1XHZA

Phi29 dna polymerase, orthorhombic crystal form, ssdna complex
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*TP*T)-3'
publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
total genus 144
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhzA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhzA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhzA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhzA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhzA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhzA06
1NK6A 4BWMA 2FBVA 3VQ4A 3NF7A 1NJYA 4C8LA 2DFHA 2G8WA 3OYLA 1UWBA 1TVRA 3UIQA 2OZMA 1RBTA 2P1JA 3AVHA 2ETJA 4LH5A 2OZSA 3KJVA 3OS1A 3CFOA 3O3FA 2D0AA 2HMIA 3SUNA 3TWHA 3HPHA 4AHVA 2Z1HA 4CJ5A 3AO3A 1BL3A 1QSSA 4M3ZA 3HP6A 3AVCA 1BISA 3K57A 5J2NA 3CM6A 1D9DA 3K5LA 1XWLA 4DQQA 4FLXA 2E6LA 3OYEA 2OA8A 1J9AA 4EP4A 1HNIA 3LP1A 3QIOA 1RILA 1CZBA 3SUPA 4OLBA 4FK0A 3DOKA 4CIFA 4KI4A 4OKKA 3E01A 4OKJA 1XC9A 4H8KA 1TKDA 4F4KA 2AJQA 4CF9A 3KD1E 3TABA 4L8RB 4M3YA 3P5JA 1U45A 4IFYA 4B9UA 4CEAA 4FM2A 3DLGA 3KD5E 3DMJA 4DTNA 4H4OA 4CEDA 4O0JA 4E7HA 1LWEA 3AO2A 3LWMA 1RDBA 1YTAA 4CJEA 4B9TA 4CJSA 1SL1A 3OJSA 3LP3A 4DTMA 1IKVA 1BIZA 3NF8A 4Z4IA 4DTJA 4CGHA 2IAJA 4NCAA 4ID1A 4OVLA 1F21A 2XO7A 4KHWA 3RR8A 4LD0A 4B9SA 1WSHA 1S6QA 4BDZA 2VG6A 4G1QA 3V9UA 2QXFA 2X6SA 3G0ZA 4W5NA 4W5TA 4FK2A 1U04A 4C8KA 4EP5A 4FLUA 3AVIA 3OYDA 3WNEA 4F3TA 2B4JA 5HRNA 1C6VA 3TANA 3QEVA 3MAQA 4C8MA 4EZ6A 1D9FA 3DRPA 4C8NA 1U47A 1YT3A 3DM2A 3OYGA 5JS2A 4CHZA 4BDYA 1X9MA 4DU3A 1XI1A 4W5QA 5CYQA 1JLEA 4FJHA 3S3OA 2FC0A 1I3AA 1KVAA 4IBNA 1NJZA 2F8TA 4O55A 4Z4FA 1RBVA 1UA0A 3OYHA 4FZYA 1X9SA 1Z25A 4LH4A 1RBRA 1VSDA 1KFSA 2OPRA 3AA3A 2E4LA 3ZT1A 1T7PA 4CJRA 3MEGA 1KLMA 1BIUA 3WNGA 1ZBUA 2NUBA 4ICLA 4CGFA 4DLEA 2OPPA 1CXQA 2D0BA 3RMDA 4FCYA 1KTQA 1S1UA 1VSKA 1JKHA 1HNVA 4OJRA 3ZSWA 4GW6A 2ITGA 3CQ8A 1X9WA 1TL1A 1JXEA 2R7YA 3U6FA 1K6YA 3AVKA 3WNHA 4DTRA 4CFDA 2YV0X 1RT3A 3AO1A 4Z4EA 3NGYA 1VRUA 3DYAA 3ZSQA 2G8HA 4FJGA 1ZBIA 4MFBA 5HRPA 1HYVA 4CJFA 3I0RA 3IG1A 4KTZA 5EU7A 4OPJA 2KQ2A 4M3RA 4CHNA 1NKBA 2O4IA 4KHSA 3K58A 4CJWA 4DSIA 4I2QA 3O3HA 4Q5VA 3AVAA 1WNSA 2ZE2A 1FKPA 4ELVA 3AVJA 4KHNA 4BWJA 3KK3A 3IAYA 2JGUA 1FK9A 1TV6A 3L8BA 1VK0A 2PW9A 4B9MA 3RWUA 2GUIA 4NYNA 3SV3A 4HVJA 2Z1JA 3CYMA 3MXIA 1WAFA 3VQDA 3CG7A 3ZT3A 4M3TA 1RT4A 3AVNA 1S6PA 3OYCA 3QETA 1WAJA 4DSKA 4PY5A 2FBYA 2KFNA 4E1NA 1LAVA 2A1SA 3CFRA 5J2MA 2HHTA 3LANA 1HPZA 5J2PA 2DFFA 4DTOA 1U48A 4W5OA 1BCMA 1RDDA 3OJUA 1R0AA 5HLFA 4DS4A 4CJVA 1SL2A 4J2BA 4KAZA 5D3GA 4GVMA 2HW3A 1DTQA 1TL3A 4J2AA 3ZSZA 4CEFA 1BGXT 1DLOA 1HRHA 1CXUA 3M8QA 3QEPA 2D5RA 2HHSA 1RTHA 4E7LA 3SI6A 1CLQA 3SQ2A 4AHRA 4CHPA 1TK0A 1D5AA 3HPGA 1NK7A 1QTMA 3K2PA 1SL0A 4B9NA 1BQNA 3VQAA 1EKEA 2YHAA 1JLCA 5HBMA 5HRRA 3RRGA 2B5JA 4BACA 3HT3A 3HJFA 2F8SA 5HP1A 3WNFA 1B92A 3QLHA 4CK3A 4FZZA 4DSLA 1Q9YA 5HROA 3HYFA 4Y1DA 4KTQA 1L5UA 1QQCA 4OPKA 3NH2A 3OYAA 2P5OA 4CF1A 1TKXA 1IKYA 1S9EA 3KLHA 3HXMA 4R5PA 2HB5A 1LAWA 3RMAA 3V9WA 1J5OA 4JRPA 3K5OA 1UA1A 1L3VA 1MU2A 4FJXA 4GMJB 3ZCMA 3HPOA 3SV4A 2YNGA 1ZBLA 3SQ1A 1HYSA 5T7BA 2ATQA 3L3VA 1FXXA 2YHBA 4PWDA 5FROA 3TAEA 1RDAA 1IO2A 4E3SA 2KW4A 1QSLA 4FJLA 3SCXA 3LPUA 4IG0A 4NYFA 2VWJA 1B9FA 3ISNC 3KK1A 3U3YA 4CIGA 2O4GA 3LP2A 4JLHA 1KSPA 4C8OA 2DTUA 1VSJA 2HNDA 3OYJA 3JYTA 3V1QA 2KTQA 1FKOA 3D0PA 1S1XA 2IC3A 4CCHA 3LALA 1RT5A 3AVFA 1GOCA 1WN7A 5DK5A 1JLAA 3T19A 3IRXA 2OYQA 2X74A 3DLBA 4FLZA 2F96A 3VQ6A 3TR8A 1RBUA 3S9HA 4OGEA 1C1CA 4KRFA 1JL2A 3PUFA 4FJJA 4KFBA 4CJ4A 4Q0BA 1BQMA 1QE1A 4CFCA 4M3XA 4KI6A 1BI4B 3LPTA 1ZBFA 4CERA 4KB1A 1ASVA 3HP9A 4BE1A 1C0TA 1EX4A 3K59A 2HVHA 2RN2A 2PYLA 4KREA 4CJ3A 2QKBA 4CJLA 1EP4A 2DY4A 4PA1A 1S9GA 2KFZA 3NGIA 3MEDA 2EHGA 3I0SA 4O5BA 3C94A 3K5NA 4FW2A 5J1EA 1RT2A 3P83D 3ZT2A 3F73A 1RTDA 4DQIA 2IGIA 1HQUA 3AVBA 3DI6A 1J54A 3V81A 3KTQA 4PQUA 2I5JA 4LY7A 2XY8A 2HNYA 3QINA 4RW8A 5C42A 3EY1A 3PV8A 2VG7A 3KKSA 1WSGA 3NCIA 3TAMA 4YFUA 1WSEA 4XIUA 2YNHA 1WLJA 1CZ9A 4FM1A 3SUQA 2XHBA 4O4GA 1BCOA 4M3UA 4M42A 1IH7A 1XHZA 4I7FA 4OKEA 4Z0UA 3OYNA 2LSNA 3L2RA 1ITGA 3V9SA 5I3UA 4DSJA 5CY4A 4CHYA 1N5YA 2KZMA 4ZTFA 1NJWA 1TKTA 4FXDA 2VG5A 3OYBA 4IDKA 3HSTB 4E0DA 1BHLA 3LP0A 1RBSA 1LWFA 2VWKA 1VSEA 1QHTA 1RNHA 3ITHA 2EX3A 4K8ZA 2D0CA 1A5WA 5FDLA 4N47A 3VQ5A 4DU1A 3CFPA 3O4QA 4Z4CA 3PX4A 1T03A 2RF2A 3DLHA 1TKZA 4CHOA 3QNNA 2G8KA 2YKMA 3B6OA 1KVCA 4Z4GA 3AO5A 4LSLA 4RW7A 1REVA 3BGRA 1RT6A 4CK2A 4DS5A 4J2EA 1LW2A 4FM0A 4CEQA 4J2DA 4FJIA 4CFAA 1Y97A 4KV8A 1KVBA 3DRRA 3TAPA 3SNNA 2PY5A 1RTJA 4B08A 4CGJA 3HM9A 4IG3A 2Y1IA 4M3WA 3V1RA 1UAXA 4FJ7A 3NFAA 3HK2A 3TAQA 3SZ2A 4CEBA 3ZSXA 4FK4A 3LDSA 3ULDA 3ZSOA 4Z4HA 1Q9XA 3M8RA 3AA2A 3SJJA 4CJPA 4FJ9A 3NGZA 1UOCA 3TI0A 4LSNA 1NKCA 1W0HA 1ZBHA 4IFVA 5KTQA 5C24A 3JSMA 4CESA 4OGCA 4DG1A 3V6DA 3ZSYA 4AHCA 2BGGA 2HHUA 3C6UA 1NK0A 4E7KA 4CEZA 2XY5A 3ZT4A 3ZSVA 2Q3SA 1N6QA 3L3UA 3FI7A 3L2UA 1GOAA 4DMNA 4DQSA 1SKWA 1BI4A 4MQ3A 4DFMA 1J53A 4KHUA 1KCFA 3NBPA 1LWCA 3QO9A 3OS2A 1LW0A 2IS3A 1NOZA 3KKRA 4M41A 3VQBA 4CEEA 3M8SA 4WE1A 4O0IA 1C0MA 4CJUA 3RTVA 4K8XA 1VSLA 3O3GA 3SQ4A 1KLNA 4DFKA 3K5MA 4CF8A 1X1PA 5KI6A 4B8AB 1JLFA 2GV9A 1DTTA 3OYIA 3TARA 1S1TA 4YNQA 4CEOA 2XY7A 3PO5A 3KLIA 3MECA 4UQGA 3HVRA 4JS5A 1EXQA 3L2VA 1EETA 3V1OA 1Z26A 3A2FA 2WONA 4QOZB 2BDPA 3OS0A 4BE2A 4W5RA 1I39A 4FVMA 1C1AA 3NDKA 4E7JA 3LWLA 4FJ8A 5DMRA 4FLYA 4TSXA 1U4BA 4KO0A 1WSFA 5CZ2A 4DTPA 1VSIA 2RKIA 4H4MA 4KKOA 2GBZA 3RMBA 3PY8A 1VSFA 1LV5A 2XY6A 1ZYQA 5KGXA 4DFPA 4F2RA 4E89A 3S3MA 3NH1A 3QNOA 1NK8A 3MXMA 3AVLA 1B9DA 3RMCA 4KHYA 5FRMA 3EYZA 2YKNA 3AA5X 1G15A 3SUOA 4DWIA 4E1MA 4FLVA 2OPSA 4N56A 4F2SA 1YTUA 4ELTA 4HCCA 4DF8A 4ZHRA 1TAQA 1SV5A 5E41A 4NCBA 1XHXA 2FBTA 4JRQA 2YNIA 4OLAA 3RRHA 3SPZA 1HJRA 3VQQA 1TGOA 2PZSA 2P51A 2RPIA 1KFDA 4N41A 1WSJA 2HHQA 4BDPA 4FW1A 1RDCA 4AILC 4HHTA 4FJ5A 1HMVA 5C25A 3U3GA 3QEIA 1ASWA 3DLEA 1U49A 4E19A 3NH0A 3OYKA 4FYDA 3LAKA 1VRTA 3D45A 4F3OA 4DSEA 4DFJA 1RTIA 1YVUA 1L3SA 3KLFA 5J2QA 1SKSA 4B3OA 3AO4A 2HHXA 1C1BA 4RW6A 1JLBA 4CFBA 2B6AA 5SZTA 4CF2A 3TAGA 1JXBA 1O1WA 1A5VA 4FJMA 4HUFA 2HHVA 5CYMA 4ELUA 3VA0A 4AHTA 4CJQA 3KLGA 1SKRA 1HYZA 4KPYA 4FJKA 1TK8A 3SQ0A 1L3TA 2HVIA 2P5GA 5KRSA 2JLEA 3RR7A 2OPQA 4CK1A 4QAGA 4DTSA 3SPYA 3PX0A 4I2PA 3H08A 3KIOA 3DLKA 4CE9A 4CJTA 4CIEA 3DOLA 4RG8A 2FBXA 4CGGA 3OYFA 4HTUA 3VQ9A 4N5SA 1QSYA 3QESA 3I8DA 2ZD1A 3LAMA 4DF4A 1NK9A 3G10A 4CGDA 1C0UA 4DQPA 4FLWA 1S1VA 3OYMA 3SYZA 4DQRA 1S1WA 3QEWA 1IKXA 4CF0A 4I9QA 5FRNA 1IG9A 2WOMA 2Z1GA 2X6NA 3VQEA 4CHQA 4JS4A 4KB0A 1W9HA 3HL8A 3VQCA 1QS4A 4AHSA 3V4IA 4KTWA 3LZJA 3OY9A 3L2QA 1T05A 5JS1A 2XRIA 2G8VA 2IDOA 3M8PA 4Y1CA 4B8CA 3O4NA 4I9LA 2W42A 3NAEA 4PUOA 1GOBA 3AVMA 1NJXA 3V9ZA 5K14A 1D8YA 3VA3A 5CZ1A 3QERA 4CECA 4DU4A 1A5XA 3AVGA 3T3FA 4FJNA 3TAFA 4CJKA 1NK4A 3ALYA 3BDPA 3THVA 1JLGA 5KRTA 4AHUA 3NE6A 5HRSA 1RT1A 1VSMA 2IOCA 5SWMA 2G8UA 2A1RA 3IS9A 1NOYA 3V9XA 3HVTA 4FLTA 4F8RA 3C6TA 5KGWA 1RT7A 4QCLA 3PO4A 1VSHA 4M45A 4AH9A 1NKEA 4CGIA 4N76A 3PX6A 2BE2A 1SUQA 2KZZA 4FZXC 2QK9A 3DRSA 1JL1A 4ID5A 1L3UA 3S3NA 3HO1A 3B6PA 2PYJA 2BANA 4BE0A 4O44A 3C95A 4ZTJA 3MXJA 3VQ8A 2HHWA 2R7FA 4DTUA 1TAUA 1ASUA 2QKKA 1Q8IA 3ASMA 1JLQA 3NF9A 1IKWA 2Y1JA 4RW9A 3F9KA 1NK5A 2DFEA 3AV9A 3LZIA 4DSFA 3FFIA 3ZT0A 4EZ9A 2HNZA 1RCHA 4DLGA 3VQ7A 3VN5A 3NHGA 5I42A 2G8FA 4KHQA 1S5JA 3NF6A 2X78A 3AA4A 2G8IA 4E7IA 2YNFA 4RW4A 4B9LA 4HUGA 1HQEA 2ZQBA 4NCGA 4IKFA 4DTXA 3MEEA 3DLRA 4HUEA 2Z1IA 3L2WA 2E6MA 3QEXA 1T8EA 3OVNA 3CM5A 4HCBA 3QIPA 3VQPA 3ZSRA 3KK2A 1WSIA 1KRPA 4B9VA 3T1AA 3EZ5A 3KLEA 3P1GA 1TK5A
chains in the Genus database with same CATH superfamily
3APQA 4PKHA 4AM6A 1PV0A 5BRFA 1NK6A 3ICXA 2RQ6A 3TXQA 1BU6O 1G4YB 1Q6UA 4I7ZB 2Z5UA 3THOA 2FBVA 2WSSG 2ZGYA 5AZJB 5H6RA 3SYCA 3ZMVA 1UWBA 3CHWA 2LQTA 1TYQA 3P32A 2ZE7A 4DW0A 4G27B 3TU5A 4K0KO 2YUAA 1RBTA 2P1JA 3OBYA 5AQGA 2GWKA 2Q36A 3O3FA 3CC4V 1N32O 1BE3H 3SUNA 3U11A 4CJ5A 4MDBA 3HR0A 3AO3A 1NGJA 3WB2A 3K57A 4DR5K 2OA8A 3K5LA 2OWOA 4I50B 5AQKA 4DV2B 3OYEA 4PL7A 1RILA 4OLBA 2UUCB 2QW9A 4BROA 3E8BA 3VRAA 4KI4A 1EAH4 3E01A 1XC9A 4F4KA 2AJQA 4LF6B 4NXMB 2RCVA 5BN9A 1U45A 4P9PA 4IFYA 4CEAA 3KD5E 2DYSB 1N0NA 3GB7C 3CCLN 1VF5B 2H8PC 5KA6A 2VGNA 3CE2A 1D4M4 2M6YA 2Q5ZA 3HSCA 2YEVA 2KQXA 2KG7A 1FPOA 1RUH4 4Z4IA 4BR9A 4CZLA 2IAJA 1YHQN 3ML0A 3CPWU 4FFKA 4JV5B 4BC4A 5EYPA 3TETA 4YT0A 2YS8A 4LD0A 4BDZA 4TV9A 1S6QA 2VG6A 4DR3K 4LF9B 3V9UA 1I94K 4I6MB 4UFZA 3ZHQA 2YI9A 3T1HO 2DJVA 3UKUB 4GUNA 5GONA 4K25A 4X1KB 3C7NA 5BXZA 1IBKK 3WNEA 2B4JA 3JAMO 3J7YP 3ABKB 4BR6A 1YI2N 4B3RB 3QEVA 1BCCH 1FJGO 4UCTA 1KP3A 3DRPA 4C8NA 3DM2A 4DV3O 3SYPA 2IVOA 1FYJA 3FR0A 5JS2A 5F2VO 1PNKA 4C7UA 2P9UA 3LNMB 4BDYA 1WPBA 3ENBA 5F2RA 4DU3A 1X9MA 2WFBA 3UT5B 1ZXOA 1P90A 2PBDA 3TXSA 2P06A 1I3AA 4W4KA 4FWSA 3FB6C 1YJ9N 1FAFA 3OYHA 1Z25A 3IJ4A 4XBFA 5JVDA 3AE8A 4CD1A 3QO8A 3WU2Z 2UUAK 3K08A 4I0XB 1HNXO 3MEGA 1KLMA 3WNGA 1KYOF 5IT9O 3C3SA 2XOKG 4UB6Z 2Q2RA 5AQTA 3RBZA 4LWSB 1CXQA 2HF3A 2D0BA 2P9SB 1MZEA 3VEZA 4FCYA 3HB3B 1HNVA 3BRCA 1IBLO 3WQTA 3CQ8A 4EB6A 3AE4A 2PTMA 3DXMB 1JXEA 2YXYA 4D6TH 1NLVA 3AVKA 4O2AA 2PI5A 5LHGA 4I55A 2YV0X 4NLCA 4Z4EA 3CRRA 1VRUA 3CJ7A 1MZFA 4DK1A 4DUZB 3C6AA 1L0NH 3ZBHA 4CHNA 3E22B 4LF8K 1AP6A 3K58A 3J81O 4O4HA 3TSQA 3MD0A 3TTDA 4BQLA 4DSIA 1T6DA 3CC2N 1K5MD 2Y48A 4TT3G 1QVGU 1FK9A 3O08A 3ULEB 3L8BA 2PW9A 3MXIA 2O8DA 4FJCC 1WAFA 3QBWA 3HKBB 4QPJA 1PM9A 3JSLA 1RT4A 3CHXA 1Z7S4 3OYCA 2IBZH 3RYCA 2Q7GA 4LFCO 2FBYA 3GBTA 3U4LA 4E1NA 2HHTA 4FFBA 1Z05A 5J2PA 1VQ6V 3CJ1A 4XH4A 1U48A 1KFSA 1VQ5V 1BCMA 2UUBO 2ZDIC 1RDDA 5HLFA 5LOVA 2OCEA 4J2BA 3ZHTA 4IJNA 1W2BM 4PDWD 3PJSK 3ZRWB 1NVPB 1BA1A 3RYHB 2EIKC 2UXCO 4XDJA 1N8RW 4BRMA 3G4SV 3LDEA 4MO5A 3M8QA 3B77A 4FWKA 3KKYA 4OXSA 1XNQO 3SQ2A 3VEYA 4CZMA 1BEV4 3ASNC 3N2GA 4H0TB 1TUUA 4KHPB 2ZIMA 5EZYA 2HHHO 3HPGA 1TK0A 4TSFG 1PO14 1JLCA 4IDHA 4ICGA 4DV2K 3H01A 3HOSA 1JFFB 2UUCK 4FZZA 4DRXB 3R65A 1XL6A 1L5UA 4LF6K 1QQCA 4NXMK 3BZKA 5AQRA 3AEGA 2M7WA 3OYAA 1G1XB 3KLHA 2A42A 1NBMG 1LAWA 3H1VX 3K5OA 1MU2A 2ZNJA 3HPOA 2QGNA 2AW9A 1NBWA 4EHUA 4PDLA 3SQ1A 2AXTZ 4GYCB 5FROA 3STLC 1RDAA 3CD6N 4R50A 3FZHA 5A9GA 4J8FA 4JV5K 1HRV4 1Q82W 3O9UA 1O9HA 4IXCA 1KKDA 3SCXA 4UVAA 4LH7A 3TK1A 1QLNA 1KXPA 4WQ5C 3G25A 4NYFA 4LF9K 4CIGA 5B66Z 2HBKA 1KSPA 3OE7G 2NRRA 2QKAA 2GX9A 2QM7A 3V1QA 2FSNA 4DR3O 1FKOA 1I94O 2IC3A 4CCHA 3JS6A 5DM6L 1WPXA 5DK5A 4O4LB 1GOCA 1JLAA 4B3RK 4HZ3A 4X64B 5GIOA 3DLBA 3VQ6A 4BR5A 1M57B 4UCSA 2XNDG 1IBKO 3CCRV 2YJEA 3D8CA 3K9KA 3PUFA 4Q0BA 1BQMA 2HOEA 3MN9A 3DSQA 1BI4B 5J2UB 1VQMN 2F1MA 4BE1A 1VQ4N 5H5NA 4WBNB 2WLHA 3QNEA 3K59A 3ETQA 1EX4A 1J5EB 2RN2A 5LMNB 4CJLA 1EP4A 3F5WC 1S9GA 3VF6A 1KFYA 4U3JA 1T3VA 1K8KA 3K5NA 2E1YA 2QR4A 3F73A 4DQIA 2IGIA 1J54A 4YHHB 2P22C 4YJ3A 3PV8A 4CH4A 1KAXA 3A0IX 3KKSA 5FLXO 3TAMA 1RUC4 4WFEA 3K03A 2UUAO 1C0GA 1HRI4 1M9NA 1MDUB 5M1KA 5GTHZ 5KUKA 3ZEDA 2QKSA 1PO24 4IOCL 3V9SA 4QNHB 4DSJA 3CXCM 2Y4TA 2XAGA 3DC6A 4DUZK 3GWKC 3OUFA 4DQ8A 2IM9A 4LNUB 3LP0A 1VQ9N 2W42A 2NRWA 3PLAA 5KHGA 2EX3A 1C0FA 5B1AC 3DLHA 4BRNA 4NKGB 1T03A 2RF2A 4OO1J 2LO1A 4GKKB 4LFBO 2Q1NA 3SPIA 3B6OA 4IEEA 4Z4GA 4RW7A 4CD3A 3J80O 1YF5L 4JTCB 4FMTA 4LF8O 5AQOA 3I55N 5JH7A 3BGRA 4J2EA 3P4PA 1X4TA 2EULA 4CEQA 2YXLA 4CFAA 3VOUA 3CS5A 5BZBA 1MG1A 2JK5C 1RTJA 4B08A 1QQMA 4IG3A 4JKGB 3U0ZA 1NWKA 1UAXA 4FJ7A 4KL1A 3AG4C 3JARA 1V4SA 3IC9A 3LDSA 2Y69B 4Z4HA 3AA2A 1RFQA 5DM7L 3RSEB 2BSKB 4JI5B 3JATB 4YY3O 1PKXA 3NGZA 5LBQA 3VR8A 4JKDA 4LSNA 1NKCA 1DF5A 2F93B 1RDWX 3MN5A 4DV5B 3E86A 3V6DA 1KUQA 4Q4W4 1P7BA 2BGGA 2HHUA 1RMU4 5LJWA 1NK0A 3IMXA 1NQTA 1IJJA 4KHPK 4D7TA 3LL3A 4CEZA 4JI6B 4FWLA 4JI8O 2WLJA 3ZT4A 1ZL8A 3FI7A 1EZJA 1GOAA 2BTFA 2YX6A 4DMNA 3L2UA 3THYB 1NCQD 3ASOC 3VEOA 3JD3A 1K4CC 1QU7A 2HF4A 4HWIA 4KHUA 1KCFA 3NBPA 4H0OA 1LWCA 1LW0A 1WB7A 4OX9O 3L6QA 4WE1A 1C0MA 2P9NB 3RTVA 4K8XA 2UUCO 3CP1A 4E2LA 5EIBD 3OM3B 1ZLZA 3VRBA 4YJ2B 4HTLA 4IEIA 4LF6O 3IUCA 1MSWD 3WG7C 4NXMO 2CGLA 3UE5A 2LGWA 2LJ2A 3KLIA 3E35A 3Q7BA 4NTYA 2WONA 2BDPA 2Q31A 3RN4A 2XT9A 4W5RA 1HWYA 2RS34 2XASA 4FVMA 4DR6O 1E1QG 2DQ0A 3ETEA 1E4FT 1NGBA 2P9KA 4E7JA 3G71N 4TSXA 1SQBH 1BQZA 4PKIA 5H2FZ 2LFSA 4JV5O 1OKJA 2RKIA 2OTJV 4KKOA 2GBZA 4X66B 4LF9O 4MT8A 1NK8A 2DWDC 3MXMA 1LNQA 2UXDB 2GELA 2BTQB 3AA5X 3VBBA 4U3FH 1G15A 1NMNA 2WUSA 1VQ7V 3VQXA 3Q4HB 3GDQA 3CETA 1N33B 4N56A 1YTUA 3CMEN 1K4DC 4MVUA 4FWQA 4ELTA 1SV5A 2RM24 2QWNB 2Z0AA 4IGGA 2QA4V 2E5LB 2FBTA 3CJCA 1GM8A 1URFA 2AHZA 1T5EA 4ISEA 4NYNA 5LA6B 1TGOA 4IIJA 3VQYA 2RPIA 4N41A 1AP5A 4CZFA 1J5EK 1WBBA 5LMNK 2IJHA 4AILC 4FJ5A 1HW7A 1NGEA 4FWPA 1Q86W 1OCOB 4Z2WA 1WOQA 4CZIA 4B1ZA 4CZEA 5AQWA 3L4QA 2WLMA 3LAKA 1R59O 1VRTA 3SGIA 4QJFB 4YHHK 1THZA 4DFJA 4RHV4 4DUYB 1QQNA 3JALA 3KLFA 1UJWB 4RW6A 2R9AA 4CFBA 5SZTA 4EKWA 1P8ZA 4FOIA 1O1WA 4CF2A 1F4MA 3AAQA 2CAZC 2VRZA 2QWPB 5CYMA 2Q0OC 3VA0A 4RO2A 2B9ZA 4PKGA 1RSOA 2EIMC 1HYZA 4O2BB 2H3GX 2EINB 2P5GA 3JAKB 2JLEA 1LOTB 2ZR3A 2DPNA 3T7ZA 1LUVA 3W0LA 3SPYA 3CRAA 4GNIA 3H08A 3KIOA 3WB0A 3EEQA 4DUZO 3AK2A 4GKKK 3I8DA 2XAHA 1PNMA 1VQNN 3LAMA 4J7KA 2RN9A 3G10A 2NN4A 5AQVA 2CGNA 2IW5A 4FLWA 4CH5A 5BRHA 3RVYA 1TYQB 1KD1W 5FRNA 2Z1GA 1JMKC 3SJBC 2KB1A 1Y74A 5GINA 4O5FA 4JS4A 1E1RG 3UB5A 4KB0A 1VF6A 3Q7CA 1TVKA 1WBDA 5DN6G 4KTWA 4M63C 4YTPA 3CCQN 4PHZA 1GN3A 1NVPD 4BQZA 1T05A 4JI5K 3JSNA 1AI5A 2E2NA 3OMNB 2F9WA 3AY9A 2YHXA 4MW3A 4LFAO 1NGDA 3PSFA 3C90A 4BC2A 5K14A 5GAGP 4DV5K 3EE8A 1YITV 1A5XA 3EFFK 3BDPA 3KCYA 3AE2A 3LM9A 4MVZA 3VEVA 2IH3C 4JI6K 5K1PA 4JHDA 5HRSA 1XUPO 2ZXWB 3OEEG 1CEZA 4IFEA 4X1IB 2A1RA 3CWBH 3IS9A 1NOYA 5MLCQ 3CCJV 2KG7B 4KHPO 3P4RA 3EE9A 3C6TA 5KGWA 4LF5B 4L3QA 2OCCB 4X88A 4A2BA 1N36B 4QCLA 1YIJV 4CGIA 4H5TA 5EYPB 3U8XA 3SJQC 3ZX3A 5LMUO 5D5QA 2QK9A 5CBGA 2KLAA 1JL1A 5FPMA 3LDQA 1BSMA 4BE0A 4O44A 3C95A 1NKDA 3MXJA 3SMSA 3VQ8A 2R7FA 4YXDA 4DTUA 1TAUA 1EO1A 3RFRA 1HNWB 3CPEA 3ETGA 2CH5A 2KZMA 1IKWA 1Y76B 3K3WA 3FFIA 1XMQO 4WYBA 3ZT0A 1FW6A 2HWC4 3VQ7A 3VN5A 1NT2B 1RDUA 3NHGA 1FS0G 2G8FA 3AA4A 4NO7A 3JAWA 2DYSC 4RW4A 4BRPA 4HUGA 1HNZB 1GN2A 3FAVA 3VEWA 4BG8A 1A32A 2P9UB 2HG5C 3MEEA 4X66K 1UPGA 4ZHQA 2ZQMA 4BAYA 2UXDK 1Q81O 4QS9A 1BS3A 4RUFA 1WB8A 5FPNA 4ISGA 4PDMA 3KLEA 4CC6A 3P1GA 5M1PA 4BRGA 1N33K 1IXMA 5JVDB 3FFKB 3GE1A 2DN9A 3VQ4A 2E5LK 3N27A 5B1OA 2A3QA 1TVRA 2QWLA 3UIQA 3THXB 3HRGA 2OIEA 2ZF5O 4WFHA 3ZMZA 3RWRD 1NU1H 4CS2A 3I33A 3ABKC 3MCAB 2Z1HA 4IYHA 3D6RA 2W0XA 3N4PA 3IFRA 1VQ8N 3HP6A 1IV0A 5J2NA 1D9DA 1J5EO 1AI4A 5FNVA 2E6LA 5F0XA 1W7AA 4H03B 1J9AA 3QIOA 3SUPA 1CZBA 1WAZA 3SPJA 3DOKA 4DUYK 2BUPA 3G80A 3H9VA 1ROPA 4O4HB 4YHHO 4JKHA 1NA1D 2E2OA 3E9LA 2RS54 3LDLA 4FM2A 3DMJA 2WLIA 5K1XA 1J95A 4H4OA 2O8FA 4O0JA 1LWEA 4JTDB 1RDBA 4CJEA 2O8DB 3HKDB 2RJZA 3HM8A 3U9DA 2K1EA 3OJSA 4DR7B 3SR2C 1IKVA 1KQSU 2VWBA 3D36A 4MVRA 4DTJA 1DGKN 1GM9A 1X59A 1OH8A 3RYIB 3RYCB 4KHWA 2FKXA 3VESA 4FFBB 1SZ2A 2Y4UA 5FPEA 2R9RB 3M99B 4I4TB 2QTDA 4UCUA 4FVUA 5LOVB 4B3TB 1U2VA 3I56V 2X6SA 3G0ZA 4FK2A 3CCMV 2JEUA 2X7RB 4GKKO 2QJ1A 4ZI7A 4F6RA 2GTSA 4BRDA 5IYBO 1L0LH 4JKAA 4JK8A 4YOTA 5HRNA 1C6VA 3ZHUA 3AGKA 3TANA 2JIZG 5A2QN 4EZ6A 3N2GB 4ABMA 2ZJQL 4PDVA 1H2NA 4C8LA 4IWVA 3AEBA 1QR9A 5KMGA 1Z2GA 3C0BA 3S3WA 1KVAA 3CCSN 3VQVA 1ATNA 4Z4FA 4M7XA 5BMVA 1UA0A 3AE3A 4FZYA 4JK7A 2GUZB 1AR64 1AI6A 4KP4A 3A5LC 2JDIG 1Y6XA 4R6ZA 1BA0A 2E4LA 3CRMA 4UCVA 3ZT1A 4CJRA 1T7PA 1ZBUA 4JZ2A 3OAAG 4DB3A 4GV3A 3OTFA 5LL6Y 4LF5K 4JI6O 1N36K 1KTQA 1S1UA 3E9PA 1VQLN 2JRIA 1X9WA 2ITGA 2EIMB 2L35A 4A59A 3HKEB 5IYDO 5CBHA 2HEPA 1K6YA 5ADXH 3F7VC 5AG2A 3PIPL 4CFDA 1RT3A 5KHKA 1YVWA 3OMIB 4IYIA 3ZSQA 2G8HA 5IYZA 3B8MA 4NTXA 5I9EB 2R044 5HRPA 4J2DA 1HNWK 3IG1A 1DEJA 4YDUA 3L71H 2UYTA 1RVF4 1XBLA 3VENA 1RPRA 4FWRA 1TUBA 4DV1B 1FKPA 2O8CA 4BWJA 4EFHA 2IU0A 1LCUA 5HFMA 1QR8A 5CBFA 2R064 3RWUA 1YSCA 4HVJA 1HNZK 4PDRA 3CG7A 4M3TA 4LBEC 4WFAV 1FXKC 1S6PA 1PL4A 3QETA 2JJ1G 1BO5O 1WAJA 2NNUA 5IJ0A 3FX7A 1KKCA 1AR4A 4WQ4A 2QDOA 5CB4B 4U3JB 4LF4O 3QB0A 5CA1B 1JJ2U 2UXDO 5CN0A 1EM1A 1RP3B 3DXRA 4GVMA 4CEFA 1BGXT 4YJ3B 3G6EN 2V1DA 3ZRVA 2E5LO 2HHSA 1RGIA 4BC3A 4WFAL 2E2QA 1J6ZA 1D5AA 2LW1A 1SL0A 4B9NA 3VQAA 1M57C 5HBMA 4JKCA 4MO4A 5HRRA 3ZHVA 1QBZA 1HKCA 3AG1B 4BC5A 3FZFA 5HP1A 1K34A 3H3NO 1Q9YA 4DSLA 5LXTA 4KTQA 4Y1DA 4H0XB 1R6NA 4OPKA 3FD9A 4PA4A 1NMDA 4CF1A 5EBLC 1IKYA 1TKXA 5ELZA 3W7SA 4DV0B 1VAZA 3WUHA 3BA9A 5L3CA 2RMU4 1L3VA 5JH7B 3BHPA 4FJXA 4UCRA 4GMJB 3RT3C 3KWGA 3ZCMA 3ZMSA 1JCFA 4DR7K 2ETNA 2ATQA 1YJNN 1FXXA 2YHBA 3JASA 3SFEA 4OGQB 1IO2A 3BVOA 1COV4 4FO0A 4FJLA 3CCVV 4IG0A 1R3LC 3JARB 3ISNC 1B9FA 2JJ2G 3CRCA 3E8GA 4BRLA 5C2FA 3KK1A 5GADP 3CMAN 5ITZA 4B3TK 2DTUA 1QCEA 4CS3A 1S5LZ 3D0PA 1S1XA 4KH5A 1AR84 1S3XA 3AG3C 1WUAA 3BF1A 3G4SN 3ID6A 4BGBA 1RT5A 1WN7A 3K06A 5CMUA 3MDSA 2OYQA 1DTOA 3CC7N 4FLZA 2HP8A 2F96A 3I5DA 3GG4A 2QWQA 4KRFA 3ABUA 1ZL8B 4KFBA 4FJJA 4HBNA 1YJWV 2F23A 1QE1A 3DXKB 3OW2M 4CFCA 3LPTA 1NEKA 2QE7G 1ZBFA 2R70A 3VMFB 2WLLA 2JWLA 1F7YA 1OZ0A 4MTGA 2QKBA 2Y0IA 2DY4A 4JD2A 4U7BA 3NGIA 4B1WB 1PD3A 1RTDA 4QGPA 3P83D 1T44A 3ID8A 1BL8A 1SS3A 2Y69C 2YHWA 3AVBA 3DI6A 3ZX2A 2I5JA 4LY7A 3QINA 1RPOA 2VG7A 4UB8Z 1NGFA 4YFUA 1WA8A 1WSEA 4XIUA 5LP6C 2NRZA 1QVFM 4O4GA 5AFUH 3H1JH 1GAXA 2P9KB 2W6LA 5HL7L 3FFQA 4XH1A 5JWPA 4FJHA 4Z0UA 4LF5O 2JS5A 2ODMA 1N36O 4DV7B 1ITGA 4NXNB 5CY4A 2UXBB 1RM1B 3SMPA 2VG5A 1FFTB 5IT9N 1PPJH 2V4DA 4B1VA 1WJZA 2YI1A 1RBSA 5B8HA 1VSEA 4CZHA 1QHTA 2WLNA 3ITHA 4N47A 4GV6A 3E89A 1A5WA 1L3TA 1JCHA 2H3OA 2HVKC 3CFPA 4DV1K 3DLLL 3ZN1A 3PX4A 5CA0A 1VQPN 4CHOA 1HNWO 3QNNA 1D5NA 1CP9A 3A0RA 2V51B 3A8YA 3SAGA 3NVKA 4KXRA 1RT6A 1LW2A 3F5TA 2BOBC 4GKJB 2WA3A 3JD74 4U7NA 3SNNA 3DRRA 1S22A 4IIJB 4K3AA 3HM9A 3UKRA 1HXS4 3V1RA 1HNZO 3A0HZ 3HK2A 3CJBA 2XUMA 1Y67A 2ASPA 4PELA 4FK4A 3ULDA 1VBD4 5KUMA 1Q9XA 5M1FA 4CJPA 2H89A 3IGAC 1H8TD 1FXVA 1BDGA 4UXNA 1UOCA 4JYYA 3HOTA 1HUXA 3D7EO 1ZBHA 2GTDA 5B3SB 4GY2B 4CESA 3ZSYA 4AHCA 4E4EA 1JR9A 1V54B 3AE6A 4E7KA 5EBMC 2A9HA 3STZC 4JI1B 5AR0A 1W59A 4CZJA 4H0PA 1Y64A 2W40A 1F23A 5LGTA 4FPAA 3HTVA 2JS3A 1OOPD 3FLCO 4MQ3A 1J53A 1HDJA 4DFMA 3UKMA 1WB9A 1GLCG 4JAAA 2Q69A 3OS2A 3M8SA 3KKRA 2B5UA 4LCUC 1NOZA 4CEEA 3EYZA 4BACA 3OGIB 1E79G 3O3GA 3SQ4A 4DFKA 4FPBA 4DV0K 1X1PA 3CCLV 2E88A 5KI6A 3K0SA 1OCOC 1EFRG 4BRIA 4YNQA 3GWOA 3EVKA 1K5SA 4DR5O 4H5NA 1SF9A 3ZYYX 3V1OA 5AZIA 3I8BA 4LH6A 1YHQV 3VPZA 3NXSA 1Y74B 3HZ6A 2VYPA 1I39A 2RNBA 4DR7O 1C1AA 3NDKA 2J4RA 3LWLA 1TVKB 4B3MB 2WS3A 5KAIZ 2WPDG 2YCHA 5DECA 1R3JC 4KO0A 2NR5A 1FXKB 5CZ2A 1GLDG 1N34B 3L75H 1SZTA 3BABA 2XY6A 5JLHA 4DFPA 3MHHC 1S72N 1SETA 2EINC 4J9ZB 4B3TO 1G6UA 3AVLA 3VTHA 4KHYA 3THWA 2E75B 3OR6C 3SUOA 2F95B 3R6MA 4DWIA 1YI2V 4E1MA 4F2SA 5LJVA 4TUYB 1BHBA 2CGKA 1RUG4 4Q4V4 5E41A 5EC1C 4R8CA 2CTPA 2Z3YA 2VQFB 4JRQA 3SPZA 1HJRA 3VQQA 2OIGA 1GLAG 4FWOA 2P51A 1KFDA 3LSQA 2HHQA 1RUI4 3VQWA 1EWQA 4K41A 1YJ9V 3ZETB 5C8YB 3SDLA 3ETDA 3QEIA 1W2BU 2JWKA 4GV9A 1U49A 3NH0A 4FYDA 3QTCA 1XQSC 4IT5A 1K97A 3D45A 4DSEA 4F3OA 2DW4A 5C2DA 5J2QA 2ZD9A 2HHXA 1JLBA 1VBA4 2B6AA 4MSWC 5EK0A 3WEEA 2HHVA 3TSUA 3QO7A 5BPLA 4HUFA 4FJMA 4ELUA 2P4VA 1OHHG 3KHYA 4DV7K 2O8EB 1H1VA 4CJQA 3KLGA 1SKRA 4NXNK 1ZUQA 4KPYA 2UXBK 1VHXA 4CBCA 2JGDA 2W6KA 3ABMB 3FB5C 4NTWA 3O5BA 3RR7A 2ZXWC 2QWMA 4ZHQB 3FB7C 3SJAC 1H8EG 1SS6A 1DT9A 4I2PA 1MWKA 2EIJC 3AE5A 2EZOA 4CE9A 4CJTA 2OCCC 3DOLA 1DF4A 4IOXA 3OYFA 2CTWA 2CH6A 4O4IA 4HTUA 2B1IA 3CC2V 1FFXA 1ESVA 2LFRA 3VQ9A 3P39A 3WFVA 2XAJA 1OH5A 2WU5A 3AG3B 4DF4A 4EAHD 2UU9B 4NVPA 4CGDA 1NK9A 3D2EA 5JQGA 4DQPA 4GKJK 1S1VA 2QWRA 1S1WA 1R6TA 4CF0A 1AR5A 3ZIAG 2ZJPL 1XEQA 3A8TA 2ZWHA 4BGAA 2I7PA 2X6NA 2OTLV 1NGGA 1W9HA 3HL8A 5AQLA 3CJHA 4ILHA 3V4IA 2PUSA 4G9ZA 4BR0A 3P4QA 3OY9A 2WWWA 3L2QA 5KX5A 5C10A 1YQ3A 2B76A 2IDOA 4LC1A 3M8PA 4MDAA 4B8CA 4K42A 4I9LA 5AZJA 5IDJA 1KAZA 3VR9A 5CA3A 3QERA 4CECA 3ATVA 4CJKA 3ALYA 3THVA 3VTIA 1SQVH 1IBMB 2YDEA 1JLGA 4NR1A 4JI1K 4AHUA 5KRTA 2QTOA 1KAYA 2O8FB 5AQPA 5LP6B 5SWMA 4I50A 1AROP 5JCOA 1YF2A 5AJ3K 3MX5A 4CH6A 4IHJA 1VSHA 4AH9A 4BVPA 3PO4A 3E1YA 3PX6A 1Q81W 4X20A 4FWMA 1HP8A 2NLJC 4BRAA 2KZZA 1US6A 3CQXA 2EBOA 2YC0A 3MN6A 4ID5A 4YTNA 1Q7YO 3BP8A 5B1NA 2BANA 2D0PA 2Q7HA 5LY3A 2HHWA 3CCEN 3E8FA 1ASUA 2ZT9B 3VF2A 1NI8A 4F6RB 1NK5A 3NF9A 1B06A 4DV2O 2Y1JA 2DFEA 2A0LA 3IC7A 3CD6V 4EZ9A 1NGHA 2HNZA 4DLGA 2F43G 1SKVA 5C93A 5E1AC 3VF4A 3VGKA 3BPZA 4B3MK 3B09A 4B7EA 3CXCU 1R3IC 1AJPA 3VGMA 3H1HH 4E7IA 2PF4E 4I6MA 2GHYA 3RYFB 1HPMA 1N34K 4UCOA 3H6EA 4DTXA 4IKFA 3A5NC 3LDOA 3UKUA 3SAFA 5BY1A 5KMGB 4A2AA 3LDDA 4J41A 2QSAA 2CE4A 2E6MA 1AB3A 3WXJA 3OVNA 4FZ0A 1I7FA 2E2PA 5BMVB 1KRPA 1K5QA 4CBUA 3EZ5A 3ZLJA 4M7YA 3SPHA 1L8DA 2N74A 4PI0A 1SA0B 2RE2A 1NJYA 3PY8A 2VQFK 2G8WA 4FSVA 4DR4B 2HVJC 3UT5A 1VMGA 1VQ4V 2ADQB 3T2MA 4X64K 5BPMA 2OZSA 2D0AA 3TWHA 4GLXA 4AHVA 1QSSA 1CZAN 2ITMA 3MCPA 1K73O 4M3ZA 2HWB4 3ZEUA 1BISA 1VQKN 2F66C 4ZKIA 1BT8A 4B3RO 2HMPA 1VBE4 4I0XA 1JPXA 5IYZB 4V19S 1HNIA 3ABLC 1HKBA 4EFEA 1M90O 4FK0A 3OTOB 4PL8A 4OKKA 1N8RO 4OKJA 3GQKA 4LWSA 1VQON 1TKDA 2P9IB 3H45C 4XH5A 4CF9A 3KD1E 3U10A 2IJIA 5EVZA 5GAHP 1ILYA 1TUBB 2E76B 5HFLA 2O8CB 3TCUA 3DLGA 3D2FB 5C0YA 1JQ0A 3P30A 1O13A 4CEDA 3OHRA 4E7HA 2YIBA 5E84A 1YTAA 4B9TA 3J7ZO 2CK3G 1GLLO 4DTMA 4JYCA 2DOSA 3BZCA 4BRHA 3SJHA 4DV7O 2NRVA 4XEIA 4CGHA 4NXNO 1VQ9V 4ID1A 4OVLA 2UXBO 1GMGA 5IJ0B 1F21A 2XO7A 2E74B 1BHAA 2GUPA 3RR8A 3J7AP 5LYJB 2P67A 3CIPA 3SYOA 2RDCA 4JN4A 1K7DA 1NM1A 3ULEA 3I55V 4PV1B 4W5NA 3DXRB 2UU9K 4JI3B 5L3BA 2QEXN 4EP5A 1EQYA 1I08A 4FLUA 3S3XA 3HKBA 3AVIA 3O6WA 2VS0A 4GKJO 3AEAA 1U47A 1VARA 4MS2A 2GWJA 4YOUA 2D2CB 4A5AA 3OYGA 1AVMA 2LGQA 3N2KA 2FSKA 3R1XA 3S41A 1Z5WA 4CHZA 1M56C 2WP9A 4BR7A 3TPQA 1JLEA 5LGUA 1GKFA 2FC0A 5KHHA 4IBNA 1NJZA 5LXTB 3TGUH 1D2DA 2F8TA 1XC3A 1RBVA 2E8AA 2HLDG 2QI2A 4LH4A 1IBMK 4UVCA 2Y0PA 5M1OA 2OPRA 2QM1A 1AR1B 4A61A 5AQJA 2R9IA 1BIUA 1XREA 2NUBA 4ICLA 4CGFA 3CI5A 4DLEA 1YEWA 4O4JA 5F1XA 1JFFA 1OCZB 4YOWA 2O8BA 3RMDA 4DRXA 1VSKA 1JKHA 3O1WA 3CJAA 3ZSWA 3AE7A 4PD4F 5IYCO 4GW6A 3IFXA 1TL1A 2B1GA 3AK1A 3T1HB 3VGLA 2R7YA 3CJ9A 5H1SQ 3GVMA 1NJIW 2I7NA 2CH7A 2CGJA 2GEMA 3QMLA 3K0DA 4DTRA 5ITZB 2P4KA 2YEVB 4RWUA 3NGYA 3M1FA 4MLEA 2EIJB 4DSFA 3SJJA 1B6QA 4KTZA 2DQ3A 2KQ2A 4GB34 2ZM6B 3AG1C 1FJGB 2D0OA 4CJWA 3O3HA 4Q5VA 1WNSA 4TV9B 4KH4A 3LNNA 3AVJA 4H5WA 3D3QA 4JK9A 3IAYA 3KK3A 2JGUA 3CCUN 3KCXA 1VK0A 2QWQB 3W7WA 4R7CA 3G71V 4B9MA 4FJGA 2P6JA 5GONB 2GUIA 3EZWA 1Q90D 2Z1JA 3CYMA 3P4IA 2ATKC 4JAXA 3C7NB 3JXUA 3QG5A 2H94A 4B3MO 1HR0B 2IVNA 1ZTEA 2WLLB 4UVBA 4DSKA 4BRFA 2HFEC 1BG3A 2KFNA 1N34O 2WDRA 2QWOA 2XAQA 3LANA 1HPZA 1XL4A 1HNXB 3AAPA 4DHYA 5IE9A 4JD2B 1ZX3A 1R0AA 3CMEV 2P9PA 3SJCC 2JEXA 4G2KA 5TKWA 4DS4A 4KAZA 4Q4Y4 2HW3A 4MTOA 1KC8O 1DTQA 3SYAA 4DR4K 1GM7A 2BH1A 1HRHA 3WXMB 1WA8B 1IDSA 1OJHA 2BE3A 2D5RA 4YOYA 1RTHA 4WBNA 2VQFO 1BQ0A 2OANA 4E7LA 1CLQA 2CDYA 3CYOA 4KFMA 4L87A 1QHAA 1NK7A 3UO3A 4DK0A 2IH1C 4E1JA 1SQFA 4X64O 2YHAA 3RRGA 1M5IA 4O8KA 5GTIZ 4JKFA 2B5JA 2NRXA 2PLV4 5AQNA 1GLJO 4MVOA 4X65B 4FPPA 3WNFA 1B92A 4C1NI 4CK3A 3OTOK 4PI2A 1U97A 3O80A 5HROA 3HYFA 3G67A 2HKOA 2L6LA 4EB6B 3J8F4 3H1IH 3DJCA 4YOXA 2LP7A 4HYOA 4CZGA 4O2AB 5BREA 4I55B 2Q7EA 1S9EA 1XDCA 5LMNO 2A40A 2HB5A 4KH6A 4R5PA 3RMAA 3P4SA 1UA1A 1YXQA 2F4VB 3SV4A 2YNGA 5T7BA 3L3VA 4PWDA 3T69A 3TAEA 4CW7B 1S5HC 4N21A 3UKRB 5CE3A 2KW4A 4E3SA 1V9PA 1QSLA 2N05A 4ILGB 3ZHRA 1P4RA 4TQFA 2FTKA 3ZN0A 3LPUA 2A41A 2VWJA 3U3YA 2O4GA 1RUF4 2ZKOA 2UXCB 4JLHA 4C8OA 1VBB4 1AILA 3AG2B 1VSJA 4JI3K 2DWEC 1MABG 4FL9A 4DR1B 2EJRA 2EILB 1XNQB 2KTQA 1RM1C 1EBOA 4TQDA 2CUGA 4XDLA 3AVFA 5CHIA 2HHHB 3F9MA 1ORQC 4CS4A 4NYKA 1X9JA 3IRXA 1IX9A 2X74A 2YIDA 3HI0A 3TR8A 4H37A 1RBUA 3S9HA 4JGSA 2HBMA 3KK7A 1C1CA 3CCQV 4JAUA 1IVSA 3RSEA 2BSKA 4XDKA 4KI6A 4M3XA 4KB1A 3HP9A 3X2QB 3BEHA 1U6ZA 1VP7A 1C0TA 3L74H 3FGUA 3T1CA 3CC4N 2Q97A 4KREA 4CJ3A 3O4WA 4WFBV 4JI7B 5EZYB 4PA1A 3T1YB 2KFZA 3MEDA 1Q18A 1YVNA 3I0SA 3C94A 4H5RA 4O5BA 3ABLB 4FW2A 1RT2A 1KP2A 1KF6A 3W7UA 3N4QA 3V81A 4PQUA 4BR4A 2XY8A 1GN6A 4BIOA 4RW8A 3EY1A 3THYA 1IBMO 4JI5O 4WCEV 1S77D 4OPAA 3ZS8C 1WSGA 4JI0B 1K3EA 4WFFA 5J2TA 2MW2B 3E9OA 5EX5A 4FM1A 3W3DA 5BN8A 2QM8A 4YORA 5B3SC 1QLEB 5A2QO 3C6HA 3T1HK 1YQ4A 2P9NA 4DV5O 1IH7A 4I7FA 4OKEA 5I3UA 1P49A 4J42A 1V54C 1S0VA 1GRJA 3JCZA 2LSNA 4WFBL 1Q86O 2C2AA 1OH7A 4CI6A 4CHYA 1OCRC 4DO2A 5B1BB 1TKTA 4FXDA 3OYBA 4ZOLA 4IDKA 3HSTB 2ZM6K 4E0DA 1FJGK 3AE9A 4BR2A 2VWKA 1W0KG 3UO2A 5FDLA 4K8ZA 2D0CA 3JD1A 4DU1A 3THWB 3C65A 3E2EA 3O4QA 4WCEL 5H9CA 1TKZA 2G8KA 2YKMA 1KVCA 3K79A 3F7YC 4B3SB 4LSLA 1REVA 4KX6A 2YJFA 4CK2A 2HJDA 1RUE4 4FM0A 4B1YB 4FJIA 4KV8A 1KVBA 2R72A 1DK1A 1HR0K 2PY5A 2NZTA 4M3WA 3BEXA 2ZDIA 1GK9A 1HNXK 3SZ2A 3TTFA 1M56B 3Q4HA 3ZSOA 1M4UA 3M8RA 1VF6C 2VQEB 2QWNA 2RMKB 2FF3B 3TI0A 3SPGA 2ZE8A 3OR7C 5LA6A 5HOOA 1H2LA 2G38A 1Q5OA 2HR3A 4IFVA 5KTQA 1SRYA 5C24A 3JSMA 4OGCA 4DG1A 4X66O 1SQXH 1ZOYA 3H3OB 4DR4O 4CH3A 1K8KB 2NLXA 3C6UA 3O9SA 3OBWA 3WEEB 1K8AO 1Y66A 1V4TA 2ADPA 2FB5A 1VQ8V 2XY5A 3ZSVA 2Q3SA 3OUSA 1N6QA 3ZX0A 1OH6A 1N33O 1SKWA 5TKYA 2JGDB 3CB2A 3VOVA 2V7QG 4X65K 1XMOB 5C2TA 4DR2B 1M93A 5KHJA 4LFBB 3CXHF 3QO9A 3QO5A 1Q6HA 3VQBA 1DLBA 3ZMUA 4CJUA 4B1UB 1VSLA 5JVGL 5EY4A 2IJKA 1KLNA 3OTOO 2FSJA 3MN7A 3K5MA 2BTOA 4J80A 2QWPA 3KWIA 4CF8A 5JJNB 5BPNA 4X8AA 5AQUA 5KPZA 1S1TA 2F4VK 3EXAA 2YICA 4CEOA 3PO5A 2QWRB 3MECA 4UQGA 3OT7A 2VGMA 3HVRA 4JS5A 2IU3A 3JAKA 5BR9A 3EKSA 1EETA 4RCHA 4WQ5A 3A2FA 1UFIA 4A5UB 1SQQH 3M5RA 4A62A 4UY8O 5GW7A 4CC5A 4DUYO 2X0LA 3QFPA 5IJ9A 4YY3B 4FLYA 1U4BA 5TISZ 2UXCK 2HBJA 1WSFA 5KX5B 3A5OC 1VSIA 4CVNE 4ZIBA 4IL6Z 4DTPA 1YCIA 3RMBA 1LV5A 3AEDA 4DR1K 3R66A 1ZYQA 5KGXA 1XNQK 3VETA 3K04A 3NH1A 3QNOA 1FD9A 1MOFA 3ABMC 2QKCA 1V55C 1B9DA 2FF6A 2HHHK 1VBC4 3H1LH 4JI3O 3EKUA 2UXNA 4JI8B 2XTAA 1VQ6N 1VQ5N 1JJOA 4HCCA 4DF8A 4ZHRA 4NCBA 3R3LA 5LGNA 1R1BA 3RRHA 4Q6GA 3D3IA 4OX9B 4QPKA 4RQFA 4QS8A 1BMFG 4MTFA 5AQHA 4IHJB 2IIRA 2W41A 1WSJA 4BDPA 3CCSV 3HKCA 4B1XB 4X20B 2EZPA 4HHTA 4JI7K 5AQYA 4C1NK 3T1YK 1TUYA 2FYUH 1ASWA 1YZBA 2DE0X 1NU0A 4CZZA 3MWPA 3O9TA 4BRCA 3QFUA 1PVC4 2KKWA 3BUZB 4X1IA 1RTIA 5IY5B 1AI7A 1YVUA 4DR6B 2X6BA 3W7TA 4JI0K 1ZP0A 3JAMN 4JI2B 3AO4A 1VQLV 3L4IA 3JD4A 1JXBA 1F51A 5KA5A 1A5VA 1POV0 4FZ1A 3B8AX 2D3OW 1QVGM 3BY5A 1WP7A 3OA9A 4FJKA 2HVIA 5KRSA 2OPQA 4YSXA 3PX0A 3SBTA 1NTZH 4D7SA 1EWRA 1Y76A 3A0BZ 3D36C 4CIEA 4RG8A 4CGGA 1XOUA 2ASMA 1YTFB 4L8JA 2ZM6O 3ENOA 4DCHA 3CF5L 3QESA 3KVGA 3LM2A 4B3SK 2ZD1A 4JI4B 1VRH4 3B4SA 4OPHA 4BIZA 2GTAA 4DQRA 3QEWA 1CXZB 3G6BA 1IG9A 3VQEA 4CHQA 5E79Z 4AM7A 5L3GA 4Q4X4 1JA8A 1QS4A 1P7GA 4HNAA 3ZX6A 3CRQA 3H1KH 1HR0O 3EN9A 3ZEUB 3CCRN 2VQEK 3AG7A 1Q7YW 1XUQA 2G8VA 3JBG4 1MWMA 3NAEA 3WXIA 4BIUA 4PUOA 1MA1A 1NENA 3AVMA 4RWTA 4UUJC 1NJXA 3V9ZA 3THXA 3RVCA 1H2GA 3MWTA 3J81N 3UQ8A 3G6EV 4KBOA 1Q43A 3ZRSA 3R8EA 1KB9F 1SQGA 3U9ZA 1NK4A 1K9MO 4H44B 5JVHL 2NRHA 2K9PA 4I9WA 4JYAB 3OEHG 3OW2U 1VSMA 2IOCA 3LDNA 4JTAB 3P38A 2G8UA 2V52B 5EBWC 2Q0UA 1EZVH 3JALB 2V7YA 3V9XA 1XMOK 1IZ3A 4DR2K 4C23A 4IOAL 1AR74 2PFUA 5JMVA 4G28B 4M45A 3L0QA 4LFBK 1NKEA 3AECA 4N76A 3B40A 3OGCC 1KECA 2BE2A 1SUQA 1M1KO 4J10A 4FZXC 1OCRB 3DRSA 4TV8A 4X65O 3CIRA 1RSOB 1L3UA 3B6PA 3R9PA 2PYJA 1JVMA 4ZTJA 3QF7A 1I5YA 2E1ZA 3HKDA 4B9UA 4F2RA 2W6IG 3NMUA 1U96A 1YJNV 1HX1A 2X6CA 5BR8B 3AV9A 3DGEA 1QVFU 4YDUC 2AZ2A 4PHTX 2OTLN 3RYIA 5KHIA 2F4VO 3O1BA 3C3TA 3J7AU 2P9LA 4U7OA 4KHQA 4RUEA 4YY3K 3FZMA 2A3ZA 1NTKH 1K73W 2X78A 2G8IA 3CMAV 4YIPA 4I4TA 4LFAB 4B9LA 1HQEA 2ZQBA 3QDKA 4NCGA 3N2KB 4PA9A 4PJ0Z 4FIPC 4HUEA 1M90W 2Z1IA 3L2WA 1AJNA 3QEXA 4DV6B 1SERA 3CM5A 3CSXA 3QIPA 4JI8K 1WSIA 4WF9V 4DR1O 4B9VA 3T1AA 3M8AA 1QTMA 3CC7V 1OVQA 5EXWA 4WQ4C 2YHYA 4BWMA 4BG9A 3NF7A 2Q0RA 2DFHA 2A79B 3OYLA 3GQHA 1MQTD 4F4LA 4OX9K 3LSUA 4O4JB 3MDQA 2OZMA 5LMUB 2O8BB 4MVQA 1SZXA 1MNGA 1GLBG 3AVHA 2ETJA 4LH5A 3KJVA 1AJQA 3CFOA 3OS1A 2HMIA 5C3JA 1XNRB 2QTSA 3A5MC 3HPHA 1NNEA 1BL3A 2D1KA 4LF7B 3FZLA 1EN6A 2GUZA 3AVCA 2CH7B 4JHDB 3CM6A 4WF9L 4DQQA 1XWLA 4R79A 3L70H 4FLXA 1N0JA 2A06H 3W7XA 4JI7O 3T1YO 1XMQB 3LP1A 4EP4A 5FPOA 5DM6V 1SQKA 4CIFA 4DR6K 3AARA 4YIOA 4H8KA 3DC5A 4JI2K 3TABA 4L8RB 4M3YA 1NR1A 1JOYA 3P5JA 1AR94 4ZBMA 1S3JA 2AHYA 4MTXA 5KQDA 3HKEA 4JI0O 4BW5A 4DTNA 1NTMH 1XQ8A 3AO2A 1B3QA 5KAFZ 3LWMA 4YTMA 4KUMA 4CJSA 3JYCA 2P7TC 3LP3A 4W4LA 1BIZA 1IG8A 3NF8A 3P31A 4NCAA 1OCZC 3AEIA 1ZSPA 3KG2A 3L9DA 2QWOB 4B9SA 1WSHA 1VQPV 2DYRC 1ZC6A 4G1QA 4UV8A 5GIPA 4GX5A 3JAWB 2QXFA 4JI4K 2P9PB 2OTJN 3FAVB 4BW9A 3WXLA 4W5TA 1V55B 2Q9LA 4H0LB 3GOIA 4X1YA 1U04A 2V7ZA 4C8KA 1H38A 2WTUA 4YSZA 3OYDA 5FLXN 1Y4MA 4B3SO 4F3TA 2E20A 4K43A 3UM7A 1NZ6A 4A57A 1VQ7N 4DYLA 2Q8VA 3MAQA 4MLHA 3B8NA 3BFRA 4C8MA 1D9FA 2ZCEA 1YT3A 2Q4PA 5CB4A 1GH6A 4DV1O 5CA1A 3M7MX 2QA4N 2IVPA 4PA6A 5LHHA 3HPLC 2HBLA 4CBWA 1SQPH 4A5BA 1XI1A 2D4WA 3FKSG 5L3FA 4JASA 2AGAA 4RTFD 1X3NA 5CYQA 3B2EE 2ARHA 4W5QA 2VQEO 3S3OA 3KZIZ 4O55A 2Q67A 4P9OA 4X62B 2HSTA 1X9SA 1EV14 1IURA 1RBRA 4LP8A 2ZE5A 1VSDA 2F9TA 3J80N 5FNVB 3AA3A 4JYAK 2ILMA 4DV4B 2GBOA 2OPPA 2JVDA 1RUJ4 2CTRA 4Q20A 4X89A 2ASOA 4Z1VA 4OJRA 3PSIA 1NGIA 1BOTO 2WLIB 1XMOO 3U6FA 4DR2O 2WC9A 3WNHA 4AI8A 4GX2A 1IXBA 3SPCA 1ATRA 4LR3A 4BREA 3AO1A 3ENHA 3DYAA 4P30A 1KC8W 4MFBA 1ZBIA 1HYVA 2YSUB 3I0RA 4CJFA 5EU7A 4AF1A 5GAEP 4M3RA 4OPJA 1K92A 1NKBA 2O4IA 3F2KA 4KHSA 5BR8K 3UCSC 4I2QA 4AQYB 3AVAA 2ZE2A 4ELVA 1S76D 4KHNA 1ZWIC 1OCCC 1YXBA 1F4NA 1U2VB 1TV6A 2AA4A 3CERA 4PA7A 4LFAK 1QQOA 4H33A 5C12A 4MVMA 3VQDA 4ZI7B 3MHSC 4H13B 3ZT3A 1O9GA 2EJ7A 4DV0O 1QNMA 3AVNA 3AEEA 2E3CA 2ZNIA 2WBNA 4P2ZA 1S72V 4PY5A 2YIAA 4DV6K 2ACZA 1LAVA 3P3NA 2A1SA 4ASUG 4DW1A 3CFRA 4IO9L 5J2MA 3SFDA 2KSDA 3MMVA 2DFFA 1X3MA 4DTOA 4W5OA 2OCHA 1SL2A 3OJUA 5D3GA 5L3DA 4CJVA 3AEFA 1TL3A 4J2AA 1ASJ4 3ZSZA 4X1KA 1GTOA 3AG2C 1DLOA 1GLEG 3DXKA 4JEPA 2YI8A 1GO3F 3L73H 1ZBSA 5LMUK 1CXUA 2EILC 3AK3A 3QEPA 2N04A 1YITN 4J11A 5J2TB 4O8UA 4YOVA 3SI6A 2PGGA 4AHRA 2EWSA 1XNRK 4CHPA 3WB1A 4LF7K 3LUTB 4LC9B 3K2PA 1R084 1BQNA 5AQZA 1EKEA 2BCCH 3HT3A 3CCJN 3HJFA 1XMQK 5AQQA 3NR7A 4JYBA 1W0JG 1EN4A 1I5XA 1R6KA 2F8SA 4ZOLB 1VQMV 3QLHA 1YIJN 4BY9C 4GX0A 4GX1A 2ZIOA 3X2QC 1PIV4 1NGCA 1AL24 3NH2A 2P5OA 5D5PA 1VF7A 3HXMA 1J5OA 4JI2O 3V9WA 4JRPA 3BY6A 1JCGA 1NH2B 4EIAA 1HYSA 1ZBLA 4N23A 2P9SA 2GSMB 2KKZA 4LF4B 3JD0A 1BUPA 2WLKA 1I0HA 1YTFD 3DXMA 5IWAB 3SLCA 5AQSA 2R074 2WQYA 2FMLA 2CGOA 4RAIA 3RVZA 1QLEC 2RHKA 3LP2A 3OMAB 2EIKB 3QBXA 2HNDA 3OYJA 4B7KA 3JYTA 1YUWA 3PIOL 2DMXA 4GVEA 3E22A 5B1BC 1EN5A 1E4GT 4JI4O 3LALA 3ASNB 1QZ6A 4F6EA 1HLUA 3T19A 2FXUA 4B9QA 4OGEA 4IJAA 4K0KB 1JL2A 3TJTA 4CJ4A 1BWFO 5DEDA 1N32B 3LDPA 4CERA 2ZE6A 1ASVA 4QE7A 1BGYH 1H8HG 3GL1A 1Q82O 2HVHA 2PYLA 4BRKA 1R094 2QXLA 4X62K 2EHGA 3EO3A 4FOEA 3K9SA 2YIBD 3ZT2A 5J1EA 1HQUA 3ZRWA 3KTQA 4JZGA 1CPYA 4DV4K 2WDVA 3RYHA 2HNYA 3SV3A 2LW7A 5C42A 2UXXA 1FXHA 4H0VB 3NCIA 2GDSA 3PN1A 2W0FC 1TA8A 4JYAO 3H46O 1KU9A 3FYIB 3BA8A 1WLJA 4JPRA 4TOIA 1CZ9A 2YNHA 3SUQA 2XHBA 1NG9A 1BCOA 4M3UA 3CX5F 4M42A 1RFYA 1XHZA 1Z6RA 5IJ9B 3OYNA 3CQYA 3L2RA 2PAVA 1N5YA 3AE1A 3QICA 4NB4A 4ZTFA 1NJWA 5AQIA 1YAGA 4JI1O 1Z5VA 3JASB 3K0GA 3CEIA 3CCEV 3BCCH 2DYRB 1BHLA 5ADXA 1LWFA 1RNHA 1K33A 3T4ZA 2VCPA 3VQ5A 4AQYK 1R3KC 2WU2A 3WXKA 4Z4CA 3EL2A 3O9QA 4FK5C 1K8AW 2ZJRL 4QIWF 3AO5A 5BR8O 2A7WA 3I56N 1QZ5A 1GLFO 3CCMN 4DS5A 1FXKA 1Y97A 1G99A 2FBWA 3TAPA 2FL4A 1G8MA 4DV3B 4CGJA 1NS1A 2AZ0A 5KQ8A 2Y1IA 5H6QA 2CTQA 3NFAA 3HKCB 3TAQA 1MA9B 3SBGA 4F9OA 4CEBA 3ZSXA 4YSYA 4I5SA 1KBHA 4TUYA 4DV6O 2A5XA 4FJ9A 4ILJA 1W0HA 4BVOA 1DGSA 3RW0A 2ZGZA 4O4LA 1ATSA 4JKBA 2RS14 4MW8A 4NB5A 5L3EA 3ZETA 1N4CA 5C8YA 2AP1A 3L3UA 2MK3A 1VQKV 1L1FA 3AGRA 4DQSA 2P90A 1IBLB 5FL7G 1XNRO 1BI4A 3KZBA 2WDQA 5J2UA 2ITDC 3JCUZ 4LF7O 3TSPA 1KQSM 5B1AB 1P84F 5JCOC 2IS3A 4M41A 1VQOV 1LUWA 1Q3EA 4Z1MG 4DXWA 4O0IA 1HKGA 2H88A 5LHIA 1E3MA 4B8AB 4DKWA 1JLFA 2GV9A 1DTTA 3OYIA 3TARA 2O8EA 2PI4A 5BRDA 2XY7A 1Q6IA 1COWG 1FKAO 1EXQA 4J7ZA 1OCCB 5EIBC 2QM4A 3L2VA 1VIBA 1Z26A 4CJ7A 4LF4K 3AG4B 5IY5C 5E26A 3OS0A 4BE2A 5CA0B 3M3ZA 4QOZB 1OV9A 5IWAK 4MVSA 2X6AA 3DAWA 4FJ8A 3O65A 5DMRA 4HNAB 1WLEA 5JLFA 4LFCB 5FPDA 4H4MA 1PNLA 1VSFA 4FWNA 4GZRB 2RR14 2QEXV 4E89A 3S3MA 4LNUA 3FZKA 2UUBB 3FE1A 3RMCA 5FRMA 2YKNA 4BRQA 1SC5B 1L0VA 3J8AA 3O9RA 4FLVA 2OPSA 4WFGA 5JICA 3RGBA 4GCZA 2KHOA 3O9OA 4JF3A 1VQNV 1TAQA 4K0KK 1RUD4 1XHXA 1T6CA 3ASOB 3DWLA 2YNIA 4OLAA 1N32K 4RQEA 3JD2A 3O8MA 1KMIZ 5J9PC 2XAFA 3DTUB 2PZSA 2UU9O 2Q6AA 4JKGA 3WQUA 4FW1A 1RDCA 1OVYA 1HMVA 4PA3A 3E66A 1WP8A 4TV8B 1SAZA 5C25A 3WG7B 3IKMA 4K35A 3DLEA 3U3GA 5M1NA 4DR5B 1BZKA 4CZKA 4E19A 3OYKA 3JATA 5KPTA 3E8HA 2WAMA 4X62O 3H1QA 5LP6A 1PP9H 4JNEA 1L3SA 2ZINA 1SKSA 4UV9A 4B3OA 5EC2C 1C1BA 2F7TA 3K9JA 1B04A 4DV4O 3TAGA 3ZCCA 2P9LB 3MK6A 2IJJA 4U67L 4HAMA 4AHTA 4GT1A 3HBTA 3ATUA 3M6GA 3MX2A 4EFBA 1TAEA 3QVNA 4Z94A 1TK8A 3SQ0A 5AFUA 4NLBA 2BOCC 2Q68A 1MMMA 4CK1A 4CBXA 5AZIB 4QAGA 4DTSA 1PL0A 2HJFC 3CCVN 3ABVA 3FB8C 3DLKA 3LSSA 3ZHSA 2FBXA 1TUEB 5FPRA 3VERA 1HJOA 5M1QA 2ITCC 4DR3B 4N5SA 1QSYA 1I94B 2X5ID 1K9MW 3CCUV 4YJ2A 4QE9A 5CR4A 3IDHA 3SK3A 1JJ2M 4AQYO 3EHBB 1C0UA 3OYMA 3RYFA 3SYZA 1MSDA 3K9AA 1IKXA 4I9QA 1IBKB 3OFNG 4DV3K 2WOMA 4J7JA 1H2SB 3ZRXA 1R73A 4Y0WA 4JAVA 4YXWG 1M1KW 3VQCA 5KLVH 4AHSA 1LR1A 3LZJA 5KPRA 5C15A 1JCEA 1H2KA 1D4XA 1YJWN 5JJEB 2XRIA 4EEQA 2NRTA 5JS1A 4Y1CA 1SA0A 3VEXA 3O4NA 1ENVA 1GOBA 3ZJZA 5AQFA 2OT5A 2NNWA 5AQMA 1D8YA 3VA3A 5CZ1A 1W97L 2BTQA 3TTCA 4DU4A 2FLOA 3FYEB 3AVGA 3T3FA 4FJNA 3TAFA 3ABTA 3SAHA 1YDXA 4QS7A 2UUAB 3NE6A 1RT1A 4J9YB 3OD4A 4EHTA 1IBLK 1DKGD 3T4DA 1VEWA 1KD1O 3HVTA 4FLTA 3BF3A 4F8RA 1RT7A 2Q0AA 4JKEA 2A6AA 2P9IA 2O57A 3ZMTA 4H0YB 1SESA 3S3NA 3HO1A 3SYQA 1NH2D 3D2FA 2W6JG 4H5VA 3L72H 1JX9A 2Q73A 4X1YB 2QKKA 1Q8IA 3ASMA 1JLQA 1SL1A 4RW9A 5JJJB 3F9KA 3CPWM 3LZIA 4TWKA 4LF8B 5B5EZ 1NR7A 1RCHA 4O4IB 1FFXB 1XILA 4IZ9A 5I42A 1S5JA 5LYJA 3NF6A 3NVMA 1NJIO 1ZAUA 2WA4A 1H2MA 3E83A 3D2EB 4O2BA 5JQGB 2YNFA 4LFCK 3APOA 5LL6Z 5IWAO 4BWAA 5EOYA 3WT0A 1NGAA 4X9QA 3DLRA 1GN4A 5AQXA 2UUBK 4ISFA 1T8EA 1RHI4 3BAAA 4HCBA 3LDCA 3VQPA 3ZSRA 2YXHA 2ZR2A 3P3PA 3KK2A 3CJHB 4WFNL 4IO8A 1TK5A 3SUCA
chains in the Genus database with same CATH topology
1NK6A 3ICXA 2RQ6A 2FBVA 4C8LA 3THOA 1UWBA 1RBTA 2P1JA 3O3FA 3SUNA 3U11A 4CJ5A 3AO3A 3WB2A 3K57A 2OA8A 3K5LA 2OWOA 4I50B 3OYEA 4DV2B 1RILA 4OLBA 2UUCB 4KI4A 3E01A 1XC9A 4F4KA 2AJQA 4LF6B 4NXMB 1U45A 4IFYA 4CEAA 3KD5E 4Z4IA 2IAJA 4JV5B 5EYPA 4LD0A 4BDZA 4TV9A 1S6QA 2VG6A 4LF9B 3V9UA 4UFZA 2YI9A 5GONA 4X1KB 3WNEA 2B4JA 4B3RB 3QEVA 4UCTA 3DRPA 4C8NA 3DM2A 5JS2A 4BDYA 1WPBA 1X9MA 4DU3A 3UT5B 1I3AA 3OYHA 1Z25A 5JVDA 3MEGA 1KLMA 3WNGA 1CXQA 2D0BA 4FCYA 1HNVA 3BRCA 3CQ8A 4EB6A 2PTMA 1JXEA 3AVKA 4O2AA 4I55A 2YV0X 4Z4EA 1VRUA 4DK1A 4DUZB 4CHNA 3E22B 3K58A 4DSIA 4O4HA 1FK9A 3L8BA 2PW9A 3MXIA 1WAFA 3HKBB 3JSLA 1RT4A 3CHXA 3OYCA 3RYCA 2Q7GA 2FBYA 4E1NA 2HHTA 4FFBA 5J2PA 1U48A 1KFSA 1BCMA 1RDDA 5HLFA 5LOVA 4J2BA 3RYHB 3M8QA 3SQ2A 3N2GA 4KHPB 2ZIMA 5EZYA 3HPGA 1TK0A 1JLCA 1JFFB 4FZZA 4DRXB 1L5UA 1QQCA 3OYAA 3KLHA 1LAWA 3K5OA 1MU2A 2ZNJA 3HPOA 3SQ1A 4GYCB 5FROA 1RDAA 1O9HA 3SCXA 4LH7A 4NYFA 4CIGA 1KSPA 3V1QA 1FKOA 2IC3A 4CCHA 5DK5A 4O4LB 1GOCA 1JLAA 4X64B 3DLBA 3VQ6A 4UCSA 3PUFA 4Q0BA 1BQMA 3DSQA 1BI4B 5J2UB 2F1MA 4BE1A 4WBNB 1EX4A 3K59A 3ETQA 1J5EB 2RN2A 5LMNB 4CJLA 1EP4A 1S9GA 4U3JA 3K5NA 3F73A 4DQIA 2IGIA 1J54A 4YHHB 2P22C 4YJ3A 3PV8A 4CH4A 3KKSA 3TAMA 3ZEDA 3V9SA 4DSJA 2IM9A 4LNUB 3LP0A 2W42A 5KHGA 2EX3A 3DLHA 1T03A 2RF2A 4GKKB 3B6OA 4Z4GA 4RW7A 5JH7A 3BGRA 4J2EA 1X4TA 4CEQA 2YXLA 4CFAA 1RTJA 4B08A 4IG3A 3U0ZA 1UAXA 4FJ7A 4KL1A 3JARA 3LDSA 4Z4HA 3AA2A 4JI5B 3JATB 3NGZA 4LSNA 1NKCA 2F93B 4DV5B 3V6DA 2BGGA 2HHUA 1NK0A 4D7TA 4CEZA 4JI6B 3ZT4A 3FI7A 3L2UA 1GOAA 4DMNA 4KHUA 1KCFA 3NBPA 1LWCA 1LW0A 4WE1A 1C0MA 3RTVA 4K8XA 5EIBD 4YJ2B 3KLIA 2WONA 2BDPA 4W5RA 4FVMA 4E7JA 4TSXA 2RKIA 4KKOA 2GBZA 4X66B 1NK8A 3MXMA 2UXDB 2BTQB 3AA5X 1G15A 3VQXA 1N33B 4N56A 1YTUA 4ELTA 1SV5A 2E5LB 2FBTA 1T5EA 5LA6B 1TGOA 4IIJA 3VQYA 2RPIA 4N41A 4AILC 4FJ5A 1HW7A 3LAKA 1VRTA 3SGIA 4DFJA 4DUYB 3JALA 3KLFA 4RW6A 2R9AA 4CFBA 5SZTA 4CF2A 1O1WA 2CAZC 5CYMA 3VA0A 1RSOA 1HYZA 4O2BB 2P5GA 3JAKB 2JLEA 3SPYA 3H08A 3KIOA 3WB0A 3I8DA 3LAMA 3G10A 4FLWA 4CH5A 5FRNA 2Z1GA 1JMKC 3SJBC 4JS4A 4KB0A 1TVKA 4KTWA 4PHZA 1T05A 3JSNA 5K14A 1A5XA 3BDPA 5K1PA 5HRSA 4X1IB 2A1RA 3IS9A 1NOYA 3C6TA 5KGWA 4LF5B 4QCLA 1N36B 4CGIA 5EYPB 5D5QA 2QK9A 1JL1A 4BE0A 4O44A 3C95A 3MXJA 3VQ8A 2R7FA 4DTUA 1TAUA 3RFRA 1HNWB 2KZMA 1IKWA 3FFIA 3ZT0A 3VQ7A 3VN5A 1NT2B 3NHGA 2G8FA 3AA4A 3JAWA 4RW4A 4HUGA 1HNZB 3MEEA 4ZHQA 3KLEA 4CC6A 3P1GA 5JVDB 3VQ4A 1TVRA 3UIQA 3RWRD 4CS2A 2Z1HA 3HP6A 5J2NA 1D9DA 5FNVA 2E6LA 1J9AA 3QIOA 3SUPA 1CZBA 3DOKA 4O4HB 4FM2A 3DMJA 5K1XA 4H4OA 4O0JA 1LWEA 1RDBA 4CJEA 3HKDB 2RJZA 1SL1A 3OJSA 4DR7B 3SR2C 1IKVA 4DTJA 3RYIB 3RYCB 4KHWA 4FFBB 4I4TB 4UCUA 5LOVB 4B3TB 2X6SA 3G0ZA 4FK2A 2QJ1A 4ZI7A 4F6RA 5HRNA 1C6VA 3TANA 4EZ6A 3N2GB 5KMGA 1KVAA 3VQVA 4Z4FA 1UA0A 5BMVA 4FZYA 2E4LA 3ZT1A 1T7PA 4UCVA 4CJRA 1ZBUA 3OTFA 1KTQA 1S1UA 1X9WA 2ITGA 3HKEB 2HEPA 1K6YA 4CFDA 1RT3A 5KHKA 3ZSQA 2G8HA 5IYZA 5HRPA 4J2DA 3IG1A 1TUBA 4DV1B 1FKPA 4BWJA 3RWUA 4HVJA 3CG7A 4M3TA 3QETA 1S6PA 1WAJA 5IJ0A 5CB4B 4U3JB 5CA1B 4GVMA 4CEFA 1BGXT 4YJ3B 2HHSA 1D5AA 1SL0A 4B9NA 3VQAA 5HBMA 5HRRA 5HP1A 4DSLA 1Q9YA 5LXTA 4KTQA 4Y1DA 4OPKA 4CF1A 1TKXA 1IKYA 4DV0B 3BA9A 1L3VA 5JH7B 3BHPA 4FJXA 4UCRA 4GMJB 3ZCMA 2ATQA 1FXXA 2YHBA 3JASA 1IO2A 4FJLA 4IG0A 3JARB 3ISNC 1B9FA 3KK1A 5ITZA 2DTUA 4CS3A 3D0PA 1S1XA 1RT5A 1WN7A 2OYQA 4FLZA 2F96A 4KRFA 4FJJA 4KFBA 4HBNA 1QE1A 4CFCA 3LPTA 1ZBFA 2R70A 2QKBA 2DY4A 3NGIA 1RTDA 3P83D 3AVBA 3DI6A 2I5JA 4LY7A 3QINA 2VG7A 4YFUA 1WSEA 4XIUA 5LP6C 4O4GA 3FFQA 4FJHA 4Z0UA 2JS5A 1ITGA 4DV7B 4NXNB 5CY4A 2UXBB 2VG5A 2V4DA 1RBSA 1VSEA 1QHTA 3ITHA 4N47A 1A5WA 1L3TA 3CFPA 3PX4A 5CA0A 4CHOA 3QNNA 1RT6A 1LW2A 4GKJB 3SNNA 3DRRA 4IIJB 3HM9A 3V1RA 3HK2A 4FK4A 3ULDA 1Q9XA 4CJPA 1UOCA 1ZBHA 4CESA 3ZSYA 4AHCA 4E7KA 4JI1B 4MQ3A 4DFMA 1J53A 3OS2A 3M8SA 3KKRA 4BACA 1NOZA 4CEEA 3EYZA 3O3GA 3SQ4A 4DFKA 1X1PA 5KI6A 4YNQA 3V1OA 4LH6A 1I39A 1C1AA 3NDKA 3LWLA 1TVKB 4B3MB 4KO0A 5CZ2A 1N34B 3BABA 2XY6A 4DFPA 3AVLA 1G6UA 4KHYA 3SUOA 2F95B 4DWIA 4E1MA 4F2SA 4TUYB 5E41A 4JRQA 2VQFB 3SPZA 1HJRA 3VQQA 2P51A 1KFDA 2HHQA 3VQWA 5C8YB 3QEIA 1U49A 3NH0A 4FYDA 3QTCA 3D45A 4F3OA 4DSEA 5J2QA 2HHXA 1JLBA 2B6AA 2HHVA 4FJMA 4HUFA 4ELUA 4CJQA 3KLGA 1SKRA 4KPYA 3RR7A 4ZHQB 3SJAC 4I2PA 4CE9A 4CJTA 3DOLA 3OYFA 4O4IA 4HTUA 3VQ9A 1FFXA 4DF4A 2UU9B 4NVPA 4CGDA 1NK9A 5JQGA 4DQPA 1S1VA 1S1WA 4CF0A 2X6NA 1W9HA 3HL8A 3V4IA 2PUSA 3OY9A 3L2QA 5KX5A 2IDOA 3M8PA 4B8CA 4I9LA 3QERA 4CECA 4CJKA 3ALYA 3THVA 1IBMB 1JLGA 5KRTA 4AHUA 5LP6B 5SWMA 4I50A 5JCOA 4CH6A 4IHJA 1VSHA 4AH9A 3PO4A 3PX6A 4X20A 2KZZA 4ID5A 2BANA 2Q7HA 2HHWA 1ASUA 4F6RB 1NK5A 3NF9A 2Y1JA 2DFEA 4EZ9A 2HNZA 4DLGA 1SKVA 3BPZA 4E7IA 3RYFB 4IKFA 4UCOA 4DTXA 5KMGB 2E6MA 3OVNA 1I7FA 5BMVB 1KRPA 3EZ5A 1L8DA 4PI0A 1SA0B 1NJYA 2G8WA 4DR4B 3UT5A 2OZSA 2D0AA 3TWHA 4GLXA 4AHVA 1QSSA 4M3ZA 1BISA 2F66C 5IYZB 1HNIA 4EFEA 4FK0A 3OTOB 4OKKA 4OKJA 1TKDA 4CF9A 3KD1E 3U10A 1TUBB 3DLGA 4CEDA 4E7HA 2YIBA 4B9TA 1YTAA 4DTMA 4CGHA 4ID1A 4OVLA 5IJ0B 1F21A 2XO7A 3RR8A 5LYJB 4W5NA 4JI3B 4EP5A 4FLUA 3AVIA 3HKBA 1U47A 3OYGA 3N2KA 4CHZA 1Z5WA 1JLEA 2FC0A 5KHHA 4IBNA 1NJZA 5LXTB 2F8TA 1RBVA 4LH4A 2OPRA 1BIUA 2NUBA 4ICLA 4CGFA 4DLEA 1YEWA 4O4JA 1JFFA 3RMDA 4DRXA 1VSKA 1JKHA 3ZSWA 4GW6A 1TL1A 2R7YA 3T1HB 4DTRA 5ITZB 3NGYA 4DSFA 3SJJA 4KTZA 2KQ2A 2ZM6B 1FJGB 4CJWA 3O3HA 4Q5VA 1WNSA 4TV9B 3LNNA 3AVJA 3KK3A 3IAYA 2JGUA 1VK0A 4B9MA 4FJGA 5GONB 2GUIA 4NYNA 3SV3A 2Z1JA 3CYMA 3QG5A 1HR0B 4DSKA 2KFNA 3LANA 1HPZA 1HNXB 1R0AA 4DS4A 3SJCC 4KAZA 2HW3A 1DTQA 1HRHA 2D5RA 1RTHA 4WBNA 4E7LA 1CLQA 1NK7A 4DK0A 1SQFA 2YHAA 3RRGA 1M5IA 2B5JA 4X65B 3WNFA 1B92A 4CK3A 4PI2A 5HROA 3HYFA 4EB6B 4O2AB 4I55B 2Q7EA 1S9EA 4R5PA 2HB5A 3RMAA 1UA1A 2F4VB 3SV4A 2YNGA 5T7BA 3L3VA 4PWDA 3TAEA 4E3SA 2KW4A 1V9PA 1QSLA 4TQFA 3LPUA 2VWJA 3U3YA 2O4GA 2UXCB 4JLHA 4C8OA 1VSJA 4DR1B 2KTQA 1XNQB 4TQDA 3AVFA 2HHHB 4CS4A 3IRXA 2X74A 3TR8A 1RBUA 3S9HA 1C1CA 4M3XA 4KI6A 4KB1A 3HP9A 1C0TA 4KREA 4CJ3A 4JI7B 5EZYB 4PA1A 3T1YB 2KFZA 3MEDA 3I0SA 4O5BA 3C94A 4FW2A 1RT2A 3V81A 4PQUA 2XY8A 4RW8A 3EY1A 1WSGA 3ZS8C 4JI0B 5J2TA 4FM1A 1IH7A 4I7FA 5I3UA 4OKEA 1P49A 2LSNA 4CHYA 1TKTA 4FXDA 3OYBA 4ZOLA 4IDKA 3HSTB 4E0DA 2VWKA 5FDLA 4K8ZA 2D0CA 4DU1A 3O4QA 1TKZA 2G8KA 2YKMA 1KVCA 4LSLA 4B3SB 1REVA 4CK2A 4FM0A 4FJIA 4KV8A 1KVBA 2R72A 2PY5A 4M3WA 3SZ2A 3ZSOA 1M4UA 3M8RA 2VQEB 3TI0A 5LA6A 1Q5OA 4IFVA 5KTQA 5C24A 3JSMA 4OGCA 4DG1A 4CH3A 3C6UA 2XY5A 3ZSVA 2Q3SA 1N6QA 1SKWA 3CB2A 1XMOB 4DR2B 1M93A 5KHJA 4LFBB 3QO9A 3VQBA 4CJUA 1VSLA 1KLNA 3K5MA 2BTOA 4CF8A 5JJNB 1S1TA 4CEOA 3PO5A 3MECA 4UQGA 3HVRA 4JS5A 3JAKA 1EETA 3A2FA 4CC5A 5IJ9A 4YY3B 4FLYA 1U4BA 1WSFA 5KX5B 4DTPA 1VSIA 3PY8A 4ZIBA 3RMBA 1LV5A 1ZYQA 5KGXA 3NH1A 3QNOA 1B9DA 4JI8B