA 2Q1NA 2X6CA 2YC0A 1W7AA 4CZHA 2WLLA 1ZOYA 4PKGA 4PA4A 3OMIB 4W4LA 2BTOA 4O4HB 3ML0A 2AW9A 3WB0A 3E1YA 3ZSWA 1NKBA 4DRXA 4UCOA 2RNBA 4FFBA 3VETA 3BA9A 3U9ZA 5IY5C 1U96A 4JKGA 4LY7A 4I2QA 4C8LA 3AEGA 3RT3C 3ZHTA 1KQSU 3CCSN 3ZX2A 4NVPA 2D0CA 2YHXA 4MVMA 4JPRA 3CCLV 4N56A 5KUKA 1HKCA 5LMNO 3OA9A 1Q18A 1ESVA 3OTFA 2P9PA 1FXKC 2JEXA 5ITZA 1XUPO 4LWSA 5IDJA 2OZSA 1XDCA 1HQUA 2H94A 3LP0A 3I55V 5JVGL 1M4UA 3DTUB 3ABTA 3AVIA 3SDLA 1JFFA 3KWIA 3SUNA 1TK8A 3WU2Z 4DV0O 2HHSA 1RSOA 3CP1A 4OLBA 3H1KH 4BRPA 4LSNA 3KG2A 5J2NA 3SUOA 4TV9A 5KAIZ 1GRJA 3KTQA 3AO2A 4E1MA 4DV7B 1N4CA 5J2TA 4B1WB 4PA6A 4KAZA 1X9JA 1N0JA 3HPGA 3CB2A 1U45A 2K1EA 5LL6Z 4GX0A 3IAYA 4CJFA 1G99A 4B9QA 2Q0UA 4GKJK 2R9IA 1TUBB 3WB1A 3ZN0A 4O8KA 5J2UA 4J7JA 2NRXA 3SPJA 3UKUA 4YSXA 4LCUC 1WSIA 2CTPA 4IHJB 4GV6A 4RW9A 4H0XB 3CHXA 4CIGA 4CK3A 4DV4K 5LOVA 1XUQA 2BOCC 1U2VA 5AZJA 3RYHA 1QU7A 1P7GA 3VQ7A 3L2WA 5DM6V 3UKRA 5E84A 1NGFA 3GQHA 2EIJB 1VSJA 1OCCB 4JKCA 3EE9A 3BPZA 4UV8A 5HFMA 3DLKA 3OE7G 5AQMA 2WQYA 2V7QG 2UUCK 1BI4B 1I94B 4J8FA 1HYZA 1MWKA 4DR3K 3CC2V 1XMOK 1WP8A 2KW4A 2HWB4 1N34K 1VBC4 1BGXT
chains in the Genus database with same CATH topology
3SI6A 3LP2A 3HK2A 1CLQA 1BCMA 4Z4CA 3TR8A 2UXCB 3OVNA 4CH3A 4AHVA 2V4DA 1TKTA 4U3JA 4K8XA 1FFXB 4EFEA 1SKVA 2Y1IA 4JI6B 1VSLA 1SKSA 3OYHA 5JQGA 4AHRA 5HRNA 3ZSYA 1NOYA 3K58A 4CGHA 4KHNA 4JI3B 1CXUA 4EB6A 3G10A 3IG1A 4CK1A 4FJKA 3S9HA 1L3SA 1RTIA 3DRSA 3SQ2A 1JJOA 3AA5X 1S9EA 3HYFA 3LZIA 3V6DA 2FBXA 2BTQA 2RN2A 3O3HA 3NF6A 4M3ZA 4JRPA 2E3CA 3VQQA 5EYPB 4DV5B 4E7JA 3KLFA 4C8KA 3L2RA 3I0RA 3NGIA 1TVKB 3M7MX 1L3UA 4B9TA 1TKDA 4DS4A 2E5LB 2HHQA 3H08A 4FK4A 1HNVA 5EZYB 2B4JA 4CHNA 4OKJA 1C0UA 3RGBA 3TAPA 4DQPA 1S9GA 1NK5A 4FLXA 4ELTA 3O4NA 4FW1A 4IIJB 3KKRA 4D7TA 1HW7A 3OS2A 5BMVA 5IJ0B 3SQ0A 3RMDA 3OYFA 1RDDA 1BQMA 4N76A 3HKBA 5JH7B 4DQRA 4M3UA 4DSKA 4NYNA 1UAXA 3U6FA 4CCHA 3KD5E 4DK0A 4CC5A 4M3TA 3RTVA 1IBMB 2HNZA 5IWAB 4DTJA 3KK2A 4UCSA 1KTQA 1VSFA 3TABA 4LF9B 5C24A 3ZCMA 4XIUA 3NCIA 3NHGA 1X9SA 4YJ2B 2QKKA 3CM6A 3VQPA 4LH6A 5JCOA 3DOKA 4LF5B 3QLHA 3UT5A 3LWMA 1T5EA 2VWKA 3WNFA 1TGOA 3HJFA 3SQ1A 4X62B 1VSDA 1IH7A 4IG0A 4I50B 3HKCB 1W9HA 4CJVA 2KZZA 1T05A 1A5XA 2D0BA 4CHZA 4RG8A 4DSIA 5KHHA 4AILC 4TSXA 2BANA 1O9GA 4CEQA 4IDKA 3CFPA 2R70A 1WN7A 4CEZA 3BA8A 1S1WA 1HYSA 5LP6A 1KRPA 2QJ1A 1HYVA 4CJPA 3SUQA 3VQEA 5J2PA 3HP9A 2QK9A 3LDSA 1KCFA 4F8RA 1XNRB 2VQEB 3HL8A 3KK3A 4E7HA 1WSEA 1LAWA 2D0AA 1LWCA 3O3GA 3OS1A 3HSTB 3NE6A 3DLEA 1TAQA 4BE1A 3DRRA 3JALB 2UUAB 1ZBLA 4DSJA 3DYAA 3MEDA 4C8NA 4TOIA 3VA3A 4H8KA 4O4LA 4DS5A 1S1UA 4W5TA 1SQFA 2OPPA 1RT6A 3JSLA 2EHGA 4RW7A 5LMNB 2IGIA 2KTQA 5KRTA 2Q3SA 4WE1A 2BDPA 4DV0B 3NF8A 1FXXA 2XRIA 1A5WA 4KV8A 4AHSA 3ZT3A 3C6TA 4WBNB 3EY1A 4KTQA 4AHCA 1KFSA 3D45A 1DLOA 2P1JA 5JVDB 4CH6A 3AV9A 4F6RA 1UA1A 4CJTA 2OWOA 5CZ1A 4N5SA 3OYGA 4KTZA 1KU9A 1ZBUA 2WOMA 5KRSA 3B6PA 4BDPA 2HW3A 2ZIOA 2YIAA 3NGYA 4W5NA 1YEWA 1GOAA 3HXMA 4O4JB 4YFUA 2YNGA 4DU4A 3JAKA 3SJCC 2YXLA 2YHAA 1BHLA 3LPTA 4RW8A 1N33B 1SV5A 5KGXA 4CJLA 3PY8A 3V9UA 4FLYA 1V9PA 1ZBHA 3CSXA 4DR4B 4JV5B 2GBZA 3JATB 4OJRA 4LF7B 4CJQA 3RYCA 3D0PA 2FBTA 4FJNA 1ZYQA 5FROA 2RKIA 3NBPA 3NH2A 3WNEA 5JJNB 3OYIA 4H4MA 3LAMA 5CA0A 4E19A 1VRTA 4JRQA 2Q7EA 1C0MA 4CFDA 4KHQA 4FJ7A 4EZ6A 3RYFA 5KI6A 2UXBB 3JAWB 1RTDA 4ZOLB 4O5BA 4OKKA 5JS1A 2YNHA 4X20A 1DTQA 1VK0A 4B9SA 4O2AA 1JMKC 3NF7A 2GUIA 1LAVA 4CHPA 4F3OA 1J5EB 4QCLA 3MEGA 2OPQA 4PQUA 4HCBA 1D9DA 3KLEA 1S1TA 2P5GA 1YTAA 1EP4A 2YHBA 5LA6A 2UXDB 3N2GA 1HNIA 4QAGA 4LH4A 4DRXB 4ZIBA 4CF9A 4HVJA 1L3TA 4FFBB 3K5MA 3AVNA 1LV5A 2F8SA 3RYIA 1UWBA 1F21A 4DR6B 3V1QA 4CF0A 4Z0UA 1IO2A 5ITZB 4X66B 1WPBA 4FLVA 2YNIA 1VSMA 3KKSA 4CERA 2ETJA 4FLZA 2DFFA 4YJ3A 3TI0A 1GOCA 4LFAB 4TV9B 3ASMA 4ID5A 4ZTFA 3KK1A 2CAZC 1YTUA 5K14A 2W42A 5J2UB 3PV8A 1Q5OA 1QTMA 4M42A 1ZAUA 2F95B 3TAMA 3L2QA 5LOVB 3BDPA 3RYHB 4EZ9A 3HKEA 4L8RB 2I5JA 5LYJA 3PO4A 4AHUA 1B04A 2OA8A 5FPOA 4DFKA 3T19A 1HR0B 1CXQA 1RT7A 3M8SA 1U4BA 4M41A 5EIBD 4LF6B 1IKXA 2Q0AA 1M5IA 1TKXA 1C1AA 3OYNA 4U3JB 2EX3A 3L8BA 4OLAA 4CJRA 3QEIA 4K8ZA 4GVMA 5JQGB 3A2FA 5LXTA 2Q7HA 5BR8B 4DV3B 5HROA 1RDBA 4BE0A 1WAJA 1Z5WA 4EB6B 4CGIA 1U49A 3ZSVA 3C6UA 1A5VA 1I39A 1X9MA 4RW6A 4KKOA 2BTQB 4DU3A 2Z1IA 4DSEA 2NUBA 4FM1A 1N5YA 3K5NA 1U47A 3RFRA 4J2BA 2ZNIA 4DQQA 4DUZB 4LR3A 4Z4HA 1M93A 4UCVA 1RBSA 4DLEA 3VA0A 4NXNB 2QM4A 4LH7A 4DFJA 4I9QA 2FBYA 3ZT0A 3JASA 1RDAA 4FJ5A 1RBUA 2VG6A 3AVAA 4JI4B 5CZ2A 4DR5B 4FJXA 5BMVB 3ZT2A 1REVA 1JLFA 3HKBB 1ASUA 3THOA 3LAKA 3KIOA 1BIUA 5HP1A 3PO5A 1XHZA 3AA2A 4CE9A 3LWLA 3C95A 3F73A 4KPYA 1JL2A 4KHYA 3N2KA 3M8PA 4IKFA 4BWMA 1J5OA 1HNXB 4CJ3A 3QNNA 3K5LA 3AVBA 4UQGA 4NYFA 4CFCA 3VQDA 5K1PA 3RRGA 3I0SA 4I4TA 1IBLB 2RPIA 4FZYA 2JLEA 4NXMB 4BWJA 3HM9A 3V1OA 1RILA 3FI7A 2ZCEA 4CHOA 4DTRA 2HMIA 3LZJA 3UT5B 3DSQA 5GONA 4DQSA 4CIFA 3B6OA 4MFBA 5C25A 3ZEDA 3NGZA 4LNUA 3ZT4A 3AVGA 2FC0A 1NKCA 4Z4FA 3T1YB 4HUFA 3ZSXA 2P22C 1BL3A 3DLGA 5JJJB 1EXQA 1L3VA 4ELUA 3ETQA 2XY6A 2Z1GA 2BE2A 3VQ5A 3ISNC 3AVHA 1FJGB 1TVRA 3V1RA 4DTOA 4F2SA 3UIQA 4W5OA 4J2AA 5CY4A 3HO1A 2XY8A 1U04A 5DMRA 4DV1B 1SKWA 5SZTA 3LALA 4X1IA 4FJIA 3THVA 4UCRA 4FJHA 3DM2A 3BABA 4CS3A 5LP6B 3VQYA 3OYJA 1SKRA 1VRUA 4K0KB 1BCOA 3HPHA 5IJ9A 4PA1A 4FLUA 1TL3A 3QIOA 4OVLA 4I55A 3I8DA 2G8WA 1RDCA 3LPUA 4JLHA 5FNVA 4QOZB 5E41A 2ITGA 4O4LB 4KRFA 3LANA 1I3AA 1XQ8A 4CGFA 5D3GA 4I9LA 1NK7A 3EZ5A 4OPJA 1HJRA 4CEEA 4UCTA 1X1PA 4X1KA 1NK4A 1RTJA 2O4GA 5HLFA 2RQ6A 4PWDA 4CC6A 3RWUA 4B9UA 1WLJA 1KVBA 3BHPA 4X1YA 1NKEA 3QINA 5HRRA 4KHWA 1NJYA 4M45A 2G8HA 4F6RB 5C8YA 1S1XA 4CJKA 3U3YA 3K59A 3HKDA 3CG7A 2ZM6B 5KX5A 4M3YA 3ICXA 4O4IA 1G15A 1GOBA 4AQYB 4M3RA 2IS3A 4PY5A 1G6UA 1RBVA 3JAKB 1S6QA 3OYBA 2ATQA 3TAEA 2X6NA 3AVJA 3JSNA 1D5AA 2XO7A 2FBVA 3M8QA 1T7PA 1JLQA 4C8MA 3QESA 4CJ4A 1B9DA 1WSGA 3VQXA 5CYMA 4LD0A 3RRHA 3RR7A 3RYCB 4LF4B 3ALYA 1KVCA 3VN5A 3ZS8C 4ZHQA 1VSIA 3HKCA 2ZD1A 1X4TA 3JARA 1MU2A 4KI4A 5CA0B 3BRCA 3HT3A 1T03A 4FZXC 4OKEA 2A1SA 3V9ZA 1TAUA 2DTUA 3QO9A 1N6QA 4IBNA 1NJXA 3RYFB 4KB0A 4CGDA 1KVAA 5CA1B 4B9MA 4Y1DA 4BW9A 2A1RA 3SV4A 4LF8B 1LW0A 2X78A 1ZBIA 4DFMA 4X20B 2VQFB 4FLTA 2KFNA 3SQ4A 2XY5A 4O2AB 3L2UA 4GLXA 5HRPA 3SJBC 4FK2A 4ZI7A 3RWRD 4DQIA 1WSFA 4CGJA 1IG9A 5LA6B 3V4IA 4JI2B 5KMGA 1QQCA 1VF7A 4JYAB 4EFBA 2RJZA 4DR2B 4YY3B 3RYIB 4FJ8A 3VQWA 3TAFA 2HHXA 1TK0A 2E6LA 4OX9B 3SPZA 4DTUA 3RR8A 4CF1A 4ZTJA 4FZZA 4CF8A 1N32B 1UA0A 2G8VA 1TL1A 1HPZA 2IM9A 3HP6A 3HVRA 4DUYB 1J9AA 5FRNA 5JVDA 2HHVA 2VG5A 3QERA 1JLEA 2X74A 1QSSA 4TUYA 4DTMA 3OS0A 4B8CA 4X65B 4B9NA 2ZQBA 3HKEB 4CJEA 4CFBA 1IBKB 5CB4A 2HHTA 3E22B 2UUBB 4DK1A 2RF2A 2B6AA 2YNFA 5LYJB 1FK9A 3SV3A 1S1VA 3L3UA 5HBMA 1SA0A 4Z4GA 2QKBA 4E0DA 4OPKA 4DV6B 4FJ9A 2YKNA 3E01A 1TA8A 1XC9A 2P5OA 3NFAA 5FDLA 4KL1A 3S3NA 2F93B 3PX6A 4HUEA 4B8AB 1C0TA 2OPSA 3C94A 4O0JA 3JATA 5EU7A 4ZHRA 2HHUA 3KLHA 4FVMA 1JFFB 1WAFA 5LXTB 4J2EA 2XY7A 3CQ8A 2HB5A 2BGGA 1RBRA 4O2BA 5IYZA 3CFOA 5J2TB 1QSLA 3K57A 1IKVA 4JI7B 1Y97A 4E1NA 1RBTA 2O4IA 2VWJA 4HNAA 4CJUA 4F3TA 3AO3A 4BDYA 1RT2A 3BGRA 4N47A 4DTNA 4FW2A 2P51A 4DU1A 4N41A 3VQCA 4GYCB 4PHZA 3QEXA 4DFPA 2F66C 3V9SA 4FXDA 3ZSRA 2R9AA 1NJWA 3KD1E 5J1EA 3SNNA 1TK5A 1Q43A 3HPOA 2DY4A 3DOLA 3AVFA 3JASB 1RNHA 4DF4A 3S3OA 2F96A 4IG3A 2B5JA 3MXJA 3CM5A 1TKZA 4TQDA 5LMUB 4IFVA 5KGWA 1Q8IA 1NK8A 2YKMA 4L8JA 3QIPA 1UOCA 4R5PA 3TAGA 2JGUA 3AO4A 1HRHA 3QG5A 3N2KB 3SGIA 4ICLA 3U3GA 3FFQA 2G8FA 3ZSZA 1NJZA 3L2VA 5KTQA 2YIBA 3IS9A 1KFDA 4I4TB 1LW2A 3KLIA 5JS2A 4CFAA 2KKWA 1NK0A 4CJSA 3LP1A 4CJWA 3CFRA 3SR2C 1NK6A 4TV8A 1VSEA 4DMNA 4CH4A 4F2RA 1Z26A 4NCAA 4FK0A 3OYCA 4J2DA 2UU9B 4UFZA 5GONB 5EIBC 2PW9A 3P5JA 4KTWA 3ULDA 2ZIMA 1O9HA 4O4HA 1C1CA 4LNUB 4C8OA 1TV6A 3TWHA 2YV0X 3OTOB 1ITGA 4DV2B 3OYEA 3OYAA 3MAQA 1ASVA 1C1BA 2ZE2A 3OY9A 3MXIA 4DF8A 1R0AA 4FJMA 3VQAA 3AO5A 4FCYA 2YI9A 3G0ZA 1JLGA 4JI5B 3VQBA 4X1IB 1SUQA 4O4GA 4E7KA 2HHHB 3PN1A 3QTCA 4IFYA 1X9WA 3SPYA 4M3WA 1TUBA