1XI1A

Phi29 dna polymerase ssdna complex, monoclinic crystal form
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
571
structure length
571
Chain Sequence
b'PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
publication title Correction of X-ray intensities from single crystals containing lattice-translocation defects
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
total genus 147
structure length 571
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xi1A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xi1A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xi1A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xi1A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xi1A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xi1A06
3AVJA 2GV9A 4FLZA 3ZSZA 2XY5A 3TAGA 1BHLA 1U49A 3AA4A 3SPZA 4FJ9A 4KHYA 4C8LA 4Q0BA 3LWMA 2ZD1A 1VSLA 2VG7A 3T19A 4BE2A 1L3UA 4O0IA 5DK5A 3L3UA 4Z0UA 2G8UA 4J2EA 1Y97A 3PX4A 3OS2A 3AO4A 4O4GA 5J2QA 1S6QA 2PW9A 4CGHA 3VN5A 4CJRA 3QEPA 3VQDA 4DLGA 3BGRA 2QK9A 1IH7A 3KD5E 1VSFA 3DRRA 3LPUA 3JYTA 4J2BA 3LP2A 3V9XA 4YFUA 3NAEA 1HYZA 3IG1A 2P5GA 4E3SA 1LV5A 3LZJA 3RR7A 1DTQA 2HHWA 2IAJA 1UAXA 1S1TA 1EXQA 1RT2A 4BDYA 2F96A 3U3YA 1A5VA 3EY1A 2KFNA 3V1QA 2KW4A 2Q3SA 3KLHA 4CEZA 1RCHA 1D8YA 3ZT4A 4W5RA 1RTHA 4CJ4A 1O1WA 1TL1A 2FC0A 3QESA 4B9UA 4CCHA 2FBTA 3OYDA 4DTPA 1G15A 3AVNA 3QEWA 2G8FA 4JRQA 2G8VA 3OYKA 2VG6A 1IKYA 1RBVA 4FLVA 4CHOA 4AHSA 2RPIA 4MFBA 4CJ3A 5FRNA 4CJ5A 3IS9A 1XHZA 4TSXA 3DMJA 3KIOA 3MXMA 2HHTA 4KRFA 3VQCA 2XO7A 1X9MA 1SKWA 1RT7A 2G8IA 1NK6A 2JGUA 2HVIA 3CFPA 3LANA 4KB1A 2JLEA 1GOBA 1TKZA 3K2PA 3L2QA 3K5OA 2E6MA 3QO9A 4O44A 1JLGA 2OZMA 1RBRA 1S9GA 1NKBA 4AHRA 1EKEA 2YNIA 4RW9A 3OYCA 3WNHA 1RBSA 4NYFA 2DFEA 3SQ1A 1NOYA 4CK1A 4CJEA 4CJLA 1JXEA 4ZHRA 3CM6A 4IFVA 1WAFA 4ZTJA 4CGGA 4W5QA 1ASUA 4HCBA 2FBXA 2WOMA 4O0JA 2VWKA 1DLOA 3IRXA 4NYNA 4H4MA 3KKRA 4OKKA 4BWJA 3SV4A 4F4KA 2Z1JA 4B3OA 4BE0A 4FJJA 4N41A 4Y1CA 3S9HA 1VSEA 3SYZA 3V6DA 1JXBA 2YNHA 3S3OA 2YKNA 4Z4CA 4KTQA 4CEBA 1WSHA 3L3VA 1IG9A 4FLWA 4LSLA 1S1VA 3DI6A 3QLHA 4FVMA 2YHBA 1LW2A 3OYHA 4DSJA 4F3TA 4C8NA 2W42A 1JLAA 3TAEA 4IKFA 3T3FA 1NK7A 2XY7A 3QIOA 1NK4A 3L8BA 1ZBHA 4I7FA 4KHWA 1XHXA 2ATQA 3QEVA 2B5JA 3TR8A 3DLHA 4R5PA 3LP3A 5CZ1A 1GOCA 3NGYA 4FCYA 2X6NA 3OYLA 3OYMA 3RTVA 4CGJA 4JS4A 4DTSA 3OJSA 4KTZA 1NK8A 1RDAA 4BWMA 1JLFA 4HHTA 1VSDA 2B6AA 3WNEA 4W5TA 3OYJA 1UWBA 1X1PA 3C94A 4KHQA 4PY5A 1ASVA 3M8SA 1KSPA 4W5NA 2QXFA 3DOLA 1BQMA 3C6TA 1BQNA 5KI6A 2X6SA 4DTMA 1SUQA 1RDDA 4FJIA 3S3NA 3V1RA 3V9WA 1A5WA 2HNDA 1HNIA 5KTQA 4DU3A 2GUIA 5J2NA 2KZZA 1S1UA 3I0SA 3SPYA 1C1AA 2RN2A 1JL1A 2HB5A 4N76A 3NDKA 4CJWA 1VRTA 2Y1JA 4FJGA 4M42A 4FLTA 2D5RA 4OPJA 1RBUA 2OZSA 4OKEA 4M45A 3U3GA 4N47A 5HRNA 1UA0A 1HRHA 2XRIA 1N6QA 3TABA 1GOAA 1SL2A 3SJJA 3PO4A 3SV3A 1B92A 4Q5VA 1NOZA 3V9UA 4FK0A 4M3TA 3NFAA 4CFBA 5SZTA 2RF2A 3NHGA 2P1JA 4K8XA 4OGCA 5HRSA 1B9FA 3AO3A 3VQPA 4N5SA 1T05A 3L2VA 3ASMA 4DTUA 1X9WA 1Z26A 2DFHA 1S1XA 3ALYA 3ISNC 1NJWA 2QKKA 4M3RA 3D0PA 4C8MA 4CF9A 3UIQA 1BIZA 1RT1A 4IFYA 3K57A 1YT3A 3P5JA 4CJSA 3MEDA 3HPOA 4DFJA 5I42A 2YKMA 4HCCA 3A2FA 4CF0A 5FRMA 1YTUA 1C1BA 1S1WA 4CF1A 1Q9XA 4XIUA 4DQIA 2WONA 3WNFA 4HUFA 3TI0A 3EZ5A 3M8QA 3HO1A 2NUBA 4CF8A 4CGIA 4CJKA 1QSLA 4DSLA 3B6OA 3AO1A 2VWJA 4AHTA 3KKSA 2EX3A 1SL0A 1KRPA 4C8KA 3OYEA 3DRSA 4NCBA 1ZBLA 2HHQA 4B9TA 1CXUA 1LW0A 4E7KA 1BI4A 3ZT2A 1C0UA 5HBMA 3VQ6A 5CYMA 4M41A 3ZSOA 3FI7A 2YHAA 3OYIA 3L2UA 4FJ5A 2HHUA 1EP4A 4KV8A 4RW8A 3NH1A 1IKWA 1JL2A 3NF8A 1RTJA 1RDCA 5C42A 4ID1A 3AV9A 4CF2A 4H4OA 4E19A 1D9FA 3AVKA 4ELTA 4WE1A 3SCXA 5CZ2A 2OYQA 3HPHA 4DQRA 3SI6A 1WN7A 2Z1HA 3HT3A 3RMCA 3TAQA 4CJPA 3SUQA 1WSGA 4C8OA 4FJNA 3DOKA 3V9ZA 5T7BA 1HYVA 3CQ8A 1L5UA 3IAYA 4BE1A 3M8RA 4KAZA 1L3SA 1VSKA 4CERA 4CJUA 3DYAA 3RRGA 1T03A 1J9AA 3NGZA 2BGGA 1KFDA 1K6YA 5K14A 3SUNA 1TK8A 4Z4HA 3HYFA 4DQQA 4AHUA 4DLEA 3THVA 2PYLA 1RT4A 2BANA 3AVCA 3PUFA 3VQ9A 3RWUA 1NJYA 4NCAA 1NKEA 5J1EA 4F3OA 3HK2A 1U47A 4FLYA 3D45A 3VQ7A 2HHVA 1EETA 4IG0A 4OVLA 4DU1A 2DY4A 4CEEA 4CHQA 5HRPA 1KVAA 3VQ5A 3CFRA 4M3ZA 3LP1A 3AVFA 4O5BA 1TL3A 4FM0A 4FJLA 1HPZA 1WSEA 3LWLA 2G8WA 4LD0A 3ZT0A 3O3GA 3HPGA 4CJVA 4DTNA 1UA1A 1TVRA 2B4JA 3DLKA 3RR8A 4M3UA 5D3GA 1RILA 1HJRA 4DTXA 3KD1E 4OLBA 1NJZA 1BCMA 5KRTA 5FDLA 2XY8A 2ITGA 4OGEA 4CHPA 3I0RA 2D0AA 3SUOA 2KQ2A 3U6FA 4Z4FA 3V81A 4DTOA 4AHCA 5HROA 1FXXA 4B9MA 3VQ8A 1QSSA 1D5AA 1ASWA 3M8PA 4B8AB 5C25A 3DLRA 3F73A 1TKDA 4M3XA 2HVHA 4DSEA 2P5OA 1IO2A 4CK2A 3HJFA 4CIEA 3OVNA 1BCOA 3VQBA 4EZ9A 4EZ6A 1LWEA 4E7HA 1KTQA 2Z1IA 1A5XA 4Z4IA 3K59A 5HRRA 4MQ3A 5DMRA 3KJVA 4OLAA 1NJXA 3LAKA 2QKBA 1VSJA 4FM2A 1TAQA 4OJRA 3MXIA 2A1RA 4FJ7A 3TARA 4CJTA 1U04A 3KLIA 1TK5A 2R7YA 3TANA 4FM1A 3WNGA 3MEGA 4CHNA 4JS5A 4E0DA 1JLEA 3ZSVA 2HHSA 1RT3A 3HP9A 4CESA 1VK0A 3SZ2A 4DF8A 4FW1A 2YV0X 5FROA 4DS5A 3T1AA 2P51A 4RW4A 2XHBA 4DTJA 3KK1A 1J53A 3NF7A 4IBNA 3ZT1A 3RMBA 3VQEA 4B9SA 4JRPA 4CFCA 4E1MA 4DQPA 1RBTA 3ZSQA 4DG1A 1HYSA 4BDPA 2HNZA 2EHGA 2FBVA 4B08A 4DSFA 4CE9A 3SNNA 1UOCA 1WSJA 3O3HA 4KTWA 4KHSA 3SQ0A 5E41A 2E4LA 4FXDA 1BISA 3HXMA 3VA3A 2YNFA 2PYJA 1YTAA 3I8DA 3ZCMA 1NK5A 5CYQA 4UQGA 1QQCA 4KREA 3NGIA 1FKPA 4JLHA 1LWFA 1QE1A 4AHVA 4B9VA 1WLJA 1L3TA 3VQQA 4Z4EA 3PV8A 1NKCA 4L8RB 2D0BA 1KVBA 2I5JA 1KLMA 1Q8IA 4CEFA 2F8SA 3ZSWA 3LAMA 3LPTA 4F2SA 4H8KA 4BDZA 2OA8A 2F8TA 1TV6A 3O3FA 1U4BA 3S3MA 1J5OA 1BI4B 2A1SA 2OPRA 1RT6A 1MU2A 4PWDA 4E7JA 3AVGA 4GVMA 1LAVA 4N56A 3NE6A 1KLNA 2DFFA 4LY7A 3KK2A 3C95A 1W0HA 3C6UA 4RG8A 3HSTB 1W9HA 3KLGA 4FLUA 4FZXC 4HUGA 3MXJA 4EP5A 4DQSA 3TWHA 1JLCA 3OYFA 3CM5A 1TKXA 1QSYA 1CZBA 4DTRA 3PX0A 4DS4A 3V1OA 3TAMA 4DU4A 2D0CA 5HLFA 1RNHA 3MECA 2X78A 4CGFA 1QTMA 1L3VA 2G8KA 2DTUA 3RMAA 1U45A 5J2MA 4J2DA 3AVMA 4YNQA 3OY9A 3HP6A 3P1GA 1T8EA 4PUOA 1TAUA 4KI4A 3TAPA 3PY8A 4FJ8A 4M3WA 3B6PA 1CLQA 1SKRA 3AA3A 4CHYA 4FZZA 3AVHA 3SQ2A 1KVCA 3NF6A 3ZT3A 3H08A 4CFAA 3OS0A 4AH9A 3AO2A 1C6VA 4E1NA 1BGXT 3DLEA 3ULDA 4OKJA 4DFMA 1NK0A 3KLEA 4QCLA 3VQ4A 2IOCA 1IKVA 3AVLA 4FW2A 3HVRA 4DFPA 3TAFA 4FZYA 2PY5A 1ITGA 3KK3A 1JLQA 2Z1GA 3DLGA 4F2RA 3OJUA 4FK2A 4I9LA 2VG5A 3AVIA 4LH4A 1QHTA 4IDKA 4LH5A 1XWLA 4IG3A 1CZ9A 3EYZA 5KGXA 1X9SA 3AA2A 3QEIA 2R7FA 3NCIA 5C24A 2IGIA 3L2RA 2OPSA 4EP4A 3ZSRA 4QAGA 4DF4A 3NBPA 2X74A 4F8RA 1S9EA 1QS4A 3LDSA 2XY6A 4G1QA 4I9QA 4E7LA 4GMJB 5SWMA 3QNOA 4CECA 1I39A 3HM9A 4B9LA 3LP0A 3QETA 1KFSA 3DM2A 4PQUA 1C1CA 1IKXA 3V9SA 4M3YA 2BE2A 1YVUA 2ZE2A 3ITHA 1HNVA 1JLBA 1LWCA 4DWIA 4FJKA 4FJHA 1ZBFA 3F9KA 1D9DA 3K5NA 1C0MA 1RT5A 3ZSXA 4CJQA 1TK0A 4FJXA 1TKTA 2FBYA 3JSMA 4DSIA 3DLBA 3KTQA 3PO5A 1Z25A 1ZBIA 2HHXA 1BIUA 4QOZB 2KFZA 2KTQA 4CJFA 1EX4A 3SUPA 1C0TA 2HMIA 4DMNA 3NH2A 4ELVA 1RDBA 2ETJA 3LALA 3K5MA 3L2WA 4O55A 4I2QA 3QERA 3ZSYA 1SL1A 4I2PA 4DFKA 3OYBA 3VA0A 3VQAA 4CHZA 3OYNA 3E01A 2O4IA 3QINA 3QEXA 2ZQBA 4KO0A 3CFOA 5EU7A 2OPPA 3AVBA 4CEAA 4CIFA 1VSHA 3V4IA 1SKSA 4FJMA 3RMDA 4ZTFA 2IDOA 4CGDA 1F21A 2YNGA 1HQUA 3O4QA 1XI1A 4KPYA 3OS1A 1Q9YA 2BDPA 3LZIA 2OPQA 4CK3A 4NCGA 3FFIA 1TGOA 4HUEA 5JS2A 3SQ4A 1ZYQA 4ID5A 1WNSA 1JKHA 4KFBA 4HTUA 4FK4A 1KCFA 3MEEA 3NH0A 1WSIA 1T7PA 4K8ZA 1I3AA 2IC3A 4FYDA 1S6PA 4J2AA 4CEOA 3PX6A 2GBZA 4PA1A 4KHNA 4GW6A 1HMVA 5HP1A 5I3UA 4OPKA 4LSNA 1XC9A 2KZMA 2G8HA 4DSKA 1N5YA 5J2PA 2AJQA 1S5JA 3P83D 3O4NA 1RTDA 1WAJA 4KB0A 1VSMA 1VSIA 3HVTA 4ELUA 2LSNA 5CY4A 1CXQA 1WSFA 3AVAA 4KKOA 4RW7A 1R0AA 1U48A 4W5OA 4RW6A 1LAWA 4E7IA 4BACA 3CG7A 2PZSA 5KRSA 4FLXA 3G0ZA 4B8CA 2E6LA 2Y1IA 4B9NA 4E89A 3KLFA 1RTIA 3QNNA 3HL8A 3RRHA 1J54A 2RKIA 3AO5A 1BL3A 1SV5A 3CYMA 3G10A 4CFDA 4Y1DA 2HW3A 2O4GA 1B9DA 1FKOA 3OYAA 4CEDA 1ZBUA 4CEQA 1HQEA 1VRUA 1NK9A 4AILC 4KI6A 4CIGA 3K58A 3OYGA 3NF9A 4Z4GA 3QIPA 1REVA 3AA5X 4ICLA 4KHUA 3DRPA 5KGWA 1FK9A 1DTTA 2HNYA 3MAQA 3BDPA 2IS3A 5JS1A 4HVJA 3K5LA
chains in the Genus database with same CATH superfamily
2YDEA 4FLZA 4FJ9A 1BHLA 3AA4A 4KHYA 1JR9A 2ZD1A 2VG7A 3CIPA 5A2QO 4LBEC 3T19A 1EO1A 1KC8O 3ASNC 4O0IA 1L3UA 2JRIA 5IYBO 4B3TB 2FF3B 4Z0UA 2G8UA 4J2EA 1POV0 3OS2A 3AO4A 3CC4N 2RDCA 5FPDA 4H5RA 3JD74 2PW9A 4CGHA 3VN5A 1BL8A 3VQDA 2ARHA 4DB3A 1FXKC 3K0SA 3KD5E 3DRRA 1AILA 2LW1A 3NAEA 3IG1A 1GLCG 2EZPA 1LV5A 4LF5B 4LC9B 4DR7O 4PA3A 5GTIZ 1RT2A 4BRHA 4BDYA 4DV2B 4RHV4 4ISGA 4BGBA 3KLHA 4CEZA 4W5RA 3ULEA 1S77D 4CJ4A 2HBLA 5IT9N 1TL1A 3X2QB 2OIGA 4O2BA 5GW7A 3OYDA 4DTPA 1G15A 1YF2A 3AVNA 3ZN1A 3TETA 2QJ1A 4DUZO 3TXSA 3J81N 1SA0B 4A62A 3SJCC 4CJ3A 5AQRA 4DR7K 3KIOA 4YTNA 3VQCA 5AJ3K 3WXKA 1X9MA 1SKWA 1OH5A 3ZETA 1NVPB 2HVIA 3CFPA 4KB1A 5IWAO 1TKZA 3L2QA 2OZMA 1S9GA 1Y74B 4JI5O 4DUZK 3SDLA 5I9EB 3JASA 2HG5C 3O9RA 3WNHA 3SQ1A 2P06A 1SQFA 3MCPA 1NJIO 5AQFA 3CM6A 4ZTJA 3TK1A 3X2QC 2ZGZA 4W5QA 5IWAK 5GADP 4DKWA 5C2FA 4NYNA 2YXLA 5EC1C 3R6MA 2AP1A 3WXLA 1Y4MA 2Z1JA 3CJ1A 4JKGA 3ZEUB 4BRLA 3UB5A 4JI5K 4N41A 4LF4O 4KTQA 1ZP0A 4J7JA 4QPJA 4TOIA 1P7BA 4FLWA 1S1VA 1N0NA 3QLHA 4WFBL 1LW2A 4BGAA 2NRTA 3HKEB 1WPBA 4C8NA 4DSJA 3CCSN 1SZTA 4BR0A 1NK7A 3DWLA 3U0ZA 3L8BA 4BR9A 4BIZA 1ZBHA 4GV6A 4KHWA 1SQKA 5BPNA 3CRAA 3CCUV 3QEVA 2QW9A 1R3KC 3OYLA 4YIOA 4LF4K 4KHPB 4U3JB 2IVOA 4CGJA 1ESVA 1GN4A 3P4SA 1RDAA 1ZSPA 1JLFA 4I55A 2Q73A 3WNEA 2O8DA 1BQ0A 1X1PA 4PY5A 4C7UA 1ASVA 1VQLV 2E5LO 4I0XB 2P9UB 2A79B 5LA6B 5KHKA 2A3QA 4RQFA 4KH6A 1QR9A 3VRAA 1L1FA 2BTOA 3CRCA 1A5WA 3MDQA 5KTQA 3EKUA 4LH7A 3WT0A 1KECA 2KZZA 3EHBB 1C1AA 1W7AA 3VQXA 1JL1A 4QNHB 3AEFA 1VRTA 2D5RA 4J41A 2R9RB 2RQ6A 4OKEA 3KCXA 4R50A 5L3GA 4N47A 3U3GA 1HRHA 4IOAL 3VETA 3STZC 3TABA 2E5LK 2Z3YA 2V7ZA 3SV3A 1IBMO 1NOZA 4X62O 2HOEA 3CMEN 3GDQA 3R1XA 4M3TA 3NFAA 1XL6A 4NLBA 2FL4A 3NHGA 2KHOA 5JQGB 5LYJB 4OGCA 5KX5A 3AO3A 3L2VA 3ASMA 1VQ4N 1S1XA 3VR9A 5AQHA 1MQTD 1BIZA 4JKAA 2IH3C 2KG7B 5JJNB 3CXHF 1IBMK 4LH6A 1TUBB 2P9IA 1YTUA 2E76B 3ABLB 1C1BA 1S1WA 2LGWA 4CF1A 1Q9XA 4LF9O 3EZ5A 4IYIA 3M8QA 2NUBA 3HO1A 4X8AA 3ZCCA 4X64O 1XREA 1QSLA 2AGAA 3B6OA 2PUSA 4OGQB 2QI2A 2EX3A 1UPGA 3K08A 4LFAB 3D2EB 5K1PA 4ISFA 2HHQA 3MX2A 3TGUH 1CXUA 1VQKV 1N4CA 1BZKA 4DO2A 1VQ7N 3DXMA 1M56B 3AE9A 1K4DC 1OZ0A 2IU3A 1R3LC 1C0UA 3OM3B 5HBMA 2XTAA 1AI4A 4M41A 3ZSOA 2ZE6A 5HL7L 3L2UA 3AK3A 4RW8A 2CK3G 2X6CA 1JL2A 4LF9K 3E2EA 1RTJA 2G38A 1H2MA 4MVSA 2JWLA 4ID1A 2IJKA 2QWNB 1B06A 4X64K 4EHTA 1ATSA 2P7TC 2P9PA 1ZL8A 3JAMN 4ELTA 3VQWA 4BR5A 1P8ZA 5B3SB 2OYQA 5E26A 4DQRA 4JTCB 2O8CA 1YF5L 1WN7A 1N34B 1IXMA 3UM7A 3RMCA 4CJPA 1WSGA 1VAZA 4MDAA 5T7BA 4B1UB 4BE1A 1WA8B 3ETQA 3M8RA 4LWSA 1VSKA 2R9AA 2XAGA 1Z05A 3DYAA 3RRGA 1J9AA 3NGZA 4JAVA 3C3TA 3SUNA 1N33O 3E9LA 4Z4HA 3ZYYX 4UCTA 1XQ8A 1M56C 1XMOO 4DQQA 4DLEA 1RT4A 3RWUA 2YI8A 4KL1A 1EN6A 1XILA 1MWKA 4BC5A 3HTVA 1GLJO 2ZD9A 4F3OA 4UVCA 3BY5A 3FZMA 4FPPA 1U47A 4FLYA 2FSNA 4BVOA 2QM1A 3EFFK 4OVLA 5B3SC 3F7YC 4DU1A 1R6NA 3CIRA 1N33K 1NTKH 1VQ5V 1K9MW 4CZLA 5HRPA 4CHQA 1KVAA 3VQ5A 5KPZA 1FYJA 3U4LA 5CB4B 3CCMV 4M3ZA 2EZOA 4K42A 3LWLA 2G8WA 4LD0A 4DW1A 3I56V 1GLDG 3HKDB 2V4DA 1HNWB 1TVRA 3DLKA 4DRXA 3ASOB 4GUNA 1RILA 3KD1E 1Q7YW 3P4RA 1Y66A 1BCMA 3W0LA 5KRTA 1HP8A 1URFA 2R9IA 1IG8A 2XY8A 4CHPA 1EN4A 2W0XA 4NXMB 4FK5C 1SS6A 3QFUA 3SUOA 5BRDA 3OTFA 1XL4A 2WLIB 1FXXA 2A42A 4B9MA 1M93A 3SPCA 1QZ6A 5C25A 1F7YA 3ENHA 3F73A 5F2RA 4BR4A 3T4ZA 1VQ9V 1RSOB 1KUQA 5AQVA 1WOQA 1YI2V 4X1KB 1YXBA 4FL9A 2HHHB 3VQBA 1AB3A 3ZRVA 2Z1IA 4L3QA 2ZF5O 2MW2B 2DW4A 1F51A 1YTFB 1L8DA 3M99B 3MDSA 4JN4A 4MLEA 5HRRA 1NJXA 2MK3A 5B1BB 3D36A 4LNUB 2ASMA 5LGUA 4PKGA 4WFNL 3MXIA 1TAQA 3THYB 2E2PA 4FJ7A 4ZKIA 3SYAA 2R7YA 1V4SA 3MEGA 2HF4A 5AQQA 4JS5A 4PL8A 4CESA 1AVMA 1VK0A 5DM6L 2OTJN 4DWIA 4BRAA 5FPOA 1SKVA 3T1AA 3KK1A 2DN9A 4BRQA 3RMBA 2HEPA 3SPHA 4YJ3A 4DQPA 2PI5A 1RBTA 2FXUA 3JS6A 3WB0A 4DCHA 4FOEA 4BDPA 3E83A 3K06A 2HNZA 3J80O 2JS3A 2YS8A 3G6EN 1WSJA 2XUMA 5ELZA 2FMLA 2Q67A 4QS9A 5LMUO 4B1WB 1VARA 5E41A 1BISA 3C6AA 2PYJA 5CYQA 4ZBMA 2YICA 3FKSG 3EXAA 4B9VA 5AZIB 3RYCB 4B7KA 1WLJA 2O8FA 2Q7GA 2YHXA 1HRV4 4U67L 1R6TA 2D0BA 2VQEO 1KLMA 1V9PA 4CD1A 3LAMA 5LMUK 3ABKB 2OA8A 1R084 1FFXA 2CH5A 2WDVA 1TV6A 4JF3A 3S3MA 4ZOLA 1AP6A 4O2AB 5AR0A 2QEXN 2OCCB 4PWDA 3AVGA 3EO3A 3NE6A 4KH4A 2DFFA 4K41A 2VQEK 2D2CB 4NLCA 2A6AA 3C6UA 4PD4F 4FZXC 1YJWN 3CHWA 3VF6A 5KPRA 1SF9A 1BMFG 3Q4HA 5BMVA 1VQOV 4B1VA 1K9MO 3AARA 3I55N 3OYFA 5M1FA 1NH2B 5F1XA 5H2FZ 1QSYA 1QR8A 3ZMUA 4BRDA 3V1OA 1RMU4 4DU4A 5HLFA 4DR7B 5BR9A 1RPOA 3ABKC 5LMNO 1BOTO 5TKYA 3RYHA 5J2MA 4PUOA 4JASA 5CA3A 1P49A 4FJ8A 4M3WA 4CZKA 5FL7G 1S5HC 2GTSA 1PD3A 4RUFA 4FZ0A 3T4DA 4LR3A 3C7NB 3QO5A 4O8UA 3DLEA 4DUZB 3LDPA 3ULDA 3ETDA 3KLEA 3HVRA 1YJNV 1ITGA 3SMSA 4A5UB 3G4SN 2PI4A 5LMNK 4J10A 2AZ0A 3FB7C 1HPMA 4F2RA 4LFCB 4PHZA 4PDVA 4B3SO 1KXPA 2OCEA 4HWIA 4IDKA 1XWLA 3EYZA 1X9SA 5LOVB 2WLKA 3NCIA 3GVMA 3HOSA 4JI5B 5GONA 3FD9A 1FXHA 3ZSRA 3NBPA 4F8RA 1KP2A 1PNKA 3LDSA 4X9QA 1NU1H 4GMJB 5SWMA 1ATRA 3F5WC 4CECA 2QM7A 3HM9A 3R66A 4B9LA 1AR94 2O8EB 3QETA 4RUEA 5CBFA 4PQUA 1C1CA 2VYPA 1IKXA 3V9SA 4O4JB 1YVUA 2ZE2A 2N74A 3A0IX 3FLCO 1LWCA 2Q31A 4FJKA 1JMKC 1ZBFA 3F9KA 5LJVA 1TK0A 1RT5A 1VBE4 4A2AA 4CJQA 4FJXA 1ZBSA 4LF4B 2FBYA 3DLBA 1ZBIA 1U96A 2HHXA 3TTFA 5LP6C 4CZZA 3VEWA 1L0NH 4CC6A 3QMLA 1WB7A 2JJ1G 5BZBA 4JI2O 4YORA 1RDBA 4DMNA 3L2WA 3K5MA 1Q82O 3D7EO 4BR2A 4X1YA 3ZSYA 1HX1A 2F9TA 3OYNA 3JCUZ 4WBNA 3QINA 1L0LH 4TV9A 4H5TA 4PI2A 3BUZB 3T7ZA 5B1AC 2NZTA 3CXCU 4E1JA 4JHDA 3TJTA 1KKCA 1AJQA 2W0FC 1BHAA 1RDWX 4MTFA 3AVBA 3PLAA 1IX9A 4TUYA 1VSHA 3V4IA 4JI2K 2E5LB 1QQNA 1G6UA 2HKOA 3OMAB 3DJCA 5AFUA 4MVRA 4IT5A 3AG2B 4R6ZA 1JFFB 1TUEB 1F21A 4KFMA 1GLAG 1M57B 1XI1A 1VRH4 4KH5A 4MVMA 2DQ3A 4XEIA 2JEUA 3LZIA 2YEVB 2P9SA 4H5VA 1TGOA 4NCGA 4A5BA 3SQ4A 4ID5A 1JKHA 3E1YA 1BWFO 1KCFA 3NH0A 3CCQN 3FR0A 3CMAV 4K8ZA 3HZ6A 2R074 3OW2U 3VEXA 2NRZA 5IYDO 1S6PA 4CEOA 1KQSU 1M1KO 3ZX3A 1OCCB 3C65A 4LSNA 5ADXH 1XC9A 1IBMB 1T5EA 2QTOA 4DSKA 3CJ7A 2YXYA 5J2PA 3P83D 1RTDA 3O4NA 1GM7A 2HBMA 2QWQB 2BUPA 3CCLN 4BVPA 4DV7O 2LSNA 4P30A 3P4QA 3ZX0A 4YOVA 4W5OA 2PGGA 4RW6A 4EB6B 1LAWA 4YXDA 3CG7A 5JJJB 5JVDB 4ZI7B 3THWB 3ZIAG 2Y1IA 1ASJ4 4MTOA 3AG2C 3HL8A 3EZWA 3RRHA 4DK0A 1M57C 4MVOA 5CA1A 2N04A 1P90A 4WQ5A 1CPYA 3K0GA 4CH4A 1SV5A 4QE7A 1B9DA 1FKOA 4LF9B 1NGEA 1BO5O 1ZBUA 4CEQA 1EWQA 1HQEA 2EIJB 4KI6A 2P6JA 3K58A 4DR5O 2P9LB 5LXTA 4DV7K 4Z4GA 2HJFC 5LHHA 1N8RO 5A2QN 3G6BA 5KGWA 1DTTA 1OCCC 2IM9A 3BDPA 5JS1A 1HDJA 3AVJA 2KB1A 3K9KA 4PKIA 2NLXA 1EQYA 4MVZA 3QNEA 2PAVA 2XY5A 3AK2A 3TAGA 1U49A 1E4FT 3GB7C 3VF4A 4IIJA 5B1OA 2P90A 1Y97A 4DR5K 3IC7A 4JZ2A 3LSQA 3ZRWA 5J2QA 4J8FA 2N05A 2LJ2A 1S5LZ 3BGRA 3STLC 3N2GA 4JD2A 3SFEA 3H46O 2EBOA 3LPUA 1JQ0A 4J2BA 3V9XA 1RUJ4 4TQDA 1HYZA 1K73W 2JDIG 2P5GA 3CP1A 2RE2A 4E3SA 3LZJA 2JGDA 3GQHA 1NENA 1J5EO 2HHWA 2JJ2G 1UAXA 2AA4A 1YQ3A 3UCSC 3ZMTA 1V55C 3EY1A 1N33B 4EKWA 3ULEB 1D8YA 3ZT4A 2QWPA 4DUYO 3A0BZ 1JVMA 4F6EA 1G99A 2P9KA 1NM1A 4NR1A 5EIBD 3LM9A 4MLHA 1NCQD 2FBTA 1NBWA 2WU2A 1LCUA 5JICA 4I4TA 3BP8A 3SK3A 1J95A 1OVQA 2YC0A 2VG6A 5D5PA 1SZXA 4ZHQA 5BRHA 4MFBA 1J5EK 1XHZA 5LGTA 2ZJQL 2HHTA 2B9ZA 3E8BA 1Y64A 2WLNA 1T3VA 4KRFA 2YCHA 4U3FH 1RT7A 1S0VA 2I7NA 3LANA 4DUYK 1GOBA 2Y4UA 2E6MA 3QO9A 1YITV 1JLGA 4BW5A 4Z1MG 4GB34 1EKEA 2YNIA 3JASB 1C0GA 2D0OA 3VGMA 4Z2WA 4WCEL 3OYCA 4CH3A 4NYFA 3CCVN 2ZXWB 4DV0O 4JNEA 4O5FA 3ETEA 2WP9A 1KAXA 2RS54 3OHRA 4CJLA 1VHXA 4WFAV 4IFVA 4CGGA 5JVGL 4DR4O 2FBXA 1VQNV 3N2KA 4H4MA 1YQ4A 4JKGB 1AROP 2BSKA 1IJJA 2ZWHA 1GLFO 4BE0A 3S9HA 3SYZA 3S3OA 3VEOA 4Z4CA 4GKKO 4CEBA 4DV0K 4J7KA 2L35A 3HRGA 3DI6A 3TCUA 3GWKC 4FVMA 2YHBA 3KWGA 3OYHA 4ICGA 3CJHA 4F3TA 3TAEA 4HTLA 3B8MA 4IKFA 3T3FA 4DR4K 1G1XB 1TA8A 4I7FA 1XHXA 4YXWG 1NR1A 3CS5A 2XASA 3IGAC 2B5JA 2DYRB 2HF3A 3H01A 4H33A 4KBOA 5CZ1A 3TR8A 3RTVA 3DC5A 2WC9A 2Q36A 1RUG4 2RM24 4GKKK 4I7ZB 4I55B 4MDBA 1NK8A 2O8DB 4CI6A 4PA4A 3ZEDA 4Y0WA 1UWBA 1B3QA 3E8HA 3C94A 5AQMA 4BC4A 4W5TA 4W5NA 5GIOA 3DOLA 1BQMA 3C6TA 3U8XA 4EIAA 1V4TA 1RDDA 2GELA 2F7TA 3R9PA 4FJIA 4Z1VA 1X9JA 3KKYA 4IFEA 5J2NA 3SPYA 4H0PA 2NRWA 3NDKA 4CJWA 5LMUB 4FWSA 4FLTA 4M42A 3ASNB 1OVYA 2EIMB 2GTDA 2HBKA 3CRMA 4D6TH 1RBUA 5M1KA 1H2LA 5C12A 2CTRA 1UA0A 3PO4A 1Q6UA 3CSXA 3FAVA 1GOAA 3SJJA 2WU5A 1B92A 2EJ7A 3SAHA 1MG1A 3VRBA 3UO3A 2HVKC 1H8HG 2DYRC 3W7UA 5KPTA 3T1YO 3ZHRA 5SZTA 1OCRB 2P1JA 1GLLO 5KX5B 1K73O 1FKAO 5FLXO 2VQEB 2IJHA 5HRSA 3VQPA 1T05A 3J8AA 2DFHA 2WSSG 4DV1O 5KQDA 2HMPA 2QKKA 4M3RA 4CF9A 3FB8C 4BIUA 4IFYA 3P5JA 4HCCA 4X89A 1Z5WA 3HPOA 2YKMA 3A2FA 2P9IB 3ENOA 3ZX6A 3MWPA 4XIUA 4J42A 3TPQA 3WNFA 3T1YK 1KD1O 4Q20A 1M90W 4CGIA 4CJKA 1YEWA 4BR7A 4DSLA 2FBWA 1SQGA 3LSSA 2VWJA 2EIMC 1SL0A 3DRSA 4DV1K 1ZBLA 2E2NA 4B9TA 2H94A 3DXMB 5EYPB 3BHPA 2Y0PA 3ZT2A 1D4XA 5H1SQ 4UFZA 3OYIA 1OCOB 1OCRC 2HHUA 4KV8A 3NH1A 1IKWA 1RDCA 3MMVA 2RS14 2D3OW 2WA4A 1G8MA 2P9PB 1ZL8B 2VS0A 1D9FA 5LMNB 4BC2A 1NS1A 3SCXA 2O8CB 2Z0AA 2IBZH 5IJ0B 4WFBV 1JCFA 3M3ZA 1I08A 3FB5C 3O8MA 4NTXA 4C8OA 1PKXA 4G27B 3ICXA 1RFQA 4LWSB 3IAYA 2A0LA 4RTFD 4KAZA 2OCHA 3JXUA 2Q0AA 4X65O 2QWMA 1VF7A 3SYOA 2Q68A 5FPEA 1SQBH 3QDKA 2ZIMA 1KAZA 1I94O 1SQQH 1OH7A 5CR4A 1TK8A 3D3IA 3BABA 3JAKA 4UVAA 3ZHQA 5AQNA 4DR3B 2E75B 4UUJC 3THVA 2PYLA 1NKDA 2BANA 2P9NB 5AQTA 4CZEA 1NBMG 1OCOC 3O9UA 3HOTA 1VBA4 3BA9A 5J1EA 5IY5B 2Q7HA 5E84A 1E3MA 4ILJA 1I7FA 2HHVA 4FZ1A 4X65K 2YIDA 1EETA 3W7SA 4IWVA 4LF7O 4JZGA 3O5BA 1I94K 4H5NA 4GLXA 5J2TA 2WAMA 4HNAB 3QFPA 2BH1A 3AVFA 1TL3A 4FM0A 3WEEA 1BGYH 3HPGA 3CPEA 3RR8A 2ODMA 5IE9A 3PJSK 5GAHP 3KG2A 5KHJA 2ITGA 4M7YA 2D0AA 1EFRG 5GAEP 2R064 4LF7K 3V81A 1NGBA 5HROA 3VQ8A 4JI2B 1VF5B 1QSSA 1PNMA 3HR0A 4J11A 3M8PA 3DLRA 4GNIA 1TKDA 4IHJA 3QTCA 3OBYA 4Q4V4 3A8TA 5IY5C 4ISEA 1PV0A 2FKXA 2BTQA 3L71H 4EZ9A 5BR8O 1Z5VA 2ZT9B 5AFUH 1ZUQA 5MLCQ 3MD0A 3I8BA 4BRGA 1ZC6A 3K59A 1FS0G 1MDUB 3LAKA 4XBFA 1HKCA 5JWPA 3JALA 1FJGO 4OJRA 3WXJA 3CC7V 3J7AU 1YJ9V 1W97L 3AE3A 1U04A 2QA4N 1W0KG 1TK5A 3AAQA 1NA1D 3C6HA 5IYZA 3K9JA 4CHNA 4E0DA 5KLVH 1JLEA 4BRMA 5KA5A 1FPOA 4E2LA 1SAZA 4JPRA 5BY1A 3HP9A 4N23A 4PA9A 3VOUA 3SPGA 4CZJA 2YV0X 2AZ2A 3BAAA 4DS5A 3J80N 1X59A 2XHBA 1ZTEA 1MZFA 3D3QA 4JI6B 1J53A 3ZT1A 1VMGA 2OTJV 4YJ3B 1QQMA 5M1NA 1FJGK 4YOWA 3FFKB 4LF8K 2H3OA 5AQXA 4TT3G 3FYEB 1S72V 4DG1A 3SNNA 3AG1B 2M6YA 4DV7B 2RCVA 1SC5B 2WUSA 3OUSA 3D36C 2FTKA 4KTWA 2ZINA 3SQ0A 1KKDA 1YDXA 3CE2A 5EBWC 2YNFA 4BQLA 1KF6A 3AE2A 4UB8Z 2VCPA 3O9QA 3NGIA 4JLHA 2P4VA 4DXWA 1AR4A 3PIOL 3G67A 1QE1A 4AHVA 4B1YB 1Y67A 1L3TA 4Z4EA 4X62K 1VBC4 4CEFA 4DR5B 2H88A 1Q8IA 4DQ8A 3LPTA 1FFXB 1KBHA 2F8TA 4ZOLB 4JKFA 4HAMA 4H0VB 1BI4B 1EV14 3CD6N 1BSMA 4JGSA 3S3WA 5BN8A 3VGKA 3AG1C 2V52B 4GVMA 3TTCA 2GHYA 4N56A 4LY7A 4JKBA 5AQLA 5HFLA 2UXNA 2XAFA 3C95A 2OTLV 4FFBA 2P67A 3SYPA 3KLGA 4X20A 1K97A 3Q4HB 1MSDA 3MXJA 4WFFA 3TWHA 1YIJV 1YJWV 3PX0A 4DTRA 1IVSA 3RVYA 1K8KB 3JD1A 3OGIB 3CWBH 1WJZA 1J5EB 1RNHA 2HSTA 3MECA 3O1BA 5FPNA 1QTMA 3WB1A 1L3VA 3RYHB 3RMAA 3J7AP 5C0YA 4YTPA 2B1GA 4J2DA 4WQ4A 4YNQA 3HP6A 3L73H 1H2GA 2UXCO 1OHHG 4KI4A 1E1RG 3PY8A 2FLOA 4DUYB 4IEIA 4D7SA 1NTZH 3AA3A 1NT2B 4CHYA 2ZJRL 3AVHA 2WDRA 4CFAA 3GL1A 4HVJA 4JAXA 3G71N 3WU2Z 5F2VO 4X66O 4YDUA 4FFKA 4GVEA 4DFMA 2LP7A 4NTWA 3P4IA 1NK0A 5L3DA 2EILB 1US6A 2CGNA 2F93B 3ZBHA 2PFUA 5DM6V 4JI4O 3KK3A 1IZ3A 2UXCK 5L3EA 2Z1GA 3DLGA 4LF8O 2V51B 3N4PA 4FK2A 2X7RB 2VG5A 3ABVA 3G4SV 1QHTA 3AE1A 2W41A 4LH5A 2ETNA 1CZ9A 5KGXA 3OTOO 3AA2A 3VEZA 1XMOK 3PN1A 5GONB 3MN5A 3H1IH 5HFMA 5IT9O 3LDEA 3SAFA 3L2RA 3MHSC 2ZJPL 3ATVA 4UB6Z 4DF4A 3CC2V 2X74A 3THXA 4JTAB 3O4WA 4G1QA 4DV0B 3OE7G 4JI4K 3H1KH 2XY6A 3J81O 1I39A 3ZRSA 1VQ8V 2W6JG 3W7XA 4FSVA 3A0HZ 3U10A 3RGBA 1HLUA 2ADPA 2X0LA 3HBTA 5C2DA 4DR4B 4BRPA 5C15A 1NGHA 3BPZA 3OTOK 4M7XA 1D9DA 3KHYA 4CZHA 3H3NO 3BF3A 2EILC 2QKAA 2BE3A 5AQPA 1TYQA 3KTQA 3PO5A 1XNQO 4GKKB 1QVFM 1BIUA 2KTQA 3VBBA 1EX4A 4YHHO 1BDGA 1VQMV 4N21A 4ELVA 3NH2A 1ILYA 4X1YB 2ITCC 4PDMA 2V1DA 3P32A 3C3SA 1PO14 2UYTA 1CEZA 1XNRO 2O4IA 3KVGA 3CX5F 1BA0A 2NRXA 4KO0A 1OV9A 3GBTA 1XNQK 5EU7A 4RWUA 3VEYA 3CCUN 3HKEA 4BWAA 3CCEV 2E1ZA 2VGNA 3DAWA 4CIFA 4YHHK 1FD9A 4BRCA 2IDOA 4JI1O 3O4QA 3SPIA 1HQUA 4BRIA 2P9SB 4HUEA 2R72A 1HW7A 4U3JA 1N32O 1VQLN 1XNRK 4KFBA 4FK4A 3P31A 1GMGA 1YHQV 4FWRA 1PO24 2EULA 5EK0A 5AZJA 1I3AA 4FWQA 4JK9A 4LF6O 1VF6A 3AG4B 3BEHA 5H5NA 3ZMSA 3BEXA 3PX6A 4J2AA 4DK1A 4GW6A 3CCQV 4FPBA 5HP1A 4CH5A 1U2VB 5I3UA 3UKUA 3HPLC 1N5YA 4JI1K 3AE4A 2WA3A 4PA7A 1S5JA 4CBCA 2AJQA 3T1YB 4NB4A 2ZKOA 1M4UA 1Q6HA 4ELUA 2GWJA 2KLAA 5CY4A 3UQ8A 4YJ2A 1CXQA 1WSFA 1EM1A 4RW7A 3ZLJA 4U7NA 3FFQA 2QWOA 2PZSA 4Q4Y4 4DV1B 3CJAA 4LF6K 1HJOA 3G0ZA 4B9NA 5CA1B 1QQOA 4TV8A 2GUZA 3QNNA 2UUAO 3EN9A 2HW3A 1MNGA 3OYAA 5JQGA 1NGFA 4CEDA 5M1PA 4QJFB 3F9MA 1NK9A 5LXTB 2RMU4 1IURA 1AJPA 1AI6A 2RNBA 3AG4C 3RYIB 3AA5X 3B2EE 5EC2C 3DRPA 1UFIA 1FK9A 2HNYA 2IS3A 2KG7A 1K5QA 3EE8A 5FNVA 2YXHA 2CE4A 1KYOF 2UUAK 4QIWF 4NYKA 3SPZA 4Q0BA 3LWMA 4IIJB 3CCRN 4DV5O 3O6WA 2ITMA 1VQKN 1RUF4 2F95B 3IMXA 2WLMA 3IFXA 1HNZO 3L3UA 2H3GX 3H9VA 2OWOA 4EFHA 4I6MB 4O4GA 1K7DA 1Y76B 4GV9A 4A5AA 2PTMA 1Q7YO 2NRRA 1S6QA 3SMPA 4WQ5C 3JARA 4CJRA 3AEEA 3QEPA 3DTUB 1IH7A 1P84F 1VSFA 4Q4W4 4NVPA 3LP2A 3LDOA 4BY9C 1CZAN 3OAAG 4IEEA 4AM7A 4YFUA 4DV5K 2JGDB 1TAEA 2QWNA 1DTQA 3T1HO 1MA1A 4JI7O 4B7EA 4X65B 1ZXOA 2IAJA 4WYBA 2F96A 2LO1A 3U3YA 3O9OA 1I94B 4OPAA 4XDLA 4JK8A 2KW4A 2QWPB 1X3NA 5CHIA 4YSZA 1RCHA 4I5SA 2P9KB 3FZKA 2CTQA 5LL6Z 1Y6XA 1O1WA 3JAMO 3E22B 3QESA 4B9UA 4CCHA 3GQKA 5LP6B 1QNMA 5IWAB 2ZQMA 2E20A 4LF5O 3QEWA 2G8FA 4JRQA 1VQPV 4ZHQB 3WXMB 3ABTA 4FLVA 2EIKB 4AHSA 5FRNA 5LHIA 3T1HK 3SR2C 4JI7K 2YIAA 3DMJA 4FPAA 3MXMA 4LF7B 2XO7A 2R044 5KAFZ 4I50A 2XT9A 1NK6A 2G8IA 3RVCA 5B1AB 5EVZA 3K2PA 2ZE7A 4B3SK 5AQZA 1VQ5N 3LDLA 3FB6C 3CCMN 1AI7A 4RW9A 4G9ZA 2I7PA 5EBLC 2Q97A 3I56N 3O80A 1NOYA 2F4VO 4CJEA 5AQYA 4DHYA 3CCJV 1JXEA 4ZHRA 4GV3A 4DV4O 1FFTB 4WF9L 4FWLA 1ASUA 1XOUA 4HCBA 1SQPH 4BWJA 4BC3A 2BCCH 2VWKA 1DLOA 1RP3B 2BSKB 2ZNIA 3SV4A 1JJ2M 3EVKA 4EEQA 5L3FA 3NVKA 2Q6AA 5IJ9A 4PDWD 2EIKC 2NRHA 1KB9F 4A59A 4I9WA 1JXBA 2YNHA 1E1QG 2YKNA 3OUFA 1VQ9N 4DV6O 4IZ9A 1WSHA 3L6QA 5LBQA 2Q2RA 4LSLA 5C8YA 1IG9A 4RWTA 2F4VK 3CJHB 3WUHA 3F2KA 5KQ8A 2Q5ZA 1FJGB 4DV4K 3J7ZO 2XY7A 1NK4A 1TVKA 1W0JG 3THOA 4H44B 5JLFA 4R5PA 3LP3A 2ZDIA 2IVNA 4FCYA 3NGYA 4PL7A 2X6NA 5AQGA 1RUH4 3OYMA 3AEGA 3ABUA 4DV6K 3OJSA 1H2KA 1WAZA 5TISZ 1Q18A 4KTZA 3QG5A 4BWMA 2DJVA 2IW5A 2B6AA 4HHTA 1YCIA 3THYA 4KHQA 3SGIA 3M8SA 2WDQA 1HRI4 1BQNA 2X6SA 4O4LA 4XDKA 4B1XB 5CA0B 3S3NA 4NB5A 2LQTA 1PPJH 4KHPO 1GLEG 2HNDA 2GSMB 3K03A 4X62B 1G4YB 1HNIA 3D6RA 4F6RA 1S1UA 3I0SA 4JTDB 3FX7A 4JKCA 1MOFA 2X5ID 4H37A 3CERA 4FJGA 1ZAUA 4OPJA 3VERA 1NGAA 4M45A 4CZMA 2XRIA 2W6KA 1VQ6V 4JI8O 2Y69B 2YUAA 3QO8A 3V9UA 1XQSC 2CGOA 2L6LA 3WXIA 1F23A 4RAIA 4O4HB 4KHPK 2RF2A 2V7QG 3C90A 4TQFA 4H0YB 3DXKB 3FZFA 3ZRXA 4N5SA 1NVPD 2JEXA 4X64B 4DTUA 4GZRB 2UUCO 1X9WA 1Z26A 2WQYA 4JV5O 4XDJA 1P7GA 3HI0A 3ISNC 1NJWA 4C8MA 4RCHA 1RT1A 5I42A 3B77A 1DF4A 1V55B 3MEDA 4DFJA 2DQ0A 1K5SA 1JJOA 5AZIA 4F4LA 3RYCA 4JI8K 4R79A 1JA8A 4DQIA 5KAIZ 4HUFA 3U9DA 3TI0A 3M8AA 1HR0O 3ATUA 3MN6A 3U9ZA 2Q69A 4OPHA 4WCEV 3ZHVA 3TTDA 3AO1A 3KK7A 4K43A 4AHTA 2VRZA 1ZLZA 2UUCK 3OYEA 1OOPD 4JV5K 3G25A 1N36O 1RPRA 4BRKA 1XEQA 1LW0A 4E7KA 2Y69C 2Q8VA 3H1VX 5AQSA 3FI7A 3ML0A 3CC4V 2YHAA 3VESA 4FJ5A 2D0PA 1VBD4 2UXDO 5KHHA 3NF8A 1VQON 2UXXA 5C42A 1HR0K 4LFAO 1YUWA 3K0DA 3AV9A 4CF2A 2E2OA 5H6QA 3AVKA 3CI5A 3ABMB 1FAFA 1Q43A 4MW3A 3O9TA 2UXCB 3HPHA 3SI6A 4FWKA 4MTXA 3VTIA 5AQWA 2Z1HA 1N36K 3TAQA 4MO4A 3DXRA 1XMOB 3RFRA 4O2BB 4GX1A 2EINB 1ATNA 3P3NA 2PBDA 5GIPA 1XUPO 2GUPA 3CQ8A 1L5UA 2UXDK 3JBG4 1A32A 1H38A 3LNMB 3W7TA 1COWG 4CJUA 4LFAK 1OKJA 3ENBA 3LM2A 2NNUA 4JI4B 1SQXH 3JAKB 1K6YA 1TUUA 3RBZA 5K14A 3VR8A 3OA9A 1OH6A 4LF8B 4RQEA 3ZETB 4A57A 1PL0A 2WLLA 3PUFA 1YJNN 5GTHZ 1NJYA 2BOBC 1B04A 1QZ5A 3OTOB 3C7NA 3B09A 3KCYA 4NCAA 1NKEA 5BPLA 3ZX2A 3ZMZA 3JATA 4UVBA 4KUMA 3TSPA 4IJNA 4NO7A 4XH4A 2QKCA 1NLVA 3D45A 3VQ7A 3ABMC 3H1LH 4JKDA 3VF2A 2DY4A 4DW0A 5J2TB 1DGSA 4MT8A 4CEEA 5EY4A 4O5BA 3RN4A 4FJLA 1WP8A 5LOVA 1KC8W 2EINC 3SLCA 3O3GA 4PV1B 2ASPA 1UA1A 4DTNA 2B4JA 2OT5A 4WFEA 1HJRA 2VWBA 5B1NA 1NJZA 2EJRA 3RVZA 1NMDA 4OGEA 2J4RA 4B3MO 3LDDA 3I0RA 1QCEA 1DT9A 2F9WA 3U6FA 4Z4FA 1V54C 2O8EA 3WB2A 3AE7A 1GK9A 5CMUA 4AHCA 4YHHB 4DTOA 1D5AA 1ASWA 4B8AB 4M3XA 1EBOA 4DSEA 2JK5C 2FSKA 3P39A 2P5OA 3EKSA 3H3OB 1IO2A 2BTQB 4WFHA 2HWC4 3HJFA 1JPXA 4YSXA 3OVNA 3EL2A 1Z2GA 1XNRB 4NXMO 4PI0A 1BCOA 1JCEA 1H1VA 1LWEA 1WB8A 1KTQA 3QB0A 1A5XA 3S41A 4E7HA 1NNEA 1R094 2RS34 3CCSV 1NR7A 4B3MK 1HWYA 2AHYA 3KJVA 4MS2A 5DMRA 3JALB 2FF6A 3L4IA 1VSJA 4FM2A 1NEKA 1DKGD 5GAGP 3AGRA 2O8BA 3IC9A 4JI1B 5LGNA 4B3RO 5IYZB 4CJTA 2QE7G 2HP8A 1NU0A 1IBLO 3TANA 1MSWD 5AQJA 1WLEA 1AR84 3NVMA 1MABG 1NGJA 2HHSA 1RT3A 4DR1O 1R6KA 4FW1A 4O4IA 1DF5A 5DM7L 4PA6A 3SJQC 1YVNA 4LF6B 4DTJA 2IU0A 3HKBA 2E74B 3NF7A 4IBNA 3VQEA 1S22A 3PIPL 3CMAN 4B9SA 4JRPA 4CFCA 4E1MA 4B3RK 3ZSQA 2YEVA 2ZM6O 1IBLK 4HZ3A 3TU5A 2DWDC 4UCVA 2EHGA 4B08A 2FBVA 4H5WA 4CE9A 1QHAA 4EHUA 1UOCA 1ROPA 3O3HA 4DR1K 4X1IA 3BZCA 2PF4E 1NWKA 3CMEV 2E4LA 2X6AA 1Q6IA 1ZX3A 2QM8A 5JH7A 4GKJO 3VA3A 1YTAA 1NK5A 3ZCMA 4KREA 4PJ0Z 2D4WA 4UQGA 1D4M4 1NI8A 2CH7A 2UUAB 2XAHA 5JCOA 5CBHA 3ZHSA 1LWFA 3F5TA 4TWKA 2QXLA 1VQ4V 4JI0O 2QWQA 2ZM6K 3DC6A 4O8KA 3J8F4 3VEVA 4BG9A 3RYFA 4R8CA 1NKCA 4L8RB 1KVBA 2I5JA 2F8SA 5H6RA 4UV8A 1S3XA 1XDCA 3ZSWA 5J2UA 2P22C 3CB2A 2VQFO 4F2SA 2AXTZ 3THWA 1XMQO 4AQYO 4BDZA 3CF5L 5CN0A 4YOYA 5C2TA 4GKJK 3A5LC 3O3FA 1U4BA 1J5OA 3CPWM 4R7CA 1U97A 2H89A 1RT6A 3SJBC 4DV5B 2E8AA 3SAGA 4JI0K 2B76A 1KLNA 3ZMVA 1VQ7V 1DLBA 5A9GA 3O9SA 3KK2A 1RUD4 3W7WA 4X20B 2ZGYA 2VQFK 1S76D 3HSTB 1XMQK 4AQYK 1NZ6A 4HUGA 3E66A 2E3CA 1WUAA 4EP5A 1HKGA 1JLCA 3AECA 5AQOA 3CM5A 1TKXA 4IDHA 5EXWA 1CZBA 1P4RA 4ASUG 3TAMA 3T1HB 1YTFD 4JI7B 1YVWA 4LFBO 4CGFA 1M9NA 1U45A 2B1IA 1OH8A 1TAUA 3P1GA 5JJEB 4PKHA 4L8JA 3NR7A 1E4GT 3B6PA 3AG7A 3APQA 3NXSA 2F23A 4FZZA 1DTOA 3SQ2A 4B3SB 1K4CC 2W6IG 4AH9A 3AO2A 1C6VA 4E1NA 1BGXT 4H0LB 3VQ4A 2CTPA 1SZ2A 2IOCA 3SPJA 3AVLA 2QTSA 3G71V 3CJCA 2XOKG 4FW2A 2PY5A 4AF1A 4DFPA 3TAFA 4LFBK 1KU9A 3LNNA 2GX9A 4Q4X4 5EZYA 1JLQA 1ZWIC 1SRYA 2Y48A 3MHHC 5E79Z 2ZIOA 4I9LA 3BFRA 2D1KA 4LH4A 3CETA 5B8HA 3JAWA 3T69A 3QEIA 2Z5UA 4P2ZA 5LY3A 1XC3A 1QVFU 5JVHL 2OPSA 3THXB 2A06H 3L75H 4DRXB 1NG9A 4WQ4C 2PLV4 1QLEB 3UT5A 4DU3A 5J9PC 1YITN 2F4VB 3QNOA 4LFCO 2ZNJA 4GX0A 3D2FA 2E1YA 2Q0UA 2NNWA 2YSUB 2KSDA 4DV4B 4JYAO 3HM8A 3LP0A 1W2BM 1KFSA 3QF7A 1Q90D 1I0HA 2YHYA 2DOSA 5DEDA 4FOIA 2UUBO 3T1CA 4YDUC 5KMGA 4B9QA 1HNVA 2WLHA 2IIRA 1Q81W 2C2AA 5IDJA 3K5NA 3ZSXA 1TYQB 2RN9A 1TKTA 4IOXA 4ABMA 3JSMA 1VQNN 4BW9A 1K33A 4DV6B 4WFGA 1Z25A 4LFCK 2KFZA 1IBKO 3UKRA 4CJFA 3OBWA 1C0TA 4HYOA 4MO5A 4JYAK 4UCSA 4ZIBA 3LALA 3RSEA 3GE1A 1LOTB 4O55A 5L3BA 3DLLL 2HVJC 1N0JA 1SL1A 2UUBK 1PVC4 3VA0A 2O57A 3A0RA 3M7MX 1SS3A 4JYCA 3JCZA 4L87A 3E01A 3VQAA 1QLEC 3E9PA 4CHZA 1GKFA 4QGPA 5BR8K 1JX9A 2ZR3A 3JD3A 2OPPA 4IO8A 3CRQA 4UY8O 1M90O 2CH6A 4CEAA 1IBKK 3HKCA 2F1MA 1SKSA 3IFRA 2LFRA 3LSUA 1NH2D 1EWRA 4CBXA 3RMDA 4JI3O 1EZJA 3A5NC 1RGIA 1SQVH 2QWLA 1Q9YA 5B5EZ 4CK3A 3FFIA 1GN6A 3AEBA 2Y0IA 5AZJB 3MEEA 3VQVA 1WSIA 4ILHA 1T7PA 3TSQA 4BRNA 2IC3A 4FYDA 1QU7A 3BCCH 2IJIA 1YXQA 1HMVA 3I33A 3UKUB 5FPRA 2E2QA 4JYBA 3G6EV 4JI8B 4JI3K 4DV3O 2QWRA 2FSJA 4FWNA 3BA8A 1WAJA 2O8FB 1VSMA 1VSIA 3HVTA 4YJ2B 4V19S 2CAZC 2QDOA 4BREA 2WS3A 4KKOA 4K35A 2QWOB 4OO1J 3CEIA 5EBMC 2UUCB 4JV5B 4B8CA 4JAUA 4TV8B 2GUZB 4E89A 3KLFA 4K0KO 1RTIA 2X6BA 4NKGB 4UCRA 3I5DA 4E4EA 1IV0A 2RKIA 5EIBC 3AO5A 4CS2A 3CYMA 1SETA 2GDSA 5ITZA 3G10A 4CFDA 1CP9A 4Y1DA 4DV3K 1FXKA 1K3EA 2CUGA 1HNXO 1HR0B 5ADXA 2QGNA 4AILC 2CGLA 3MX5A 4CIGA 1QBZA 1VF6C 3G80A 5LJWA 3NF9A 2ZCEA 3OD4A 3QIPA 4K25A 1REVA 2QEXV 5C3JA 2UXBO 4RO2A 3VQYA 5FNVB 1N36B 3K5LA 3LDQA 4K0KK 3BY6A 2GV9A 3MCAB 2Q9LA 3ZSZA 3R8EA 5BMVB 4C8LA 1M5IA 3SJHA 1R73A 5AG2A 4CC5A 3TXQA 2UXDB 1VSLA 2YX6A 1BS3A 4BE2A 1HNXK 5DK5A 2ADQB 3UO2A 4IJAA 3PX4A 3CJBA 3CCRV 1PM9A 2QM4A 3I55V 1VEWA 4C1NK 3JARB 5EYPA 2UXBK 4YY3O 4DLGA 2QK9A 4J80A 2UU9O 3JYTA 1W59A 1NGDA 3P38A 2DYSB 1Q81O 3RR7A 5KHGA 4H0OA 3SFDA 2HWB4 1S1TA 1AR5A 2FYUH 1EXQA 3FE1A 3AEAA 5IJ0A 1A5VA 2KFNA 3V1QA 5AQIA 1BT8A 2Q3SA 3LDNA 3ABLC 1XUQA 1RTHA 3EEQA 2Q1NA 2FC0A 3H45C 4YY3K 3C0BA 5H9CA 2UU9K 3R3LA 2H8PC 4XH1A 2YIBD 2G8VA 2JIZG 3MN9A 3OEHG 3OYKA 1GO3F 3E89A 5KUKA 1IKYA 4H0TB 1RBVA 3VOVA 4BQZA 3JD2A 4CHOA 2RPIA 4X66K 1SA0A 4C1NI 3IS9A 4CJ5A 4IGGA 4TSXA 2EWSA 4CBUA 4I50B 2NR5A 3P4PA 3AK1A 1JJ2U 2JGUA 5AQKA 2P9NA 3O1WA 5BREA 4CS3A 1JCGA 2JLEA 1BEV4 4DR6O 3K5OA 4O44A 2DYSC 1RBRA 1NKBA 1WPXA 1THZA 1RUC4 4AHRA 3AE6A 1Y74A 5BN9A 1RBSA 2DFEA 4B3MB 4DYLA 4CBWA 4CK1A 3E86A 4A2BA 3GG4A 4HNAA 1NQTA 1WAFA 3E8FA 3K9SA 4PELA 2RR14 2NRVA 4YOXA 2WOMA 2B5UA 4O0JA 3IRXA 4OKKA 4DR6K 4ILGB 3KKRA 5IJ9B 4F4KA 1AR1B 4B3OA 4FJJA 3UE5A 3SBTA 4Y1CA 1VSEA 3V6DA 3ZEUA 4CS4A 4WBNB 5GINA 1BE3H 4TV9B 2HBJA 5C8YB 3L3VA 1AJNA 3AEIA 3H1JH 3ZN0A 2ZR2A 1HXS4 2QSAA 1EN5A 4JHDB 4NXNO 1VBB4 1HKBA 4TUYB 1JLAA 2W42A 1TVKB 4YSYA 3QIOA 5KHIA 2Y4TA 4B3RB 2DPNA 4YIPA 1K8AW 1IBLB 2ATQA 4YOUA 1KP3A 3DLHA 1GOCA 3CC7N 1IDSA 1YJ9N 4DR1B 2DE0X 4JS4A 4P9PA 3VTHA 4DTSA 4FJCC 4J9YB 1GAXA 1PIV4 5IYCO 3QBXA 1AR64 1VSDA 4NXNK 3OYJA 1T44A 4YOTA 4D7TA 1KSPA 4O4LB 2QXFA 2GWKA 3ASOC 4KXRA 5KI6A 4Z94A 2P9UA 4I0XA 2VGMA 4DTMA 5LA6A 1QLNA 1SUQA 3H6EA 3RT3C 3V1RA 4Q6GA 4CW7B 2ZM6B 4CVNE 3V9WA 4F6RB 1SERA 1Z7S4 4J9ZB 2GUIA 3L72H 2ACZA 1H8EG 2RN2A 2HB5A 4N76A 1ENVA 2Y1JA 4J7ZA 1N32K 1S72N 3NMUA 5LL6Y 4GKJB 2OZSA 3OMNB 1N6QA 5HRNA 2K1EA 3HSCA 4OX9O 3CCLV 1SL2A 5D5QA 4H03B 3APOA 1LR1A 2WTUA 4Q5VA 4C23A 1VP7A 2ZDIC 1BUPA 2JWKA 4FK0A 4JI0B 3AE8A 2E88A 4CFBA 4DR2O 4K8XA 5B1BC 1DK1A 5LYJA 1Q82W 4MVQA 1B9FA 4JEPA 2CGJA 2VQFB 1Q86W 1KMIZ 1XMQB 4AQYB 3ALYA 2WBNA 3D0PA 3UIQA 2CDYA 4CJSA 3K57A 1YT3A 4OX9K 1OJHA 4CF0A 1NGGA 5FRMA 1K34A 1LNQA 1TUBA 4BR6A 2WONA 4DR2K 1C0FA 4CF8A 4YTMA 3U11A 4EAHD 5TKWA 5AQUA 3E9OA 3RW0A 3EE9A 2ZE8A 1BCCH 2BTFA 3KWIA 3WG7B 1GLBG 3KKSA 1WBBA 1KRPA 4C8KA 3ZRWB 4IO9L 3D2EA 3RWRD 4WF9V 2AHZA 1BI4A 5KA6A 4JD2B 3VMFB 3IUCA 3N2GB 2WLJA 5CYMA 3VQ6A 2OTLN 1H2NA 3AY9A 3QICA 3SBGA 1EP4A 2NN4A 4AM6A 3BRCA 2CGKA 2HJDA 4B3TO 1M1KW 1PNLA 4H0XB 4LFBB 4H4OA 4E19A 1YIJN 4IYHA 2NLJC 4WE1A 1HNZK 3OT7A 3R65A 4FO0A 5CZ2A 2A5XA 4GX5A 2ILMA 3DXRB 2DMXA 3HT3A 1FW6A 1K92A 1QVGU 3AGKA 4F9OA 3SUQA 1FXVA 4FJNA 3DOKA 3V9ZA 4CZGA 2HLDG 1HYVA 3WFVA 1K8KA 2DWEC 4I4TB 4CD3A 3L70H 1KAYA 1L3SA 2JVDA 2GTAA 1WA8A 4CERA 4B3TK 1T03A 3DSQA 3WG7C 4DV2O 1KFDA 2BGGA 4P9OA 3HYFA 1NGIA 3CQYA 2WLLB 2Q4PA 2OCCC 3VPZA 1AI5A 5B66Z 3AVCA 2QR4A 4AHUA 3B40A 3VQ9A 3GOIA 3JSLA 1WB9A 3A5OC 3JATB 3HK2A 3KZBA 1N8RW 1K8AO 2WFBA 4LF5K 2A41A 1JOYA 1MZEA 2IH1C 1H2SB 1R3IC 3E8GA 4DR3O 4IG0A 4DV2K 2Q0RA 4KP4A 4JYAB 3CFRA 3CC2N 3LP1A 1MWMA 1HPZA 1WSEA 3TSUA 5CB4A 3ZT0A 2UUBB 1E79G 1D5NA 3N2KB 3CCVV 4CJVA 1VQ8N 4M3UA 5D3GA 3HKDA 4DTXA 4OLBA 5FDLA 4M63C 1ORQC 3HB3B 4LP8A 5BR8B 1RHI4 4GY2B 1F4MA 1R3JC 2KQ2A 4DR3K 2YI1A 4BAYA 1IBKB 1YI2N 3P30A 1U6ZA 4HBNA 2WLIA 1I5YA 2LW7A 3QO7A 1GM8A 2HVHA 2QTDA 2BDPA 3ZJZA 4CK2A 1RSOA 4CIEA 1VQMN 4EZ6A 4X1KA 2GBOA 3N4QA 4UCOA 4Z4IA 4OXSA 4U7OA 4B1ZA 2BOCC 4NTYA 4MQ3A 4OLAA 1Q86O 3QVNA 2QKBA 3JD4A 3T2MA 3FZLA 3MWTA 4LNUA 3WQUA 2O8BB 2A1RA 5C10A 3TARA 4JI3B 3KLIA 3CCEN 4FM1A 3WNGA 3LUTB 4H13B 1DGKN 3ZSVA 4PDRA 1BQZA 2LGQA 3SJAC 1OCZB 4O4IB 3SZ2A 4DF8A 3IKMA 5FROA 1GM9A 3SUCA 2P51A 3CYOA 3HKBB 1T6DA 2XAQA 4RW4A 4AI8A 5E1AC 1YHQN 4XH5A 1AR74 1R1BA 3FAVB 2ITDC 3LDCA 1MMMA 4K3AA 5FLXN 4DV3B 4BRFA 3CJ9A 1GN2A 3L9DA 1HYSA 3SYQA 5EOYA 3CQXA 3JSNA 5KUMA 4DSFA 1X4TA 4X1IB 4MSWC 1GRJA 4KHSA 4CZIA 4MW8A 5JH7B 1RM1B 4JI6O 3CPWU 2OIEA 3LL3A 4PHTX 5JLHA 3HXMA 4FXDA 2CH7B 1O9GA 4JKEA 4EFEA 1LUWA 2P4KA 1QQCA 1U2VA 4K0KB 3I8DA 3BVOA 5DN6G 2RMKB 4W4KA 1FKPA 1Q3EA 3B8AX 2XNDG 5C93A 1HUXA 3RYFB 1HNXB 2ASOA 3PSFA 3VQQA 3O08A 3PV8A 3ZS8C 1PL4A 1OCZC 5J2UB 1SESA 3M6GA 4FWMA 4BG8A 2HR3A 3IDHA 3QBWA 4LC1A 4JI6K 4H8KA 3OR6C 2UXBB 3N27A 3VENA 1K5MD 1LUVA 3M1FA 4IL6Z 3J7YP 2A1SA 2OPRA 3W3DA 4GX2A 1MU2A 4QE9A 4O2AA 4JAAA 4E7JA 1ZOYA 1LAVA 3K9AA 1S3JA 2AW9A 2CTWA 2Q7EA 3RYIA 1RM1C 1YSCA 2FB5A 2A3ZA 1W0HA 4RG8A 1W9HA 3M5RA 5JCOC 4FLUA 1BU6O 1AP5A 4TSFG 4YY3B 2RHKA 4DQSA 2UU9B 4QPKA 3K79A 3L0QA 5K1XA 4DS4A 2D0CA 1T6CA 4X66B 4I6MA 1RUI4 1Y76A 2X78A 4GT1A 2DTUA 3AAPA 3AVMA 3OY9A 2W6LA 1T8EA 1DEJA 3H1QA 4IXCA 3B8NA 3E35A 5CE3A 3TAPA 1O13A 1N34O 1CLQA 4CZFA 1R59O 1SKRA 1V54B 4UXNA 4FMTA 1KVCA 1GN3A 1O9HA 2EIJC 3H08A 3NF6A 3ZT3A 3OS0A 3UKMA 1COV4 3K3WA 4OKJA 1RDUA 4QCLA 4JYYA 1IKVA 1QVGM 4FZYA 1W2BU 4QS7A 5EZYB 1VQPN 1I5XA 2KKWA 4GYCB 4A61A 3E22A 4LCUC 3OJUA 2KKZA 3FGUA 5LP6A 1N34K 2G8KA 4NCBA 1KD1W 3AVIA 3JAWB 4DR6B 5LHGA 2HFEC 4IG3A 4W4LA 1MA9B 3ETGA 2YHWA 3WEEB 3FZHA 2R7FA 5C24A 2IGIA 1JCHA 1NMNA 2A7WA 2F43G 4EP4A 3UT5B 4QAGA 3BF1A 4JKHA 2K9PA 3OFNG 1EAH4 1S9EA 1QS4A 3ZHTA 4CH6A 4I9QA 3D2FB 3L4QA 4E7LA 1YZBA 4GCZA 1XNQB 3MN7A 4EFBA 3DM2A 1IXBA 5KMGB 4M3YA 1NGCA 5JMVA 1RFYA 4IHJB 2BE2A 3A8YA 1WP7A 1JLBA 3ITHA 5CBGA 3MK6A 4O4JA 1HNWO 3CCJN 4FJHA 1KFYA 3GWOA 3ZHUA 2JS5A 3OR7C 1C0MA 3AEDA 5BRFA 3DGEA 4DSIA 2WWWA 1PP9H 1D2DA 3JYCA 4MTGA 3UKRB 4X88A 1GTOA 3OMIB 3H1HH 4QOZB 4NXNB 2W40A 3RSEB 3SUPA 2HMIA 5BXZA 2ETJA 1BG3A 4I2QA 3QERA 1L0VA 2XAJA 4KX6A 4I2PA 2ATKC 4DFKA 3OYBA 1HNWK 2HHHO 3IJ4A 5FPMA 1WBDA 1EZVH 2A9HA 3D8CA 3K04A 3OEEG 3QEXA 2LFSA 3WQTA 3B4SA 2R70A 2ZQBA 2M7WA 5L3CA 3ID6A 4G28B 4FIPC 1N32B 4JK7A 3CFOA 4NXMK 2YJFA 1GH6A 2QA4V 2YI9A 3HKCB 4UV9A 2A40A 4FWPA 2OANA 4IOCL 2YJEA 4CJ7A 4FJMA 1BA1A 1RUE4 3ID8A 1NTMH 3JD0A 4CGDA 4ZTFA 2YNGA 1CXZB 4KPYA 1JFFA 1XBLA 3OS1A 4YT0A 2Q0OC 2OPQA 2ZXWC 3OGCC 1ZYQA 2HHHK 3PSIA 5JS2A 4FVUA 1WNSA 5DECA 4HTUA 2YIBA 4G2KA 4UCUA 3Q7CA 1NJIW 4FWOA 3A5MC 3KZIZ 3VGLA 1Q5OA 2GBZA 4PA1A 5HOOA 4KHNA 3CXCM 1VIBA 4BIOA 4OX9B 3AG3B 1TUYA 1YAGA 2V7YA 3CHXA 4OPKA 5CA0A 2KZMA 2QWRB 2G8HA 2ZE5A 4DR2B 4QS8A 3Q7BA 5M1QA 3F7VC 4KB0A 1VQ6N 1J6ZA 1BHBA 3FYIB 3AVAA 3O65A 1R0AA 5BPMA 1U48A 1UJWB 1Z6RA 4E7IA 3S3XA 4BACA 5KRSA 4EB6A 4FLXA 4WFAL 3SYCA 2E6LA 4PDLA 5JVDA 4ZI7A 1F4NA 2KQXA 3L74H 3AE5A 3OW2M 1J54A 4BROA 5F0XA 5ITZB 1KQSM 1BL3A 2GEMA 1FXKB 4O4HA 1X3MA 1B6QA 2QKSA 4MVUA 2RJZA 2O4GA 5EX5A 4U7BA 1AL24 2IJJA 2WPDG 1VRUA 3DXKA 1H8TD 3OYGA 1HNZB 2P9LA 3P3PA 5M1OA 4ICLA 4KHUA 1RVF4 3CD6V 4FFBB 2F66C 3MAQA 3AG3C 2IVPA 3BZKA 3CRRA
chains in the Genus database with same CATH topology
4FLZA 4FJ9A 1BHLA 3AA4A 4KHYA 2ZD1A 2VG7A 3T19A 1L3UA 4O0IA 4B3TB 4Z0UA 2G8UA 4J2EA 3OS2A 3AO4A 2PW9A 4CGHA 3VN5A 3VQDA 3KD5E 3DRRA 3NAEA 3IG1A 1LV5A 4LF5B 1RT2A 4BDYA 4DV2B 3KLHA 4CEZA 4W5RA 4CJ4A 1TL1A 4O2BA 3OYDA 4DTPA 1G15A 3AVNA 2QJ1A 1SA0B 3SJCC 4CJ3A 3KIOA 3VQCA 1X9MA 1SKWA 2HVIA 3CFPA 4KB1A 1TKZA 3L2QA 2OZMA 1S9GA 3JASA 3WNHA 3SQ1A 1SQFA 3CM6A 4ZTJA 4W5QA 4NYNA 2YXLA 2Z1JA 4N41A 4KTQA 4TOIA 4FLWA 1S1VA 3QLHA 1LW2A 3HKEB 1WPBA 4C8NA 4DSJA 1NK7A 3U0ZA 3L8BA 1ZBHA 4KHWA 3QEVA 3OYLA 4KHPB 4U3JB 4CGJA 1RDAA 1JLFA 4I55A 3WNEA 1X1PA 4PY5A 1ASVA 5LA6B 5KHKA 2BTOA 1A5WA 5KTQA 4LH7A 2KZZA 1C1AA 3VQXA 1JL1A 1VRTA 2D5RA 2RQ6A 4OKEA 3U3GA 4N47A 1HRHA 3TABA 3SV3A 1NOZA 4M3TA 3NFAA 3NHGA 5JQGB 5LYJB 4OGCA 5KX5A 3AO3A 3L2VA 3ASMA 1S1XA 1BIZA 5JJNB 4LH6A 1TUBB 1YTUA 1C1BA 1S1WA 4CF1A 1Q9XA 3EZ5A 3M8QA 3HO1A 2NUBA 1QSLA 3B6OA 2PUSA 2EX3A 4LFAB 5K1PA 2HHQA 1CXUA 1C0UA 5HBMA 3ZSOA 4M41A 3L2UA 4RW8A 1JL2A 1RTJA 4ID1A 4ELTA 3VQWA 2OYQA 4DQRA 1WN7A 1N34B 3RMCA 4CJPA 1WSGA 5T7BA 4BE1A 3ETQA 3M8RA 1VSKA 2R9AA 3DYAA 3RRGA 1J9AA 3NGZA 3SUNA 4Z4HA 4UCTA 1XQ8A 4DQQA 4DLEA 1RT4A 3RWUA 2YI8A 4KL1A 4F3OA 1U47A 4FLYA 4OVLA 4DU1A 5HRPA 4CHQA 1KVAA 3VQ5A 4M3ZA 5CB4B 3LWLA 2G8WA 4LD0A 3HKDB 2V4DA 1HNWB 1TVRA 3DLKA 4DRXA 1RILA 3KD1E 1BCMA 5KRTA 2XY8A 4CHPA 4NXMB 3SUOA 3OTFA 1FXXA 4B9MA 1M93A 5C25A 3F73A 4X1KB 2HHHB 3VQBA 2Z1IA 1L8DA 5HRRA 1NJXA 4LNUB 3MXIA 1TAQA 4FJ7A 2R7YA 3MEGA 4JS5A 4CESA 1VK0A 5FPOA 1SKVA 3T1AA 3KK1A 3RMBA 2HEPA 4YJ3A 4DQPA 1RBTA 3WB0A 4BDPA 2HNZA 1WSJA 5E41A 1BISA 2PYJA 5CYQA 4B9VA 3RYCB 1WLJA 2Q7GA 2D0BA 1KLMA 1V9PA 3LAMA 2OA8A 1FFXA 1TV6A 3S3MA 4ZOLA 4O2AB 4PWDA 3AVGA 3NE6A 2DFFA 3C6UA 4FZXC 5BMVA 3OYFA 1QSYA 3V1OA 4DU4A 5HLFA 4DR7B 5J2MA 3RYHA 4PUOA 1P49A 4FJ8A 4M3WA 4LR3A 3DLEA 4DUZB 3ULDA 3KLEA 3HVRA 1ITGA 4F2RA 4PHZA 4LFCB 4IDKA 1X9SA 1XWLA 3EYZA 5LOVB 3NCIA 4JI5B 5GONA 3ZSRA 3NBPA 4F8RA 3LDSA 4GMJB 5SWMA 4CECA 3HM9A 4B9LA 3QETA 4PQUA 1C1CA 1IKXA 3V9SA 4O4JB 1YVUA 2ZE2A 4FJKA 1LWCA 1JMKC 1ZBFA 3F9KA 1TK0A 1RT5A 4CJQA 4FJXA 4LF4B 2FBYA 3DLBA 1ZBIA 2HHXA 5LP6C 4CC6A 4DMNA 1RDBA 3L2WA 3K5MA 4X1YA 3ZSYA 3OYNA 3QINA 4WBNA 4TV9A 4PI2A 3AVBA 4TUYA 1VSHA 3V4IA 2E5LB 1G6UA 1JFFB 1F21A 1XI1A 2BDPA 3LZIA 4NCGA 3SQ4A 1TGOA 4ID5A 1JKHA 1KCFA 3NH0A 4K8ZA 1S6PA 4CEOA 4LSNA 1XC9A 1IBMB 1T5EA 4DSKA 5J2PA 3P83D 1RTDA 3O4NA 2LSNA 4W5OA 2PGGA 4RW6A 4EB6B 1LAWA 3CG7A 5JJJB 5JVDB 4ZI7B 2Y1IA 3HL8A 3RRHA 4DK0A 5CA1A 4CH4A 1SV5A 1B9DA 1FKOA 4LF9B 1ZBUA 4CEQA 1HQEA 4KI6A 3K58A 5LXTA 4Z4GA 5KGWA 1DTTA 2IM9A 3BDPA 5JS1A 3AVJA 2XY5A 3TAGA 1U49A 4IIJA 1Y97A 5J2QA 3BGRA 3N2GA 3LPUA 4J2BA 3V9XA 4TQDA 1HYZA 2P5GA 4E3SA 3LZJA 2HHWA 1UAXA 3EY1A 1N33B 1D8YA 3ZT4A 5EIBD 2FBTA 4I4TA 2VG6A 5D5PA 4ZHQA 4MFBA 1XHZA 2HHTA 4KRFA 1RT7A 3LANA 1GOBA 2E6MA 3QO9A 1JLGA 1EKEA 2YNIA 3JASB 3OYCA 4CH3A 4NYFA 4CJLA 4IFVA 4CGGA 2FBXA 3N2KA 4H4MA 4BE0A 3S9HA 3SYZA 3S3OA 4Z4CA 4CEBA 3DI6A 4FVMA 2YHBA 3OYHA 4F3TA 3TAEA 4IKFA 3T3FA 1TA8A 4I7FA 1XHXA 2B5JA 3TR8A 5CZ1A 3RTVA 4I55B 1NK8A 3ZEDA 4W5TA 1UWBA 3C94A 4W5NA 3DOLA 1BQMA 3C6TA 1RDDA 4FJIA 5J2NA 3SPYA 3NDKA 4CJWA 5LMUB 4M42A 4FLTA 1RBUA 1UA0A 3PO4A 3CSXA 1GOAA 3SJJA 1B92A 5SZTA 2P1JA 5KX5B 2VQEB 5HRSA 3VQPA 1T05A 2DFHA 2QKKA 4M3RA 4CF9A 4IFYA 3P5JA 4HCCA 1Z5WA 3HPOA 2YKMA 3A2FA 4XIUA 3WNFA 4CGIA 4CJKA 1YEWA 4DSLA 1SQGA 2VWJA 1SL0A 3DRSA 1ZBLA 4B9TA 5EYPB 3BHPA 3ZT2A 4UFZA 3OYIA 2HHUA 4KV8A 3NH1A 1IKWA 1RDCA 1D9FA 5LMNB 3SCXA 5IJ0B 4C8OA 3ICXA 3IAYA 4KAZA 2Q0AA 1VF7A 2ZIMA 1TK8A 3BABA 3JAKA 4DR3B 3THVA 2PYLA 2BANA 3BA9A 5J1EA 2Q7HA 1I7FA 2HHVA 1EETA 4GLXA 5J2TA 4HNAB 3AVFA 1TL3A 4FM0A 3HPGA 3RR8A 5KHJA 2ITGA 2D0AA 3V81A 5HROA 3VQ8A 4JI2B 1QSSA 3M8PA 1TKDA 3DLRA 4IHJA 3QTCA 2BTQA 4EZ9A 1Z5VA 3K59A 3LAKA 3JALA 4OJRA 1U04A 1TK5A 5IYZA 4CHNA 4E0DA 1JLEA 3HP9A 2YV0X 3BAAA 4DS5A 2XHBA 4JI6B 1J53A 3ZT1A 4YJ3B 4DG1A 3SNNA 4DV7B 4KTWA 2ZINA 3SQ0A 2YNFA 3NGIA 4JLHA 1QE1A 4AHVA 1L3TA 4Z4EA 4CEFA 4DR5B 1Q8IA 3LPTA 1FFXB 2F8TA 4ZOLB 1BI4B 4GVMA 4N56A 4LY7A 3C95A 4FFBA 3KLGA 4X20A 3MXJA 3TWHA 3PX0A 4DTRA 1J5EB 1RNHA 3MECA 1QTMA 3WB1A 1L3VA 3RYHB 3RMAA 4J2DA 4YNQA 3HP6A 4KI4A 3PY8A 4DUYB 4D7SA 3AA3A 1NT2B 4CHYA 3AVHA 4CFAA 4DFMA 1NK0A 2F93B 3KK3A 2Z1GA 3DLGA 4FK2A 2VG5A 1QHTA 4LH5A 1CZ9A 5KGXA 3AA2A 3PN1A 5GONB 3L2RA 4DF4A 2X74A 2XY6A 4G1QA 4DV0B 1I39A 3U10A 3RGBA 4DR4B 3BPZA 1D9DA 3KTQA 3PO5A 4GKKB 1BIUA 2KTQA 1EX4A 4ELVA 3NH2A 4X1YB 2O4IA 4KO0A 5EU7A 3HKEA 4BWAA 4CIFA 2IDOA 3O4QA 1HQUA 4HUEA 2R72A 1HW7A 4U3JA 4KFBA 4FK4A 1I3AA 4J2AA 3PX6A 4DK1A 4GW6A 5HP1A 4CH5A 5I3UA 1N5YA 2AJQA 1S5JA 3T1YB 1M4UA 4ELUA 5CY4A 3UQ8A 4YJ2A 1CXQA 1WSFA 4RW7A 3FFQA 2PZSA 4DV1B 3G0ZA 4B9NA 5CA1B 3QNNA 4TV8A 2HW3A 3OYAA 5JQGA 4CEDA 1NK9A 5LXTB 3RYIB 3AA5X 3B2EE 3DRPA 1FK9A 2HNYA 2IS3A 5FNVA 3SPZA 4Q0BA 3LWMA 4IIJB 2F95B 3L3UA 2OWOA 4O4GA 2PTMA 1S6QA 3JARA 4CJRA 3QEPA 1IH7A 1VSFA 4NVPA 3LP2A 4YFUA 1TAEA 1DTQA 2IAJA 4X65B 2F96A 3U3YA 1I94B 2KW4A 1RCHA 1O1WA 3QESA 3E22B 4B9UA 4CCHA 5LP6B 5IWAB 2G8FA 3QEWA 4JRQA 4ZHQB 4FLVA 4AHSA 5FRNA 3SR2C 2YIAA 3DMJA 3MXMA 4LF7B 2XO7A 4I50A 2G8IA 1NK6A 3K2PA 4RW9A 1NOYA 4CJEA 1JXEA 4ZHRA 1ASUA 4HCBA 4BWJA 2VWKA 1DLOA 3SV4A 2ZNIA 4EEQA 5IJ9A 1JXBA 2YNHA 2YKNA 1WSHA 1IG9A 4LSLA 5C8YA 1FJGB 1NK4A 2XY7A 1TVKA 3THOA 4R5PA 3LP3A 4FCYA 3NGYA 2X6NA 3OYMA 3OJSA 4KTZA 4BWMA 3QG5A 4HHTA 2B6AA 4KHQA 3SGIA 3M8SA 1BQNA 2X6SA 4O4LA 5CA0B 3S3NA 2HNDA 1HNIA 4X62B 4DU3A 4F6RA 1S1UA 3I0SA 4FJGA 1ZAUA 4OPJA 4M45A 2XRIA 3V9UA 4O4HB 2RF2A 4TQFA 4N5SA 4X64B 4DTUA 1X9WA 1Z26A 3ISNC 1NJWA 4C8MA 1RT1A 5I42A 3MEDA 4DFJA 1JJOA 3RYCA 4DQIA 4HUFA 3TI0A 3AO1A 4AHTA 3OYEA 1LW0A 4E7KA 3FI7A 2YHAA 4FJ5A 5KHHA 3NF8A 5C42A 3AV9A 4CF2A 3AVKA 1Q43A 2UXCB 3HPHA 3SI6A 2Z1HA 3TAQA 1XMOB 3RFRA 4O2BB 3CQ8A 1L5UA 4CJUA 4JI4B 3JAKB 1K6YA 5K14A 4LF8B 3PUFA 1NJYA 1B04A 3OTOB 4NCAA 1NKEA 3JATA 3D45A 3VQ7A 2DY4A 5J2TB 1DGSA 4CEEA 4O5BA 4FJLA 5LOVA 3O3GA 1UA1A 4DTNA 2B4JA 1HJRA 1NJZA 4OGEA 3I0RA 3U6FA 4Z4FA 3WB2A 4DTOA 4AHCA 4YHHB 1D5AA 1ASWA 4B8AB 4M3XA 4DSEA 2P5OA 1IO2A 2BTQB 3HJFA 3OVNA 1BCOA 1XNRB 4PI0A 1LWEA 4E7HA 1KTQA 1A5XA 3KJVA 5DMRA 3JALB 1VSJA 4FM2A 4CJTA 4JI1B 5IYZB 3TANA 2HHSA 1RT3A 4FW1A 4O4IA 4LF6B 4DTJA 3HKBA 3NF7A 4IBNA 3VQEA 4B9SA 4JRPA 4CFCA 4E1MA 3ZSQA 4UCVA 2EHGA 2FBVA 4B08A 4CE9A 1UOCA 3O3HA 4X1IA 2E4LA 5JH7A 3VA3A 1NK5A 1YTAA 4KREA 3ZCMA 4UQGA 2UUAB 5JCOA 1LWFA 3RYFA 1NKCA 4L8RB 1KVBA 2I5JA 2F8SA 3ZSWA 5J2UA 2P22C 3CB2A 4F2SA 4BDZA 3O3FA 1U4BA 1J5OA 1RT6A 3SJBC 4DV5B 1KLNA 3KK2A 4X20B 3HSTB 4HUGA 2E3CA 4EP5A 1JLCA 3CM5A 1TKXA 1CZBA 3TAMA 3T1HB 4JI7B 4CGFA 1U45A 1TAUA 3P1GA 5JJEB 4L8JA 3B6PA 4FZZA 3SQ2A 4B3SB 4AH9A 3AO2A 1C6VA 4E1NA 1BGXT 3VQ4A 2IOCA 4DFPA 3AVLA 4FW2A 3TAFA 2PY5A 1KU9A 3LNNA