1XI1A

Phi29 dna polymerase ssdna complex, monoclinic crystal form
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
publication title Correction of X-ray intensities from single crystals containing lattice-translocation defects
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
total genus 147
structure length 571
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xi1A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xi1A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xi1A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xi1A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xi1A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xi1A06
4AHUA 3V9ZA 3V9WA 2PYLA 5HP1A 2KZMA 1RBVA 1LAVA 1TKZA 4CGDA 1BIZA 1UWBA 3HT3A 2YNHA 3AVFA 1BHLA 5E41A 3ALYA 5C24A 1RBUA 1Y97A 1WLJA 4CHQA 4FLXA 4I9QA 2OPQA 4CGHA 4DU1A 3AO1A 3NGIA 1JLBA 1C1AA 1T05A 3VQ5A 3OJSA 1QHTA 1JLGA 4DTJA 1QSYA 2HNZA 4N76A 3OVNA 3OYAA 1XI1A 1VK0A 1NK4A 4H4OA 3VQ6A 4OVLA 3HSTB 1RDDA 2D5RA 3WNFA 1L3TA 4F2RA 3CG7A 1CLQA 4YFUA 3QEXA 1RILA 4AILC 3WNGA 1DTQA 4BWJA 4CHZA 4CFDA 2DFHA 2BE2A 2HHVA 2OPPA 4DWIA 4FJIA 1JL2A 4W5NA 4B8CA 3AVMA 2X6NA 2B6AA 5HRPA 3TARA 3FI7A 1SL0A 1QSLA 4CF8A 4KAZA 4FW1A 4RW9A 3RR8A 5KI6A 3SPYA 1VSEA 2P1JA 4B08A 1A5VA 4KV8A 4DFJA 3DLEA 5J2MA 2YNIA 1L5UA 4CE9A 4E19A 3OYJA 4B9UA 3K57A 3I0RA 4CJLA 1NK8A 3VQBA 1JLQA 3LZIA 1G15A 4CK2A 5KTQA 1KLNA 2PZSA 1KTQA 4CHPA 4HTUA 3V9SA 1TVRA 1KCFA 3AO5A 5HBMA 3K5LA 4B9VA 3MAQA 1IKYA 3KIOA 1BGXT 3KKSA 3L3UA 3WNEA 1DTTA 3EY1A 3C94A 1B9FA 3PY8A 4KREA 2PYJA 3AVHA 3AVNA 3M8QA 5K14A 4LD0A 3K5NA 3ZT2A 1WSIA 4HUEA 1L3SA 3QERA 1UA1A 4DMNA 3SUPA 4OKKA 3I0SA 4KTQA 4FJ8A 3OYNA 4OJRA 3OYKA 1RT4A 2DFFA 4Z4CA 4BDZA 4FZXC 5CZ2A 3ZSVA 3VQEA 3RRHA 1WN7A 2O4IA 3TAGA 4FLTA 3RMBA 3AO4A 4Z4IA 1F21A 3V1RA 4CJUA 4DFPA 3RR7A 1TGOA 2ETJA 4IG3A 3T1AA 3SYZA 1BCMA 3L2QA 2R7FA 1WSJA 3L2RA 4M45A 2OPRA 1YTUA 2Z1IA 4XIUA 4DFMA 4DTXA 3QETA 1S1XA 1X9MA 3MEDA 4DFKA 3SQ1A 3LP1A 4E89A 4FM2A 1RDCA 1WNSA 1HQUA 3OY9A 3OYCA 3B6PA 1Q9YA 4KHYA 2F8TA 1ZBFA 5HRSA 4LSLA 4KI4A 1VSMA 3DI6A 4NCAA 1RT7A 4W5QA 3V81A 1J53A 2IS3A 1S1TA 2FC0A 3ZCMA 1KVCA 3SUQA 4E3SA 4CESA 3S3OA 4FJNA 4DTNA 4OPJA 2ZQBA 4FJJA 2HNYA 3SPZA 4KO0A 4CEAA 4DF4A 1N6QA 1BIUA 1HNVA 3HVTA 3ZSRA 4E1MA 3SJJA 2NUBA 3CM6A 2HVIA 4FM0A 1QE1A 1W9HA 3O3HA 2F8SA 1NK7A 4M3TA 4LH4A 4KI6A 4HUGA 4CCHA 3P5JA 4CFAA 4MQ3A 1JXEA 1KFSA 1RCHA 3NGZA 1D5AA 4F4KA 4BACA 3M8SA 4Z4HA 2VWKA 1S9GA 3F9KA 2KZZA 2FBTA 3SV4A 1Z26A 2GUIA 2XY7A 1RBRA 1I3AA 3VQ7A 1SV5A 3B6OA 3T19A 4B3OA 3V9UA 3KLEA 3AA4A 1BQNA 1K6YA 4CJPA 3PV8A 1ZBIA 1ASVA 4Z0UA 4CIFA 2YNGA 4RW4A 3DMJA 3SZ2A 3O3FA 4J2DA 1IKVA 2VG6A 3OYEA 5CZ1A 3ZSZA 2F96A 3NE6A 3OYHA 4BWMA 1R0AA 3QEIA 1U48A 4QOZB 3ULDA 3VA3A 1U47A 3A2FA 3OYBA 4KHWA 2G8IA 4I2PA 5DK5A 2AJQA 4FJLA 3EZ5A 4KHNA 3NBPA 4DSFA 1SUQA 2HNDA 3LP3A 4DTSA 4ID5A 4FM1A 1BL3A 2PY5A 1RT1A 3NF7A 4CEDA 3OS0A 4ZTJA 4PQUA 4FZYA 3KKRA 3RTVA 3QESA 2XY5A 4PWDA 4CHNA 3ASMA 3TWHA 1GOAA 3O4QA 3V1OA 3VN5A 1NK0A 2P5GA 1XHZA 1SKRA 4W5RA 3AVGA 3OS2A 4OGEA 1J5OA 1HQEA 1GOCA 2IDOA 4M3RA 4NYFA 3KLFA 4DQQA 4EZ9A 3LALA 1TK8A 1NK6A 2G8HA 1IKXA 3D0PA 1WSHA 4DS4A 3PX6A 4OLAA 3O3GA 4HCBA 4O5BA 4C8MA 1VSFA 1ZYQA 3ITHA 3ZSXA 3HM9A 1C0UA 3TANA 2HB5A 4FJKA 3DLBA 4KFBA 4B9TA 5KGWA 4FCYA 5HRNA 4W5TA 3OYFA 4EZ6A 1NOZA 1EETA 3H08A 3ZSYA 4CGGA 1WSFA 4C8NA 1IH7A 4DLGA 1NJYA 1HYSA 5J2NA 1RT6A 2HVHA 4CIEA 1BCOA 1EKEA 3ZT1A 1ZBLA 1S6PA 2GBZA 3NH0A 1C0TA 4I7FA 3DOLA 1FXXA 1EXQA 2YKMA 3HPGA 2X78A 1Q8IA 4JS4A 1ITGA 4N5SA 2XY8A 4CF2A 4DTOA 4F3OA 2IOCA 1HMVA 1BI4B 1TKXA 4CERA 1XHXA 1VRUA 1O1WA 2O4GA 2HMIA 3PX4A 1TAUA 3SUNA 1FK9A 3ZSQA 1UAXA 3MXJA 2Y1JA 3LP2A 2IAJA 4DF8A 1XWLA 4UQGA 3L3VA 4O55A 4CGJA 3P1GA 1SKWA 1CZBA 3HL8A 2XRIA 1Z25A 4CJ3A 5SZTA 3SQ0A 1BQMA 1ZBHA 2VWJA 3KK3A 3I8DA 3LWLA 3NCIA 3NAEA 1ZBUA 3AVJA 4KKOA 2FBYA 4BDPA 2RF2A 3NH2A 4B9NA 1VSDA 3OYLA 4CHOA 1JLCA 3AA2A 1S5JA 4DSKA 4FJHA 3ZT4A 2WOMA 3KK2A 4LSNA 2KFZA 1RTIA 4AHSA 4CF1A 1S9EA 3DLGA 1RT2A 4FW2A 1S1WA 2OZMA 4CFCA 3CFRA 4QCLA 3SI6A 3C6TA 2ITGA 5FDLA 5C25A 4JRPA 4M42A 3OYIA 2W42A 3ZT3A 2XO7A 3QEPA 1HYZA 4ELVA 3SV3A 4GW6A 1RNHA 4Q5VA 3D45A 3VQQA 4FJXA 3MEEA 3VQPA 1TK5A 3L2VA 3HPOA 1EX4A 1VSJA 2XHBA 4CJFA 4E7KA 4CEQA 4CJ5A 3LZJA 3HJFA 1B92A 5KRSA 1IKWA 1RT5A 2BANA 4EP4A 4CK3A 4FK4A 1B9DA 2QXFA 4O0JA 3L2WA 1NJWA 3LWMA 4JS5A 3S3MA 4FJGA 2G8FA 1JL1A 4AH9A 3QIOA 4CGFA 1YVUA 2HHWA 4EP5A 2JLEA 3LPUA 2VG7A 2QKKA 2Z1HA 4CIGA 1WAFA 1NKCA 4Q0BA 3OYMA 4KB0A 1C6VA 2Q3SA 3SQ4A 2QKBA 1RTJA 5KRTA 1QTMA 3HK2A 4K8XA 4M3YA 1CZ9A 3KJVA 4FLUA 1NKEA 3NH1A 4KRFA 5J2PA 4FLZA 3TABA 4CF9A 4FZZA 3NFAA 1VSHA 4OLBA 3DOKA 4KB1A 1X1PA 4CECA 3QLHA 4DTUA 5FRNA 3AVKA 1UA0A 1U49A 1QSSA 3KD1E 1WAJA 4PY5A 4BE1A 2OA8A 1U04A 5HRRA 4CEOA 2Y1IA 3TAQA 3IAYA 1GOBA 3C6UA 2DFEA 3QIPA 4CJQA 1J9AA 4O4GA 4DSLA 4FLWA 2FBVA 4C8LA 2D0CA 4NYNA 4CJVA 1TKTA 3QINA 4ZTFA 4G1QA 1LW2A 4IFYA 3TI0A 3MXIA 3DLRA 3KLGA 5C42A 4B9MA 4JRQA 5KGXA 3LANA 3RMDA 1LWCA 1T03A 3EYZA 4J2AA 4I9LA 3AA5X 4M41A 4CEEA 3K5OA 1S1VA 4DSJA 5JS2A 2KW4A 4M3UA 4ICLA 4J2BA 2D0BA 3IS9A 4KPYA 4FYDA 3ZSOA 2I5JA 4N56A 3C95A 4F2SA 3IG1A 4RG8A 3TAMA 2OYQA 4C8OA 3S9HA 3LAKA 2HHXA 2DY4A 1HJRA 1VRTA 3AVCA 3AVIA 4WE1A 2ATQA 3DYAA 5CYMA 1XC9A 1L3UA 3PO5A 1DLOA 2OPSA 3AVBA 2G8VA 3KD5E 4K8ZA 1D9FA 4KHSA 2LSNA 3DM2A 1NK5A 2KFNA 3WNHA 1HPZA 3G0ZA 1U4BA 1CXUA 1LAWA 3LPTA 3UIQA 3VQDA 2GV9A 4KHQA 5I3UA 1D9DA 1KVAA 4IFVA 1NJZA 3K5MA 3LP0A 3PO4A 4DTMA 4DQIA 3IRXA 4RW8A 3AVLA 3SUOA 4CFBA 1QS4A 5T7BA 4OKEA 1A5XA 1SL2A 3HO1A 3ISNC 1ASWA 3OJUA 3DLHA 1FKOA 3M8PA 3PUFA 4Y1CA 2G8UA 1RBTA 4CJKA 4FVMA 1KSPA 4LY7A 5EU7A 4ELUA 4DU3A 1TAQA 1YT3A 1REVA 3RMCA 4M3XA 4QAGA 4CGIA 4FXDA 4RW6A 3NGYA 1IO2A 1S6QA 3QEVA 3VQ9A 4E7JA 4IKFA 1UOCA 1T8EA 3RRGA 1Q9XA 4DTRA 4MFBA 4PUOA 2HHQA 2DTUA 3VQCA 1A5WA 4AHRA 2HW3A 3BGRA 3T3FA 1VSIA 2B5JA 3V9XA 4IDKA 5D3GA 1RDBA 5SWMA 2BDPA 3ZT0A 4E0DA 1TL3A 1CXQA 4NCGA 4DG1A 3RMAA 1SL1A 1TL1A 1NJXA 5DMRA 4I2QA 4RW7A 4ZHRA 3QNOA 1I39A 4CJSA 4CJWA 3KLHA 2YKNA 1W0HA 1RTHA 1T7PA 4LH5A 4ID1A 4W5OA 1JXBA 3DRSA 2HHTA 3NF6A 2X6SA 3KLIA 1JLFA 2X74A 4KTWA 4HCCA 2KTQA 4BE2A 4FLVA 4FLYA 4GVMA 2P51A 3O4NA 1LWEA 4CEZA 2JGUA 3NF9A 2PW9A 1J54A 2Z1JA 4L8RB 3K58A 1RBSA 2IC3A 3AA3A 3ZSWA 2E6LA 3QNNA 2ZE2A 2B4JA 4IBNA 3TAEA 3PX0A 1JLEA 4M3WA 1FKPA 4HUFA 3QEWA 1VSLA 4JLHA 4CJ4A 3CFOA 3AO2A 3HPHA 3NF8A 2YHBA 3FFIA 4GMJB 4B9LA 3OYDA 3K59A 4F3TA 2HHUA 2HHSA 1YTAA 3F73A 3M8RA 4NCBA 2OZSA 3CYMA 4N41A 1D8YA 2QK9A 1WSEA 2RPIA 4IG0A 4TSXA 4KHUA 4FJ5A 3OYGA 4CJEA 3CQ8A 2D0AA 1JKHA 1RTDA 3SQ2A 4M3ZA 1S1UA 1ASUA 4DSIA 4AHVA 1WSGA 4CHYA 2WONA 2E4LA 4CEFA 3THVA 3DRPA 4CJRA 4E7LA 3V1QA 4H8KA 3RWUA 4CJTA 3HXMA 3DRRA 3AVAA 2A1RA 3MEGA 2R7YA 4DQSA 3KK1A 2YNFA 3SCXA 4OKJA 4FJMA 3L2UA 3CFPA 1LWFA 4FK0A 3LDSA 2G8WA 4O0IA 4DQPA 3L8BA 3BDPA 3QO9A 3V4IA 2G8KA 3HVRA 3SNNA 4CEBA 4B8AB 4J2EA 4BDYA 5FRMA 1KRPA 4KTZA 5HROA 1IG9A 1NKBA 5I42A 2P5OA 1HRHA 1HNIA 3HYFA 3HP6A 4FJ9A 3P83D 4DQRA 3G10A 3LAMA 4FJ7A 3HP9A 4ELTA 4CK1A 1TV6A 4DSEA 3S3NA 1RT3A 4Y1DA 3VA0A 3AV9A 5HLFA 4OGCA 1BISA 2YV0X 3E01A 3K2PA 1KFDA 4B9SA 4YNQA 4DTPA 1X9SA 4Z4EA 2YHAA 3TAFA 1SKSA 4C8KA 2IGIA 2ZD1A 2VG5A 1TK0A 1L3VA 2XY6A 1LV5A 3VQAA 2Z1GA 1LW0A 4R5PA 4AHCA 4DU4A 1KVBA 2E6MA 3U3YA 3TAPA 5J2QA 1C1BA 3MXMA 1BI4A 4O44A 3TR8A 1NOYA 4FK2A 5CY4A 1MU2A 4E7IA 1JLAA 4HHTA 3VQ4A 4F8RA 1KLMA 4PA1A 2KQ2A 5FROA 3JSMA 3U6FA 1X9WA 1TKDA 4DLEA 1U45A 1C1CA 4Z4GA 2EHGA 3MECA 1VSKA 4OPKA 1C0MA 3AO3A 3CM5A 3NDKA 3OS1A 4DS5A 3U3GA 1RDAA 5JS1A 2RN2A 3NHGA 5CYQA 3VQ8A 2A1SA 4CF0A 4E7HA 1QQCA 1EP4A 2EX3A 2FBXA 1NK9A 4Z4FA 4AHTA 2BGGA 3V6DA 3JYTA 4N47A 1HYVA 4HVJA 3KTQA 5J1EA 3DLKA 2RKIA 4H4MA 4E1NA 4BE0A 1N5YA
chains in the Genus database with same CATH superfamily
2QEXN 4UUJC 1WUAA 2Q1NA 4AHUA 5HP1A 4NXNB 4JI2O 1AP6A 2WLNA 4DV3K 3AVFA 5E41A 3HI0A 3GB7C 4I9QA 1VP7A 3AO1A 1JLBA 3NGIA 5C2TA 3VQ5A 4L3QA 2E20A 2RMKB 3OR7C 4H0VB 2YIDA 4N76A 3OYAA 3I5DA 1XI1A 4KH4A 4Q6GA 2D5RA 2B1GA 4F2RA 4KXRA 2NNUA 1V54C 2QWMA 4FWSA 1VBA4 2A42A 2UXCO 1RILA 1GKFA 3B09A 4J7ZA 4X89A 1DTQA 4BWJA 4A57A 1WPXA 4DKWA 2AA4A 4W5NA 3WXIA 2X6NA 2BH1A 2B6AA 4GZRB 4ZHQB 4G28B 1C0GA 3TTCA 5KPTA 4ZI7A 5C93A 1P84F 4X1KB 1GRJA 1TVKA 2OCEA 2Q36A 2RE2A 4FW1A 4EHUA 4YSYA 4B08A 4JAXA 2VGMA 5J2MA 2KSDA 2P9IB 1L5UA 4GX0A 1XNQB 1BQ0A 3OYJA 3K57A 3ZS8C 3E8GA 3VQBA 1VQLV 3SJBC 3JAKA 1QHAA 3TTFA 2YCHA 1G15A 5KTQA 3THOA 3P4SA 5AQFA 1KTQA 1I94K 4PDMA 1SRYA 1BUPA 5IYBO 3ZN0A 4LNUA 3C65A 2F66C 1BGXT 3KCYA 3KIOA 3KKSA 1DTTA 1RGIA 3L3UA 3M8QA 3ZT2A 5JMVA 3K5NA 2YHXA 1FJGK 2WA3A 4DMNA 3SUPA 2WA4A 3I0SA 1PPJH 3RBZA 3WXKA 4FZXC 3ZSVA 4K3AA 3WG7B 1H2KA 2ADQB 1PO14 4TSFG 3CXCM 4PD4F 3RSEB 3TAGA 3RMBA 4Z4IA 1H2SB 4M63C 4DFPA 1Q3EA 5EIBD 2ETJA 2OCHA 2Q7GA 4AI8A 1VQ9N 2HJDA 3F7VC 1AR94 2AHYA 3UQ8A 2Z1IA 1YJ9V 3CC7N 4U3JA 3SQ1A 1KECA 4NO7A 1WNSA 1EZVH 1ESVA 4CI6A 1DF5A 1EZJA 3SPJA 3UO2A 4I5SA 4H5RA 4LSLA 1Q9YA 2D1KA 4P9OA 2YIAA 4DV6B 1J53A 2IS3A 3IFRA 2X6AA 2YUAA 1S0VA 4BRKA 3SUQA 1VHXA 4O5FA 2JWKA 4O4HB 3DXMB 4FJNA 2WDRA 3P3PA 3QICA 3CCSN 1H8HG 3SPZA 4FPPA 1NH2D 4UB6Z 1EN4A 2GTDA 4CEAA 1X3MA 4DF4A 3RFRA 2P6JA 5LOVB 5FNVB 1K73W 3HVTA 2ILMA 2HVIA 4FM0A 1KB9F 1W9HA 1TUEB 2LJ2A 3K79A 4GYCB 4DR5B 2I7NA 4JI7O 2MW2B 3D2FA 3K9KA 1RUH4 2XASA 5B1BC 1IZ3A 5FPNA 4HUGA 3GQHA 2P9SA 4CFAA 1JXEA 4YIOA 4MTGA 2QM8A 1KUQA 1NGBA 1WA8B 4DV1O 2WWWA 4GV3A 2NRZA 3RN4A 3F9KA 1BE3H 3CCMN 4DV7B 4IGGA 2KZZA 2HWC4 4B3SB 4JI5O 1HWYA 3E22B 4MTXA 2YDEA 2CH5A 4U7BA 2XY7A 4MSWC 5KAFZ 3OBWA 5AZIB 2WP9A 2EZPA 3KLEA 3PV8A 4J7JA 1BQNA 2O8DB 3K3WA 5CN0A 1N32B 1TUYA 2W6JG 3THXB 4R79A 3O8MA 2A79B 2YNGA 2DN9A 3ZX3A 3A0HZ 1BU6O 3WB2A 3BABA 2UUAK 4BWMA 1U48A 2YEVB 3RYIB 1OV9A 4EIAA 2UXBB 4K35A 4KHWA 1K4DC 4EAHD 1T6CA 3EZ5A 3DXKB 3CB2A 1N34O 1SUQA 3LP3A 2DQ0A 1ZOYA 2WFBA 1BL3A 3CSXA 1R084 2YI9A 1N33K 2HWB4 4DR7B 1AJPA 1RT1A 3FZMA 3OS0A 3QBWA 3PJSK 1FFTB 3QESA 4ICGA 3A0BZ 4GKKO 1BA0A 4E2LA 2IM9A 4DR1K 2DYSB 2ZM6O 1MSWD 1GO3F 1MABG 4LCUC 3OS2A 1A32A 3HOTA 5KX5A 1O9HA 4XH1A 1NK6A 2DYRB 4J41A 1IKXA 1UFIA 4IYIA 1VAZA 1G4YB 2QTSA 1WSHA 4BRHA 3O3GA 4DS4A 4BC3A 1SS6A 3THWA 5CA0B 1AP5A 4WBNB 5EXWA 3ZSXA 5IY5C 3ZJZA 4FOEA 5LMUO 4DR6B 4U3FH 1VQKN 4BIOA 5KHKA 1OKJA 4B9TA 4YSZA 2BTQA 4I0XB 2RHKA 4W5TA 1SQVH 3SMSA 4GLXA 1NOZA 3PSIA 2BTOA 2XAQA 3SJAC 1JCFA 5EX5A 4C8NA 1J95A 5EYPA 3CQYA 1HYSA 3K0GA 2AZ0A 4Q4V4 4DR3B 2PI4A 1S6PA 3NH0A 4JI3K 3HB3B 1BOTO 1FXXA 3DOLA 3RYCA 3GOIA 1YJNN 1ITGA 1JQ0A 4CF2A 1QR9A 1Y64A 4NLCA 3WB1A 1HMVA 3DGEA 4BRAA 3C6AA 5GAHP 4NXNO 3LSUA 3ZSQA 3CRQA 1UAXA 3H1VX 2Y1JA 1R3JC 2Z0AA 4BRIA 2P9NB 3J80N 3L3VA 4UQGA 4DUYB 3EE8A 1Y67A 1SKWA 5KQ8A 4UV9A 1IXMA 4CJ3A 3SQ0A 1OH8A 5FPDA 2VWJA 1QLNA 1HRV4 3I55V 2ZNIA 3NAEA 3LDPA 2WDVA 4O4JA 1JCEA 2FBYA 1SA0B 3HKEB 1HX1A 2RF2A 3CCRN 1VSDA 1JFFA 3E2EA 1HNWB 1KBHA 4JK9A 4DV4K 1KP3A 1S5JA 4CC6A 3VOUA 3CCSV 2WOMA 3CERA 4LSNA 1RTIA 2R72A 3KZIZ 1N36B 3T1YO 3DJCA 3SK3A 3ZX2A 4IJAA 1P7BA 3FAVA 1NGJA 4QCLA 3SI6A 3D2EB 5FDLA 5C25A 4M42A 2QDOA 1GN2A 4WFFA 3TK1A 2V7ZA 4LF5B 3OYIA 2W42A 1MG1A 5CBGA 3MX5A 1IBMK 2LP7A 1WJZA 1HYZA 4ELVA 2BTFA 4HTLA 1QU7A 2F43G 1FD9A 1KC8O 2EJ7A 3WFVA 3LUTB 4WFGA 3CCMV 2KKWA 3VQPA 1ZL8A 5H6RA 1HLUA 1EX4A 2XHBA 1EWQA 3AE9A 1QZ5A 4CEQA 3LZJA 5KRSA 1IKWA 2BANA 4EP4A 4JYAK 1NTMH 4TQFA 1H2GA 3H1HH 1B9DA 3L2WA 4YJ3A 3LWMA 4JS5A 3S3MA 3B2EE 3OTOB 3L75H 4MVZA 4LF9K 1XMQO 2HBMA 2R70A 4UV8A 4ISEA 4CGFA 5BREA 2HHWA 5AQWA 2JLEA 2OIEA 2VG7A 1L1FA 4O4LA 2JS3A 2ZJQL 4CIGA 1KQSU 3ZHRA 1WAFA 1NKCA 2DW4A 2PAVA 4Q0BA 1M56C 3OYMA 1XMOB 3ABKC 3L72H 2Q3SA 4X20B 5EBMC 3L9DA 5KRTA 3LSQA 1GLJO 5AQTA 3R3LA 3WXLA 4LF7B 1HKGA 3NH1A 2UU9B 4FLZA 4CF9A 4AQYO 3NFAA 1VSHA 1B04A 4JI4K 2L6LA 3QLHA 4DTUA 4LF4K 3IC7A 3DC6A 3KD1E 2QWOA 1Q81O 1HR0O 4ZKIA 1KP2A 4IIJA 1GOBA 4QS8A 1HNZK 4O2AB 4FLWA 1MOFA 1VQKV 3E8BA 4IO9L 4F4LA 3H1QA 4ZTFA 2Q6AA 5F1XA 4PJ0Z 1GN3A 4Z94A 4JRQA 3WT0A 2E1ZA 4NKGB 1LWCA 1T03A 1QNMA 5TKYA 3ZYYX 2X7RB 2B1IA 1XOUA 1EFRG 1OJHA 4LP8A 4CEEA 2CE4A 4XH4A 3ULEA 4GKJB 4KX6A 4YHHB 5JH7B 2Y0PA 4CZZA 1NLVA 4J2BA 4DV7O 4FWLA 3IS9A 4B3SO 1RUJ4 5CB4A 2ZGZA 4JASA 3ZSOA 3BFRA 3CJ7A 4N56A 2W6IG 4RG8A 3TAMA 4CZKA 3FZFA 2XAHA 2HHXA 3B40A 1XNQK 5B3SC 1FAFA 4WE1A 3VEXA 4C1NI 2P9PA 2NLXA 1N32O 1XC9A 3I33A 4LFCK 3PO5A 2O8CA 4LF6K 1DLOA 5GONA 2V7QG 2OPSA 4YSXA 4UVAA 4K8ZA 1NVPB 2KFNA 1HPZA 3LPTA 3SLCA 2Q0RA 1PNKA 2ZXWB 2D0PA 4IFVA 4BC4A 5EBWC 3CCRV 2GWKA 3AE6A 1GK9A 3E8HA 4KBOA 1WB9A 4DQIA 4RW8A 4MW3A 4BIUA 3AG2B 1V55C 1OCOC 2QWPB 2WSSG 3DTUB 1N8RO 4OKEA 2XNDG 1M57B 1F7YA 1A5XA 1KMIZ 1SL2A 3ISNC 4DV0K 3HO1A 4YTMA 3PUFA 3WQUA 5IWAK 4NXMB 3THYA 1DGKN 4OXSA 2ZE8A 4LY7A 2VQEB 4B3RB 2QJ1A 4ELUA 2O8BA 2Q8VA 1ZP0A 2JWLA 4M3XA 1WB7A 1K8AW 3APOA 4IOXA 3NGYA 5IE9A 1IO2A 5AQKA 1P90A 5LYJA 3VQ9A 2GBOA 2HHQA 1VQMN 4AHRA 2HW3A 4BG9A 4RHV4 5EZYB 5EC1C 4E0DA 2QWQB 4DG1A 1SL1A 4DR6O 4Q20A 2WLHA 3FYIB 1NJXA 3QNOA 4DV6K 1ZSPA 4CJSA 4CJWA 3OUSA 1RTHA 1T7PA 2WLMA 2EBOA 1U97A 1JXBA 3DRSA 4RQFA 2HHTA 4HCCA 3MHHC 3ZLJA 2RS14 1AILA 4BE2A 4DR3O 3K03A 4FLYA 2GWJA 4GVMA 2A0LA 4FWMA 3O4NA 4CEZA 5IT9N 2PW9A 3JD1A 2Z1JA 4DR5K 3R8EA 3ZSWA 2NN4A 1IBLK 5JJJB 2UUBB 1NWKA 1BSMA 4HUFA 1IJJA 3QEWA 3THWB 1VSLA 4CJ4A 5BRFA 3AO2A 2HSTA 3FFIA 4DUYO 1ILYA 5CA1A 1YTAA 3GG4A 3M8RA 3BP8A 1BL8A 3CYMA 4FIPC 3M7MX 1WSEA 1QVFU 4FL9A 1COV4 1BWFO 1T44A 2D0AA 1RTDA 1FYJA 1ASUA 4C1NK 1NBMG 4DSIA 5AQJA 5TISZ 1O9GA 4PI2A 4EB6A 1I94B 1WSGA 2E88A 3RYCB 2E4LA 4CEFA 3THVA 2Z5UA 2A06H 3MCPA 3GE1A 1N36O 3HKDB 3RYHB 5C0YA 5KHJA 2UXDO 2UXBK 3RWUA 3DRRA 2NRHA 2KB1A 3AVAA 1P49A 2YHWA 3MEGA 4FZ1A 2R7YA 4BR5A 3KK1A 3WG7C 2YNFA 3L2UA 1Q6UA 2YIBA 1LWFA 4ILJA 4B1VA 4O0IA 1KYOF 1AJNA 1XNRO 3FZKA 2G8WA 4FVUA 4DR7K 1DK1A 4CBWA 1XQSC 2F93B 3SR2C 3EKSA 2KHOA 1XL4A 1KAZA 4B8AB 4CEBA 4BDYA 5HROA 3EE9A 4IEEA 4I4TB 5EY4A 2P5OA 1GLEG 1KKCA 3G80A 1HNIA 1AR4A 2IIRA 3HYFA 1PIV4 5FLXO 3P83D 5C3JA 2FMLA 4JAAA 3M6GA 3F5TA 1TV6A 1XUPO 4DSEA 1RUD4 5JCOC 3AV9A 1KKDA 4OGCA 3E01A 4B1ZA 4B9SA 4ZHQA 1MZEA 2Q7HA 2ZD1A 1QZ6A 3VEWA 3IGAC 4KL1A 5BRDA 1SQQH 5F2VO 1LW0A 4H0YB 2W41A 5HL7L 4R5PA 3CC2N 1X9JA 3U0ZA 3U3YA 1XMOO 1C1BA 4OX9B 2HMPA 3ZIAG 2RMU4 2O57A 1JVMA 3ZHUA 5CY4A 1Y76B 4JZGA 1MU2A 3E1YA 1JLAA 4QE7A 1LOTB 3FX7A 5LXTB 2ZIOA 4DQ8A 1X9WA 3CC4V 4DLEA 1U45A 1XUQA 4X66O 5H2FZ 1M93A 4LH6A 5CYQA 1MMMA 2A1SA 2EX3A 1U2VA 2BGGA 3NXSA 3JYTA 4IHJB 4HVJA 2H3OA 3KTQA 2D3OW 3CMAN 3RVYA 3TXQA 2RKIA 3DLKA 3VEOA 4CBXA 1N5YA 2WC9A 5LL6Z 3H6EA 4KH6A 3V9WA 2KZMA 1RMU4 3SJCC 1HNXB 3VR8A 2Q0UA 1M5IA 3OUFA 1UWBA 4TUYB 3GL1A 4JI1O 2YNHA 1Y97A 4I50B 1HNWK 2FB5A 5EOYA 2UUAB 3KCXA 1ZTEA 4JI0B 3CX5F 3OJSA 1JLGA 4DTJA 2HNZA 3OVNA 1M4UA 1VK0A 3E9PA 5JICA 1NK4A 4YHHO 1URFA 1QLEB 3HSTB 3B8AX 4FWOA 5JCOA 4OVLA 4C23A 3T7ZA 1L3TA 4YFUA 4H5NA 2BE2A 4LFBK 4DWIA 3B77A 3CJCA 4FJIA 4O4HA 1JL2A 3DXMA 4B8CA 3AVMA 3W3DA 2DYSC 3FI7A 1SL0A 5CBFA 5D5QA 1K73O 2WBNA 4RW9A 5FNVA 3JYCA 3RR8A 1JMKC 2P1JA 1A5VA 3AK1A 5E1AC 2OT5A 2YNIA 4E19A 3O4WA 4B9UA 3BHPA 2W0FC 4CJLA 3OTOK 1YQ4A 1Z7S4 3TSPA 1JLQA 3ULEB 4Z1MG 1WA8A 3JCZA 4CH6A 4H5VA 3V9SA 4JPRA 1TVRA 4B9VA 3E22A 3RGBA 3MAQA 4NXMO 1IKYA 3PY8A 3CQXA 1K33A 4B3RO 1B9FA 3IJ4A 5AZIA 4KREA 4BWAA 3MHSC 3RT3C 4JI4B 5K14A 4DR2O 3JASA 4LBEC 3T1CA 2W6LA 3DAWA 2O8DA 3QERA 4UB8Z 3RYFB 3THXA 2WLKA 1GLLO 3ABKB 2EILB 1K9MW 4OKKA 1HXS4 3OYNA 2HLDG 3OYKA 1RT4A 2B5UA 5CZ2A 2BCCH 2YC0A 3SUCA 2UU9K 1WN7A 1Z5VA 3GVMA 3LNMB 3RYIA 5AQOA 3CF5L 5AFUH 5HFMA 1F21A 3V1RA 3WUHA 4IG3A 3T1AA 4ILHA 1BCMA 4BRPA 3L2QA 1WSJA 3DXKA 2PUSA 4DV3O 4H5TA 1Q5OA 1YTUA 2X0LA 4YY3B 4JKEA 5M1PA 4DTXA 3QETA 2WQYA 2JGDB 1X9MA 3FZLA 3AK3A 3SPHA 5JWPA 4FM2A 5JLFA 3JD74 1SETA 5TKWA 3OYCA 2F8TA 2XOKG 1MWKA 3N2GA 2QWNB 4QS9A 3MWTA 5E79Z 4M7YA 4W5QA 3V81A 4NCAA 1SQKA 3M3ZA 4DV4B 3ZCMA 2FC0A 4D6TH 1KVCA 4XEIA 5BMVA 3S41A 3CCVV 4CESA 3AARA 4DTNA 2ZQBA 4FJJA 5J2TA 4KO0A 1N6QA 1BIUA 1HNVA 3H9VA 3EZWA 4WBNA 4GKJK 4E1MA 1IBMB 2CTPA 2IBZH 3BF1A 4M3TA 1K92A 5KMGA 5LHHA 3EN9A 3HPLC 4I0XA 4BC2A 3P5JA 2OIGA 3AG3B 1DGSA 1D5AA 4EFEA 2HHHK 4KHPK 4MVUA 1I94O 1S9GA 4WQ5C 1K4CC 4WFHA 1Z26A 4JYAB 4TOIA 1OCRB 1YTFD 3K0DA 3B6OA 2O8FB 3A0IX 1K3EA 4X64K 1K6YA 4LF9B 1FJGO 1QVFM 4IJNA 1ZBIA 3JD3A 1CZAN 4CIFA 4FWRA 4RW4A 4J2DA 2GUZB 3K9SA 4CH3A 1E3MA 1IKVA 1PD3A 5CZ1A 2P9NA 2F96A 1SQGA 2WU5A 3OYHA 1R0AA 1PVC4 1YEWA 4CS3A 3CJBA 2G8IA 2VQEK 1ROPA 3P32A 3ASOB 3R1XA 4B1WB 2YSUB 4DTSA 3HKEA 4ID5A 3VF2A 4YOXA 5ITZB 3L6QA 5KAIZ 3NF7A 4CEDA 2Q73A 4NTWA 3VGKA 3EL2A 5GINA 4PQUA 2QKSA 3RTVA 4PWDA 2XY5A 3GWOA 1DF4A 4CVNE 3O9TA 4OPAA 2PGGA 1LUWA 4LF4B 4I9WA 4IYHA 5H5NA 1NK0A 3D2EA 4PDRA 5DN6G 3ZETB 4JHDB 3ZBHA 1J5OA 1HNZB 5CR4A 4M3RA 1OVQA 4NYFA 2WTUA 1V4TA 4JYYA 1L0VA 3PX6A 2F23A 2Y4TA 2XT9A 4C8MA 3HM9A 1C0UA 3TANA 2DWEC 1WPBA 2WPDG 2YS8A 3C3SA 1W2BU 4LFAB 2FF3B 4BREA 2F4VK 4MTFA 5HRNA 1Y66A 4WQ5A 1EETA 3H08A 4OGQB 2PF4E 3JD0A 4B3MK 1BA1A 2A6AA 4BRQA 1NJYA 2UUBK 4BR4A 2ZR2A 2HVHA 4CIEA 3ZT1A 2GBZA 2PFUA 4K41A 4PKHA 5IJ9A 4I7FA 3UT5B 3A5MC 3L73H 2X78A 1E1QG 1Q8IA 4J80A 4N5SA 4JS4A 1YCIA 4CD3A 1XHXA 4LFCB 2O4GA 3E66A 4CZJA 2HMIA 3PX4A 2FBWA 4LF6B 3QBXA 4X20A 4XDJA 3MXJA 3L0QA 1RSOB 4Q4Y4 4DF8A 1XWLA 5LHGA 2ZXWC 1IG8A 3P1GA 3HRGA 4A2BA 3HL8A 3CIRA 1NI8A 3BA9A 5LMNK 1R094 2YIBD 1GH6A 3MN5A 5AR0A 5BZBA 3TTDA 3AG2C 2FL4A 1JA8A 3W0LA 2V52B 1M57C 2RCVA 3F2KA 3L4IA 1U2VB 3NH2A 3RVZA 1YIJN 3AA2A 4DSKA 4BW9A 4DV0B 1N33O 3H3OB 3U8XA 3NMUA 4GV6A 2KFZA 5IWAB 1NTZH 4O2AA 3DLGA 4CF1A 2OZMA 4FW2A 5KPZA 1BEV4 3A5LC 5AZJA 3R6MA 3OGIB 4A61A 2ITGA 4JRPA 4DR1O 5BR9A 3QEPA 3I56N 2OCCC 4MS2A 3SV3A 4GW6A 1POV0 4FJXA 1AR5A 2ZINA 4MVMA 4LR3A 2NZTA 5JH7A 2UUCB 3I55N 2ZE6A 1B92A 3CMEV 3JARB 2QXFA 4O0JA 4FJGA 2G8FA 3P38A 3PLAA 3MN9A 4H44B 4OX9K 3BUZB 1MWMA 4AH9A 5LY3A 2ZT9B 1YVUA 1B3QA 4JI3O 2DE0X 2XUMA 4RTFD 1SC5B 2Z1HA 1KD1W 3ZMUA 5EBLC 1W97L 1IBLB 2E74B 3CD6N 3J81O 2QKBA 4A62A 2RS34 3VBBA 3ID6A 1QTMA 2IW5A 4EHTA 1QVGU 3HK2A 3BZCA 1CZ9A 4JAVA 2DJVA 2QWPA 5C2DA 1YVWA 5J2PA 3TABA 1Q18A 4IZ9A 5E26A 1XDCA 2N05A 4OLBA 1SF9A 1X4TA 4HAMA 4CECA 5BN8A 2V7YA 2YJFA 1VQ8N 3JASB 3AE8A 4WCEV 1WOQA 1UA0A 4JV5K 1K8AO 4KFMA 1QSSA 4W4KA 1WAJA 1HNXK 5B1OA 4DV2K 4BE1A 2OA8A 4DV4O 2Y1IA 4CEOA 2E1YA 3C6UA 2DFEA 4JD2B 1J9AA 1G1XB 2H88A 1VF5B 2FBVA 2XTAA 2ZE7A 2ZDIC 1TKTA 4JI0K 2FSNA 1PKXA 2QM7A 1EM1A 4DRXB 5EZYA 3CRCA 4ILGB 1NR1A 1PNLA 2ADPA 1IBMO 2QWQA 1SZ2A 3MXIA 2E2NA 4FJCC 3DLRA 5IDJA 3KLGA 3BEXA 3CHXA 3U4LA 4W4LA 2GTSA 3RMDA 4BR0A 1Q82W 1FXKB 4FFKA 4I9LA 2H89A 3N2GB 5L3DA 4DSJA 1ASJ4 2CUGA 5JS2A 4M3UA 4ICLA 2R074 2ASPA 1Q6HA 2D0BA 4FK0A 3D7EO 3CXHF 4JYAO 4F2SA 4YT0A 5BMVB 2OYQA 1YAGA 4ABMA 3N2KB 3AVCA 4KH5A 1QQNA 3KWGA 3CCQN 5J2TB 3H01A 2WUSA 2EIKB 2G8VA 2D2CB 3KD5E 4KHSA 1D9FA 3VR9A 5AG2A 3WNHA 2UXXA 4L87A 3QO7A 2J4RA 3G0ZA 3CCLV 4DXWA 3Q7BA 2HP8A 1VQNV 5KMGB 1L3UA 3G6BA 4JI6O 4DTMA 2ZCEA 1YIJV 2Y0IA 1L8DA 1MNGA 1AR64 3P4RA 2HVKC 3AG4B 4NTXA 1Z2GA 1QS4A 2OTJV 3OJUA 1QQOA 1VBE4 1WP8A 1FKOA 3GWKC 4Y1CA 1RBTA 1KSPA 3O9SA 4JI4O 3HKDA 4P9PA 3RYHA 4DU3A 2GTAA 1TAQA 4BQLA 4LF4O 4EFHA 4CGIA 4NLBA 3F9MA 3I56V 4PHTX 4R6ZA 2ZDIA 3NR7A 1RUG4 4E7JA 1HNZO 4YY3K 1NGEA 3O80A 4DTRA 1I08A 2LGWA 3SJQC 3QVNA 4TV9B 4UXNA 3D6RA 1RDBA 4CW7B 5SWMA 2BDPA 3DWLA 1VIBA 3OE7G 1CXQA 4I4TA 3ZEDA 3L4QA 4UVBA 4K0KB 3GDQA 1WBDA 2JS5A 4RW7A 1PP9H 5B66Z 1I39A 1W0HA 1OOPD 2IU3A 3O9OA 1NKDA 1Q7YW 2CTRA 4ID1A 5LP6B 1QLEC 1S77D 4TV8B 3N4QA 2KTQA 3OFNG 2ASOA 2X6CA 2LW1A 3SPGA 2P51A 5LL6Y 4QNHB 2JGUA 4PDLA 3CD6V 4LFBB 1J54A 1K5QA 3ZEUB 2ATKC 3K58A 1XNQO 1RBSA 1W2BM 3P4IA 3QNNA 3PX0A 4LFCO 2ZE2A 2B4JA 3LDDA 1NGFA 2QI2A 1JLEA 4IBNA 4LF6O 1FKPA 2E2QA 3EVKA 2ACZA 2FSJA 4JLHA 4GMJB 3NF8A 1Y76A 2GUPA 5A2QO 3K59A 2Q7EA 2FKXA 3H1IH 3VESA 5KLVH 2HHUA 1VQ8V 5LXTA 1PNMA 3HKCA 1D8YA 2RPIA 4TSXA 4IG0A 4CJEA 1P8ZA 3CQ8A 1JKHA 3MX2A 4M3ZA 1EN6A 4BVPA 4ZOLB 4JN4A 5IJ9B 4CHYA 4DV0O 2WONA 3T4ZA 4IHJA 5IWAO 1YHQN 2AZ2A 4CJRA 2YXLA 3V1QA 3J8AA 1S3XA 4K42A 2EILC 4CJTA 3HXMA 3ETGA 2LO1A 1BDGA 1TYQA 4QS7A 3U10A 1ZWIC 5AFUA 3G4SN 1IBKB 3SCXA 4FJMA 4TUYA 3CFPA 2BOCC 4DQPA 1D4XA 4I50A 1BG3A 1GLBG 2NRVA 3BPZA 3SNNA 4L8JA 3Q4HB 4J2EA 1GM7A 3LM2A 4Q4W4 5KA6A 3HZ6A 4RWUA 4DV6O 3QB0A 2QM1A 3CCQV 4DQRA 2PLV4 1JJ2U 4QGPA 4GV9A 4FJ7A 4CK1A 3S3NA 3VA0A 2FXUA 4H03B 5AZJB 5HLFA 5C8YA 3ABLC 1KFDA 1RPOA 2QM4A 3MDSA 2E5LK 4Z4EA 3TAFA 2F9WA 2VG5A 1TK0A 4MLEA 1LV5A 2XAFA 1NJIW 4LFAK 1H8EG 4DR5O 4JI8B 3A5NC 1SZXA 5BPLA 4AHCA 3OHRA 5BR8K 1KVBA 3B8MA 2E6MA 4DU4A 5J2QA 3MXMA 4IWVA 3TR8A 2CGLA 2P9UA 1F23A 2EJRA 3K9JA 4GT1A 3BVOA 4JF3A 4WFAV 3JCUZ 5C12A 5FROA 3AE7A 3C6HA 4HYOA 5KA5A 3O9QA 3QFPA 4O8KA 5FLXN 3AG3C 1C1CA 2EHGA 3MECA 4QJFB 4DS5A 3NDKA 1W0KG 3OS1A 5JS1A 2RN2A 4ISFA 4E7HA 2HHHB 4KHPB 2LQTA 1EP4A 3RYFA 2QA4N 2FBXA 1K9MO 1OCRC 3V6DA 1QVGM 1YITV 1HPMA 4WCEL 1QR8A 4EKWA 3VTHA 2IJIA 3K06A 4BE0A 2FYUH 4X65B 2E3CA 2NLJC 1NU1H 3SPCA 5GTHZ 4X64B 5BY1A 2UXBO 5BPMA 2PYLA 1OHHG 5M1NA 4CGDA 3JD4A 3AEEA 3OA9A 4FWPA 3ETDA 3ALYA 5C24A 1RBUA 2F9TA 5B1NA 3BRCA 5DECA 1M1KW 4CHQA 2OPQA 4CGHA 4DR7O 2JGDA 4DUZK 2WDQA 1T05A 3ASOC 3H3NO 1QHTA 2QXLA 1QSYA 3JATB 3TGUH 4DR4K 5D5PA 3AE1A 1Y74B 3CC4N 1OCCC 2W6KA 4NVPA 4H4OA 4BRCA 1YJWN 3C7NB 1RDDA 2QWNA 3O6WA 3OBYA 3AEIA 3CRMA 1RFYA 3CG7A 4ASUG 3EKUA 4H0PA 3W7WA 4CFDA 4B7KA 2PTMA 3WNGA 1VEWA 2DFHA 2HHVA 1O13A 1BS3A 4J42A 4O2BB 4BQZA 1YSCA 1E1RG 1WBBA 2OCCB 3SYQA 4FO0A 3CS5A 2Y69B 5HFLA 3TARA 1XL6A 4PL8A 4CF8A 4KAZA 2QGNA 2G38A 5KI6A 2Q4PA 2UUCK 3UKMA 4JZ2A 4JNEA 4X1IB 4RO2A 1NVPD 4CE9A 4FPBA 1R6KA 3H1LH 2DPNA 1AL24 4AM6A 4DW0A 1GLDG 3LZIA 1R3IC 3MN7A 1GN4A 1YHQV 4MO4A 5FPMA 4CK2A 3IKMA 3SPIA 4CHPA 4HTUA 4BY9C 5C15A 2F4VB 3EY1A 3G4SV 3SBTA 1WLEA 1F4MA 3C94A 2O8FA 4CZEA 2PYJA 1RHI4 3AVNA 5KPRA 4HUEA 4B3MB 4DB3A 1RUF4 1WSIA 2HBKA 3W7UA 3ATVA 3M8AA 4OJRA 4HZ3A 2GUZA 2DFFA 5K1PA 4BDZA 4H0XB 4YOTA 3VGMA 3RRHA 2O4IA 1H2MA 2YI8A 2RN9A 4K43A 2F95B 1TGOA 2YX6A 5BRHA 4WYBA 3SYZA 1E79G 2R7FA 5LHIA 5GAGP 3L2RA 4M45A 1HNWO 2JK5C 5IYZA 4BROA 5EVZA 5ITZA 1ZXOA 3M5RA 5LMNB 3MEDA 4DFKA 1KAXA 3FFKB 3LP1A 1KF6A 4XH5A 4E89A 4F6RB 1HQUA 4AM7A 3N27A 1ZBFA 3OR6C 5HRSA 2RS54 4NR1A 4F9OA 3LNNA 3ETQA 1RT7A 2VQFB 4LF5O 3ZETA 1IDSA 1S1TA 4JHDA 5L3EA 5GADP 4JGSA 4H0TB 4E3SA 3S3OA 1YXQA 2RDCA 3ZRWB 3JAWB 1W7AA 1H8TD 5A9GA 3VF6A 3ZSRA 1Y4MA 4MVQA 1NZ6A 1IX9A 4X1YB 3CPWU 2ZKOA 1X59A 1KU9A 2NUBA 3CM6A 4YOUA 5KUMA 2F8SA 3VQWA 2HF3A 4LH4A 2DMXA 4FPAA 2JVDA 3OTOO 2QA4V 3RVCA 3OW2M 4BR9A 1EWRA 3U9DA 1KFSA 1HUXA 3CJHB 2KLAA 3NGZA 3M8SA 4Z4HA 3TETA 2ZIMA 2FBTA 3SV4A 3ZX6A 3WB0A 3UT5A 4I55B 1NTKH 1I3AA 5KHIA 3VQ7A 5F2RA 2L35A 1NU0A 1SV5A 2QTDA 3T19A 3TSUA 5ADXH 1W59A 5GIOA 3STLC 3AA4A 3SYCA 4QPKA 2EINB 1YVNA 3CCVN 1M90W 4Z0UA 3E9OA 2C2AA 1RSOA 3DMJA 3OYEA 4LF7O 2QW9A 3IMXA 4B3TK 2UU9O 2CK3G 3HKCB 4H37A 3QEIA 4QOZB 1ZLZA 3R65A 3H45C 1YJWV 4BAYA 4U7OA 3ULDA 1U47A 2QWRB 2P9KB 2AJQA 4M7XA 1DT9A 3ABTA 4FJLA 1GLAG 3NBPA 3DSQA 3PIPL 4JI2B 2HNDA 1AI6A 4FM1A 3QF7A 3VTIA 1SKVA 3LDNA 2PY5A 2RNBA 1NR7A 3G71N 4JKGA 1TYQB 1J5EK 3TWHA 4JV5B 1K7DA 3O4QA 3CE2A 3VN5A 2P5GA 4DV2B 4W5RA 1SKRA 1JCHA 3AVGA 1GMGA 4OGEA 5B8HA 4K0KK 1HQEA 2GEMA 2A7WA 4XDLA 1GOCA 2IDOA 4CZHA 3JAMO 4DQQA 3A8YA 4EZ9A 3FB6C 1TK8A 1JJ2M 4A2AA 4KP4A 3HTVA 4PL7A 4O5BA 5AQZA 2CGKA 1VSFA 4GKJO 4UVCA 4WFNL 4H13B 1E4FT 3SYPA 1FXKC 3FLCO 4WFAL 3JARA 4PDVA 1PV0A 5AQLA 4EZ6A 3ZSYA 1WSFA 5C8YB 3AY9A 3OMIB 3WEEA 1AR74 4GB34 5AQXA 2HHHO 4KHPO 2GX9A 5IJ0B 5J2NA 1BCOA 1ZBLA 1VMGA 1VQ5V 1Z6RA 1NA1D 1C0TA 3AECA 2A3QA 2YKMA 3HPGA 4CBUA 1KD1O 4E1JA 1QQMA 2EIKC 2QKAA 1W0JG 2Q9LA 4X62K 4X64O 1FKAO 1S5HC 1TKXA 2YJEA 2P9UB 4LC9B 1O1WA 1DTOA 1OZ0A 3KVGA 4GY2B 3BAAA 3CCUN 2WLLA 4DV5K 3SUNA 1TAUA 4YXDA 4JKHA 3LP2A 4GCZA 2IAJA 4DW1A 2Q31A 1JR9A 2P4VA 4FWKA 4O55A 3G67A 3SYAA 3P4QA 1Z25A 3OMNB 2VQEO 3AG4C 3I8DA 3NCIA 4PDWD 4FK5C 3CRAA 3AVJA 4JYBA 4BDPA 3G25A 3HKBB 1Q86W 1NS1A 3AG7A 4MVRA 2EWSA 4B9NA 3OYLA 3P3NA 1IBKK 4JAUA 1AR1B 1JLCA 4FJHA 3ZT4A 4MDBA 1R6TA 3FYEB 4YIPA 1S9EA 4JD2A 3D3QA 2A40A 1WAZA 2Q97A 4BR7A 1AJQA 1SQBH 2JDIG 3AEFA 3SYOA 4GUNA 4DRXA 1VBC4 4BIZA 5GIPA 3O65A 4QPJA 1NQTA 2XO7A 4JK8A 3SAFA 3W7SA 1SQXH 1RUI4 1Q6IA 1ENVA 4OPHA 4AF1A 1H38A 1CEZA 3VQQA 2QE7G 2P22C 4FWQA 1Q82O 3MEEA 1EO1A 1FXKA 2WAMA 3CWBH 1TK5A 3L2VA 3E83A 1VSJA 3ZCCA 3KWIA 2Z3YA 4BGAA 3ABLB 1ZX3A 3ID8A 3KHYA 4CJ5A 1RT5A 5LP6C 4Z4FA 1VQOV 2F4VO 4JI8K 2CH6A 4J8FA 3FB7C 3TJTA 3N2KA 4B3MO 4MVOA 3DXRB 4LWSB 4R7CA 3CPEA 2UUBO 3AK2A 3LDQA 3MK6A 3QIOA 2VRZA 1QBZA 5IYCO 4EP5A 2LFRA 1OVYA 1EN5A 4Z1VA 2ITCC 1VQPV 1GLCG 4JI5B 4A5UB 3LDOA 3AE3A 1C6VA 1G6UA 5JLHA 3JSNA 4GX1A 1OH7A 1RTJA 5M1FA 1OH6A 1J6ZA 2D4WA 4K8XA 3CCJV 1AVMA 4CD1A 4FLUA 4JKDA 2E75B 3G71V 1NKEA 3T1HK 5LMNO 4X65K 3EXAA 3JSLA 3DOKA 4KB1A 1X1PA 3LDLA 4LH7A 3CMEN 4LF8K 4PELA 1U49A 3TXSA 1HKCA 2IJKA 3UE5A 3ZHQA 4PV1B 3FE1A 5HRRA 2ZJRL 3E8FA 4HBNA 1VQ4V 4O4GA 1BHBA 4DSLA 4C8LA 5DEDA 2D0CA 4CJVA 2QR4A 4H5WA 4TV9A 3QINA 2P4KA 3OM3B 1XQ8A 3J81N 4G1QA 1LW2A 2YI1A 3VGLA 3TI0A 2ZF5O 2ZM6B 5IYZB 1OCCB 5C42A 4B9MA 2RM24 5KGXA 2Q5ZA 1Q7YO 4IT5A 1G99A 1JX9A 3EYZA 1S72N 2N04A 1K34A 5LP6A 2BUPA 4TV8A 4M41A 3K5OA 1S1VA 1FFXA 1ZUQA 1ATSA 2KW4A 5LMUB 1BGYH 4OO1J 1EAH4 4FYDA 2GDSA 1R3LC 2I5JA 2Q69A 3C95A 2WLIA 3CCUV 3IG1A 3P39A 3CJAA 5CE3A 5KQDA 3CPWM 4C8OA 3ZEUA 2DY4A 1HJRA 4OX9O 2ATQA 3DYAA 3MMVA 5CYMA 5E84A 4B9QA 4YOYA 4JTCB 2A3ZA 1WP7A 2E5LB 3M1FA 5AQYA 3H46O 2GHYA 3CRRA 1RP3B 5AQUA 1KXPA 1U4BA 2YHYA 1CXUA 3GBTA 1NGIA 3NVMA 3VQDA 2GV9A 1GM8A 3UIQA 5B5EZ 1WB8A 4Z2WA 5BR8B 1JOYA 4HNAB 3LP0A 2YXHA 3GQKA 4ISGA 1U6ZA 1NNEA 3IRXA 1HRI4 3AVLA 3SUOA 2ITMA 1MDUB 5T7BA 1I5YA 4ZOLA 3O1WA 2OWOA 3MDQA 1ASWA 3LDCA 3M8PA 1RDUA 4CBCA 4J10A 4YXWG 5L3BA 3IC9A 3FB5C 4JV5O 1YT3A 4QAGA 1HNXO 2HBJA 4RW6A 4DV2O 2CGOA 3QEVA 4IKFA 2Q68A 1VRH4 3AEDA 2UUAO 3ZRXA 1Q90D 1Q9XA 2RJZA 4MFBA 2JEXA 2UYTA 4PUOA 3T1YB 1A5WA 4JI0O 1X3NA 3BGRA 1AI4A 1VSIA 2B5JA 3T3FA 3V9XA 3CCLN 1MQTD 3Q4HA 1VQNN 2BOBC 5JJNB 3AG1B 1ZBSA 5AQPA 3ZT0A 1TL3A 3BF3A 5MLCQ 1I0HA 3ETEA 2NRXA 2VQFK 3TCUA 2YKNA 4DUZB 1N4CA 1H2LA 2V4DA 3ENBA 4JKGB 4XDKA 4LH5A 4W5OA 2OTJN 1KAYA 3NF6A 4G9ZA 2X6SA 4KTWA 4PA4A 4DR4B 1CPYA 3KZBA 1R73A 3BY6A 4J9ZB 4FLVA 3J7ZO 1YZBA 2ARHA 1LWEA 1NJIO 3KKYA 2X6BA 4UY8O 1NH2B 3J7AP 4UFZA 4KHUA 3AA3A 4EEQA 2Y69C 4M3WA 3TAEA 1XMQB 4PA6A 5CMUA 3LSSA 5AQGA 2YHBA 3G6EV 4GNIA 4B9LA 4U7NA 5DM7L 3SMPA 2ITDC 1UPGA 4NCBA 3FFQA 1R1BA 2IVNA 3ASNB 4PI0A 2QK9A 3JBG4 4FFBB 1B06A 4TQDA 3WEEB 3OYGA 4FJ5A 4FMTA 2FLOA 4R8CA 4TT3G 1H1VA 3SQ2A 1S1UA 2O8EA 2K1EA 4ZIBA 1BHAA 3QG5A 2ZQMA 5L3GA 3EO3A 3WXMB 4AQYB 2P9LB 3C0BA 4I6MA 4EFBA 3B8NA 4E7LA 3STZC 3VENA 4DK0A 1JPXA 2WLLB 4GVEA 3OT7A 3IFXA 1HR0B 2ZJPL 4JI2K 4OKJA 1S72V 5AQNA 4YY3O 5A2QN 3L8BA 1M1KO 3BDPA 2G8KA 1GN6A 4YJ2B 4G2KA 4N21A 3CYOA 3OTFA 3RW0A 1NEKA 1KRPA 3JATA 1IG9A 3QNEA 1Y74A 1NKBA 4WFEA 2YXYA 4Y0WA 3UKRB 5I42A 1HRHA 3C7NA 3HP6A 3EFFK 4FJ9A 3U9ZA 1THZA 2PBDA 1ORQC 1YF2A 2UXCK 2EULA 4O2BA 1RT3A 3VQXA 1DKGD 2IVPA 4YTNA 1BISA 2Y48A 5FL7G 3DLLL 4YNQA 1X9SA 2YHAA 1RM1B 1SKSA 4C8KA 4UCUA 4IL6Z 2IGIA 2XY6A 2QEXV 3FGUA 2Z1GA 5KHGA 4X1IA 3TAPA 1IXBA 1BI4A 4O44A 4FK2A 2FSKA 2HEPA 3PSFA 1NCQD 4RUFA 5HOOA 1VQ7N 1VBB4 4E7IA 3O5BA 3EEQA 4X62B 3VQ4A 5J2UB 1KLMA 4PA1A 2KQ2A 2QSAA 1P4RA 3ZHSA 3JALB 4CH5A 2A9HA 3ZHVA 1T5EA 1F4NA 1VSKA 1C0MA 3AO3A 3CM5A 3ZRSA 2HBLA 3TPQA 4LF9O 2EIMB 4UCOA 5H1SQ 4MW8A 4DYLA 5AQIA 5ADXA 3NHGA 5J9PC 1QQCA 1AROP 3ZMSA 3KG2A 1HYVA 4C7UA 1VF7A 1DLBA 2Q0AA 1TUUA 4YORA 4H4MA 4BRFA 2EINC 5M1OA 4UCTA 1TUBB 1ZC6A 5AQSA 3V9ZA 3OEEG 4CZIA 1K5MD 1BQZA 1D4M4 1MSDA 4LC1A 2R9AA 1LAVA 1RBVA 2KG7A 1AB3A 1BIZA 1SAZA 1TKZA 3QFUA 3HT3A 3J8F4 4BR6A 1BHLA 4B3TB 1GTOA 1WLJA 4FLXA 4DU1A 3CEIA 1RUE4 4PA9A 1VARA 2V51B 1YI2N 1C1AA 2JJ2G 2M6YA 3X2QB 4F6RA 4RUEA 3VQ6A 4GX2A 3WNFA 1BT8A 4BVOA 3VF4A 3AGRA 4PHZA 1CLQA 5L3FA 4AILC 4RQEA 4CHZA 5JVDB 4TWKA 2OPPA 2EIJB 1D2DA 4V19S 2Q2RA 1YITN 3A5OC 1J5EB 3ZRWA 3A0RA 3JAWA 5LA6A 2E5LO 1NGAA 3VOVA 5HRPA 1U96A 2QWLA 2WS3A 1QSLA 2R9IA 4FSVA 1Y6XA 4YOWA 1SESA 2W0XA 1VSEA 3R9PA 3SPYA 4X1YA 4LFAO 4KV8A 4DFJA 3DLEA 4H0LB 2IH1C 5BR8O 1JCGA 4JI7K 3C90A 5JVHL 1VQ9V 2K9PA 5AQRA 3I0RA 1NK8A 4MT8A 1L0NH 1FFXB 3WXJA 2KQXA 4ZBMA 3CJHA 3CC7V 5I9EB 2KKZA 4DV1K 1KLNA 2PZSA 3ZMTA 4NB5A 1BO5O 2E8AA 2WLIB 1KCFA 3AO5A 4X9QA 3K5LA 5HBMA 1R3KC 4JI5K 4I55A 1H2NA 3WNEA 1FPOA 3BEHA 2JRIA 3OW2U 2NRRA 3AVHA 4M3YA 4LD0A 1L3SA 2JEUA 2P67A 3Q7CA 1UA1A 5GW7A 2D0OA 1M90O 4KTQA 4P2ZA 1LUVA 5JQGB 3O9UA 4FJ8A 4Z4CA 1I5XA 3JD2A 2XAJA 1K97A 3UO3A 3VQEA 2NRTA 5DM6V 4PA7A 4FLTA 2UXDB 3AO4A 2FTKA 1VQ6N 4DV5B 3QTCA 4CJUA 2QWRA 2P9KA 3RR7A 5LBQA 1HW7A 3OD4A 1N34K 1RDWX 4WFBV 5K1XA 2OPRA 4XIUA 4FZ0A 4I7ZB 1XNRB 4DFMA 3ABVA 1S1XA 4IDHA 2H8PC 4DUZO 3AEBA 3D8CA 5BXZA 1XREA 1RDCA 3OY9A 2CH7A 2R9RB 4DR4O 3B6PA 4DCHA 4KHYA 4GKKK 4KI4A 1VSMA 4RCHA 3DI6A 3VEZA 1EBOA 3W7TA 2ZM6K 3PIOL 1V9PA 3CP1A 5FPRA 2DWDC 3HM8A 1VQ7V 2Q67A 4OPJA 3HBTA 2HNYA 3F5WC 2HOEA 2BSKA 1LR1A 4ZI7B 1CXZB 1TVKB 3K9AA 3TSQA 1NENA 2UUCO 3VERA 5LMUK 3SJJA 1QE1A 3FD9A 3ABMB 3VETA 2ZE5A 3O3HA 1NK7A 5B1AB 1T3VA 4KI6A 4CCHA 2UXNA 4JI6K 4IOAL 3JAKB 4MQ3A 1RCHA 4YDUC 3QMLA 4O4IA 4JKCA 4F4KA 4BACA 5IJ0A 2VWKA 4D7SA 2CDYA 4LNUB 2GUIA 1RBRA 4F6EA 3VMFB 3B4SA 3LDEA 4X66B 3V9UA 4B3OA 1IBLO 1UJWB 1SZTA 4CJPA 2IVOA 5KHHA 3VRAA 4NXNK 1ASVA 3UB5A 3P30A 3SGIA 3SZ2A 3AE5A 1YI2V 4B1YB 4U67L 2VG6A 3O3FA 3ZSZA 2B76A 3NE6A 3AGKA 2A41A 4RWTA 3VA3A 3E89A 3A2FA 5CBHA 3OYBA 4I2PA 5DK5A 1YDXA 4KHNA 4DSFA 2O8EB 1Q86O 4BG8A 3HKBA 4JI1B 2B9ZA 3OMAB 5LGUA 1SQFA 3FKSG 4CZMA 1BMFG 2LGQA 2E2OA 4U3JB 3T1HB 5FPOA 4I6MB 4ZTJA 1V54B 4FZYA 4JTAB 3KKRA 3T1YK 4CHNA 3T4DA 4LF8B 3ASMA 4B1XB 1K5SA 2IU0A 5LGNA 1GOAA 3V1OA 1YJNV 1XHZA 2ZWHA 2N74A 5BPNA 4YOVA 1KFYA 5H9CA 1FS0G 4JKAA 3D3IA 2HJFC 3O08A 4CS4A 3E35A 1HDJA 1R59O 3KLFA 1D5NA 3LALA 3TU5A 2G8HA 4CC5A 1S76D 3D0PA 5LJVA 2ASMA 4OLAA 1GLFO 4HCBA 3J80O 1ZYQA 3ITHA 2Q0OC 2QKCA 2JIZG 4X62O 2HB5A 4FJKA 1OCZC 4DHYA 3DLBA 5JJEB 4YDUA 4KFBA 1XBLA 3AAPA 3D2FB 5KGWA 4FCYA 1COWG 3OYFA 2P9SB 3O1BA 4NYKA 1XC3A 4CGGA 1XMQK 2GELA 1VBD4 3DXRA 4LWSA 1IH7A 4IFEA 3UKUA 4DLGA 1RT6A 4HWIA 1EKEA 3W7XA 4B7EA 1VQ6V 3APQA 4N23A 1EXQA 5BN9A 4DTOA 3P4PA 4F3OA 2XY8A 3JAMN 2IOCA 1BI4B 4CERA 1VRUA 4DR2B 2OTLN 2HR3A 1FK9A 2IJJA 3LL3A 4IO8A 2CAZC 1NT2B 1YQ3A 5F0XA 1Z5WA 3ZRVA 3JS6A 2LFSA 1US6A 4B3TO 4JYCA 4CGJA 1CZBA 1RUC4 2H94A 2XRIA 2F1MA 5SZTA 1BQMA 4AQYK 1ZBHA 2ETNA 4CZGA 3KK3A 3LWLA 4CS2A 4G27B 1ZBUA 2F7TA 4KKOA 4JEPA 2W40A 1TAEA 4H33A 1YUWA 1S3JA 4DV3B 1HR0K 1RVF4 4CHOA 3KK2A 2DTUA 4AHSA 1NGHA 1G8MA 1RT2A 4J11A 1S1WA 5FPEA 1VQ5N 4CFCA 3MN6A 1J5EO 5AQHA 3CFRA 4WF9V 2KG7B 3C6TA 1Q43A 5EIBC 4RAIA 3MCAB 3ZT3A 4JKFA 4K0KO 2DQ3A 3SAGA 5KX5B 1RNHA 4UCRA 3CHWA 3FR0A 3AG1C 4Q5VA 3D45A 5B1BB 3HPOA 4CJFA 4E7KA 5GAEP 3CI5A 2PI5A 3HJFA 2E76B 2IH3C 4DV7K 3O9RA 4B3SK 4CK3A 4QE9A 4FK4A 2BTQB 3J7AU 4LFBO 1NJWA 1FXHA 3C3TA 3VEVA 1C0FA 1JL1A 3BY5A 3VQYA 2CTQA 5LA6B 5EYPB 4CZFA 1N32K 3OAAG 2WLJA 1K8KA 1BCCH 1AI7A 1EQYA 1MA9B 3I8BA 3LPUA 3DC5A 2QKKA 3T2MA 2BE3A 1PL4A 2MK3A 3M99B 3AEAA 3QO5A 4KB0A 1NMDA 4HNAA 4DV5O 1SS3A 1CP9A 4IXCA 3SQ4A 1FJGB 4R50A 5DM6L 3L71H 3KJVA 3ASNC 3T69A 4FWNA 4KRFA 4FZZA 4WFBL 2WU2A 1QCEA 3QDKA 5FRNA 1IV0A 3VQVA 4QIWF 3AVKA 1VQON 4O4JB 1NGCA 4UCSA 2P06A 1JFFB 1SQPH 4PKIA 4PY5A 1IBKO 2VGNA 1U04A 3TAQA 3ABUA 3IAYA 3QIPA 4JTDB 4CJQA 1R6NA 3AE2A 2HFEC 4KUMA 1RPRA 2HVJC 4NYNA 3HR0A 3FAVB 4O8UA 3ZMVA 4D7TA 3SAHA 1VQPN 2X5ID 3WQTA 1RFQA 1XILA 4IFYA 4X1KA 2VWBA 5JVGL 4DR6K 3OEHG 2A5XA 2QTOA 4BR2A 5IY5B 1N0NA 2R064 2ZD9A 3ZX0A 3F7YC 2P9IA 3LANA 5AQMA 3CCJN 1MZFA 2Y4UA 1KC8W 5L3CA 4J2AA 2CH7B 1ZL8B 3A8TA 3BA8A 3AA5X 2FF6A 4J7KA 2AGAA 2ODMA 3AE4A 1NM1A 1NBWA 4DR3K 3AAQA 3BZKA 5GTIZ 4X88A 4KPYA 2XAGA 2UXCB 4YJ3B 2IJHA 2OTLV 4JI8O 3S9HA 4YTPA 3S3XA 3LAKA 1KQSM 3AVIA 1VRTA 1RM1C 2BSKB 1VQ4N 1E4GT 3AVBA 1NGDA 2LSNA 3DM2A 1VQMV 4O4LB 1NK5A 4BRDA 3HOSA 4DUYK 1LAWA 4KHQA 5I3UA 1D9DA 1KVAA 1NJZA 3RSEA 2P90A 3D36C 3K5MA 1B6QA 3FZHA 3U11A 4A5BA 3PO4A 4FFBA 4MDAA 4MO5A 1S22A 3KK7A 4O4IB 2ZR3A 4CZLA 3K08A 3WU2Z 4CFBA 3S3WA 1DEJA 1P7GA 2AP1A 4JKBA 2LW7A 4BC5A 3DLHA 3CXCU 3T1HO 2G8UA 2CTWA 2EIMC 3ATUA 4CJKA 4XBFA 4FVMA 4X65O 2P9LA 3MD0A 5EU7A 2JJ1G 1N36K 2UXDK 4LF8O 3RMCA 1REVA 5LGTA 3L74H 4FXDA 3QO8A 2QWOB 2CGJA 3CIPA 1Q81W 1S6QA 2NRWA 3L70H 5M1QA 4IIJB 4LF5K 5IT9O 3E9LA 1N33B 3RWRD 1NG9A 4MTOA 1UOCA 1XNRK 1T8EA 3RRGA 4YJ2A 3VQCA 4E4EA 2H3GX 4IDKA 4IEIA 5D3GA 1JJOA 4UCVA 3SDLA 3CCEN 5LOVA 4DR1B 4NCGA 3RMAA 3UKRA 1TL1A 2DYRC 1M9NA 5DMRA 4I2QA 4ZHRA 4L8RB 2GSMB 3KLHA 2AHZA 3X2QC 1EV14 1IURA 2VS0A 3ENHA 3KLIA 1JLFA 3PN1A 2X74A 4NTYA 1ZAUA 3VRBA 2VCPA 3ICXA 4BRNA 3IUCA 5KUKA 4MLHA 5H6QA 4WQ4C 4BW5A 5CB4B 2EIJC 2NNWA 2R044 2AXTZ 1MA1A 3SFEA 4P30A 3NF9A 3LM9A 5AQVA 5C2FA 2IC3A 2OANA 2P9PB 2E6LA 1VF6C 1XMOK 2O8CB 2DOSA 1IVSA 5GONB 3AEGA 3UM7A 1M56B 1ATNA 2I7PA 2ZGYA 1YF5L 3D36A 3CFOA 4F3TA 3HPHA 3SFDA 4MVSA 5M1KA 4JI3B 3OYDA 4LF7K 3NVKA 2HHSA 3H1KH 5J2UA 3F73A 4K25A 2YEVA 1PL0A 3JALA 4PA3A 4JI7B 5EC2C 2OZSA 4N41A 4X66K 3P31A 3MWPA 1LNQA 3UKUB 4BRMA 4H0OA 5EK0A 3IDHA 4DV1B 1HJOA 1YTFB 4B1UB 2EZOA 1N8RW 3N4PA 3SJHA 4AHVA 1ATRA 3VEYA 3K0SA 1VQLN 4A59A 3EHBB 3DRPA 3THYB 3OGCC 5CA3A 4BRLA 1V4SA 2O8BB 1FXVA 3E86A 4H8KA 4IOCL 1TUBA 3QEXA 1PO24 2A1RA 3BCCH 3CC2V 1T6DA 1N0JA 2RQ6A 4DQSA 5LYJB 1HKBA 4JI1K 2V1DA 3LDSA 2VYPA 3CETA 4BGBA 5C10A 1AI5A 4WF9L 3H1JH 3QO9A 3V4IA 3K04A 3ZMZA 5IYDO 4A5AA 3G6EN 5LJWA 3HVRA 2M7WA 5FRMA 4KTZA 5CA0A 4DO2A 1N34B 4YHHK 1GM9A 2VQFO 5AQQA 5CHIA 4NB4A 1SERA 3G10A 4GX5A 3LAMA 4WQ4A 2YICA 3HP9A 4ELTA 5JVDA 3JXUA 3R66A 4Y1DA 4PKGA 3J7YP 2RR14 1YJ9N 2YV0X 4GKKB 1NGGA 3K2PA 5B3SB 3CMAV 2HF4A 4DTPA 4DK1A 1VF6A 1L3VA 4Q4X4 1XEQA 3VQAA 1TA8A 2NR5A 1LCUA 1YXBA 2AW9A 3ENOA 3ML0A 1OCZB 2CGNA 5AJ3K 1NOYA 1GAXA 3VPZA 3ABMC 3ZN1A 1NMNA 2HKOA 5B1AC 5CA1B 2ZNJA 3SBGA 4HHTA 3FB8C 4F8RA 1OH5A 3U6FA 1TKDA 4JK7A 3JSMA 1V55B 1OCOB 1PM9A 4J9YB 4NXMK 4Z4GA 1BZKA 4OPKA 4JI6B 4B3RK 3U3GA 1RDAA 2HG5C 4DR2K 1L0LH 1K8KB 3VQ8A 4CF0A 2E2PA 1AR84 3UCSC 4X8AA 4CJ7A 1SA0A 1NK9A 4EB6B 1Z05A 4AHTA 4BRGA 1F51A 5JQGA 3CJ1A 3HSCA 4FOIA 5ELZA 4N47A 1S5LZ 1FW6A 1HP8A 5J1EA 3CJ9A 4E1NA 2P7TC 3ZHTA 3CCEV 1I7FA 4CH4A
chains in the Genus database with same CATH topology
4AHUA 5HP1A 4NXNB 3AVFA 5E41A 4I9QA 3AO1A 3NGIA 1JLBA 3VQ5A 4N76A 3OYAA 1XI1A 4Q6GA 2D5RA 4F2RA 3QEXA 1RILA 1DTQA 4BWJA 4W5NA 2X6NA 2B6AA 4ZHQB 4ZI7A 4X1KB 1TVKA 4FW1A 4B08A 5J2MA 1L5UA 1XNQB 3OYJA 3K57A 3ZS8C 3VQBA 3SJBC 3JAKA 1G15A 5KTQA 3THOA 1KTQA 4LNUA 2F66C 1BGXT 3KIOA 3KKSA 3L3UA 1DTTA 3M8QA 3ZT2A 3K5NA 4DMNA 3SUPA 3I0SA 4FZXC 3ZSVA 3TAGA 3RMBA 4Z4IA 1H2SB 4DFPA 1Q3EA 5EIBD 2ETJA 2Q7GA 3UQ8A 2Z1IA 4U3JA 3SQ1A 1WNSA 1Q9YA 4LSLA 2YIAA 4DV6B 1J53A 2IS3A 3SUQA 4O4HB 4FJNA 3SPZA 4CEAA 4DF4A 3RFRA 5LOVB 5FNVB 3HVTA 2HVIA 4FM0A 1W9HA 4GYCB 4DR5B 4HUGA 4CFAA 1JXEA 3F9KA 2KZZA 4DV7B 4B3SB 3E22B 2XY7A 3KLEA 3PV8A 1BQNA 1N32B 2YNGA 3WB2A 3BABA 4BWMA 1U48A 3RYIB 2UXBB 4KHWA 3EZ5A 3CB2A 1SUQA 3LP3A 1BL3A 3CSXA 2YI9A 4DR7B 1RT1A 3OS0A 3QESA 2IM9A 3OS2A 5KX5A 1O9HA 1NK6A 1IKXA 1WSHA 4DS4A 3O3GA 5CA0B 4WBNB 3ZSXA 4DR6B 5KHKA 4B9TA 2BTQA 4W5TA 4GLXA 1NOZA 2BTOA 3SJAC 4C8NA 5EYPA 1HYSA 4DR3B 1S6PA 3NH0A 3DOLA 1FXXA 3RYCA 1ITGA 4CF2A 3WB1A 1HMVA 3ZSQA 1UAXA 2Y1JA 4UQGA 3L3VA 4DUYB 1SKWA 3SQ0A 4CJ3A 2VWJA 2ZNIA 3NAEA 4O4JA 2FBYA 1SA0B 3HKEB 2RF2A 1VSDA 1JFFA 1HNWB 1S5JA 4CC6A 2WOMA 4LSNA 1RTIA 2R72A 1N36B 4QCLA 3SI6A 5FDLA 5C25A 4M42A 3OYIA 2W42A 4LF5B 1HYZA 4ELVA 2KKWA 3VQPA 1EX4A 2XHBA 4CEQA 3LZJA 5KRSA 1IKWA 2BANA 4EP4A 4TQFA 1B9DA 3L2WA 4YJ3A 3LWMA 4JS5A 3S3MA 3B2EE 3OTOB 2R70A 4CGFA 2HHWA 2JLEA 2VG7A 4O4LA 4CIGA 1WAFA 1NKCA 4Q0BA 3OYMA 1XMOB 2Q3SA 4X20B 5KRTA 4LF7B 3NH1A 2UU9B 4FLZA 4CF9A 3NFAA 1VSHA 1B04A 3QLHA 4DTUA 3KD1E 4IIJA 1GOBA 4O2AB 4FLWA 4ZTFA 4JRQA 1LWCA 1T03A 4CEEA 4GKJB 4YHHB 5JH7B 4J2BA 3IS9A 5CB4A 3ZSOA 4N56A 4RG8A 3TAMA 2HHXA 1L3UA 4WE1A 1XC9A 3PO5A 1DLOA 5GONA 2OPSA 4K8ZA 2KFNA 1HPZA 3LPTA 4IFVA 4DQIA 4RW8A 4OKEA 1A5XA 1SL2A 3HO1A 1KMIZ 3ISNC 3PUFA 4NXMB 4LY7A 2VQEB 4B3RB 2QJ1A 4ELUA 4M3XA 3NGYA 1IO2A 5LYJA 3VQ9A 2HHQA 4AHRA 2HW3A 5EZYB 4E0DA 4DG1A 1SL1A 1NJXA 3QNOA 4CJSA 4CJWA 1RTHA 1T7PA 1JXBA 3DRSA 2HHTA 4HCCA 4BE2A 4FLYA 4GVMA 3O4NA 4CEZA 2PW9A 2Z1JA 3ZSWA 5JJJB 2UUBB 4HUFA 3QEWA 1VSLA 4CJ4A 3AO2A 3FFIA 5CA1A 1YTAA 3M8RA 3CYMA 3M7MX 1WSEA 2D0AA 1RTDA 1ASUA 4DSIA 1I94B 1O9GA 4PI2A 4EB6A 1WSGA 3RYCB 2E4LA 4CEFA 3THVA 3HKDB 3RYHB 5KHJA 3RWUA 3DRRA 3AVAA 1P49A 3MEGA 2R7YA 3KK1A 2YNFA 3L2UA 1LWFA 2YIBA 4FK0A 2G8WA 4O0IA 2F93B 3SR2C 4B8AB 4CEBA 4BDYA 5HROA 4I4TB 2P5OA 1HNIA 3HYFA 3P83D 1TV6A 4DSEA 5JCOC 3AV9A 4OGCA 3E01A 4B9SA 4ZHQA 2Q7HA 2ZD1A 4KL1A 1LW0A 4R5PA 3U0ZA 3U3YA 1C1BA 4OX9B 5CY4A 1MU2A 1JLAA 5LXTB 2ZIOA 1X9WA 4DLEA 1U45A 1M93A 4LH6A 5CYQA 2A1SA 2EX3A 2BGGA 3JYTA 4IHJB 4HVJA 3KTQA 3DLKA 2RKIA 1N5YA 3V9WA 2KZMA 3SJCC 1HNXB 1M5IA 1UWBA 4TUYB 2YNHA 1Y97A 4I50B 2UUAB 4JI0B 3OJSA 1JLGA 4DTJA 2HNZA 3OVNA 1M4UA 1VK0A 1NK4A 4OVLA 3HSTB 5JCOA 1L3TA 4YFUA 2BE2A 4DWIA 4FJIA 4O4HA 1JL2A 4B8CA 3AVMA 3FI7A 1SL0A 5D5QA 4RW9A 3RR8A 5FNVA 1JMKC 2P1JA 1A5VA 2YNIA 4E19A 4B9UA 3BHPA 4CJLA 1JLQA 4CH6A 3V9SA 1TVRA 4B9VA 3E22A 3RGBA 3MAQA 1IKYA 3PY8A 1B9FA 4KREA 4BWAA 5K14A 3JASA 3QERA 3RYFB 4OKKA 3OYNA 3OYKA 1RT4A 5CZ2A 1WN7A 1Z5VA 3RYIA 1F21A 3V1RA 4IG3A 3T1AA 1BCMA 3L2QA 1WSJA 2PUSA 1Q5OA 1YTUA 4YY3B 4DTXA 3QETA 1X9MA 4FM2A 3OYCA 2F8TA 3N2GA 4NCAA 4W5QA 3V81A 4DV4B 3ZCMA 2FC0A 1KVCA 5BMVA 4CESA 4DTNA 2ZQBA 4FJJA 5J2TA 4KO0A 1N6QA 1BIUA 1HNVA 4WBNA 4E1MA 1IBMB 4M3TA 5KMGA 3P5JA 1DGSA 1D5AA 4EFEA 1S9GA 1Z26A 4JYAB 4TOIA 3B6OA 1K6YA 4LF9B 1ZBIA 4CIFA 4J2DA 4RW4A 4CH3A 1IKVA 5CZ1A 2F96A 1SQGA 3OYHA 1R0AA 1YEWA 4CS3A 2G8IA 4DTSA 3HKEA 4ID5A 5ITZB 3NF7A 4CEDA 4PQUA 4PWDA 3RTVA 2XY5A 2PGGA 4LF4B 1NK0A 1J5OA 1HNZB 4M3RA 4NYFA 3PX6A 4C8MA 3HM9A 1C0UA 3TANA 1WPBA 4LFAB 5HRNA 1EETA 3H08A 1NJYA 2HVHA 4CIEA 3ZT1A 2GBZA 5IJ9A 4I7FA 3UT5B 2X78A 1Q8IA 4JS4A 4N5SA 1XHXA 4LFCB 2O4GA 2HMIA 3PX4A 4LF6B 4X20A 3MXJA 4DF8A 1XWLA 3P1GA 3HL8A 3BA9A 2YIBD 3NH2A 3AA2A 4DSKA 4BW9A 4DV0B 2KFZA 5IWAB 4CF1A 4O2AA 3DLGA 2OZMA 4FW2A 2ITGA 4JRPA 3QEPA 3SV3A 4GW6A 4FJXA 1I7FA 2ZINA 4LR3A 5JH7A 2UUCB 1B92A 3JARB 2QXFA 4O0JA 4FJGA 2G8FA 4AH9A 1YVUA 2Z1HA 1IBLB 2QKBA 1QTMA 3HK2A 1CZ9A 5J2PA 3TABA 4OLBA 1X4TA 4CECA 3JASB 1UA0A 1QSSA 1WAJA 4BE1A 2OA8A 2Y1IA 4CEOA 3C6UA 2DFEA 1J9AA 2FBVA 1TKTA 4DRXB 5EZYA 3MXIA 3DLRA 3KLGA 3CHXA 3RMDA 4I9LA 3N2GB 4DSJA 5JS2A 4M3UA 4ICLA 2D0BA 4F2SA 5BMVB 2OYQA 3N2KB 3AVCA 5J2TB 2G8VA 3KD5E 4KHSA 1D9FA 3WNHA 3G0ZA 5KMGB 4DTMA 2ZCEA 1L8DA 1QS4A 3OJUA 1FKOA 4Y1CA 1RBTA 1KSPA 3HKDA 3RYHA 4DU3A 1TAQA 4CGIA 4E7JA 4DTRA 4TV9B 1RDBA 5SWMA 2BDPA 1CXQA 4I4TA 3ZEDA 4K0KB 2JS5A 4RW7A 1I39A 1W0HA 4ID1A 5LP6B 4TV8B 2KTQA 2P51A 2JGUA 4LFBB 1J54A 3K58A 1RBSA 1X9SA 3QNNA 3PX0A 2ZE2A 2B4JA 4IBNA 1JLEA 1FKPA 4JLHA 4GMJB 3NF8A 3K59A 2Q7EA 2HHUA 5LXTA 3HKCA 1D8YA 2RPIA 4TSXA 4IG0A 4CJEA 3CQ8A 1JKHA 4M3ZA 4ZOLB 5IJ9B 4CHYA 2WONA 4IHJA 4CJRA 2YXLA 3V1QA 4CJTA 3HXMA 3U10A 1IBKB 3SCXA 4FJMA 4TUYA 3CFPA 4DQPA 4I50A 3BPZA 3SNNA 4L8JA 4J2EA 4DQRA 4FJ7A 4CK1A 3S3NA 3VA0A 5HLFA 5C8YA 1KFDA 2QM4A 4Z4EA 3TAFA 2VG5A 1TK0A 1LV5A 4JI8B 4AHCA 4DU4A 1KVBA 2E6MA 3MXMA 5J2QA 3TR8A 5FROA 1C1CA 2EHGA 3MECA 4DS5A 3NDKA 3OS1A 5JS1A 2RN2A 4E7HA 2HHHB 4KHPB 1EP4A 3RYFA 2FBXA 3V6DA 4BE0A 4X65B 2E3CA 4X64B 2PYLA 4CGDA 3ALYA 5C24A 1RBUA 3BRCA 4CHQA 2OPQA 4CGHA 1T05A 1QHTA 1QSYA 3JATB 5D5PA 4H4OA 4NVPA 1RDDA 3CG7A 4CFDA 2PTMA 3WNGA 2DFHA 2HHVA 4O2BB 3TARA 4CF8A 4KAZA 5KI6A 4X1IB 4CE9A 3LZIA 4CK2A 4CHPA 4HTUA 2F4VB 3EY1A 3C94A 2PYJA 3AVNA 4HUEA 4B3MB 1WSIA 4OJRA 2DFFA 4BDZA 5K1PA 3RRHA 2O4IA 2YI8A 2F95B 1TGOA 3SYZA 2R7FA 3L2RA 4M45A 5IYZA 5ITZA 3MEDA 4DFKA 5LMNB 3LP1A 4E89A 4F6RB 1HQUA 1ZBFA 5HRSA 3LNNA 3ETQA 1RT7A 2VQFB 1S1TA 4E3SA 3S3OA 3JAWB 3ZSRA 2NUBA 4X1YB 3CM6A 1KU9A 2F8SA 3VQWA 4LH4A 2JVDA 1KFSA 3NGZA 3M8SA 4Z4HA 2ZIMA 2FBTA 3SV4A 3WB0A 3UT5A 4I55B 1I3AA 3VQ7A 5KHIA 1SV5A 3T19A 3AA4A 4Z0UA 3DMJA 1RSOA 3OYEA 3QEIA 3HKCB 4QOZB 3ULDA 1U47A 2AJQA 4FJLA 3NBPA 3DSQA 4JI2B 2HNDA 4FM1A 3QF7A 1SKVA 2PY5A 3TWHA 4JV5B 3O4QA 3VN5A 2P5GA 4DV2B 4W5RA 1SKRA 3AVGA 4OGEA 1HQEA 1GOCA 2IDOA 4DQQA 4EZ9A 1TK8A 4O5BA 1VSFA 3JARA 4EZ6A 3ZSYA 1WSFA 5C8YB 5J2NA 5IJ0B 1BCOA 1ZBLA 1C0TA 2YKMA 3HPGA 1TKXA 1O1WA 3BAAA 1TAUA 3SUNA 3LP2A 2IAJA 4O55A 1Z25A 3I8DA 3NCIA 3AVJA 4BDPA 3HKBB 4B9NA 3OYLA 1JLCA 4FJHA 3ZT4A 1S9EA 4DRXA 2XO7A 3VQQA 2P22C 3MEEA 1TK5A 3L2VA 1VSJA 4CJ5A 1RT5A 5LP6C 4Z4FA 3N2KA 3QIOA 4EP5A 4JI5B 1C6VA 1G6UA 3JSNA 1RTJA 4K8XA 4FLUA 1NKEA 3DOKA 3JSLA 4KB1A 1X1PA 4LH7A 1U49A 5HRRA 4HBNA 4O4GA 4DSLA 4C8LA 2D0CA 4CJVA 4TV9A 3QINA 1XQ8A 4G1QA 1LW2A 3TI0A 2ZM6B 5IYZB 5C42A 4B9MA 5KGXA 3EYZA 5LP6A 4TV8A 4M41A 3K5OA 1S1VA 1FFXA 2KW4A 5LMUB 4FYDA 2I5JA 3C95A 3IG1A 4C8OA 2DY4A 1HJRA 2ATQA 3DYAA 5CYMA 2E5LB 1U4BA 1CXUA 3UIQA 3VQDA 2GV9A 5BR8B 4HNAB 3LP0A 3IRXA 3AVLA 3SUOA 5T7BA 4ZOLA 2OWOA 1ASWA 3M8PA 1YT3A 4QAGA 4RW6A 3QEVA 4IKFA