1XHZA

Phi29 dna polymerase, orthorhombic crystal form, ssdna complex
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
molecule keywords 5'-D(*TP*TP*TP*TP*T)-3'
total genus 144
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhzA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhzA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhzA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhzA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhzA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhzA06
1SL0A 2DTUA 2ATQA 1EX4A 3MEGA 4MQ3A 3AVFA 1BI4A 1LWCA 1RBVA 1W0HA 3QLHA 1RTDA 4DSJA 4I7FA 1T7PA 4OKEA 4FLTA 5CYMA 4CJWA 2AJQA 4DLGA 4HCBA 1BISA 3C95A 4YFUA 2LSNA 5HRRA 2E6LA 4CF8A 4L8RB 2E6MA 3QIPA 3PX4A 1UA0A 1BI4B 3SV4A 4O0JA 4DLEA 5KRTA 4DSFA 1W9HA 2HHTA 1EP4A 3VQPA 4FK0A 3LALA 1RT6A 4AHRA 3AVNA 3AVAA 3HM9A 2ZE2A 4DTJA 4ELTA 2NUBA 3DRPA 1SUQA 4B9UA 4O0IA 3SQ2A 3DRSA 1VRTA 2PZSA 3LP1A 3NF6A 3ULDA 3QNOA 1TKDA 2HMIA 3AA5X 1S1VA 2Z1HA 3OYMA 1KRPA 2VWKA 1BHLA 2E4LA 3HP9A 4DSEA 1SL2A 4KHNA 2I5JA 1BQMA 1RT4A 1A5XA 1J9AA 4FXDA 1B9FA 4C8MA 3RRHA 3VQ8A 2GBZA 4CECA 4CJQA 4E7KA 3BDPA 5E41A 1Q9XA 4CHZA 3HK2A 3LPTA 3T1AA 3DLGA 4FLXA 4N56A 3L2QA 2R7YA 1R0AA 1IKXA 3P1GA 4OGCA 4DQPA 4DQQA 3OYFA 1NKEA 4HUFA 4QOZB 3LDSA 1L5UA 4BWMA 3SV3A 4CEOA 1ZBHA 3DLHA 3DLBA 3PO4A 4PA1A 1JLAA 1X9SA 4CHOA 3H08A 1HYSA 3LP0A 1ZBUA 5D3GA 3CM6A 4DTUA 2FBTA 3O4NA 3K59A 3V1OA 4CJ3A 4DMNA 1S1WA 3VQCA 1WSIA 4CEEA 3HXMA 3ZT1A 1RBSA 5DK5A 3RTVA 4CGFA 2Q3SA 2XY5A 4CJRA 3TWHA 4M3WA 4IG3A 1GOBA 4FJ9A 1YTUA 3AVGA 4KHSA 1KFSA 4DF8A 3KLHA 3VA3A 1RILA 4Z4CA 4GVMA 1VSFA 3CYMA 4RG8A 4FLWA 2IDOA 2Z1IA 1N5YA 1ZBFA 1RDCA 4G1QA 1S1TA 1QQCA 4CEFA 1HJRA 3QEXA 1NK8A 4FM1A 3DI6A 4Y1CA 1WAJA 4FJNA 3I0SA 4OGEA 1IKVA 3ISNC 2HW3A 5EU7A 3V1QA 3AA4A 4KAZA 2HHQA 1VSKA 1XI1A 2B6AA 5HRNA 4AHSA 4NCBA 3E01A 2BGGA 1EKEA 1FK9A 4FLVA 3D0PA 4N41A 1NOZA 3AVLA 4RW9A 4CK3A 2PY5A 4CK2A 1GOCA 5JS2A 3F73A 1ZBLA 2FC0A 1DTTA 3IRXA 3RMCA 1HYZA 4ID1A 1C0TA 2OZMA 3OYNA 2BANA 4DQSA 4DU3A 4C8OA 3ZSZA 3KD5E 4PWDA 1X1PA 2VWJA 2D0BA 3V6DA 3OYCA 4TSXA 2PW9A 4EZ9A 1BQNA 3NE6A 4DFKA 3K5OA 3AO4A 3EYZA 3FFIA 5J2QA 4B9LA 3PX0A 3OS2A 4QCLA 2YNIA 1BCOA 5C24A 4QAGA 3NHGA 1RT1A 4FJ8A 1RT3A 5KRSA 4OPKA 1BIZA 4IBNA 4DFPA 4C8KA 3K2PA 1IKYA 3SPYA 2IOCA 4BDZA 4FJXA 3B6PA 4CEQA 3L2RA 4CE9A 3VA0A 3V81A 3HVTA 1Q8IA 4C8NA 4DQIA 4F2SA 4KTQA 2RN2A 3JYTA 1NJXA 5HBMA 3ZSOA 4B08A 3AA2A 3SZ2A 2KW4A 3K5MA 4Z0UA 1RBUA 1UA1A 4W5QA 5CY4A 1QSSA 4OLAA 1D5AA 4B3OA 4JRQA 2Z1JA 3NF9A 1S9EA 1SV5A 3LZJA 1VSLA 4FJ7A 3V4IA 2JGUA 2OPRA 3VQBA 5KGWA 3MAQA 4FVMA 1C1AA 1QE1A 4BWJA 4AH9A 4EP5A 3ZSVA 3HT3A 3LZIA 3V9WA 5FRMA 2QXFA 1RDDA 2VG5A 2X78A 4CJ5A 2WOMA 3KK3A 5I3UA 1XHXA 5J2NA 1U4BA 3M8QA 4M3XA 1YVUA 4H8KA 2P5OA 3I8DA 4HHTA 2HHSA 3MXIA 3SYZA 1NK0A 3L3VA 4JLHA 4M41A 3RWUA 3V9XA 4J2EA 4AHCA 4CJVA 4YNQA 3V9ZA 1IH7A 4B8CA 4CHPA 4M3TA 1CZBA 3S3MA 1BL3A 4FJHA 3TR8A 2IAJA 3VQ7A 3HO1A 3ZT3A 2HHWA 4PY5A 4KRFA 1Z26A 2IGIA 4PQUA 2W42A 2G8WA 4H4MA 4LY7A 5FDLA 1T03A 1NK7A 3WNFA 1C1CA 4NYNA 4DSLA 3S3NA 1NKBA 2ETJA 3C6UA 4O55A 4CJUA 1NJYA 1G15A 2IC3A 4DS4A 1Z25A 4CHNA 3WNEA 3QEPA 2P51A 1X9MA 1EXQA 2OYQA 2G8KA 2OZSA 4KI6A 4KI4A 3SNNA 1D9FA 4CJLA 2F96A 4N5SA 1RT5A 2XRIA 3TAMA 3PY8A 3NH0A 1ASWA 3SCXA 3TAFA 3KJVA 3AVMA 4BE0A 1TK8A 5HP1A 3NAEA 3ALYA 1CZ9A 3TAGA 1HPZA 4FJ5A 3UIQA 4DTOA 3VQAA 2BDPA 1RTHA 1WSJA 2YNGA 3OYLA 2YKMA 2YV0X 4BDYA 2X6SA 3LWMA 2FBXA 1WN7A 1ASUA 1TK0A 1C1BA 1LV5A 3MECA 4CFAA 1JL2A 1HQUA 1JLFA 2X74A 4NYFA 2DY4A 4IFVA 4Z4GA 1DLOA 2D0CA 3AVJA 4CF9A 4FJLA 3M8RA 3SUQA 2FBVA 4JS4A 4KTZA 3DLKA 4CHQA 4O44A 4DG1A 3PV8A 4B9NA 3SUNA 1KLNA 2OPQA 1ASVA 3RMDA 3BGRA 4F4KA 4DTXA 1LWFA 4DF4A 4CEDA 3LAKA 4F3TA 1B9DA 4IFYA 4BDPA 4CK1A 4FW1A 4W5OA 3DLRA 2G8FA 1S1UA 4DTNA 2P1JA 4E7IA 3OYBA 1JLBA 3EZ5A 3PUFA 1RDAA 4FJKA 3M8SA 5FROA 1SKRA 3V9SA 2HVIA 1XC9A 4Y1DA 4Q5VA 1T8EA 2O4IA 4LH4A 3U3GA 3OYDA 2HB5A 3OYEA 2HVHA 1DTQA 4KB1A 4UQGA 3U3YA 4GW6A 3KLIA 4CHYA 4CEAA 3HYFA 4OJRA 5J1EA 1TL3A 3U6FA 2B4JA 4KFBA 3K5LA 1RNHA 3WNGA 4WE1A 3OY9A 3OYAA 4DFMA 5I42A 4XIUA 4I2PA 3RRGA 2G8IA 1QSLA 3ZSYA 2JLEA 4LD0A 4F8RA 1WLJA 3MXMA 1C0UA 2KTQA 1UAXA 2RF2A 2ZQBA 3TANA 1WSEA 4EP4A 3TI0A 5CZ1A 4B9VA 4Z4FA 3DM2A 3KKSA 1NJZA 3QEIA 1VSMA 1WNSA 3NH2A 4LH5A 2EX3A 4E89A 4B8AB 4M3RA 4FCYA 3RMBA 3PX6A 1HNIA 1RBTA 4J2BA 5CZ2A 1JL1A 3KK1A 2DFEA 3ZT2A 1J5OA 1D8YA 3NF8A 4FZXC 1U49A 4CGIA 3QIOA 3AO3A 1JKHA 2KZMA 5HRPA 1FKPA 2D5RA 3QETA 4CGJA 1I39A 3S3OA 3K58A 1S1XA 2VG7A 3P5JA 3OYJA 3CFRA 1JXEA 4FM0A 1SKSA 4CF1A 4EZ6A 1TGOA 3LPUA 4FLUA 3QEWA 3C94A 4IG0A 3KLFA 3NCIA 4W5RA 1NJWA 3G0ZA 3LP3A 4HVJA 3PO5A 4KV8A 1TAUA 2P5GA 1L3UA 3AVBA 3O4QA 4RW6A 2HNDA 4CERA 4CF0A 4CFBA 3L2WA 2G8UA 2YNFA 2KFNA 1MU2A 1ITGA 1JLGA 3NBPA 3QINA 4GMJB 5K14A 4DTMA 4IKFA 1BCMA 1RT2A 1HRHA 4FM2A 4CGHA 3TARA 3IAYA 1T05A 4JS5A 3S9HA 1VRUA 1NK5A 2F8TA 1GOAA 4FJMA 4I2QA 3SQ0A 3AVHA 1XWLA 4FW2A 2OA8A 2YHAA 1B92A 3CFOA 1X9WA 3ITHA 4LSLA 3NGIA 3ZSRA 1CXUA 2QKBA 1L3VA 5KI6A 3L2VA 4AILC 3VQ6A 3TAQA 4FK4A 4OKKA 3OYGA 1CXQA 2B5JA 1KVCA 1U47A 4KHYA 3IS9A 4CJSA 1JLQA 4CJEA 5KGXA 3DOLA 4DS5A 4CGGA 3HP6A 4Z4IA 1S6QA 2ITGA 3SPZA 3P83D 3DMJA 3SUPA 4DSIA 1XHZA 3CM5A 2KFZA 2G8VA 3NDKA 1TAQA 3OJUA 3NFAA 3OS1A 2FBYA 3MEDA 4CJKA 4I9QA 1EETA 3VN5A 1FXXA 3AVCA 2YNHA 4ZTJA 4KB0A 3TABA 3HJFA 1NOYA 3L8BA 1QHTA 1S6PA 4DTPA 3V9UA 2A1SA 4R5PA 4OLBA 4ZHRA 3NGYA 1KLMA 5C25A 3QEVA 2HHXA 2XHBA 4FYDA 3HPGA 4E19A 4KO0A 4E7HA 4CJPA 1NKCA 1S5JA 3LAMA 4FLZA 3V1RA 5HLFA 3KKRA 1CLQA 4CIEA 3QERA 1RTIA 2OPPA 4BE2A 1D9DA 1WSHA 1VSJA 4CFDA 1QS4A 4KTWA 4M3ZA 2ZD1A 3VQ5A 3KLEA 3RMAA 3DYAA 3KLGA 3VQEA 3VQ4A 4CGDA 1JLEA 3MXJA 1WAFA 1KVAA 4Z4EA 3F9KA 3CQ8A 3VQQA 1J54A 1LWEA 3ZSQA 2RKIA 4FLYA 1LAVA 4E3SA 2Y1JA 2QK9A 2GV9A 1VSDA 1BIUA 4W5NA 3M8PA 1C0MA 4J2AA 3OJSA 2YKNA 4BE1A 2QKKA 3EY1A 1RT7A 1IKWA 1U48A 3LP2A 1HQEA 1RCHA 1I3AA 3G10A 3OVNA 4NCGA 3WNHA 3SJJA 4ZTFA 2HNYA 4I9LA 4HTUA 4AHTA 3KD1E 4RW8A 4ID5A 1IO2A 3ZSWA 1U45A 1ZBIA 1JLCA 4E7LA 2IS3A 4M3UA 1VSHA 1K6YA 5SWMA 3RR7A 3VQ9A 2G8HA 1WSFA 3AO2A 4OVLA 1TKXA 4DU1A 1U04A 1NK6A 3AO1A 3TAEA 3O3GA 3NF7A 4CESA 3SQ4A 1TKTA 2KQ2A 4CCHA 4KHWA 4BACA 4N47A 5T7BA 1L3TA 4CJTA 2OPSA 5KTQA 1JXBA 1KVBA 3T19A 1TV6A 1VSEA 4CJ4A 5C42A 3HSTB 3SQ1A 3OS0A 3AV9A 4CEBA 3O3FA 4CJFA 4B9MA 3NH1A 1C6VA 4HCCA 2PYJA 4J2DA 1IG9A 1SL1A 2XO7A 2WONA 3ZSXA 4E1NA 1BGXT 4N76A 3ZT4A 4FK2A 2XY7A 1F21A 1Q9YA 1HYVA 1VSIA 2EHGA 3HVRA 3T3FA 3OYKA 4C8LA 5FRNA 4K8ZA 1S9GA 3QO9A 1ZYQA 4M3YA 1KCFA 4FJIA 5J2PA 2R7FA 1RDBA 1RTJA 4K8XA 2BE2A 3ASMA 3IG1A 3ZCMA 4CIGA 4JRPA 2RPIA 5DMRA 4HUGA 3FI7A 1REVA 1QTMA 3D45A 1FKOA 5HROA 1QSYA 3QNNA 4E7JA 3KIOA 2F8SA 4IDKA 2A1RA 4ICLA 4M42A 3DRRA 4RW7A 4FZZA 4Q0BA 3HPHA 4B9SA 3AVKA 3MEEA 4PUOA 4ELUA 3ZT0A 2XY6A 1NK4A 1SKWA 1YT3A 4M45A 2D0AA 4AHUA 4DQRA 4CEZA 3SUOA 4RW4A 4O4GA 3LWLA 4OPJA 2PYLA 3JSMA 1N6QA 2HHVA 2KZZA 4FZYA 1HMVA 3A2FA 3NGZA 1L3SA 2X6NA 4KPYA 3DLEA 1TKZA 2YHBA 5SZTA 4AHVA 3OYHA 3OYIA 1A5WA 3AA3A 4DFJA 1Y97A 4NCAA 4OKJA 2XY8A 4W5TA 2Y1IA 4H4OA 1TVRA 4DU4A 4F2RA 4F3OA 2HHUA 4DTRA 3CG7A 5J2MA 5CYQA 1TL1A 1LAWA 2HNZA 3L2UA 3RR8A 3AVIA 4CFCA 4ELVA 3HPOA 4CF2A 3QESA 3KK2A 4KHUA 3B6OA 3VQDA 1NK9A 3DOKA 4Z4HA 4LSNA 3SI6A 1HNVA 4FJGA 1KFDA 3O3HA 2Z1GA 1LW2A 1J53A 1O1WA 4HUEA 3KTQA 4MFBA 3K5NA 1LW0A 1UOCA 3THVA 2DFHA 4CIFA 1VK0A 2O4GA 3AO5A 3LANA 3CFPA 4O5BA 4DSKA 4B9TA 1YTAA 1WSGA 4KKOA 2DFFA 4KREA 5JS1A 1RBRA 4DTSA 5HRSA 4E0DA 4E1MA 3TAPA 3L3UA 4FJJA 1A5VA 4DWIA 3C6TA 1KTQA 3K57A 2GUIA 3HL8A 1TK5A 1KSPA 1UWBA 4KHQA 3I0RA 2VG6A
chains in the Genus database with same CATH superfamily
1NGEA 1U2VA 1DEJA 2Q69A 1SL0A 1I94K 1RUI4 4LC1A 1AP5A 1O9GA 1SQQH 4FWRA 5BPLA 2ADQB 3AVFA 1BI4A 3RYCA 2UU9O 2ZQMA 1W0HA 2HF4A 4C23A 2BE3A 5B8HA 4NVPA 1T7PA 4DSJA 3J80N 2YXHA 3K0GA 3K79A 2Z5UA 2Q68A 4FLTA 5CYMA 1EO1A 4CD1A 4HYOA 1XILA 4CC5A 2PFUA 2E1ZA 3RGBA 2QEXV 1JCGA 4CZHA 2O8CA 3ASOC 1BI4B 3SV4A 4DUYO 3ZRVA 5LL6Y 4K0KO 1S22A 4GUNA 1W9HA 3L8BA 5M1QA 1K97A 1RT6A 4H13B 4HAMA 3GB7C 3L75H 2ZGYA 5CBGA 3AVNA 3QFPA 4CBUA 1THZA 3MCAB 1KQSU 4ELTA 2NUBA 3TU5A 2JDIG 4B9UA 1HR0O 2FBWA 1TKDA 4LF5K 2E8AA 2CTRA 4BR5A 1M1KW 2O8FB 1BHLA 3WXJA 4GKKB 3ZLJA 5L3EA 3UKMA 1ZC6A 4CJQA 3MN5A 2WLIB 4E7KA 3JD0A 4YHHK 1IZ3A 5FPNA 4RTFD 3BVOA 1HRV4 1CZAN 3T1AA 1D4XA 4PI2A 1E4FT 1ZSPA 1SZ2A 3L6QA 2F43G 4QPKA 3P1GA 4DQQA 3HZ6A 4IOAL 4JKCA 4JZ2A 1PP9H 4YORA 1WPBA 2NRVA 5EBMC 2V7ZA 2LFRA 1YVNA 3OE7G 1X9SA 3H08A 5D3GA 2Y69C 4DTUA 3R6MA 2FBTA 3HXMA 3VMFB 5KA6A 5DK5A 3CRRA 3R66A 4CJRA 5JJEB 4IG3A 3AVGA 5AQFA 2EINB 3D2FB 4IEEA 2HBJA 4CZGA 1Q86W 5B1AC 4NTYA 1CPYA 4GVMA 1EN4A 1VSFA 3D6RA 3IKMA 2IDOA 1IV0A 4DR3K 1RDCA 2HBKA 4CEFA 1VAZA 2ZM6K 3IMXA 1RPOA 4FM1A 1I7FA 2IU0A 1WLEA 4OGEA 3WXIA 1JA8A 5A2QO 2HHQA 2HG5C 1W59A 1F51A 3OGCC 2B6AA 4XDJA 2ZD9A 3CQYA 4AHSA 3E01A 1K73W 1EKEA 5HFLA 1FK9A 4H5WA 4AQYO 2HHHO 4DR2K 1VQON 4N41A 1N0NA 1U2VB 4FWLA 1QZ5A 1GOCA 4KFMA 4WQ4C 3TTFA 4BW5A 1DTTA 3O9UA 4DQSA 4C8OA 3U9ZA 3P4QA 1X1PA 2P9IB 4EIAA 1RPRA 4BQLA 3V6DA 3SK3A 3RVZA 1QQMA 3OYCA 1BEV4 1BQNA 3HSCA 5K1PA 1XNQB 4Z94A 2UXBK 2YI9A 1VP7A 2VYPA 3AO4A 1HNZK 5IWAO 2YNIA 3LDPA 2B1IA 5H6RA 5C24A 4FJ8A 2ZIMA 4HBNA 1RT3A 4JK8A 2VQFB 2QTSA 5KRSA 4DV3B 1BIZA 4IBNA 4DFPA 1KU9A 2GBOA 5LGTA 3B6PA 3F5TA 1GK9A 1QVFM 3L2RA 3VA0A 4Q4Y4 3HVTA 4DQIA 2WTUA 5HBMA 1IBLO 4LFAK 1U96A 3K5MA 4OLAA 1EM1A 5CY4A 3O9OA 5JWPA 2WUSA 5BN8A 4H0LB 1K5MD 3QVNA 3T1YO 3BABA 5LMNB 1S9EA 3MDQA 1VSLA 4JRQA 1YJNN 2Z0AA 1K9MO 4FJ7A 4WFEA 3V4IA 3VQBA 4Q5VA 5KGWA 1QE1A 4A59A 1Q6UA 5FRMA 1V4SA 2XT9A 1AR94 3H1LH 4EHUA 3CXCM 1RDDA 5E84A 3VENA 2EZOA 1XHXA 4LF4O 1U4BA 4R6ZA 4UCOA 4M3XA 3HBTA 3A8TA 3SPGA 2P5OA 2OCEA 2HHSA 4DR1O 5B1NA 4QNHB 1NGGA 3V9XA 2J4RA 4F6EA 2MW2B 3ZCCA 4DB3A 4YNQA 2JWLA 3THWB 1CZBA 2ZXWB 1XMQB 2NRRA 3ZETB 3S3MA 1TUYA 3TR8A 2UXBB 3E35A 2HHWA 4PY5A 3JXUA 1YF5L 3VQWA 4PQUA 5LYJA 1AJQA 2FMLA 4YJ3A 4DSLA 1NKBA 3C6UA 5DECA 4JKGB 2R9AA 4RAIA 3VQXA 2PGGA 4CW7B 3N27A 2P51A 1EXQA 3QEPA 4MO4A 2IJHA 4D7SA 4UFZA 2PAVA 2DMXA 2QWRA 4C1NI 4R8CA 2XRIA 1EFRG 3SCXA 4CH6A 1ASWA 3O6WA 5LJVA 3E66A 5HFMA 3D3IA 3AVMA 2IVPA 1X4TA 3VTHA 4BE0A 1TK8A 1VQ9N 1XC3A 5GAEP 5CN0A 4B7EA 3K04A 2E88A 3C0BA 3MWPA 3Q7BA 3ENOA 2L35A 5AQJA 4GB34 2AHZA 2BDPA 1N36B 1VRH4 2P9UA 4CD3A 4BDYA 4OX9B 4DV1O 2CH5A 2X6SA 3E2EA 2ETNA 1C1BA 4CFAA 1HQUA 1Q7YW 3K0SA 2X74A 3CJBA 3GBTA 2D0CA 5IYZB 2FBVA 1OCOB 4CHQA 4JI1O 4JI2B 4O44A 5JJNB 4PL8A 4B9NA 1OJHA 4JI3K 3CIRA 1RHI4 2A41A 1BWFO 3JAMN 2DYRC 3RVYA 4DF4A 2K9PA 3HM8A 3LAKA 3CD6V 4FW1A 5LHHA 2GWKA 3EKUA 4DTNA 3SFEA 3OYBA 1SESA 4Z2WA 1XQSC 2XAHA 3FR0A 1XC9A 4Y1DA 1T8EA 2HVIA 2ZIOA 3WG7C 2HB5A 1FFTB 4UB6Z 4KB1A 2WBNA 3U3YA 3B8NA 5B5EZ 4V19S 1XNQK 3LL3A 3W7WA 2WLMA 4CEAA 3HYFA 1TL3A 5LMUO 2B4JA 4KFBA 4IHJA 2B5UA 3X2QC 2YDEA 4DFMA 2G8IA 2JJ1G 1YHQV 1S72V 4WQ5C 3R8EA 3ZSYA 2JLEA 2YHWA 4NXNK 5D5PA 2E2NA 1C0UA 3B4SA 4BRPA 2RF2A 4LBEC 2ZQBA 2QKSA 3SFDA 1DF5A 1WSEA 4EP4A 4NTWA 2GTDA 1R3JC 4JYAO 5CZ1A 4Z4FA 4CS4A 1NJZA 1HNXB 1VSMA 3QEIA 3OR7C 3M99B 3CCUV 3UCSC 3JATB 1Q3EA 4FCYA 4Q4X4 3HTVA 1V55B 2BSKA 3CCVV 1Y66A 1NGDA 2ZGZA 3KK1A 2NRWA 2DFEA 2XTAA 4YOUA 2UUCB 4O8KA 5FNVB 1U49A 1RM1B 4MVSA 1VQ9V 3A5MC 1H38A 1XMQK 5CA0B 1YITN 5AQPA 4JI7K 3S3OA 2H88A 1PIV4 4JYAB 4UVCA 3JD1A 2KKZA 5JVHL 1SKSA 4FM0A 3T1HB 2UUBK 3G4SN 1NCQD 1HR0K 3MN9A 4R50A 5DEDA 3KK7A 4P9PA 2F9TA 4AF1A 2YIBA 1DGKN 5LMUB 3LP3A 4DO2A 1TA8A 4DV2B 2QXLA 1R094 1HUXA 3JD4A 2OCCB 1M56C 5B3SC 1YAGA 3VGMA 4RW6A 4CFBA 3L2WA 1BMFG 4CERA 2G8UA 4YTMA 1ITGA 4GMJB 2RR14 3ETGA 3O9TA 4BVOA 5LMNK 5KA5A 1BCMA 5AQTA 3L72H 1TUEB 3SPHA 1HRHA 3IAYA 4A5BA 2RNBA 3CHXA 5BPMA 3A0BZ 4MVMA 4LFAB 3AVHA 1KAZA 3ZMTA 4FW2A 2YHAA 1NVPB 1X9WA 3ITHA 4LSLA 1CXUA 3E1YA 3TAQA 4JI4K 4BG9A 2OTLV 4KHYA 4JD2B 1L1FA 1GO3F 3ZRWA 2E74B 5CA1A 5JCOC 2YICA 3TXSA 1JLQA 3DOLA 4DV7K 1PVC4 3C6AA 4Z4IA 2R074 3OT7A 1HLUA 3NXSA 1F7YA 3CM5A 3NDKA 2G8VA 2AZ2A 2KFZA 3NFAA 1NM1A 2HKOA 4X1YA 3ZMUA 3CMEV 4CJKA 1QVGM 3VN5A 1FXXA 4I7ZB 3TABA 1NA1D 1QHTA 1GN3A 2QJ1A 4I4TB 3V9UA 4TT3G 5LA6A 2ZM6O 5EK0A 4NXMO 4JI1B 4E19A 1JCHA 3EEQA 2BCCH 1SS3A 5B1AB 4WCEV 2UXDB 2YI8A 5AQGA 4DQ8A 4DR4K 4CIEA 1RTIA 3VBBA 2OPPA 2DPNA 4BE2A 5FNVA 1WSHA 4OO1J 2QTOA 3HPLC 4PA3A 1AR74 1QS4A 3FAVA 2IJKA 4MVUA 3C65A 4O4JA 3DYAA 3KLGA 3I8BA 3VQEA 4BRKA 2YUAA 4CGDA 2JGDA 3MXJA 4Q4W4 2HFEC 4ASUG 3F9KA 4M7YA 2DQ0A 1Y74B 3HKCB 4BRMA 4UVAA 4XEIA 1LWEA 5AQLA 3VQQA 3ZSQA 4FLYA 4K0KK 2IU3A 4O4JB 1W0JG 1BL8A 1BIUA 4BRGA 4PELA 4UCSA 3OJSA 3OEHG 4BE1A 4LP8A 3LP2A 3BEHA 4UV8A 1I3AA 1RCHA 5F1XA 4O5FA 4I9LA 3RYHB 3BF1A 2GUZB 4JI2K 2WDRA 5IYDO 1PL0A 1IO2A 1R6NA 2DN9A 5IJ0A 3ZSWA 4E7LA 4G28B 1ESVA 4XH5A 1WA8A 1NENA 4BR9A 3JD2A 1L0LH 1Q43A 3LDOA 3VQ9A 1AVMA 2EIKB 4WYBA 5KMGA 4OVLA 4CI6A 2JEUA 1GN2A 3TAEA 3NF7A 2XNDG 1L3TA 1N36K 5KTQA 3L4QA 2DJVA 3GQKA 4CJ4A 2YXYA 2OCHA 4FFBB 4DR1B 2IJJA 3OS0A 4LF4K 1NLVA 2HVKC 1N34B 1C6VA 4AM6A 3NH1A 2PYJA 3CWBH 4LF5B 5BY1A 1H2LA 3EXAA 2XO7A 1SL1A 4LF4B 1BGXT 4DV3O 4FK2A 3U11A 3TXQA 2Q73A 4H0VB 3UKUB 3M3ZA 1F21A 4B1UB 4EFHA 1Q9YA 4UVBA 3VEXA 2N05A 3HVRA 2LGWA 5FRNA 4M3YA 3CYOA 1AR64 2R9IA 3T1YB 3O5BA 4BGBA 3W7UA 4U3JB 3RSEA 1S3XA 5FPOA 3ASMA 3ZCMA 5KPTA 1H2GA 3HKDB 4ISGA 4JRPA 5BMVA 2RPIA 5DMRA 3UB5A 4X1KA 1L0VA 2F66C 2A3QA 1FKOA 2DYSB 1COWG 2P9PA 4JK9A 4GLXA 1XNRO 1BQ0A 4I55B 5JCOA 4B3MB 3VRAA 1NTZH 4B9SA 4AQYB 3HKDA 1H2NA 2HHHB 3P4SA 4YJ2A 3E8FA 5CA3A 3ZT0A 4R79A 4FWKA 4E2LA 3WG7B 4DQRA 2WSSG 4X66O 1EV14 3ZHSA 3AGRA 4FZYA 5GW7A 3E9OA 2ZKOA 1L3SA 1N33K 3DLEA 2YHBA 3OYIA 2GWJA 4DFJA 3AA3A 2O8DB 3S41A 2EBOA 1RVF4 2XY8A 4F3OA 3F7YC 3AARA 3RW0A 2GTSA 5LYJB 1VQ8V 3I33A 1W2BM 3RBZA 1LAWA 2HNZA 3L2UA 4YSYA 3JATA 4DUZB 4JN4A 3QESA 1OOPD 2NNWA 2Q8VA 4AI8A 2GUPA 4C1NK 1KFDA 2QTDA 5AFUH 1EN6A 3DC6A 1YXBA 1O1WA 1H2MA 3AAQA 5DM7L 1UOCA 3THVA 2UUAK 2DFHA 4CIFA 5IYCO 4D6TH 3H1JH 4JI0O 3LANA 4DSKA 3KWGA 2DFFA 4WQ5A 4B1VA 4IYIA 2D4WA 5AQKA 3TAPA 2HBLA 1NGBA 4MVOA 2ARHA 4DWIA 1GTOA 3CCLV 2NR5A 2GUIA 3LDQA 1SAZA 4GV3A 2VG6A 1QSSA 1E4GT 2WLJA 5B1OA 3P31A 2O57A 2YEVB 2W41A 3MEGA 3ENBA 1LWCA 4LF6B 2KG7B 4BRQA 1RDWX 1RTDA 3A8YA 5BRFA 4GKKO 3LDNA 1Y64A 4J9YB 4CJWA 4U3JA 3CRCA 4DLGA 1MNGA 1YCIA 2E6LA 3MWTA 4B3TO 2GELA 3H01A 1NGIA 1UA0A 2LW1A 1S5HC 3RWRD 4DLEA 3ZEDA 1MWMA 4NXMB 2ZM6B 1GN4A 3VR8A 3LDDA 4FK0A 5BZBA 1FAFA 3N4QA 1LOTB 2QWPB 3GWKC 3W7TA 2RM24 3ULEB 4I50B 3ZEUB 4JEPA 3P4PA 5KX5A 4O0IA 1D4M4 4MW3A 3DRSA 1DTOA 1VRTA 3LP1A 3NF6A 1ZWIC 2FXUA 4QPJA 2BTOA 1S1VA 3T4DA 1I5XA 2Z1HA 3K9AA 3WUHA 3OYMA 2RS34 2E4LA 3ML0A 4DSEA 1SL2A 4KHNA 3NMUA 2I5JA 3H3NO 1BQMA 1YI2V 2LO1A 4X1KB 5GADP 2EIJC 2QE7G 1HDJA 1B9FA 1EWRA 5KAFZ 2GBZA 4CECA 4DR6B 3DXRB 3VR9A 4I55A 3LUTB 3B2EE 5E79Z 4ZOLA 4CZMA 3DLGA 4FLXA 4N56A 1R0AA 4DQPA 4HUFA 1XOUA 4YOXA 3OUFA 4BR4A 4DHYA 3L74H 1L5UA 1FW6A 2E2OA 4E4EA 1ZBHA 3DLBA 3B8AX 5BRHA 4Y0WA 1JLAA 4GX5A 3FAVB 5KQ8A 5IJ0B 4CHOA 3K9SA 2QM7A 4WBNA 3LP0A 5IJ9A 1JX9A 3SBTA 1NNEA 2IH1C 5AQWA 3O4NA 2Q0RA 3V1OA 3CPEA 3ABKC 1KAYA 4ABMA 4CGFA 2Q3SA 4Z1MG 3TWHA 1VQ6N 4M3WA 1N34K 3EVKA 2ZR3A 1JJ2M 4QE7A 2HOEA 4U3FH 5JICA 4UY8O 3VERA 1G6UA 3VA3A 4DF8A 1GKFA 3TSUA 4YY3B 1HNWK 3GQHA 4RG8A 3G67A 4DV7O 4IJNA 1AI5A 4AM7A 3HOSA 1N5YA 3E8HA 2P06A 4EFEA 5FPMA 5ITZA 1NG9A 3ZIAG 3CF5L 3QEXA 2PI4A 5C10A 1WAJA 2YJFA 3EKSA 4FJNA 4H0OA 3H1HH 1IKVA 3P30A 3FLCO 2Q9LA 4IT5A 4DR2O 3ISNC 1VBE4 2V51B 5EU7A 4U67L 1UJWB 4KHPK 3OMAB 1VSKA 5H6QA 4NCBA 3MHSC 2EIKC 5KHHA 4DV0O 1IBKO 1N33B 1OHHG 4YIPA 4JI3B 1NOZA 3D36A 4RW9A 2XASA 2X5ID 2PY5A 5JS2A 1ZBLA 3ULEA 3ZEUA 2FC0A 2YEVA 3RMCA 3A5NC 1C0TA 1Z6RA 5AQNA 4DU3A 4DR4O 4BROA 4P30A 3JAWA 3ZSZA 3KD5E 2Q36A 5IWAK 3QG5A 2VWJA 2D0BA 4X65K 4IIJA 3NE6A 3J81N 1YXQA 3UKUA 3K5OA 5AZJA 4JKDA 4LFBO 4OX9K 3FFIA 3CRQA 3N2KA 4X62O 1FXKA 4B9LA 4QCLA 1BCCH 1BCOA 4QAGA 3NHGA 2W6IG 1RT1A 2UUCK 3SJBC 4BR2A 3O65A 4DR5O 2OANA 4FSVA 4YTNA 2IBZH 1IKYA 3SPYA 1NGCA 4BIUA 3OTOB 4BDZA 4FJXA 3A0HZ 4IO9L 2OTJN 3X2QB 4CE9A 3L71H 3V81A 1Q8IA 3CC2N 4F2SA 3T1YK 4X20A 2CTPA 1NJXA 3ZSOA 3EFFK 1MA9B 3AA2A 5C8YB 4BR0A 2K1EA 1UA1A 1WOQA 1MA1A 4CZFA 3NF9A 5AR0A 2ASOA 4FWQA 3VPZA 3SYQA 2JGUA 4AH9A 1YI2N 3U4LA 2FB5A 4FVMA 1C1AA 3OAAG 5L3BA 2EWSA 3LZIA 1TVKA 3E8BA 3ZSVA 2QXFA 3E9LA 2Q7HA 4BRCA 3OGIB 1RMU4 5GTHZ 2AXTZ 3B40A 3M8QA 2WLLB 1YVUA 3FZLA 1R084 1NK0A 3SYCA 3TCUA 1EWQA 1VBC4 4YJ3B 1WP7A 4J2EA 4H0XB 5L3CA 1N36O 5F0XA 5GINA 2F93B 4NLCA 5TKWA 4JASA 1IH7A 1Y74A 1VQ7V 1BL3A 1KFYA 2E5LK 5EZYA 2IAJA 5M1FA 3E9PA 3ZX6A 2IGIA 5HL7L 4CBWA 1COV4 1RUE4 2W42A 4CZEA 4FPAA 1T03A 3AE4A 1NK7A 3SPIA 3WNFA 1C1CA 1B6QA 1S5LZ 4PHZA 4CJUA 2WWWA 2NN4A 1XEQA 3AG3B 3HKBA 1FXKC 5M1NA 4JV5O 1X9MA 3WNEA 5JLFA 3GWOA 4KI6A 2VRZA 1K3EA 3VGLA 4JI6K 1D9FA 2HVJC 5IT9O 4NTXA 3P38A 3AGKA 4N5SA 5KMGB 1RT5A 3K9JA 4PL7A 1M5IA 3TAFA 4GY2B 5JVGL 3MN6A 4LFBB 3ALYA 3TAGA 2VQFK 4NXMK 3M6GA 3UIQA 2WAMA 2L6LA 4GYCB 1RTHA 2YNGA 1SQVH 4I9WA 5EBLC 4JI7B 1L8DA 1VQ5N 4DR4B 2ATKC 1ASUA 3CPWM 1LV5A 3M8AA 4PDMA 1JL2A 2NLJC 4NYFA 4WFNL 4NYKA 3CERA 3KZBA 4FIPC 5C8YA 5J2TA 1VQPV 3H1VX 3ENHA 2LFSA 3CB2A 4BIOA 4BR7A 3M1FA 1AJPA 3K08A 4DG1A 1S3JA 3OEEG 4PDVA 2P9SB 1ASVA 3CXCU 3RMDA 3BGRA 1JJOA 2IM9A 2UXCB 1RGIA 4F4KA 1LWFA 1TVKB 3BZCA 3SBGA 5TKYA 3CCRV 1NTKH 2YIAA 2YHYA 4JKHA 5IY5B 2ITCC 2G8FA 1S1UA 1K73O 1GLJO 1JLBA 1TUUA 3WQUA 3PUFA 3U9DA 5FROA 3VETA 2RHKA 1JR9A 2Y0PA 4B1WB 2O4IA 2O8FA 3OYDA 1OCZC 4YSXA 2WPDG 2Q0UA 2CE4A 1WB8A 3JSLA 5J2UB 4GW6A 3KLIA 4CHYA 4BG8A 4H03B 4YOVA 2G38A 3CJCA 2QW9A 1QU7A 3TTCA 5J1EA 1Y67A 1PNLA 5JJJB 3K5LA 5TISZ 3OYAA 4WE1A 4FXDA 1Z5WA 3RRGA 2M6YA 4JI6B 1PNKA 1BHAA 1VQMN 2RMU4 2JGDB 4LD0A 4F8RA 4ZI7A 1NGHA 5LP6B 1WLJA 1UAXA 4FZ0A 4MTGA 1ZLZA 2ZWHA 1IURA 3KZIZ 3STZC 2NRZA 2GHYA 4E89A 3NVMA 2I7NA 3CXHF 3G6EN 3CJHB 3APQA 3DTUB 3NVKA 3FZHA 1RBTA 4DV3K 4QJFB 2E5LB 5CZ2A 4H5RA 4DR7B 3T1HK 3T69A 1D8YA 3AO3A 5HRPA 3OFNG 2UUBO 1FKPA 4F9OA 2D5RA 1HNZB 3CJHA 4BWAA 4GT1A 4CGJA 1KC8O 4LWSB 1MG1A 2VG7A 4DW0A 3OYJA 3MN7A 3ZHRA 4CF1A 3LPUA 4FLUA 1ZAUA 5L3DA 1OCOC 5H1SQ 1W7AA 1VEWA 4IG0A 2HWC4 4WFAL 2YX6A 1Q90D 4TV9A 4W5RA 4JKGA 1FKAO 3G0ZA 3PO5A 5CBHA 3BPZA 3CC7V 4KV8A 4ILHA 3JD74 4DR6O 4MVRA 3S3WA 4B3RB 2YNFA 1JLGA 4IKFA 2ZXWC 5K14A 1BE3H 1RT2A 4CGHA 4FM2A 3W7XA 4IO8A 3TARA 3HKEA 1MWKA 1P4RA 4X20B 3ZMZA 1YJNV 1GOAA 4LH6A 4HTLA 4I2QA 4PDWD 1XWLA 4K43A 5AQRA 2OA8A 4LF8K 4RWTA 3I5DA 4Q20A 3ABKB 4H0YB 3IC9A 4LNUA 3NGIA 3ZSRA 2A40A 3QF7A 5KI6A 3L2VA 1L3VA 3VQ6A 4LF7O 1CXQA 4B3SB 2B5JA 1KVCA 1QQNA 4CJSA 3BY5A 1Q82W 1M56B 5B3SB 2H8PC 4DS5A 1DGSA 2CTWA 3DGEA 4CGGA 3HP6A 5J2UA 2ITGA 4H0PA 2CH7B 3P83D 3SUPA 2NRXA 4LNUB 4PKIA 2V52B 1KAXA 3OJUA 4OPAA 2FBYA 1KUQA 2QI2A 3N4PA 1AP6A 4QS8A 4I9QA 1VQMV 4O2BB 3ASOB 3HJFA 1PO14 3AG1C 3A0IX 3DAWA 1NKDA 2F23A 4CZZA 3N2GA 1S6PA 5H2FZ 4GCZA 1VQKN 4OLBA 2WLIA 1RM1C 1Q7YO 1KLMA 3QEVA 5AQOA 2HHXA 2XHBA 2W0XA 3HPGA 5J9PC 4DUYB 4JKEA 2LW7A 1XQ8A 1BQZA 5AQQA 3Q7CA 1S5JA 4DKWA 4DV6K 2P9LA 1UFIA 3I55N 2QWQB 5H9CA 3WB0A 4DV5O 1QHAA 1BS3A 3H6EA 4QS9A 2B76A 1IBKK 3BUZB 3UT5A 1KYOF 4DRXA 3KLEA 5EY4A 5LA6B 1Y4MA 3VQ4A 3U0ZA 1JLEA 3APOA 4W4LA 4TOIA 1YDXA 3TJTA 4Z4EA 5CMUA 2QEXN 2F1MA 1BGYH 3JCZA 3O9RA 1N0JA 1KBHA 2Y1JA 2QK9A 5C0YA 4UCTA 3UT5B 3JAKB 2GV9A 3CJ1A 2FSJA 1AR4A 3JASA 1GLCG 4KH6A 4B3MO 1NEKA 2QKKA 1YIJV 1GLFO 5AQYA 1RT7A 1IKWA 4X62K 1PO24 4JI8O 1M57B 1P49A 3HKBB 3G10A 5IDJA 3AG4B 4AHTA 1NZ6A 1E79G 1E3MA 5FPEA 5AQIA 2HJFC 3CCQN 1U45A 2IS3A 1RSOB 2P4KA 3ZX3A 1RP3B 2Q7GA 4A62A 5CA0A 4JAUA 2FKXA 2G8HA 1WSFA 4MTXA 1H8TD 3WB2A 2KKWA 4I0XB 1ZL8B 4CESA 1TKTA 4CCHA 4KHWA 3EN9A 1RFYA 1G8MA 4JPRA 5KHJA 2WLHA 4FOEA 4HWIA 1XMOO 4BGAA 1BG3A 2LJ2A 4CEBA 3O3FA 4B9MA 4HCCA 4QIWF 1OVQA 4J2DA 2WONA 3ZSXA 4E1NA 4X64K 4N76A 3K0DA 3OUSA 1S0VA 4O2BA 5JH7B 4BRHA 2CAZC 1IX9A 3W7SA 3T3FA 4K8ZA 4KXRA 2OTJV 1S9GA 3QO9A 1ZYQA 2W0FC 3LDEA 3K3WA 2R7FA 4LF5O 1NGAA 4K8XA 4Z1VA 4BAYA 4WFBV 1N34O 2BE2A 2FSNA 1RDUA 3DC5A 3ETQA 4PKGA 3SAHA 1MSWD 1K9MW 2OCCC 1AR1B 4JKAA 2O8CB 1V9PA 4JAVA 1HNWO 4LF6K 1FPOA 4JF3A 4UXNA 4ILJA 4ZOLB 3ZN0A 4E7JA 1G4YB 2A1RA 4YHHO 1R73A 4RW7A 2QA4N 3HPHA 4Q0BA 4JYBA 4B9QA 3FYIB 1TYQB 3RYFA 1SKWA 5CHIA 1AI6A 4X1YB 1YITV 1OCZB 3SUOA 4RW4A 3LWLA 1EAH4 4OPJA 4WBNB 1VBD4 3WB1A 3JSMA 4ZHQB 3G71V 3QBWA 2ZJRL 2QM8A 1YJWV 5BR9A 5EX5A 3HR0A 5AZIB 4W4KA 4AHVA 4DW1A 5JMVA 3BEXA 3AE8A 3AE1A 2RE2A 1J5EK 2EIMC 3C7NA 4F2RA 1VQ4V 4NXNB 2HHUA 2XAFA 3AE7A 4KL1A 4DTRA 2WU5A 3CG7A 5J2MA 3ZETA 4FPPA 2D0PA 1ENVA 4J7KA 2UXDO 1TL1A 5CYQA 3D2EA 5KPZA 1RSOA 1W0KG 4IXCA 4KHUA 3VEOA 2UUAO 3NGZA 4LFBK 1JVMA 3SPJA 2E1YA 1LUVA 2A6AA 4L3QA 4Z4HA 4HUEA 1LNQA 2ITDC 4DR3O 1JMKC 4ICGA 4YSZA 4EB6B 2WP9A 3JASB 3MCPA 3CFPA 2CTQA 2D0OA 1IJJA 2P4VA 3ATUA 1WSGA 4KREA 2B9ZA 1RBRA 4R7CA 3CCSV 3ABMC 4EEQA 3R3LA 5GAGP 1KXPA 1RUC4 2CGNA 1UWBA 3D2FA 3H1IH 3DXKA 2HBMA 4G2KA 2O8BB 4IL6Z 1EX4A 3CCMV 3O9QA 4B1XB 3CC7N 1WP8A 2P9UB 4GVEA 4B3TK 4GV9A 4OKEA 2AJQA 3E22A 1BISA 4YFUA 1VARA 3WEEA 3CPWU 2LSNA 1VQNN 2QWLA 3QIPA 1XDCA 1B04A 4CS3A 5KRTA 4JK7A 4DSFA 2E20A 4X8AA 1EP4A 3VQPA 3T7ZA 2E5LO 2Q7EA 1R59O 3CE2A 4AHRA 3AEFA 1K4DC 2P9KA 3AVAA 4IWVA 5JLHA 1S72N 2W40A 4DTJA 2CH6A 4FK5C 1XREA 3BZKA 1BA1A 2QWQA 2DQ3A 4J9ZB 4DK0A 4LFAO 1IBLK 4F4LA 2PZSA 2HEPA 3T1HO 3DJCA 4HNAB 4BC3A 3ULDA 3U8XA 2HMIA 3MX5A 3ABVA 3AEAA 4M63C 1KRPA 2VWKA 3CCJV 1IG8A 3G6EV 3CI5A 3JSNA 3AK3A 1N32B 3VGKA 2UXXA 3BFRA 1A5XA 4JI6O 1RT4A 3BP8A 3SJHA 3VQ8A 1NS1A 3BDPA 5IJ9B 2AA4A 1Q9XA 5C93A 1JCEA 4CHZA 2P9PB 3LPTA 2R7YA 1NBMG 2YC0A 5KAIZ 2VGMA 1T44A 4DR6K 2F4VK 1CEZA 3ZHUA 1Q81O 1X59A 3SV3A 4CEOA 2YI1A 3PO4A 2QSAA 1T5EA 3J7YP 1HYSA 3AEEA 1NGFA 1ZBUA 3CM6A 3D36C 2XUMA 3K59A 3FD9A 5E1AC 1OV9A 2UXCO 1JCFA 2D1KA 3VQCA 4CJ3A 4ZKIA 2ZE7A 3H1QA 1EQYA 1RBSA 3ZT1A 2XY5A 1YQ4A 4N23A 3P32A 1GOBA 4KHSA 1E1QG 4KHPB 5GIOA 1MZEA 1KFSA 1FFXB 3H3OB 3O80A 1RILA 4LF7K 4Z4CA 3QFUA 4JAAA 3CYMA 2Z1IA 3P3PA 2Q4PA 4G1QA 2H94A 4TUYB 4J11A 1HJRA 1NK8A 2PI5A 1C0FA 3DI6A 4YDUC 4CZKA 3DXMB 3QICA 3CMAN 3WEEB 4YY3K 1ZXOA 3Q4HB 4DV0K 1GM8A 4KAZA 3JS6A 5HRNA 3RFRA 2E2PA 1I94O 4BREA 4CK3A 4X65O 3TPQA 2CGLA 4NO7A 3WQTA 2EIJB 2WC9A 2UU9K 5LY3A 2BANA 4DV1B 4OX9O 3MK6A 1YZBA 2DWEC 5IY5C 4CZIA 1B06A 4IOCL 3IDHA 3RYIA 4MVQA 4DV5K 4TSXA 4EZ9A 2DYRB 1ZUQA 2UUAB 2F9WA 3P39A 1TYQA 3EYZA 2V7QG 1Y76A 4DR5K 4YDUA 5J2QA 3PX0A 1IBMB 5KUKA 3CCRN 2FTKA 4OPKA 4DXWA 5FPDA 4C8KA 1X3NA 3K2PA 4JI5O 3OHRA 4CEQA 4KTQA 3QO5A 3CC4V 3JYTA 4MS2A 1T6DA 4DR3B 4H5NA 5IYZA 1RUJ4 3A5LC 3JALA 4MDBA 1A32A 4Z0UA 4W5QA 1SZXA 2QDOA 3N2KB 5LOVA 1RFQA 3B77A 4I6MA 1H8EG 3UKRB 1D5AA 3AEDA 2R9RB 3G4SV 1X3MA 1LCUA 3E86A 4EP5A 4BWJA 4NB4A 3V9WA 2P67A 1POV0 4H5TA 3JALB 2VG5A 4MLHA 2WOMA 5I3UA 3JYCA 2ZT9B 2OTLN 4H8KA 4Q6GA 4DRXB 3SYZA 3MXIA 4EAHD 5MLCQ 3L3VA 2W6JG 1OCRC 2H3GX 3FZKA 4AHCA 3ABLC 2BUPA 4CJVA 2BOCC 3C7NB 4JKFA 3OR6C 2M7WA 3CS5A 4FZ1A 4CHPA 2YIBD 4FJHA 1VF6C 3HO1A 3T1CA 3D2EB 4B1YB 4A2AA 4KRFA 3ABMB 1J6ZA 4PDLA 3ZHTA 1VQPN 1XMQO 4H4MA 2G8WA 1N32K 1AR84 4LR3A 1P84F 4TQDA 3S3NA 5A9GA 2NNUA 1HNWB 4O55A 1Z2GA 3CCQV 1G15A 5BREA 1NJYA 2IC3A 4DS4A 1Z25A 4MTOA 4CHNA 2OYQA 4KI4A 3SNNA 2BTFA 4FL9A 2QGNA 4BC5A 2JRIA 1D2DA 4JKBA 1N8RO 2OWOA 4CVNE 1TAEA 3TK1A 2VQFO 3TSQA 3NH0A 4DV0B 4O4IB 3AK1A 2P9IA 3FFKB 5BRDA 4JTCB 5HP1A 3DXMA 2VCPA 4LFCB 5LMNO 1WPXA 1XL4A 2CK3G 1CZ9A 3NR7A 4BRDA 3SAFA 4DV6B 3J80O 3WXKA 4DTOA 3VQAA 5K1XA 3AK2A 1WSJA 4J41A 3OBWA 1GAXA 5GIPA 3DLLL 4O4IA 3LWMA 2NRHA 1WN7A 3VF6A 1AR5A 1JJ2U 1TK0A 2HMPA 4MVZA 1JLFA 4KH4A 2DY4A 1P7GA 3OMNB 4IFVA 4Z4GA 2PUSA 3SAGA 4H44B 4FJLA 3M8RA 1B3QA 3RVCA 3SUQA 2N04A 1QZ6A 4KTZA 4CC6A 1HJOA 3CEIA 1ZP0A 3ABLB 3O9SA 2Q5ZA 3PV8A 3G6BA 5LHIA 3L73H 5GAHP 1NJIO 4J42A 1QBZA 5B66Z 1VF6A 2E3CA 2NZTA 1SZTA 4F3TA 1B9DA 4BDPA 1MOFA 3EZWA 4IJAA 4W5OA 3SGIA 2HF3A 4B3MK 4JYCA 3K06A 4ISEA 5HOOA 3EZ5A 4FJKA 3S3XA 2RQ6A 3F5WC 4LF8B 1VBB4 5EC2C 1BT8A 2MK3A 1KC8W 1DK1A 5KUMA 1HXS4 2DWDC 1QQOA 5AFUA 4WCEL 3QNEA 3THWA 3AG3C 1VQ7N 3O4WA 3B8MA 3U6FA 2X6CA 3PN1A 1PD3A 5I42A 4I2PA 1QSLA 1NU0A 3THXA 4ISFA 4DV5B 5LXTA 2Q2RA 4TUYA 3CIPA 4GX1A 1KB9F 1G99A 3VOVA 4B9VA 3F7VC 2LP7A 2JVDA 4FWNA 1WNSA 3NH2A 4IEIA 2EX3A 3C6HA 4IGGA 4B8AB 1F4MA 3ICXA 3LNMB 3RMBA 1HNIA 4X64O 4WFHA 1OH6A 1JL1A 5LXTB 3ZT2A 1Y6XA 1YHQN 1R6KA 1WB9A 1J5OA 3NF8A 3CJAA 5FLXN 4FZXC 4CGIA 5C3JA 3QIOA 1JKHA 3AG4C 2GUZA 1KD1W 3IJ4A 2WFBA 4D7TA 4DR7K 1WBBA 4B3TB 3MD0A 3KCYA 2WA4A 1WA8B 4FWOA 3OW2U 4FWPA 4PKHA 4UB8Z 1Q82O 1D5NA 2QWNB 4EZ6A 2O8DA 4GNIA 4I0XA 3QEWA 4DUZK 1Q86O 3NCIA 4PV1B 4LF6O 1HPMA 1OKJA 5GONB 2V4DA 1SA0B 4B3SO 3LM2A 3STLC 2FLOA 4UV9A 1XBLA 1WJZA 1PNMA 4X64B 2PLV4 3VF2A 3W3DA 4K0KB 4CF0A 4GV6A 3QINA 3NBPA 4DTMA 3QO7A 4LF8O 2GX9A 1N8RW 1M93A 2AHYA 1T05A 4YXWG 1K8AO 1GLEG 3OA9A 2F8TA 1GN6A 1VRUA 1NK5A 1NQTA 2UUBB 4NR1A 4KX6A 3PIOL 1UPGA 3OTFA 3JBG4 5M1OA 3AEGA 1LR1A 2IJIA 1CXZB 3OYGA 5H5NA 3IS9A 2UXDK 1VQKV 2GDSA 2P22C 4FFBA 3SPZA 3AEIA 5JVDB 5DM6V 3CETA 4DSIA 1XHZA 4I4TA 2ASMA 2QM1A 3DSQA 3KVGA 1ASJ4 3R65A 2P9LB 3QBXA 3H46O 1XNRK 1EETA 1C0GA 5F2VO 2P9SA 1GLAG 2YNHA 2Y0IA 4YJ2B 3C3TA 5GTIZ 2KLAA 3AVCA 3QMLA 3FE1A 1H8HG 3E83A 1KMIZ 5M1PA 1NOYA 4DTPA 5JQGA 4X66B 5KHKA 4DV6O 4RQEA 2A1SA 4R5PA 3NGYA 4JZGA 3HB3B 4BRNA 2EULA 3GE1A 4KO0A 2WQYA 4CJPA 2XAQA 1NKCA 4FLZA 2BSKB 3V1RA 2OIGA 2Q97A 3F9MA 3KKRA 3QERA 1O9HA 5KX5B 4X88A 3SPCA 1D9DA 4IHJB 1VQ4N 2AP1A 3HOTA 4CFDA 1HKCA 4M3ZA 1BSMA 2ZD1A 3J81O 4NLBA 5BR8B 1HKGA 3B09A 2JIZG 1WAFA 1KVAA 4LFCO 5LP6A 4RQFA 1V4TA 3EE8A 4O2AA 3CQ8A 2P9NA 4E3SA 2RKIA 1SERA 1SKVA 3M8PA 4J2AA 2YKNA 3EY1A 2VQEK 2A79B 1HQEA 3H1KH 3OVNA 2BOBC 1MABG 3WNHA 4ZTFA 1QR9A 4HTUA 2ZNJA 3KD1E 4JI7O 3DXKB 4ID5A 3BAAA 5DN6G 3IGAC 3LSQA 2ITMA 1JLCA 1ZBIA 2X0LA 3ZJZA 2XAGA 5SWMA 2QWMA 3GG4A 1GMGA 1R3IC 3AO2A 3O1BA 1TKXA 4DU1A 2QA4V 1U04A 3CRAA 3AO1A 1R6TA 1YJ9V 4CS2A 1XMOK 1SA0A 3MHHC 3U10A 4GKKK 4YTPA 2RCVA 5KLVH 3JCUZ 1JXBA 1M9NA 3SUCA 2HP8A 3RYIB 3OW2M 1TV6A 1VSEA 1IDSA 4FMTA 4C7UA 4YOTA 3FZMA 1MZFA 3SQ1A 4RHV4 3AV9A 5EOYA 4CJFA 3CCUN 4B3RK 1Y76B 1IG9A 1SQGA 1JPXA 2JJ2G 2KSDA 4JI5B 4DV4O 3ZT4A 4TQFA 2R72A 1SQKA 2XY7A 4P9OA 4UUJC 2DW4A 1VSIA 3L9DA 1ILYA 4C8LA 1QR8A 1DKGD 3OTOK 1IVSA 1VQ8N 4FJIA 1PM9A 2FSKA 3RYFB 3IG1A 2WA3A 1OCCC 4HUGA 2FL4A 5A2QN 4JV5B 3PIPL 4EFBA 1ZBSA 3D45A 5JVDA 4UCRA 1QSYA 2F8SA 4PDRA 3KIOA 4F6RA 1KKCA 4IDKA 1K4CC 4X65B 5F2RA 5JH7A 4ICLA 5AQVA 3DRRA 3ZRXA 4FZZA 1Q6IA 1I94B 3L0QA 3O8MA 4PUOA 3MEEA 2ZE8A 4J8FA 1OH5A 1F4NA 3IFRA 5IT9N 2IVNA 2D0AA 5AQMA 1T3VA 1GH6A 4AHUA 2HR3A 4CEZA 3FFQA 4O4GA 4DCHA 2PYLA 1N6QA 4L8JA 1FXHA 3FYEB 3HKCA 3A5OC 1ATSA 3FGUA 3A2FA 3ID6A 4OPHA 1RUH4 3BA9A 2RJZA 5SZTA 4EKWA 3OYHA 4NCAA 4PA6A 1Y97A 4W5TA 1QLEC 1ROPA 4H4OA 1TVRA 4DU4A 2OIEA 4TV8B 2EIMB 5EYPB 1AJNA 3QO8A 3RR8A 1E1RG 5LGUA 4CFCA 3LDLA 4ELVA 1URFA 2UXNA 4PJ0Z 4GX0A 3KK2A 1VF5B 1AL24 2Y69B 4FJGA 2VS0A 5LGNA 4LCUC 1HNVA 3SI6A 2CGOA 2NRTA 3AAPA 1LW2A 1J53A 3WU2Z 3G80A 2X6AA 3ID8A 3UE5A 2P9NB 4MFBA 3K5NA 4ZIBA 1LW0A 3JAMO 2Q31A 1US6A 2B1GA 2Y4UA 3BF3A 2WDVA 4JI5K 3FB5C 1MQTD 2O4GA 1IBMK 3AY9A 4O5BA 4B9TA 1I0HA 1YTAA 4IDHA 2Q6AA 4DR5B 5JS1A 4J80A 5HRSA 2JEXA 2EZPA 3L3UA 4KHPO 5AG2A 1A5VA 3R9PA 3SLCA 3KG2A 4FJJA 3C6TA 1QNMA 1YF2A 1KSPA 1TK5A 1KP2A 1HNXK 4KHQA 3VEYA 4DR2B 1FXVA 4B7KA 3I55V 1IXBA 2DTUA 1QLNA 1H2SB 3ZHVA 2ATQA 1NT2B 4MQ3A 1PPJH 1RBVA 3QLHA 4I7FA 1AILA 1YTFB 2VWBA 2YCHA 1QVGU 3J7AP 4HCBA 3C95A 2ODMA 5BMVB 1WBDA 3QB0A 5HRRA 4JI4B 4CF8A 4WF9L 2E6MA 4L8RB 1NU1H 2IIRA 4LF9O 2HSTA 4GKJO 1NR7A 3P4IA 4O0JA 3PX4A 4A61A 4J10A 1VQOV 2UUCO 2HHTA 3RYCB 3LALA 3ZRWB 1AI4A 4K25A 3HM9A 2ZE2A 5LHGA 2A7WA 3DRPA 5LL6Z 1SUQA 4RUFA 1N32O 2ADPA 3SQ2A 3PSFA 3QNOA 1TUBB 1QCEA 1RUD4 4K41A 4IIJB 3T2MA 1SC5B 2JS5A 3AA5X 4BRAA 3CRMA 3HP9A 4RUEA 4DV2K 3SJAC 1J9AA 4C8MA 3BHPA 1LUWA 5J2TB 3RRHA 2ILMA 5E41A 3EE9A 5AQZA 5BXZA 1SETA 2X6BA 3BCCH 5EYPA 5CB4B 3VESA 4YOWA 3HK2A 4MLEA 1AROP 4WFFA 4JAXA 3L2QA 4B3SK 1IKXA 4OGCA 1PV0A 3EHBB 3QDKA 3OYFA 2H3OA 1BA0A 1NKEA 4QOZB 3LDSA 4ZI7B 3G25A 4X66K 4ILGB 4BWMA 3DXRA 3RYHA 1Q6HA 2CUGA 5EXWA 3DLHA 2UXCK 4PA1A 4KP4A 2F7TA 3O1WA 2AW9A 4ZHQA 4DMNA 4JHDB 1S1WA 2E2QA 4J7JA 1WSIA 4CEEA 1OZ0A 4ZBMA 3GDQA 3LM9A 3ZMSA 1SQBH 3WT0A 3RTVA 2FYUH 4IFEA 2EINC 1M1KO 4FJ9A 1YTUA 2YIDA 4YOYA 4Q4V4 2HLDG 1FJGO 3KLHA 1BUPA 3SMPA 5KPRA 4FO0A 4G9ZA 3RN4A 5AJ3K 5M1KA 2E75B 1G1XB 4FLWA 3CCMN 1ZBFA 1Z05A 1S1TA 1QQCA 5L3GA 1R3KC 3ZYYX 1HX1A 3FX7A 3CC2V 4DYLA 4Y1CA 3KKYA 4CZLA 2BTQA 2YS8A 3I0SA 5CE3A 3AE5A 2WDQA 2V1DA 2HW3A 1WAZA 3V1QA 3AA4A 3TSPA 4JTDB 2HWB4 2IW5A 2I7PA 1XI1A 4JNEA 1SF9A 1VIBA 5ITZB 3SYAA 2BGGA 1FD9A 4FLVA 2BH1A 3D0PA 4BIZA 3AVLA 5AZJB 3CQXA 4CK2A 3F73A 4WFAV 4JI0B 4FJCC 1YUWA 1RUG4 5B1BC 3IRXA 2E76B 1HYZA 4ID1A 2OZMA 1I5YA 3OYNA 4AQYK 3LNNA 2Q1NA 2HHHK 4PWDA 4F6RB 3CC4N 3SYOA 1TUBA 2Q0AA 1GLDG 2PW9A 4QS7A 3ASNC 1DF4A 4DFKA 3C3SA 4O4LB 1MDUB 5BR8K 3OS2A 3E89A 3MMVA 3JAWB 2UXBO 3CCVN 1HRI4 2HJDA 4YHHB 1K8KB 4IZ9A 3I56V 2IOCA 4LH7A 2R044 4C8NA 3WXMB 2D3OW 2RN2A 5D5QA 3SZ2A 4B08A 1SQXH 2P6JA 3P3NA 1NH2D 3HRGA 2KW4A 5E26A 3ZS8C 2VQEO 1RBUA 2W6KA 3CX5F 4B3OA 2Z1JA 2GTAA 1SV5A 3LZJA 4M7XA 4MDAA 4DUZO 2OPRA 1V54C 2WU2A 1HWYA 2Y48A 2DE0X 3MAQA 3DWLA 2A06H 3H9VA 4BR6A 5LBQA 2KQXA 4JHDA 4CJ7A 2ZE5A 3HT3A 2X78A 4CJ5A 4CH3A 2A0LA 1GM7A 3KK3A 5J2NA 1XNRB 4BC4A 2CGKA 1DLBA 3I8DA 3LDCA 4HHTA 4CH4A 4WF9V 4JLHA 2D2CB 4M41A 3RWUA 3PLAA 2OT5A 5C12A 1XMOB 3IC7A 3TGUH 3W0LA 4BW9A 2P90A 4BY9C 3V9ZA 1W97L 5CR4A 4B8CA 4M3TA 3OM3B 4FVUA 2ZINA 3N2GB 5B1BB 3VQ7A 4MTFA 4PD4F 3ZT3A 1YJ9N 1F23A 1ATRA 1Z26A 3AE6A 4IYHA 2QWNA 4LY7A 5FDLA 4A2BA 4XDKA 1ATNA 1XNQO 4NYNA 3BY6A 2ETJA 1HP8A 5GONA 3SYPA 2VQEB 3J7AU 4FPBA 4BRFA 1VMGA 2OZSA 2G8KA 3D7EO 4CJLA 4EB6A 2VGNA 4JTAB 2F96A 1VBA4 3TAMA 3PY8A 3UO2A 2JWKA 3KJVA 1U97A 3AG1B 4BRLA 1GM9A 4N21A 3UO3A 3ZMVA 2FF6A 3NAEA 3ASNB 4X89A 4CBCA 3FB7C 1HPZA 1R3LC 1FXKB 3WFVA 4YIOA 5AQXA 4JYYA 3OYLA 2GSMB 4XDLA 1KKDA 2YKMA 2YV0X 3OD4A 4KBOA 5EVZA 2QWRB 2FBXA 3M5RA 2KB1A 3AG7A 3OMIB 5KHIA 1H1VA 3MECA 2LGQA 2DOSA 3AG2B 1QVFU 5EIBD 1DLOA 2A42A 3AVJA 4CF9A 4DV1K 5KHGA 2JK5C 4H5VA 3H45C 4JS4A 1VQLN 3DLKA 3THYB 4PI0A 4G27B 3OBYA 3SUNA 2OPQA 1KLNA 3HKEB 2RMKB 1GLBG 3ZN1A 4DTXA 2JS3A 4BQZA 4MSWC 4CEDA 5JQGB 2AZ0A 4CZJA 4FJ5A 3J8F4 4IFYA 3THOA 4CK1A 3DLRA 1K5SA 2ZR2A 3SJQC 2P1JA 3ZX0A 4RO2A 4E7IA 4O8UA 3K03A 2CDYA 3UM7A 1RDAA 1KD1O 3TETA 3VF4A 3M8SA 1SKRA 3ABTA 1FJGB 2Q0OC 3V9SA 4FOIA 2Q67A 2QR4A 1VQ6V 4LH4A 3U3GA 4OXSA 3OYEA 1IBMO 2HVHA 1DTQA 2EJ7A 4UQGA 4LF7B 5ADXH 1T6CA 4OJRA 4WQ4A 1EZVH 4X1IB 1NH2B 5LOVB 4I6MB 1RNHA 3JARB 3UKRA 3VEWA 3WNGA 4B1ZA 5FLXO 3OY9A 4XIUA 1K34A 4UCUA 2H89A 5ADXA 4XH1A 2KTQA 1NR1A 2ZE6A 3MXMA 5AZIA 2QKAA 4J7ZA 4YT0A 4DUYK 3TANA 2X7RB 2WS3A 3TI0A 2PTMA 4X1IA 4U7NA 3DM2A 1HR0B 1SQFA 1HNZO 3KKSA 5BPNA 1PKXA 4LH5A 3FB6C 4P2ZA 2R064 1K8AW 3FKSG 1YTFD 4B3RO 1K7DA 1M57C 1WUAA 4M3RA 1DT9A 2ZDIA 3PX6A 4JYAK 4DR7O 4DV4K 1BOTO 1P7BA 1ZX3A 3IUCA 4J2BA 1X9JA 3AE9A 4GKJK 3CD6N 1OH8A 2ASPA 3CHWA 4JI8K 2KZMA 3CJ7A 4H0TB 3ETDA 1YEWA 3QETA 1I39A 3K58A 1S1XA 3CFRA 1XUQA 3P5JA 2A9HA 3D3QA 1JXEA 1HW7A 1TGOA 1SRYA 4JV5K 1OH7A 4TWKA 1ORQC 2EJRA 3MDSA 1JQ0A 3C94A 3KLFA 2UU9B 1N4CA 3CP1A 3JD3A 4HZ3A 1NJWA 2A5XA 1ZL8A 4HVJA 4O4LA 4EHTA 1S77D 2YHXA 2GEMA 3AG2C 1TAUA 4DV2O 2P5GA 1L3UA 2YSUB 3TTDA 3AVBA 3O4QA 2KFNA 2HNDA 2UYTA 1EBOA 2A3ZA 1OCCB 3AECA 1MU2A 1NMDA 1NVPD 1VHXA 3T4ZA 4LF9B 2F95B 1R1BA 3PSIA 4KUMA 4DR1K 5FL7G 3AE2A 4TV9B 1IXMA 1JFFA 3WXLA 4JS5A 3S9HA 1XUPO 1O13A 1NWKA 4FJMA 3SQ0A 3VOUA 3L70H 3A0RA 1K33A 1B92A 3CFOA 5C2FA 4YXDA 3PJSK 1JFFB 3LSSA 1KQSM 2QKBA 1RUF4 3VRBA 4AILC 5I9EB 4I50A 4FK4A 4OKKA 5AQHA 5EBWC 1U47A 3ABUA 4CJEA 5KGXA 4GKJB 1NMNA 2QM4A 2RS14 3SJCC 1MSDA 2LQTA 2QWOB 3VQYA 1S6QA 4JI4O 3GOIA 2YXLA 3DMJA 3THYA 3P4RA 1KF6A 3BRCA 1TAQA 3CCEV 3IFXA 3OS1A 3QTCA 3MEDA 4X9QA 1M90O 4KB0A 4BC2A 1WB7A 1ZTEA 4ZTJA 3KCXA 1L0NH 3J8AA 3FB8C 2C2AA 5CB4A 3CJ9A 5EZYB 4JD2A 3E8GA 5C2DA 2F4VB 5KQDA 2O8EB 4O4HB 4ZHRA 5C25A 3CCSN 4FYDA 1Q81W 4I5SA 2ZJPL 4E7HA 2P9KB 3LAMA 1OCRB 1HNXO 4FWMA 3CCLN 5HLFA 4CH5A 2ACZA 1CLQA 3KHYA 3MX2A 2WLLA 3CMEN 1BHBA 1BDGA 2O8EA 1AB3A 1J5EO 4H33A 3JARA 4PA7A 1H2KA 1NJIW 5BN9A 1YIJN 3ZHQA 3CMAV 1VSJA 4LFCK 4KTWA 4FFKA 3VQ5A 3RMAA 4E1JA 2QKCA 3ETEA 4JI1K 2PBDA 4U7BA 3EL2A 3THXB 2DYSC 2IVOA 4LF9K 1Q5OA 2V7YA 5IE9A 1J54A 3C90A 1LAVA 2CGJA 1VSDA 4W5NA 3J7ZO 1C0MA 1PL4A 2EILC 4TSFG 4K42A 2ZDIC 4H37A 4NB5A 1U48A 3VTIA 4QGPA 2IH3C 4NCGA 2ZJQL 1CP9A 2XAJA 3SJJA 1ZOYA 2HNYA 4DK1A 4GX2A 4RW8A 1M4UA 2N74A 4CBXA 3O08A 3JAKA 5AQUA 4M3UA 4BRIA 1VSHA 1K6YA 1V55C 1P90A 4WFBL 1V54B 2KG7A 4JI2O 3CCJN 3Q4HA 3RR7A 4KH5A 4NKGB 1GRJA 3UQ8A 4MT8A 1NK6A 3AEBA 3EO3A 4A5AA 3I56N 3O3GA 2RS54 1Z5VA 3CSXA 3SQ4A 2AGAA 4NXNO 2R70A 4DV4B 5EIBC 2KQ2A 2ZF5O 4N47A 5T7BA 3E22B 3LSUA 1NGJA 4CJTA 4BACA 2OPSA 3AE3A 1KVBA 5EC1C 3T19A 1YSCA 4RCHA 5C42A 2QWOA 3HSTB 4MW8A 3RSEB 1I08A 4A57A 1K92A 2QWPA 3CCEN 3OTOO 5AQSA 4RWUA 2YJEA 3ZX2A 1EN5A 1HYVA 1KP3A 1NI8A 4PA9A 5L3FA 2EHGA 2FF3B 1K8KA 3M7MX 5LJWA 3OYKA 5C15A 5C2TA 1KCFA 4O4HA 1VQLV 1NBWA 3ZBHA 3K9KA 4HNAA 1S76D 5J2PA 1RDBA 2WLNA 1XL6A 1VF7A 1RTJA 3F2KA 4CIGA 1HKBA 2NLXA 2ZCEA 1J95A 3HI0A 2KHOA 3FI7A 1REVA 1FJGK 4XBFA 5LP6C 1FS0G 1QTMA 4L87A 2CH7A 1BO5O 1FYJA 3ATVA 2XOKG 5CA1B 3KWIA 3QNNA 1J5EB 5HROA 2EILB 1VQ5V 1YJWN 2ZNIA 1BZKA 4M42A 1AI7A 4GZRB 1BU6O 4K35A 2Y4TA 3AVKA 4BVPA 3VEZA 4WFGA 4ELUA 2XY6A 1YQ3A 1NK4A 1YT3A 4M45A 1KECA 4TV8A 4X62B 5FPRA 1SS6A 2P7TC 2F4VO 2HHVA 1W2BU 1M90W 2KZZA 3SDLA 1HMVA 1GLLO 1P8ZA 1JOYA 1Q18A 1IBLB 1EZJA 2X6NA 4UCVA 4LWSA 3FZFA 5IYBO 4FWSA 4KPYA 4U7OA 1NTMH 5CBFA 1TKZA 1A5WA 4DV7B 3VEVA 4OKJA 2Y1IA 4PHTX 4JI3O 1IBKB 1QLEB 3GVMA 1N33O 3SMSA 4QE9A 5ELZA 4PA4A 2RDCA 2Z3YA 3AVIA 3HPOA 4CF2A 1FFXA 3VQVA 1YVWA 1OVYA 4JGSA 3B6OA 5DM6L 3VQDA 1SQPH 3DOKA 1NK9A 3GL1A 1MMMA 5BR8O 4LC9B 3SR2C 3D8CA 4LSNA 4XH4A 4IOXA 2Z1GA 3O3HA 1Z7S4 3KTQA 2W6LA 1K5QA 2BTQB 4O2AB 3R1XA 2RN9A 4JI8B 1VK0A 3AO5A 2O8BA 4KKOA 4YY3O 4DTSA 2PF4E 4E0DA 4OGQB 4K3AA 4MO5A 4E1MA 3BA8A 1U6ZA 5LMUK 4JI0K 5IWAB 1VQNV 3RT3C 3K57A 1KTQA 3ZRSA 3HL8A 3L4IA 3I0RA 4A5UB 3G71N 2WLKA
chains in the Genus database with same CATH topology
1SL0A 1O9GA 3AVFA 1BI4A 3RYCA 1W0HA 4DSJA 1T7PA 4NVPA 4FLTA 5CYMA 4CC5A 3RGBA 1BI4B 3SV4A 1W9HA 1RT6A 3AVNA 4ELTA 2NUBA 4B9UA 1TKDA 1BHLA 4GKKB 4CJQA 4E7KA 3T1AA 4PI2A 3P1GA 4DQQA 1WPBA 1X9SA 3H08A 5D3GA 4DTUA 2FBTA 3HXMA 5DK5A 4CJRA 5JJEB 4IG3A 3AVGA 4GVMA 1VSFA 2IDOA 1RDCA 4CEFA 4FM1A 1I7FA 4OGEA 2HHQA 2B6AA 4AHSA 3E01A 1EKEA 1FK9A 4N41A 1GOCA 1DTTA 4DQSA 4C8OA 1X1PA 3V6DA 3OYCA 1BQNA 5K1PA 1XNQB 2YI9A 3AO4A 2YNIA 5C24A 4FJ8A 2ZIMA 4HBNA 1RT3A 5KRSA 2VQFB 4DV3B 1BIZA 4IBNA 4DFPA 1KU9A 3B6PA 3L2RA 3VA0A 3HVTA 4DQIA 5HBMA 3K5MA 4OLAA 5CY4A 4JRQA 3BABA 5LMNB 1S9EA 1VSLA 4FJ7A 3V4IA 3VQBA 4Q5VA 5KGWA 1QE1A 5FRMA 1RDDA 1XHXA 1U4BA 4UCOA 4M3XA 2P5OA 2HHSA 3V9XA 4YNQA 1CZBA 1XMQB 3S3MA 3TR8A 2UXBB 2HHWA 4PY5A 3VQWA 4PQUA 5LYJA 4YJ3A 4DSLA 1NKBA 3C6UA 2R9AA 3VQXA 2PGGA 3QEPA 2P51A 1EXQA 4D7SA 4UFZA 2XRIA 3SCXA 4CH6A 1ASWA 3AVMA 4BE0A 1TK8A 1X4TA 2BDPA 1N36B 4BDYA 4OX9B 2X6SA 1C1BA 4CFAA 1HQUA 2X74A 2D0CA 5IYZB 2FBVA 4CHQA 4JI2B 4O44A 5JJNB 4B9NA 4DF4A 3LAKA 4FW1A 4DTNA 3OYBA 2HVIA 1XC9A 4Y1DA 1T8EA 2ZIOA 2HB5A 4KB1A 3U3YA 4CEAA 3HYFA 1TL3A 2B4JA 4KFBA 4IHJA 4DFMA 2G8IA 3ZSYA 2JLEA 5D5PA 1C0UA 2RF2A 2ZQBA 1WSEA 4EP4A 5CZ1A 4Z4FA 4CS4A 1NJZA 1HNXB 1VSMA 3QEIA 3JATB 1Q3EA 4FCYA 3KK1A 2DFEA 2UUCB 5FNVB 1U49A 5CA0B 3S3OA 4JYAB 1SKSA 4FM0A 3T1HB 2YIBA 3LP3A 5LMUB 1TA8A 4DV2B 3L2WA 4RW6A 4CFBA 4CERA 2G8UA 1ITGA 4GMJB 1BCMA 1HRHA 3IAYA 3CHXA 4LFAB 3AVHA 4FW2A 2YHAA 1X9WA 3ITHA 4LSLA 1CXUA 3TAQA 4KHYA 5JCOC 1JLQA 5CA1A 3DOLA 4Z4IA 3CM5A 2KFZA 2G8VA 3NDKA 3NFAA 4X1YA 4CJKA 3VN5A 1FXXA 3TABA 1QHTA 2QJ1A 4I4TB 3V9UA 5LA6A 4JI1B 4E19A 2UXDB 2YI8A 4CIEA 1RTIA 2OPPA 4BE2A 5FNVA 1WSHA 1QS4A 4O4JA 3DYAA 3KLGA 3VQEA 4CGDA 3MXJA 3F9KA 3HKCB 3VQQA 1LWEA 3ZSQA 4FLYA 4O4JB 1BIUA 3OJSA 4UCSA 4BE1A 3LP2A 1RCHA 1I3AA 4I9LA 3RYHB 1IO2A 3ZSWA 5IJ0A 4E7LA 1Q43A 3VQ9A 5KMGA 4OVLA 3TAEA 3NF7A 1L3TA 5KTQA 4CJ4A 4FFBB 4DR1B 3OS0A 3NH1A 1N34B 1C6VA 2PYJA 4LF5B 1SL1A 2XO7A 4LF4B 1BGXT 4FK2A 3U11A 1F21A 1Q9YA 3HVRA 5FRNA 4M3YA 3T1YB 4U3JB 5FPOA 3ASMA 3ZCMA 3HKDB 4JRPA 5BMVA 2RPIA 5DMRA 4X1KA 2F66C 1FKOA 4GLXA 4I55B 5JCOA 4B3MB 4B9SA 4AQYB 3HKDA 2HHHB 4YJ2A 3ZT0A 4DQRA 4FZYA 1L3SA 3DLEA 2YHBA 3OYIA 4DFJA 3AA3A 2XY8A 4F3OA 5LYJB 1LAWA 2HNZA 3L2UA 3JATA 4DUZB 3QESA 1KFDA 1O1WA 1UOCA 3THVA 2DFHA 4CIFA 3LANA 4DSKA 2DFFA 3TAPA 4DWIA 2GUIA 2VG6A 1QSSA 3MEGA 1LWCA 4LF6B 1RTDA 4CJWA 4U3JA 4DLGA 2E6LA 1UA0A 3RWRD 4DLEA 3ZEDA 4NXMB 2ZM6B 4FK0A 4I50B 5KX5A 4O0IA 3DRSA 1VRTA 3NF6A 3LP1A 2BTOA 1S1VA 2Z1HA 3OYMA 2E4LA 4DSEA 1SL2A 4KHNA 2I5JA 1BQMA 4X1KB 1B9FA 2GBZA 4CECA 4DR6B 4I55A 3B2EE 4ZOLA 3DLGA 4FLXA 4N56A 1R0AA 4DQPA 4HUFA 1L5UA 1ZBHA 3DLBA 1JLAA 5IJ0B 4CHOA 4WBNA 3LP0A 5IJ9A 3O4NA 3V1OA 4CGFA 2Q3SA 3TWHA 4M3WA 4DF8A 1G6UA 3VA3A 4YY3B 4RG8A 1N5YA 4EFEA 5ITZA 3QEXA 1WAJA 4FJNA 1IKVA 3ISNC 5EU7A 1VSKA 4NCBA 5KHHA 1N33B 4JI3B 1NOZA 4RW9A 2PY5A 5JS2A 1ZBLA 2FC0A 3RMCA 1C0TA 4DU3A 3JAWA 3ZSZA 3KD5E 3QG5A 2VWJA 2D0BA 4IIJA 3NE6A 3K5OA 3FFIA 3N2KA 4B9LA 4QCLA 1BCOA 4QAGA 3NHGA 1RT1A 3SJBC 1IKYA 3SPYA 4BDZA 3OTOB 4FJXA 4CE9A 3V81A 1Q8IA 4F2SA 4X20A 1NJXA 3ZSOA 3AA2A 5C8YB 1UA1A 3NF9A 2JGUA 4AH9A 1C1AA 4FVMA 3LZIA 1TVKA 3ZSVA 2QXFA 2Q7HA 3M8QA 1YVUA 1NK0A 4YJ3B 4J2EA 2F93B 1IH7A 1BL3A 5EZYA 2IAJA 2IGIA 2W42A 1T03A 1NK7A 3WNFA 1C1CA 4PHZA 4CJUA 3HKBA 1X9MA 3WNEA 4KI6A 1D9FA 4N5SA 5KMGB 1RT5A 1M5IA 3TAFA 4LFBB 3ALYA 3TAGA 3UIQA 4GYCB 1RTHA 2YNGA 4JI7B 1L8DA 4DR4B 1ASUA 1LV5A 1JL2A 4NYFA 5C8YA 5J2TA 3CB2A 4DG1A 1ASVA 3RMDA 3BGRA 1JJOA 2IM9A 2UXCB 4F4KA 1LWFA 1TVKB 2YIAA 2G8FA 1S1UA 1JLBA 3PUFA 5FROA 2O4IA 3OYDA 3JSLA 5J2UB 4GW6A 3KLIA 4CHYA 5J1EA 5JJJB 3OYAA 3K5LA 4FXDA 4WE1A 1Z5WA 3RRGA 4JI6B 4LD0A 4ZI7A 1WLJA 5LP6B 1UAXA 4E89A 1RBTA 2E5LB 5CZ2A 4DR7B 1D8YA 3AO3A 5HRPA 1FKPA 2D5RA 1HNZB 4BWAA 4CGJA 2VG7A 3OYJA 4CF1A 3LPUA 4FLUA 1ZAUA 4IG0A 4TV9A 4W5RA 3G0ZA 3PO5A 3BPZA 4KV8A 4B3RB 2YNFA 1JLGA 4IKFA 5K14A 1RT2A 4CGHA 4FM2A 3TARA 3HKEA 4X20B 1GOAA 4LH6A 4I2QA 1XWLA 2OA8A 4LNUA 3NGIA 3ZSRA 3QF7A 5KI6A 3L2VA 1L3VA 3VQ6A 1CXQA 4B3SB 2B5JA 1KVCA 4CJSA 4DS5A 1DGSA 4CGGA 3HP6A 5J2UA 2ITGA 3P83D 3SUPA 4LNUB 3OJUA 2FBYA 4I9QA 4O2BB 3HJFA 1S6PA 3N2GA 4OLBA 2HHXA 1KLMA 3QEVA 2XHBA 3HPGA 4DUYB 1XQ8A 1S5JA 3WB0A 3UT5A 4DRXA 3KLEA 5LA6B 3VQ4A 3U0ZA 1JLEA 4TOIA 4Z4EA 2F1MA 2Y1JA 2QK9A 4UCTA 3UT5B 3JAKB 2GV9A 3JASA 2QKKA 1RT7A 1IKWA 1P49A 3HKBB 3G10A 4AHTA 1U45A 2IS3A 2Q7GA 5CA0A 2G8HA 1WSFA 3WB2A 2KKWA 4CESA 1TKTA 4CCHA 4KHWA 5KHJA 4CEBA 3O3FA 4B9MA 4HCCA 4J2DA 2WONA 3ZSXA 4E1NA 4N76A 4O2BA 5JH7B 2CAZC 3T3FA 4K8ZA 1S9GA 3QO9A 1ZYQA 2R7FA 4K8XA 2BE2A 3ETQA 1V9PA 4E7JA 4ZOLB 2A1RA 4RW7A 4Q0BA 3HPHA 3RYFA 1SKWA 4X1YB 3SUOA 4RW4A 3LWLA 4OPJA 4WBNB 3WB1A 3JSMA 4ZHQB 4AHVA 4F2RA 4NXNB 2HHUA 4KL1A 4DTRA 3CG7A 5J2MA 5CYQA 1TL1A 1RSOA 4KHUA 4Z4HA 4HUEA 1JMKC 4EB6B 3JASB 3CFPA 1WSGA 4KREA 1RBRA 4EEQA 1UWBA 1EX4A 4OKEA 2AJQA 3E22A 1BISA 4YFUA 2LSNA 3QIPA 1B04A 4CS3A 5KRTA 4DSFA 1EP4A 3VQPA 2Q7EA 4AHRA 3AVAA 4DTJA 4DK0A 2PZSA 2HEPA 3ULDA 2HMIA 4HNAB 1KRPA 2VWKA 3JSNA 1N32B 1RT4A 1A5XA 3VQ8A 3BDPA 5IJ9B 1Q9XA 4CHZA 3LPTA 2R7YA 3SV3A 4CEOA 3PO4A 1T5EA 1HYSA 1ZBUA 3CM6A 3K59A 4CJ3A 3VQCA 3ZT1A 1RBSA 2XY5A 1GOBA 4KHSA 4KHPB 1KFSA 1FFXB 1RILA 4Z4CA 3CYMA 2Z1IA 4G1QA 4TUYB 1HJRA 1NK8A 3DI6A 4KAZA 5HRNA 3RFRA 4CK3A 2BANA 4DV1B 3RYIA 4TSXA 4EZ9A 2UUAB 3EYZA 5J2QA 3PX0A 1IBMB 4OPKA 4C8KA 3K2PA 4CEQA 4KTQA 3JYTA 4DR3B 5IYZA 3JALA 4Z0UA 4W5QA 5LOVA 3N2KB 1D5AA 4EP5A 4BWJA 3V9WA 3JALB 2VG5A 2WOMA 5I3UA 4H8KA 4Q6GA 4DRXB 3SYZA 3MXIA 3L3VA 4AHCA 4CJVA 4CHPA 2YIBD 4FJHA 3HO1A 4KRFA 2G8WA 4H4MA 4LR3A 4TQDA 3S3NA 1HNWB 4O55A 1NJYA 1G15A 2IC3A 4DS4A 1Z25A 4CHNA 2OYQA 4KI4A 3SNNA 2OWOA 1TAEA 3NH0A 4DV0B 4O4IB 5HP1A 4LFCB 1CZ9A 4FJ5A 4DV6B 4DTOA 3VQAA 5K1XA 1WSJA 4O4IA 3LWMA 1WN7A 1TK0A 1JLFA 2DY4A 4IFVA 4Z4GA 2PUSA 4FJLA 3M8RA 3SUQA 4KTZA 4CC6A 3PV8A 2E3CA 4F3TA 1B9DA 4BDPA 4W5OA 3SGIA 3EZ5A 4FJKA 2RQ6A 4LF8B 3U6FA 3PN1A 5I42A 4I2PA 1QSLA 4DV5B 5LXTA 4TUYA 4B9VA 2JVDA 1WNSA 3NH2A 2EX3A 4B8AB 3ICXA 3RMBA 1HNIA 1JL1A 5LXTB 3ZT2A 1J5OA 3NF8A 4FZXC 4CGIA 3QIOA 1JKHA 4D7TA 4B3TB 4EZ6A 3QEWA 3NCIA 5GONB 2V4DA 1SA0B 4X64B 4CF0A 4K0KB 3QINA 3NBPA 4DTMA 1M93A 1T05A 2F8TA 1VRUA 1NK5A 2UUBB 3OTFA 3OYGA 3IS9A 2P22C 4FFBA 3SPZA 5JVDB 4DSIA 1XHZA 4I4TA 3DSQA 1EETA 2YNHA 3AVCA 4YJ2B 1NOYA 1KMIZ 4DTPA 5JQGA 4X66B 5KHKA 2A1SA 4R5PA 3NGYA 4KO0A 4CJPA 1NKCA 4FLZA 3V1RA 3KKRA 3QERA 1O9HA 5KX5B 1D9DA 4IHJB 4CFDA 4M3ZA 2ZD1A 5BR8B 1WAFA 1KVAA 5LP6A 4O2AA 3CQ8A 4E3SA 2RKIA 1SKVA 3M8PA 4J2AA 2YKNA 3EY1A 1HQEA 3OVNA 3WNHA 4ZTFA 4HTUA 2ZNJA 3KD1E 4ID5A 3BAAA 1ZBIA 1JLCA 5SWMA 3AO2A 1TKXA 4DU1A 1U04A 3AO1A 4CS2A 1SA0A 3U10A 1JXBA 3RYIB 1TV6A 1VSEA 3SQ1A 3AV9A 4CJFA 1IG9A 1SQGA 4JI5B 3ZT4A