The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
147
|
sequence length |
571
|
structure length |
571
|
Chain Sequence |
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Correction of X-ray intensities from single crystals containing lattice-translocation defects
pubmed doi rcsb |
molecule tags |
Transferase/dna
|
source organism |
Bacillus phage phi29
|
molecule keywords |
5'-D(P*TP*TP*TP*TP*T)-3'
|
total genus |
147
|
structure length |
571
|
sequence length |
571
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.7.7.7: DNA-directed DNA polymerase. |
pdb deposition date | 2004-09-21 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03175 | DNA_pol_B_2 | DNA polymerase type B, organellar and viral |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix hairpin bin | ||
Alpha Beta | 2-Layer Sandwich | Nucleotidyltransferase; domain 5 | Ribonuclease H-like superfamily/Ribonuclease H | ||
Alpha Beta | 2-Layer Sandwich | TPR 1 domain of DNA polymerase | TPR 1 domain of DNA polymerase | ||
Alpha Beta | Alpha-Beta Complex | Palm domain of DNA polymerase | Palm domain of DNA polymerase | ||
Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | DNA polymerase; domain 5 | ||
Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | DNA polymerase; domain 6 |