1XI1A

Phi29 dna polymerase ssdna complex, monoclinic crystal form
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Correction of X-ray intensities from single crystals containing lattice-translocation defects
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
total genus 147
structure length 571
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xi1A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xi1A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xi1A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xi1A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xi1A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xi1A06
2YHBA 1S5JA 3TR8A 4HCCA 3T3FA 2JGUA 3QESA 3ZSZA 4DSKA 1HQUA 4N5SA 4E7IA 2X74A 3RWUA 1NK7A 4CJSA 4LSNA 3WNFA 3PUFA 3NAEA 3O3GA 3AO5A 3LZIA 2IDOA 1BIZA 4N56A 4KFBA 3NCIA 4BE0A 4HTUA 1SKRA 2XRIA 4I2PA 1UA0A 4IG3A 4E89A 3AVKA 4RW7A 3OJUA 3TAFA 3DLEA 4J2BA 3CFOA 3NFAA 3AA4A 2G8VA 2OZMA 4LY7A 4FZZA 4CEZA 3UIQA 4Z4FA 1ZYQA 2Z1GA 1TL1A 1TKTA 4CHOA 4CIEA 2X6NA 1J5OA 4F8RA 3NGZA 3SPYA 1LAVA 1NKBA 1L3TA 1NKEA 4B9VA 4PY5A 3DM2A 4DTSA 1X9MA 5FRNA 4H4MA 5KI6A 3P5JA 3QEPA 4C8LA 1XHZA 2P5GA 4E7KA 3WNGA 4Y1DA 2D5RA 3L2QA 3ZSVA 1NOZA 1HJRA 4CECA 3AVMA 3ZT1A 3EYZA 3KKSA 4B9UA 4EP5A 4KHYA 3LANA 4OPJA 3KK2A 4DTXA 4CHQA 4RG8A 2PYLA 1KCFA 1SL0A 4FJ8A 4CJQA 1LWCA 4OGCA 4FLTA 3A2FA 3V6DA 3L2UA 4M3UA 3OVNA 4AHUA 3I0RA 3T1AA 3HT3A 4O0IA 1TKDA 3QETA 3V9UA 4GMJB 4ZTJA 4E0DA 4IKFA 1JXBA 4CGGA 4DLEA 1YTUA 1DLOA 4CF1A 2GBZA 3AO2A 3CM6A 3B6OA 4B8CA 4KV8A 3V9XA 3O3HA 1JLCA 4CK3A 1K6YA 4C8NA 2VG7A 2BANA 4O55A 4FZYA 3DOLA 3DRPA 3NF9A 4LD0A 4CGIA 1RNHA 3QEXA 1NJWA 2FBTA 2WOMA 4M3XA 4AH9A 4BE1A 4EZ9A 4EZ6A 5J2PA 4KRFA 4CHYA 5J2MA 1NK0A 5D3GA 1C1CA 3OS0A 4AHSA 1KVAA 3HSTB 4TSXA 2KFZA 3NF7A 4RW4A 4GW6A 4FK4A 5HROA 1HRHA 1T03A 1BL3A 2X78A 3AA5X 4HCBA 1QE1A 2HMIA 4CERA 5FRMA 3AVCA 3QIOA 4AILC 4K8XA 3SQ4A 2DTUA 1HYVA 1U48A 4W5NA 3MECA 4NCAA 3OY9A 4F2RA 3TAQA 2OPQA 4DLGA 4DSFA 3B6PA 3VQEA 1RTIA 3OYEA 3OYIA 1NK9A 4W5OA 1SKSA 3AVAA 2XY7A 2Z1HA 1TKZA 1S1TA 2IAJA 3L3VA 1VSKA 2IC3A 1EKEA 4FJXA 3VQ6A 5J2QA 1NKCA 3KK1A 3O4NA 4DSEA 4HUGA 4DU1A 3VQ4A 4DSLA 1RTJA 1S9GA 4FXDA 4CF0A 4C8KA 2E6MA 1TK0A 4CEQA 1L3VA 4CESA 4BACA 2RKIA 4CHNA 2G8UA 2YKNA 3DRSA 5CZ1A 2DFFA 4M45A 4DSJA 3ALYA 4RW8A 1HNVA 1Y97A 4KHQA 2XO7A 3BGRA 3PO5A 5FDLA 1ZBUA 3E01A 4ICLA 4OLAA 4KHWA 3CG7A 1LAWA 3RRGA 4AHVA 3OYFA 4FJLA 4H8KA 3SUQA 2YNIA 3D45A 4JRQA 2ATQA 3RRHA 4Q5VA 3LDSA 1RTHA 1RT1A 5KGWA 5HRPA 4FW2A 1S6QA 1RBRA 4FLWA 3MEGA 4CJUA 2YV0X 3KKRA 3NBPA 2D0AA 3V4IA 4CJFA 4L8RB 3NH1A 4FJGA 4CEAA 3V81A 1RDCA 3MXMA 1RBVA 5SZTA 1JL2A 4K8ZA 3OYAA 2E4LA 3CQ8A 2IS3A 4DTOA 1Z25A 4FJMA 3TAGA 1IKYA 1IKXA 4WE1A 4FM2A 1S9EA 2Z1JA 3FFIA 1CZ9A 1FK9A 3QLHA 4CEEA 3OYMA 3OYLA 1JL1A 3L8BA 4DS5A 4FM0A 2VWKA 2A1RA 1XC9A 4DQRA 2P5OA 1SKWA 3FI7A 4FW1A 2GV9A 3OS1A 2PYJA 2A1SA 1GOCA 4I9LA 1ASVA 1EP4A 4R5PA 4KB0A 1JKHA 1J9AA 3LP1A 1KFSA 4ELUA 4NYFA 1HYZA 1WN7A 4DTUA 1LV5A 2HHXA 4XIUA 1FXXA 1HNIA 3AA3A 4DU4A 4J2EA 4CFDA 4B3OA 2NUBA 4M3ZA 3K59A 3HPHA 3TAPA 1N6QA 4E3SA 1MU2A 1WAFA 3TI0A 4DMNA 4F2SA 2OYQA 3V1OA 3H08A 2OPRA 4DF8A 2FBVA 4CFCA 3LWLA 3SUOA 5C42A 3RMBA 2ETJA 3V1QA 2D0CA 5HLFA 1TK8A 1G15A 1SV5A 3QNNA 1JLAA 4FJ9A 1KLNA 4C8MA 5E41A 3KJVA 2ZE2A 1GOBA 4ID1A 4I9QA 4RW9A 1TAQA 3ZSWA 1U47A 4KI4A 1RILA 4M3WA 4KREA 4E7JA 4E7HA 3AVIA 4DTJA 2VG6A 1Q9XA 3ZT4A 2Q3SA 4FK0A 3NGYA 3MXIA 4O44A 3WNHA 3LP2A 3V9SA 3AVFA 2KFNA 1JLQA 1BHLA 1HMVA 4CK1A 1QSLA 2HHSA 3AVJA 2KZZA 2OPSA 4KAZA 2VWJA 5J1EA 1X9SA 1A5VA 5HRSA 4FYDA 2E6LA 3K5NA 1EX4A 3MEEA 1RDDA 4YNQA 4B9LA 4KI6A 4PQUA 1TL3A 3KTQA 2BE2A 2RPIA 3ZCMA 4CEBA 1T7PA 3SV3A 3QIPA 3HVRA 2HNDA 4CK2A 3TAEA 3LP3A 3OYDA 1NK8A 3VQ8A 5HRNA 3KLHA 4J2DA 3KD5E 4Y1CA 3VQ5A 3HP6A 3L2WA 2QKKA 1IKVA 3AA2A 4CJEA 3U3GA 1RTDA 1JLBA 1WAJA 3JYTA 4Z4EA 2B6AA 3PX0A 4Z4GA 1IO2A 1VSEA 2KQ2A 4DFPA 1ZBLA 4DSIA 3VQPA 2RN2A 3O4QA 4DFKA 4KTZA 3V1RA 1B92A 3TANA 4FZXC 3S3NA 3K2PA 1RCHA 3ZSRA 2HVHA 3KLIA 3HXMA 4OPKA 4N47A 4MFBA 1D9DA 1X1PA 1QSYA 1NJXA 4W5QA 3ZT2A 1B9FA 5DMRA 1RBUA 4BWMA 3AVNA 3OJSA 4CGFA 3LZJA 4CGHA 3HJFA 1LWFA 1RT3A 4CJPA 1Z26A 4ZTFA 1D9FA 1Q9YA 2G8KA 4M42A 4RW6A 1SL1A 5KRSA 4HVJA 4DTRA 3DYAA 3G10A 4HHTA 2YHAA 4Q0BA 1CXQA 5JS2A 3D0PA 1XHXA 1S1WA 4CEOA 3ULDA 1U49A 1A5WA 3RMDA 2Z1IA 1A5XA 4FLZA 1VSJA 4BDZA 1D8YA 4LH5A 1HYSA 3SNNA 4G1QA 2BDPA 3HK2A 4CGDA 3IAYA 4IDKA 1WSHA 3SQ0A 2DFEA 4M3TA 1VRTA 3VA3A 3ZSOA 5I3UA 3IS9A 2HHVA 5CY4A 4CJWA 2B5JA 4FCYA 3NDKA 4M3RA 2YNHA 4FJ7A 1RDBA 3LWMA 4HUEA 3U3YA 3TARA 3CFRA 2KW4A 2RF2A 3NF8A 1RT5A 5CYQA 3VQBA 1C0TA 2ZQBA 4CJRA 3RR7A 3QO9A 3DLGA 1ITGA 1S1UA 3G0ZA 4W5TA 1VSLA 2XHBA 3ITHA 1UA1A 2YKMA 3C95A 3LPTA 3SZ2A 2HHQA 4E1NA 1XI1A 2PY5A 3HPOA 3JSMA 1QSSA 4DWIA 4KPYA 3P1GA 2HHWA 1TAUA 1WSGA 4CIGA 3VA0A 1F21A 1VSMA 3M8RA 4DTMA 3EY1A 3S3OA 4B9TA 2OPPA 5KGXA 3V9WA 1QTMA 2OZSA 4NCBA 4FJIA 2HVIA 4CFBA 2PW9A 1IH7A 3CM5A 1JLGA 3KD1E 4CF2A 1VSIA 3RTVA 4OKKA 3NE6A 2G8WA 3C6UA 2B4JA 5HP1A 4BDPA 3L2RA 1CXUA 3NHGA 3DMJA 1RT7A 3PY8A 4B9MA 3KLGA 2HHUA 4KTQA 1BGXT 1JLFA 2FBYA 4E19A 4B8AB 3OYHA 3U6FA 1SL2A 2IOCA 4CIFA 4BWJA 4QCLA 1J53A 3AO3A 1C6VA 5DK5A 1TKXA 5KRTA 2DY4A 4EP4A 1BIUA 4B9NA 4FJKA 4CHZA 4OKEA 4MQ3A 3T19A 2BGGA 2P51A 4FLVA 1YVUA 2W42A 3DLBA 4KKOA 2Y1JA 5CZ2A 2ZD1A 2VG5A 3RMAA 5KTQA 4FLXA 1T05A 4IFVA 1BQNA 3NF6A 4KHNA 4LSLA 4GVMA 4DFJA 4Z0UA 3K58A 1FKOA 2XY6A 3SUNA 1D5AA 2QXFA 1QQCA 3VQDA 3ISNC 4CJ3A 3BDPA 1CZBA 3O3FA 1QS4A 2YNGA 3VN5A 3RR8A 4DQQA 1L5UA 1BI4B 2XY8A 4CEFA 3ZT0A 2G8IA 3L2VA 1EXQA 3SCXA 1WLJA 1WSJA 3DLKA 2OA8A 3HVTA 4CJLA 3HPGA 3PX4A 4UQGA 1VRUA 3M8SA 1QHTA 1TV6A 4CE9A 3IG1A 1NK6A 5SWMA 1L3UA 3VQCA 3ASMA 4O4GA 4KB1A 4IFYA 1VK0A 3SQ2A 3DI6A 3VQ7A 3AVLA 1ZBFA 1JLEA 5I42A 4Z4IA 3MEDA 5C25A 2EX3A 2Y1IA 4FVMA 4YFUA 4AHTA 3SV4A 1O1WA 1B9DA 4I7FA 1U4BA 4FJ5A 1S1VA 4ELVA 4KHSA 4DTNA 3F9KA 3M8QA 3VQQA 2O4IA 3I0SA 1BCOA 1W0HA 1WSFA 4DQIA 4PUOA 1ZBHA 1IG9A 3ZSXA 4DG1A 1REVA 2JLEA 3QERA 1SUQA 4KHUA 3KIOA 3DOKA 1HPZA 4CJKA 1CLQA 4ID5A 3ZT3A 2R7FA 3PO4A 2KTQA 4KTWA 3NGIA 4CHPA 1BISA 1DTTA 1UAXA 4BE2A 3LAKA 3AO1A 3TAMA 1RT2A 1YTAA 4FLYA 4NYNA 1BQMA 2F96A 5K14A 3QEVA 1IKWA 3AV9A 3WNEA 3SPZA 3QINA 2HNZA 2G8FA 4JS4A 4DU3A 4DTPA 1VSDA 1WSIA 2GUIA 3RMCA 1KSPA 3HM9A 4CF9A 2QK9A 1WSEA 4DQSA 1RBTA 1W9HA 1NK4A 3ZSQA 3KLFA 4CF8A 3QEWA 1I3AA 1YT3A 2HW3A 4E1MA 4PA1A 3OYCA 3MAQA 4NCGA 1KFDA 1EETA 2HB5A 1JXEA 1N5YA 5HRRA 4I2QA 3K5LA 1U45A 1FKPA 1NJZA 4FJJA 3AO4A 4CFAA 4JLHA 1DTQA 4KO0A 3C94A 3HL8A 4E7LA 3THVA 1NK5A 1C1BA 1RBSA 2D0BA 1KLMA 5EU7A 4F3TA 4AHCA 3K5OA 1XWLA 4OKJA 3L3UA 3OYBA 4J2AA 3HO1A 4CJTA 1J54A 1R0AA 4F3OA 4DFMA 4FK2A 1C0MA 3AVGA 1T8EA 3PV8A 3VQAA 4ELTA 1NOYA 4HUFA 1HQEA 1ASUA 3LALA 5CYMA 1LW0A 4CJVA 3KLEA 2I5JA 2XY5A 4CCHA 4JS5A 3LAMA 3KK3A 5J2NA 3PX6A 3K5MA 3V9ZA 4FJNA 3SJJA 2HNYA 1C0UA 1KTQA 4PWDA 1RDAA 2KZMA 1TVRA 1RT6A 3OYNA 4FLUA 1ZBIA 3C6TA 4IG0A 3SUPA 4M3YA 3M8PA 4LH4A 4C8OA 1BCMA 4CJ4A 3CYMA 3K57A 2YNFA 2G8HA 4IBNA 3EZ5A 2ITGA 4CGJA 1S6PA 4N76A 1RT4A 3IRXA 1WNSA 1KVBA 2X6SA 5HBMA 5FROA 4B08A 2LSNA 1S1XA 4QAGA 4FJHA 1LW2A 4W5RA 3MXJA 1KVCA 3S3MA 3P83D 2AJQA 2DFHA 1X9WA 3CFPA 4BDYA 5JS1A 4CJ5A 3SI6A 3OYJA 2QKBA 3NH2A 3TWHA 5C24A 4FM1A 1BI4A 3OYKA 3QEIA 1TGOA 4B9SA 2FBXA 2P1JA 3DLRA 4ZHRA 1ASWA 3AVHA 3S9HA 2HHTA 3OS2A 3SQ1A 2FC0A 3F73A 3VQ9A 3ZSYA 3LP0A 4DS4A 1L3SA 4OLBA 2F8SA 2EHGA 3OYGA 2IGIA 1I39A 5T7BA 1KRPA 3SYZA 4F4KA 1LWEA 4O5BA 3DRRA 3HYFA 4H4OA 4DF4A 4Z4CA 2O4GA 1GOAA 4JRPA 3TABA 4DQPA 4M41A 2PZSA 3DLHA 1C1AA 4Z4HA 4N41A 1U04A 1VSHA 4O0JA 4AHRA 2R7YA 3HP9A 4QOZB 2WONA 1Q8IA 1TK5A 4CEDA 2F8TA 3QNOA 1UOCA 1UWBA 3LPUA 1VSFA 4OJRA 3AVBA 4OVLA 3I8DA 3NH0A 1NJYA 4OGEA
chains in the Genus database with same CATH superfamily
3JBG4 1S5JA 1AB3A 1NKDA 4X88A 1VQ4V 5LA6B 2OCEA 3J81N 2P9SB 3T3FA 2WLKA 3H1QA 1WPXA 2Z3YA 1HQUA 4N5SA 2F93B 4LF7O 3E1YA 4LSNA 3GQKA 3PUFA 1BQ0A 3ZEDA 3O3GA 3NAEA 2FYUH 2QWOA 4TT3G 1F7YA 1EN4A 4NXMB 5KQ8A 4N56A 3LZIA 2WSSG 1LUVA 3O65A 5BY1A 5IJ0A 2WDQA 3ZLJA 1OJHA 1SKRA 2XRIA 1K3EA 1UA0A 3BRCA 4YHHO 4JI5O 2XT9A 3AVKA 3K9KA 4IG3A 3A5NC 2BUPA 2XUMA 4CEZA 4JI2B 3SDLA 1N8RW 2X6NA 3AAPA 3NGZA 1QVGM 1TYQA 2Q9LA 2ZJPL 4B9VA 2FXUA 1ZTEA 1JPXA 2P5GA 1M93A 3ABKC 3THWA 1QVFM 2D5RA 2PLV4 2Q68A 2VS0A 2PI5A 3KKSA 4JYAB 2P9PA 3LANA 4P30A 2VQFO 1T5EA 1B6QA 3BEHA 3P32A 3D3QA 3L2UA 1RM1B 3OVNA 4AHUA 3T1AA 4AQYO 3HT3A 1TKDA 1RUH4 5C15A 1HXS4 3CCJN 4FWKA 2X6AA 4J41A 4IKFA 3SJHA 3AVBA 2CTQA 2DJVA 4DW1A 4LF6B 1VQ7N 4XBFA 2H3GX 2P9IB 1PPJH 1JR9A 3AE8A 3B6OA 4B8CA 1J5EB 1BE3H 2Q7GA 1QQNA 1BSMA 3O3HA 4IGGA 1F4NA 2WP9A 2GTDA 2VG7A 2BANA 4JKHA 4O55A 3DRPA 4LD0A 2WA3A 3LDDA 1RUJ4 2FBTA 4EZ6A 1EO1A 5IYCO 1DK1A 3DC6A 4XDKA 2CDYA 1Q3EA 3UKUB 5D3GA 2R074 1I94K 4AHSA 1R3JC 4UXNA 4TSXA 1K8AO 2KFZA 2XAGA 4GW6A 5HROA 1T6CA 1W0KG 1BL3A 4HCBA 1LOTB 1NGHA 2E5LB 1N4CA 3BA9A 3SAGA 2AZ0A 2A41A 1Q81O 5FRMA 2YIDA 4AILC 3CCMN 2DTUA 1SA0A 4W5NA 3JASB 4UCTA 4FWQA 3OY9A 2HHHO 4GKJO 1K92A 2OPQA 4DLGA 2KHOA 4X20A 1Y64A 1NTKH 1YJNV 1BA1A 3AVAA 2XY7A 1XDCA 4JGSA 3HKEB 4NXNO 1S1TA 2IAJA 3BY5A 4DV5K 2AZ2A 2IC3A 4WF9V 2D2CB 2WLLA 4C7UA 4BW9A 2J4RA 4IL6Z 1S77D 4DSEA 3GVMA 3QNEA 3SYQA 3KHYA 2CAZC 4DSLA 1S9GA 2WFBA 4CF0A 1Q82W 3OR6C 4KXRA 3TPQA 1L3VA 4JAUA 4BR7A 4A2AA 4CHNA 3DRSA 4DR3K 3HR0A 3CE2A 1HNVA 3M99B 1Y97A 2BOCC 3OAAG 4YJ3A 5HFMA 4LF6O 4IYHA 2WAMA 4WQ4A 1V54C 2YIBD 2M7WA 4R6ZA 5EVZA 3PO5A 4Z1VA 4J11A 3AG4B 4L8JA 1SZ2A 5FDLA 4JI1K 5ELZA 3P38A 3C90A 5DECA 3E01A 3FR0A 2QR4A 3O9QA 1H2GA 2N04A 4LCUC 4QGPA 4H8KA 3U9ZA 3SUQA 1VAZA 4WFBL 1CP9A 3ZRSA 3FKSG 5HRPA 1LCUA 1RFQA 2AGAA 4JD2B 4FLWA 1H2SB 3MEGA 1Q5OA 3NBPA 4IO9L 3CHWA 1YHQV 1NGEA 3CHXA 4QE7A 2Q8VA 4DV2O 1NCQD 4FJGA 3CS5A 4EFHA 4DR1B 2MK3A 1RDCA 1BEV4 5SZTA 1JL2A 4K8ZA 4M7YA 2E4LA 3CQ8A 2RMKB 3HKCB 4WFBV 1VQ6V 4BRQA 4JI4K 4JK7A 3TAGA 2ZXWC 1HNWO 2FBWA 3LDCA 1IKYA 4WE1A 4FM2A 3QLHA 4CEEA 4DS5A 3OYMA 3L8BA 5B3SB 2EIJC 2VWKA 4BRGA 1XC9A 2WC9A 1IJJA 5F2VO 1VQPV 1YF2A 1AR4A 4YHHB 4CBWA 3FI7A 1HNWB 4I9LA 3ZX2A 1ASVA 1ZUQA 1NEKA 3B8NA 2HF3A 4L3QA 3C3TA 3CSXA 1J9AA 3H1JH 2XNDG 3LP1A 1KFSA 2K9PA 2E2PA 2HBMA 4DTUA 1H2MA 2NRTA 2Q4PA 3BEXA 3LSSA 4DU4A 3LM9A 3GL1A 5B1BB 1P7GA 4RQEA 3UKUA 4B3OA 1WAFA 4DV1K 3H08A 2OPRA 4DF8A 4DV4O 1HX1A 5KAIZ 2D0CA 2PAVA 2VQEK 3H6EA 1G15A 4MDAA 1SV5A 3QNNA 4LF8K 4FJ9A 3AEAA 1F23A 4ZI7A 3LSUA 2HBKA 1K9MO 4I9QA 4KI4A 3GOIA 3ZHRA 1EZJA 3CRRA 1EQYA 1YEWA 4DTJA 3ZT4A 4FWLA 3WXJA 4GVEA 3FE1A 3V9SA 1XOUA 1JLQA 1BHLA 1Q86W 4CK1A 4FWOA 2KZZA 2PBDA 2B1GA 2G38A 1JVMA 4LR3A 1A5VA 5J1EA 2E6LA 3TXSA 1AILA 2D3OW 2QWQB 4B9LA 4KI6A 1TL3A 3KTQA 3JSNA 2RPIA 3ASNC 1S5LZ 4J7ZA 5GTHZ 4JI4O 2YEVB 3HVRA 3CXCU 3E22B 3CJCA 3F9MA 3KLHA 1VQ8N 2YEVA 3HSCA 3VQ5A 1PO14 2O57A 2IBZH 3CCSV 3L75H 3O4WA 2QM4A 1D4M4 4DUZO 2W40A 3CCQN 1RTDA 2IU3A 1MA1A 3PX0A 4LF8B 4Z4GA 2JWKA 4UV9A 4DSIA 3CCEV 1YVNA 4DV7K 4DFKA 5EIBD 2DQ0A 2EIMB 3U8XA 3AG4C 1KFYA 5LXTB 3SPCA 2CGOA 1FS0G 4JI6K 1QLEB 3JD0A 4TV8B 3K2PA 3ZSRA 4A5AA 3KLIA 2HVHA 4IYIA 2Y48A 1X3NA 5LMNK 4BR6A 5MLCQ 1ZLZA 1D9DA 1QSYA 1GN2A 2QA4N 1NJXA 1R3IC 5DMRA 1RBUA 3OJSA 4PJ0Z 1L8DA 4CGHA 3WQUA 3Q7CA 4TOIA 1RT3A 4BRNA 1Z26A 3TCUA 2MW2B 5C8YA 4O4IB 3LDPA 1GKFA 3ETEA 3QF7A 1YZBA 1D9FA 4TWKA 4DR5O 3ZBHA 3JALA 3D0PA 4FVUA 4JV5O 2RHKA 1EBOA 1DF5A 2ZF5O 4CEOA 4DHYA 1KD1O 3TSQA 3ZN1A 4WCEV 4FSVA 1VSJA 3OMAB 5A2QO 4LFAK 4LH5A 5IYDO 2QKCA 2QKSA 4I4TB 1FKAO 5DM7L 3HK2A 4O4LA 1NT2B 4DV2B 3CP1A 2Q6AA 5FPMA 3SLCA 4OX9B 2Z5UA 3T4DA 2YXHA 2JEUA 3I5DA 4M3TA 4JYYA 3ZSOA 3CCQV 4CJWA 4FCYA 2JWLA 5AQXA 1FJGK 1H38A 1IVSA 3NDKA 4CH4A 3LWMA 3VOVA 3TARA 3F2KA 2XAQA 2KW4A 3ZHQA 2JS5A 4JK8A 3TTFA 5LMUB 4BRDA 4YTMA 5E84A 1G8MA 2PUSA 3QO9A 3G0ZA 1WP8A 1VMGA 1VSLA 4ILHA 2E75B 1UA1A 4PA9A 1PVC4 2HHQA 2PY5A 1QSSA 3T2MA 4KPYA 1SESA 3P1GA 1RUE4 4DR6O 1NGDA 3EVKA 4X1KA 1Q6HA 3UKMA 4RAIA 4XDJA 3M8RA 3S3OA 2OPPA 2VQEO 5AZIA 3V9WA 2IJKA 2OZSA 4CFBA 2FMLA 3HOTA 3ASOC 1MOFA 5IWAB 4OKKA 3SYCA 3RTVA 5KX5B 5HP1A 1AL24 3DMJA 1HJOA 3PY8A 3JARB 5D5QA 4B9MA 3J80O 3GQHA 4B3RO 2E20A 2ZWHA 4E19A 2NZTA 3QO5A 2JGDA 2IOCA 2UXDK 4YY3K 4CIFA 4QCLA 1SQQH 4NVPA 1D4XA 5DK5A 5LP6C 5KRTA 1AI4A 4H5RA 1BIUA 4FJKA 4YSZA 1V55B 3BUZB 4DO2A 1VQPN 1KUQA 3DLBA 4DR2K 4B3TK 2E5LK 4DR4K 4KKOA 4MTXA 4LFAB 4BW5A 5FPEA 2XAJA 3ZMZA 5AG2A 1IBMO 1US6A 2WQYA 3O9TA 4LSLA 3LDQA 4GVMA 1P8ZA 4Z0UA 2R064 3ATUA 1FKOA 4JI4B 4YJ2B 4O2AB 5CBGA 1RSOB 4EB6A 5LHIA 1FAFA 3OMIB 2QXFA 1OCCC 1X9JA 3QVNA 1T3VA 1W2BU 2DWDC 4EB6B 4YXWG 4GZRB 4IIJB 4YJ2A 4DQQA 2Z0AA 3E35A 1XMOB 2F4VB 1WJZA 3AG7A 4NO7A 5GAEP 3ZT0A 3L2VA 4JI8O 1EXQA 4H33A 4JAXA 4CJLA 3WG7B 4GYCB 5AQIA 3M8SA 2Q5ZA 2XAHA 1NK6A 5SWMA 4X1IB 4DW0A 3N4QA 4IFYA 2F4VK 3L4QA 2QEXN 3AVLA 2RM24 1JLEA 3MEDA 3CMAN 2P9IA 3UB5A 5IJ9A 4JI7B 3SV4A 1B9DA 4I7FA 5AQMA 2JGDB 5TKWA 4WCEL 1VF7A 2BTQB 3K3WA 2ZM6B 2VRZA 3CC4N 2O4IA 4WQ5A 2EILC 1ZBHA 1W7AA 3JYCA 1XNRK 3HM8A 3GG4A 3ZSXA 4KHUA 3QERA 1OVYA 4A61A 2QE7G 1Q90D 4ZKIA 3MWPA 4ID5A 2R7FA 1XL6A 4JI8K 2Q31A 4BE2A 1R094 3CXHF 4KP4A 1U2VA 1K8AW 3AO1A 4K43A 4X62B 4FLYA 4NYNA 1W97L 1VARA 5K14A 3QEVA 2HNZA 2HWC4 2B9ZA 2PTMA 5JLFA 4DTPA 2E74B 3HM9A 4CF9A 1YJWN 3ABMC 1I5YA 4N23A 4B3MK 1XMQB 4CZJA 3ZSQA 2A6AA 5CA0B 3QEWA 4E1MA 4IXCA 4LP8A 3MAQA 2P9KB 4C23A 3RYHB 3ABLB 4IJNA 3ICXA 4WYBA 4CBCA 4JAAA 1EETA 3OTOK 1H2NA 3EHBB 1JXEA 3L6QA 5HOOA 1N5YA 5H2FZ 4JI2O 3RYHA 4G27B 3K5LA 1FKPA 2P9KA 4IEIA 4ISGA 5KHKA 4FJJA 4I5SA 1I94O 3BZCA 1RGIA 1HNXK 3ULEB 4DV4B 4I7ZB 2I7PA 3CCEN 4F3TA 1C1BA 1RBSA 5EU7A 3AE9A 2KG7B 3OYBA 4J2AA 4X65K 4HNAB 4CJTA 1MQTD 1J54A 1R0AA 4F3OA 3HB3B 2WWWA 4DFMA 4I4TA 1AI5A 4BRLA 1HKCA 1NOYA 4ELTA 4HUFA 1HQEA 4PDRA 3KLEA 4CCHA 2I5JA 2IVNA 3IFXA 1KD1W 3LAMA 2O8BB 5K1PA 5J2NA 1OKJA 5EBWC 2Q97A 1M4UA 4O4HA 1C0UA 1KTQA 1NGAA 1RDAA 3CB2A 1R084 1NH2B 2D4WA 3HKDB 2AW9A 5BMVA 5BRFA 3C6TA 5AQTA 3EE8A 3AE2A 1TUUA 3UO3A 2P4KA 2R9AA 3M1FA 2GBOA 3ZJZA 3SAFA 1K5MD 3K57A 4IBNA 2EILB 4JYAK 3EZ5A 1MWMA 2ITGA 4DCHA 1WNSA 5HBMA 4B08A 2LSNA 1S1XA 1RUI4 2FF6A 3CMEN 2IH1C 5JQGA 4W5RA 1KVCA 1Z05A 2AJQA 2EBOA 2IW5A 4DUZB 4JN4A 3U4LA 3VEVA 2EINB 3CFPA 5JS1A 3MX2A 4KUMA 4TV9A 2QKBA 4MTOA 3TWHA 5C24A 2A42A 4FM1A 3QEIA 3NVMA 1L0LH 3ABUA 1F4MA 1IBLB 2FBXA 2P1JA 1XMQK 1XNQK 1TVKB 4BC2A 4MW8A 3BY6A 4CH3A 1SQKA 3P3PA 3OS2A 2A9HA 2W6IG 1Z7S4 2Q7HA 4O2AA 1QVGU 5KHHA 2QJ1A 3AK2A 3L72H 2Q7EA 3QBWA 1V9PA 3D36A 5M1NA 2X0LA 2FSNA 3CCJV 5IYBO 1G1XB 3DJCA 1H8EG 1LNQA 2QTDA 4A59A 1HNZK 2ZGZA 4PA6A 2QA4V 1HWYA 1V4TA 2F4VO 3R6MA 1Z6RA 3L73H 1C1AA 2R9RB 2QWQA 4Z4HA 2R7YA 1VSHA 4LWSA 4O0JA 1Q86O 3HP9A 3J8F4 1Q8IA 4JV5B 4IDHA 1TK5A 1UWBA 2GHYA 4GLXA 5LY3A 4OGEA 2ZXWB 2ODMA 3NH0A 1VQLV 4ASUG 4GV6A 2H3OA 2YIAA 3OMNB 1K9MW 4PHZA 1OV9A 4TSFG 4P9PA 3QESA 4DSKA 3A0HZ 5KX5A 3RWUA 4CJSA 3WNFA 2QI2A 3DXRB 3KWGA 3THYA 3JATA 3EZWA 1KECA 4H37A 4BY9C 3R9PA 4X1KB 4WFGA 1NH2D 4H0XB 5LMNB 1QZ5A 4I2PA 4RTFD 4HTUA 2GWKA 3ZS8C 4RW7A 5AQHA 3OJUA 3TAFA 4MVOA 3NFAA 1BL8A 3QB0A 3LDOA 4ISEA 5GIOA 2F1MA 4NLCA 3ABLC 3DC5A 2Z1GA 1ZYQA 5DM6V 3D3IA 4X62O 3G6EV 4O8UA 3ID6A 4KH4A 1AR94 1NKBA 2UUCO 4UB6Z 3BVOA 4FPBA 3CCUN 4H4MA 2H94A 1M56C 2Q67A 3ZMVA 1CEZA 2AP1A 3EKUA 3WNGA 1NBMG 4PL8A 4Y1DA 4C8LA 1L1FA 1HJRA 2ZR2A 3ZT1A 4EP5A 1S72N 3CETA 3G80A 4RG8A 2PYLA 2QEXV 1LWCA 3FZMA 5EX5A 4M7XA 4M3UA 3CWBH 4WFAV 3ZEUB 1NNEA 3I0RA 1SZXA 4O0IA 3CEIA 4GMJB 5M1QA 1KAXA 2QWNB 1XQSC 4I9WA 3O1BA 4UVAA 5CE3A 1JXBA 3FB7C 4KHPB 4CGGA 1XUQA 5JJNB 4DLEA 1YTUA 3P4QA 2DWEC 3CM6A 3SPJA 2RQ6A 3T69A 1VBA4 4LNUA 3V9XA 4QNHB 4GX5A 5LP6A 4CK3A 2RMU4 2F95B 4DV6O 4L87A 1ZSPA 4YIOA 4D7TA 1GLFO 3QEXA 4M3XA 1K4CC 4RHV4 2HVKC 4AH9A 5J2PA 3KG2A 1WA8B 5IY5C 3M3ZA 4O4IA 5FLXO 5J2MA 2VQFK 1PM9A 4DR3B 3SAHA 1KVAA 3NF7A 3O08A 3JD4A 2YJEA 2KKZA 4FK4A 1RUF4 1IG8A 4AQYK 3ZHUA 4I55B 2X78A 3AA5X 1GAXA 4MVZA 2RS34 2HMIA 1KAZA 3AVCA 3SQ4A 4TV8A 4JI5K 1NGCA 3JXUA 3B6PA 3ZETB 4WQ5C 3OYIA 1NK9A 2DYRB 1RVF4 3TTCA 4W5OA 1NGFA 1NU0A 1TKZA 1XNQO 3MX5A 3ZHVA 3O5BA 3VQ6A 1K34A 4H13B 4R50A 5J2QA 4FJXA 2WLLB 4BROA 2OTLN 3O4NA 4JI6B 4DU1A 1RTJA 1R6NA 3B40A 5IDJA 4JNEA 1IBLO 4CEQA 4CESA 4BACA 4ZHQA 2VGMA 1E3MA 4N21A 4X20B 2NNWA 4M45A 5KPZA 5L3EA 1MABG 1N36K 3HRGA 1QQMA 3MMVA 2XO7A 1SA0B 3FFKB 2HBLA 4MDBA 1FFTB 2FKXA 2Q0UA 3U11A 3A8YA 4ICLA 2LGWA 2R72A 1BO5O 4KHPO 1LAWA 1YUWA 3AEGA 3TGUH 4MTFA 4FJLA 3F7YC 2P9NA 1L0VA 1XUPO 2YNIA 3CD6V 2E1ZA 3D45A 4JRQA 1GLLO 3VENA 1RTHA 2DQ3A 2ITCC 1RBRA 4FWMA 2YDEA 4RUEA 4CJUA 5BR8B 4BVPA 3KKRA 2D0AA 3MN6A 4CJFA 5EC1C 4JTCB 4L8RB 3AEDA 1Z2GA 1FPOA 2DE0X 4CEAA 4YTPA 2EJ7A 3OYAA 3FAVA 2HG5C 3E8HA 1Q43A 1QQOA 2IS3A 4DTOA 1NR7A 4IHJB 4D6TH 1WAZA 1DGSA 3AK3A 4MO5A 3P4PA 4JI1O 2Q0OC 1S9EA 3FB5C 1CZ9A 2P5OA 3W0LA 5EZYB 4JI2K 1QCEA 1SKWA 5AFUA 4GX1A 3OS1A 2A3QA 2PYJA 2A1SA 4YOWA 1GOCA 3L0QA 3LDLA 4HZ3A 1OCOB 1S0VA 3E89A 4MLHA 4C1NK 1VP7A 4NTYA 1HKBA 3ASOB 5JICA 3HOSA 3AG3B 4WQ4C 1AJQA 4JI6O 4CS4A 2ZD9A 3E83A 3D2EA 4XIUA 4FWPA 2RS14 3CC7V 1J95A 3K59A 3HPHA 3TAPA 2OCCB 5J9PC 1MU2A 4E3SA 5KA6A 1GK9A 4F2SA 2OYQA 3V1OA 2FBVA 1PV0A 3IFRA 5C42A 3RMBA 2ETJA 1JJ2M 3LNNA 3V1QA 1ZXOA 1P90A 1SERA 1QU7A 4GKKO 4E4EA 1BA0A 2ZE2A 5F2RA 4DR5K 1GOBA 1K73W 4RW9A 1U47A 1TAQA 4QJFB 4M3WA 3IGAC 4E7JA 4DR7O 2ZM6O 3VEOA 5H6QA 4FK0A 2QKAA 4WFFA 1GO3F 2E1YA 4O44A 3WNHA 4QPKA 3AVFA 2KFNA 1KQSM 4DV6B 2F66C 1HR0O 4LFAO 4YIPA 2OPSA 4H0PA 4KAZA 2OIGA 4MSWC 3EEQA 3CIPA 3MEEA 2RKIA 3A0BZ 3D6RA 4GV3A 3DXMB 3A8TA 1K7DA 2BE2A 3ZCMA 4CEBA 3N2KB 3H45C 3AG1B 4ZIBA 1JCGA 3E9OA 3QIPA 4CK2A 1SS6A 3TAEA 4JAVA 2LP7A 3OYDA 1NK8A 4LC9B 4JI1B 1H8HG 3KD5E 4CZZA 1NBWA 1ZL8A 4OX9K 4CW7B 1GH6A 2P4VA 3HP6A 3NVKA 1P7BA 2QM8A 1IKVA 3APQA 3ZYYX 2YHYA 3EFFK 3K0SA 3U3GA 1ESVA 1JLBA 4O5FA 4Z4EA 3HKEA 3F7VC 3ZEUA 3AE3A 3I55N 3R66A 3ENHA 4FPAA 1ZBLA 2XY6A 5BPNA 2BSKB 2UUAK 3FB8C 5J2UA 1SC5B 3TANA 2R70A 5AQFA 1Y74A 1JCFA 3STZC 3HXMA 1RP3B 4N47A 5AQQA 3O8MA 5L3BA 4JHDA 4BRPA 4DUYK 4YSXA 3CCVV 3E9PA 1WBBA 4MVQA 3KCYA 4CGFA 3LZJA 1M57C 3G71V 3A5LC 3ZHTA 4W4LA 2Y0PA 4MVMA 3JD74 4IHJA 1QR8A 1O9GA 2NRRA 1P84F 2NRVA 3E9LA 3G10A 4HVJA 4HHTA 1MA9B 4GKKK 5AQWA 1VF6A 4JZGA 4CZEA 1S1WA 3SR2C 2OTJV 4CD3A 1IV0A 2AHYA 1EAH4 1XC3A 3BPZA 3VERA 3OEHG 3QBXA 4K35A 1YJWV 3CRMA 4LFCO 4U7OA 4X65O 1S72V 3VR9A 5FPOA 4BIOA 1DTOA 3OGIB 3AAQA 3OEEG 3SNNA 2BDPA 4GNIA 3AY9A 4CGDA 3IAYA 3CXCM 5JH7A 1RM1C 5BR8K 4B3MO 2HHVA 1SKVA 2HOEA 1VQ5N 4I6MA 1K33A 4Q4W4 4M3RA 4BRCA 4FOIA 4H5TA 4BGAA 2AXTZ 3U3YA 1GRJA 2P6JA 4KX6A 4IZ9A 5B1AC 3R8EA 1ATSA 3WXIA 1TYQB 1YQ4A 5B5EZ 1C0TA 3AEEA 4HYOA 4A57A 5AQVA 2XHBA 4BIUA 2YKMA 4B3SO 3QICA 4E1NA 1XI1A 3HPOA 3FD9A 4FO0A 3SUCA 3K04A 5IJ0B 4JI7O 4IOAL 5KGXA 1E79G 4NCBA 4FJIA 4LF4O 3J8AA 1NGBA 3ZETA 4TV9B 5L3FA 1NR1A 3C6UA 4ZOLB 1VQ6N 5JQGB 1CXUA 3B09A 1NTMH 1ORQC 1FW6A 4J9YB 4R8CA 1K8KA 2YICA 1Y6XA 1BGXT 1Q7YW 4JPRA 3OYHA 3U6FA 1KKDA 1R73A 4JYBA 4G28B 1XL4A 3AO3A 1TKXA 4EP4A 2JRIA 3TETA 4YXDA 2BH1A 4IEEA 3P39A 4F6EA 4OKEA 3T19A 5IWAK 2P51A 1AP6A 2XTAA 5EC2C 4X65B 2QWPB 3R3LA 1COV4 3OUSA 3K03A 4PA7A 1MSDA 4JI3B 5KTQA 1MWKA 1MNGA 2XAFA 1M56B 1T05A 1IZ3A 2NRXA 3EO3A 4KHNA 3MN7A 5E1AC 3K58A 1VHXA 3N2GA 1U97A 1XMQO 4LF7K 4YOXA 3ISNC 4NR1A 1O13A 3OW2M 4UV8A 3U9DA 4CZLA 3VN5A 1L5UA 1QVFU 2YIBA 3EL2A 2V1DA 4CEFA 4DV5B 2ZIOA 3DLKA 2OA8A 4UQGA 3D36C 1OCRC 4CE9A 5LGUA 3IG1A 1YDXA 3CCLN 1VK0A 3SQ2A 5I42A 5L3GA 5AJ3K 1NTZH 2JJ1G 4FVMA 4YFUA 4AHTA 4DUZK 2C2AA 1O1WA 3A0RA 1WB9A 1U4BA 4FJ5A 1S1VA 3SJQC 4ELVA 5IY5B 1Q82O 2IU0A 3I56V 1FYJA 3F9KA 1XILA 3M8QA 1VBE4 2VCPA 4DRXA 3VQQA 1VQOV 1BCOA 4I0XB 3VEXA 2K1EA 5GADP 4C1NI 1IG9A 4FIPC 3THYB 1REVA 3BF3A 2O8EA 3B8AX 3GWKC 1AI6A 1M9NA 2DOSA 3PO4A 2KTQA 1GN4A 2GDSA 1HW7A 1M1KW 3NGIA 4CHPA 1UAXA 1QR9A 1TUEB 4O2BB 1ROPA 2YSUB 3LAKA 1R6TA 1YTAA 3CJ7A 1BQMA 2HHHB 1N32O 2F96A 2OWOA 1IKWA 5GTIZ 2E5LO 1JFFB 1VSDA 2HR3A 2GUIA 3WG7C 1WSEA 3K06A 2E2NA 4DQSA 1VQKN 3HPLC 3CJHA 1IX9A 2QWMA 1RUG4 4Q20A 1YT3A 4PI0A 3QG5A 1ZP0A 4NCGA 1N0NA 4IO8A 5JLHA 2DPNA 4FL9A 3T1HO 4J7JA 4BVOA 3FZHA 1U45A 2UXBK 1RUC4 3DXKB 1NJZA 1AR1B 2E2QA 3S3WA 1KMIZ 3CC7N 4DV3B 4JEPA 3C6HA 2PGGA 4KO0A 1VQNV 1NK5A 3PLAA 4E1JA 1KLMA 2D0BA 1H8TD 2HKOA 4AHCA 4IIJA 4UCVA 2ASMA 2P22C 2NNUA 3EN9A 4IWVA 4OKJA 2PF4E 4UB8Z 1C0MA 1T8EA 1TVKA 3OTOB 1F51A 1ASUA 2KB1A 4KBOA 1SQGA 3S41A 2RR14 1Y76B 2YI1A 5JCOA 3ZRXA 3K5MA 2H8PC 3V9ZA 3K0GA 2HNYA 1FJGB 3SJJA 4CH5A 3AG3C 1TVRA 1E1RG 2D1KA 4CH6A 1ZBIA 5AQJA 2OT5A 4B7EA 4IG0A 1HR0K 2GUPA 2E76B 2NRWA 2DYRC 4JKFA 4C8OA 4P2ZA 1BCMA 1KC8O 3AK1A 1HRI4 4NTXA 1FJGO 5K1XA 4LFBB 2YNFA 4DR7K 4H5VA 4X89A 4N76A 1S6PA 3IMXA 4K41A 2X6SA 3QDKA 4QAGA 5BRHA 4UCRA 1KLNA 2WLIB 1LW2A 1EV14 3A0IX 4DR3O 1N0JA 2WLMA 2YCHA 3P83D 4EIAA 2ZE6A 2DFHA 3AARA 1X9WA 3UCSC 3SI6A 3OYJA 2O8BA 1YF5L 1AROP 3VTIA 1BHAA 1BI4A 1TGOA 2YC0A 2CTWA 3T1HB 1K5QA 3AVHA 2UUCB 3TTDA 4HNAA 2CH7B 1MZEA 3Q4HB 3VETA 1M1KO 3M7MX 2EHGA 5ADXA 1VBC4 1OH6A 3ULEA 3ZX0A 2IGIA 1I39A 3ZX3A 4BQLA 4CBXA 3T1HK 5BPLA 4DR2O 1XMOK 3FFQA 1KQSU 3CCVN 3E66A 1E4FT 4FPPA 1GOAA 2O4GA 2PFUA 4DQPA 5M1OA 3LDNA 3JCZA 4BR4A 2PZSA 2RS54 1ZWIC 1U04A 4AHRA 4DR5B 5F1XA 1HUXA 2WONA 3JD3A 3CCLV 5ITZB 2CH5A 1UOCA 5DM6L 3I8DA 2VQEB 3NMUA 1AJNA 2E3CA 1X59A 3CRCA 2CH7A 1N33B 2YHBA 2CE4A 3VGMA 4V19S 3GBTA 5EXWA 2OTJN 4HCCA 2QGNA 2JGUA 2XOKG 3SBGA 4KL1A 4E7IA 4XH4A 1BCCH 1SQXH 3CCSN 3O9SA 4B9QA 3VPZA 3RYFA 1K5SA 5FLXN 3AO5A 2DW4A 2QDOA 4EAHD 3MHHC 4CZGA 1P4RA 3THXB 3NCIA 3P3NA 1U6ZA 4BE0A 2WTUA 3SFDA 2FSKA 2EIKC 1PNMA 3DLEA 2CTRA 4MT8A 4TUYA 5EYPA 3AA4A 2G8VA 1N34O 4JI3K 3UIQA 4J2BA 4Z4FA 2YHXA 1RPRA 2LFRA 3SPYA 3C7NB 3M8AA 1RFYA 4PY5A 1NKEA 3JCUZ 4DTSA 5AQRA 3ZN0A 2QM1A 5FRNA 2KLAA 5JCOC 4LF8O 3P5JA 3L2QA 3ZSVA 5BRDA 4ZOLA 2W6JG 1NOZA 3T4ZA 4MVSA 3BHPA 2QWRA 3AVMA 3B4SA 4MW3A 4CECA 4B9UA 4KHYA 3CMAV 4DR2B 3KK2A 1OZ0A 1SETA 3RYIA 2ETNA 4DR6B 1KCFA 5GIPA 4DTXA 4CJQA 1YITN 2UU9B 1SL0A 4MVRA 4BRFA 3S3XA 4FLTA 3I8BA 1XMOO 5CR4A 3MD0A 4JKAA 3H1HH 3QETA 3V9UA 2Q2RA 4ZTJA 1C0GA 5EIBC 3AE5A 3RVZA 5C93A 5B1BC 1KBHA 2W0FC 1DLOA 4CF1A 3W7UA 2KQXA 3ZX6A 5AQLA 1FXKA 4KV8A 3J80N 1JLCA 4TQFA 4LBEC 1KKCA 1K6YA 2RE2A 3NF9A 3IKMA 4Q4X4 1NJWA 2WOMA 3LM2A 5HL7L 2NLJC 4CHYA 2A7WA 1G6UA 1WUAA 3ABTA 4J42A 4X66O 4K0KO 5AQGA 5KQDA 4CS2A 1HRHA 3CMEV 5TISZ 4HWIA 4WBNA 1X4TA 5M1PA 3MDSA 1QE1A 4CERA 4J7KA 1TUBA 4I50B 4K8XA 5AQKA 4DUYO 4NCAA 1SZTA 1JMKC 2UXDB 5BPMA 1FXHA 3OR7C 4DSFA 3FZKA 3TAQA 3MHSC 3CD6N 4Z94A 3VQEA 4BGBA 1RTIA 3OYEA 2O8EB 4OX9O 1N34B 3UE5A 1SKSA 2UUCK 2Q1NA 1WLEA 4DRXB 1FXKC 5C2DA 1EKEA 2NRHA 4JTDB 1NKCA 1VBD4 3KK1A 1DF4A 2YX6A 1VQKV 4DK1A 3VQ4A 4FXDA 4RWUA 2V52B 2JS3A 4C8KA 3FB6C 1TK0A 3A5OC 3MDQA 1VF5B 4DSJA 3W3DA 3C3SA 2G8UA 5CZ1A 2DFFA 4LFCK 4DKWA 1HPMA 4BAYA 3ALYA 4LF9O 2VYPA 4RW8A 2JIZG 1NGGA 2FF3B 2V4DA 4GUNA 5B8HA 3K79A 3BGRA 3VGKA 4BR9A 1ZX3A 3CJ1A 2A0LA 2CGNA 4OLAA 4FMTA 1PL0A 5KHJA 1SQVH 2YJFA 3CG7A 2QSAA 4NYKA 5AR0A 3OYFA 4XEIA 1YIJN 3TU5A 1NQTA 3KKYA 4NXNK 2HWB4 3UKRA 1NLVA 1S3XA 2ATQA 2ZT9B 3N2GB 3OFNG 5GINA 1VQ7V 3LDSA 4FW2A 1I5XA 4BR5A 2UUBK 4CI6A 4H5WA 3NH1A 1GLEG 2GELA 2QM7A 4B3RB 2EIKB 3V81A 4X66B 4K0KB 1RBVA 1R1BA 2E2OA 2VWBA 1AR84 5KUMA 3AG2C 2ZCEA 3D8CA 4JKCA 5TKYA 1Z25A 4CZIA 4WF9L 4FJMA 1VBB4 1NS1A 2YHWA 1YI2N 1MSWD 4DV4K 3OYLA 2A1RA 1GN3A 4LFCB 1JL1A 4FM0A 4J10A 4PA3A 3CC2V 3H1KH 1BHBA 4BRMA 2X5ID 4FW1A 2CTPA 4CBUA 1PKXA 3TXQA 1EP4A 5GAHP 4YJ3B 3WUHA 3G71N 2FTKA 2EIMC 1RUD4 4NYFA 1WN7A 2ZE7A 1NWKA 1S76D 5L3CA 3KCXA 4WBNB 2HHXA 4FFBB 3AG1C 2WU5A 2ITDC 3G4SV 2EJRA 1HNIA 1BT8A 2JVDA 5FPDA 1Y66A 4CFDA 4LF4B 2NUBA 2YXYA 1I0HA 4JI8B 1N6QA 2NLXA 3BP8A 4UUJC 3W7XA 1L0NH 4FWRA 3D2FA 3LWLA 5CA1A 2V7YA 3N4PA 5HLFA 3CCUV 1TK8A 4JKEA 5C10A 2KZMA 1CZAN 1JLAA 4BC4A 4B3TO 4DR4O 4ICGA 4UVBA 1FFXB 3E22A 4C8MA 5E41A 3KJVA 2RDCA 5BN9A 1M5IA 1MMMA 4LF5B 2HSTA 5AQOA 4KREA 1RILA 2IH3C 5AFUH 4E7HA 3AVIA 1Q9XA 1YSCA 1URFA 2Q3SA 3ENOA 5CB4B 5J2TA 3NGYA 3MXIA 2UUBO 4GKKB 3LP2A 1U96A 1QSLA 1NI8A 3T1CA 2X7RB 4NXMO 5JH7B 1AR74 2VWJA 4DV7O 1EM1A 4QS7A 2WA4A 5HRSA 2ZKOA 1X9SA 3CQYA 4FYDA 1EX4A 4YNQA 4IJAA 4PQUA 3B77A 1T7PA 4JZ2A 5JJEB 3SV3A 4CS3A 5LMNO 4ZI7B 3LP3A 3N27A 1V55C 4JI5B 2FL4A 5HRNA 1EWQA 3L71H 4X8AA 1LUWA 3MN5A 5L3DA 3E86A 1R3LC 4Y1CA 4U7BA 3PN1A 1PIV4 3AA2A 3IC7A 4CJEA 3WB0A 2EIJB 1Q18A 4BC5A 1ENVA 1SQBH 1XNRO 1WAJA 1ZOYA 3CCMV 1WOQA 2P9NB 3JYTA 4DV3K 2CK3G 1MG1A 1IO2A 4EHTA 4B3SK 3RYFB 3VQPA 5BR9A 2WPDG 5CB4A 3HI0A 4PV1B 4YSYA 4IOCL 3V1RA 1B92A 4FZXC 5B3SC 4CZKA 4LF4K 3VQXA 4RQFA 1MZFA 1OH5A 2GUZA 2Q73A 4O4JA 4PA4A 4QIWF 3OTOO 4B1YB 2HFEC 3HJFA 3J7AP 2RNBA 1LWFA 4K25A 5CBFA 3O6WA 1Q9YA 2UXNA 3KWIA 2G8KA 4M42A 2UYTA 1SL1A 5KRSA 4DTRA 3K0DA 3DYAA 4YDUC 1ZBSA 5JS2A 3CIRA 5BN8A 1JA8A 1XHXA 2YS8A 4PD4F 3OA9A 4DV7B 2QWOB 3BZKA 5JVDB 2X6BA 1UJWB 4FWSA 2Y69B 3CRAA 3RMDA 3SPIA 4YORA 3CCRV 2LW1A 2Z1IA 4NTWA 2F43G 2NR5A 4FLZA 2CGLA 4BDZA 4JKDA 3Q4HA 3RN4A 1R3KC 1D8YA 4A5BA 1HYSA 1P49A 1KP3A 4I55A 5LA6A 4G1QA 2O8DB 4BRIA 4D7SA 2M6YA 2ZDIA 1J6ZA 1WSHA 3SQ0A 1JJ2U 4B1VA 3HZ6A 1VRTA 2A5XA 4UFZA 4JI3O 1N32B 1KU9A 3E8BA 4W4KA 3IS9A 1WA8A 1M90W 5CY4A 1B06A 4DB3A 3J7YP 4KHPK 1YQ3A 2CUGA 4FJ7A 4ISFA 2YNHA 3C65A 1C0FA 1XNQB 2F9TA 3CFRA 1Z5VA 3QO8A 3CPWU 4H44B 3I56N 1RT5A 5CYQA 3VQBA 3MCPA 4CJRA 1K97A 3ID8A 1R6KA 1ITGA 1S1UA 5C3JA 5H6RA 5EK0A 2UUAO 1EWRA 1W59A 3SZ2A 1CPYA 3JSMA 5A2QN 3OHRA 4DWIA 3UKRB 4M63C 1EN5A 1WSGA 2VQFB 3HKBB 4X64K 1F21A 3VA0A 5C2FA 4H03B 2CGJA 4NB5A 1EZVH 4Q4V4 3ML0A 3CM5A 1VQ9N 1JLGA 3KD1E 2QW9A 3MWTA 4CF2A 1AR64 4LFBK 3RYCB 2B4JA 3DWLA 3L2RA 3VMFB 3AGKA 1TAEA 1RT7A 4EEQA 5LYJB 4U3JB 3KLGA 3WXMB 4KTQA 1JLFA 2FBYA 1A32A 4CC5A 5CA3A 4B8AB 5M1FA 1SL2A 2Q0AA 1VQMV 4GT1A 3MN9A 1D2DA 4CHZA 2GTAA 3FAVB 4R79A 2BGGA 4FLVA 1YVUA 2W42A 1YXBA 2Y1JA 4XDLA 1ZAUA 3RGBA 4U7NA 5CZ2A 3OUFA 3L74H 4FLXA 3STLC 3NR7A 3AE6A 4IFVA 5AQZA 1BQNA 1O9HA 3NF6A 2ZINA 5IT9N 4DFJA 3SYPA 1V4SA 4UCUA 3BA8A 3SPHA 1K73O 2P9UB 1WB8A 1D5AA 3SUNA 1QQCA 3X2QC 2ZIMA 5JJJB 3BDPA 4H0LB 4LF9B 4DV3O 1CZBA 1QS4A 5D5PA 5FPNA 5LJWA 1J5EK 3CC2N 3RR8A 1NA1D 4O2BA 1KB9F 3U0ZA 1OCRB 2FSJA 5IYZA 3SCXA 3H01A 1WSJA 5BZBA 3HVTA 4IOXA 3PX4A 1SQFA 1TV6A 4B1UB 4YOYA 3VQCA 4DK0A 4X62K 3WXKA 4KB1A 3H1LH 1FXKB 3DI6A 3O80A 1GM9A 1ZBFA 2LQTA 4PI2A 2OCCC 3VQ7A 4BREA 4A62A 1K4DC 4YHHK 5DEDA 3PSIA 1Z5WA 4DTNA 3RSEB 2HJFC 2HBJA 1B04A 2VGNA 4U3JA 1NMNA 1IBKB 3DGEA 3SMSA 3H1IH 4PUOA 5KMGB 5KAFZ 4DG1A 1OH7A 3W7SA 5KHGA 2JJ2G 3FX7A 3D7EO 3ZT3A 1BISA 3IC9A 3K9AA 1JX9A 4DV1B 5LL6Y 4GY2B 2LO1A 2WU2A 3AV9A 3VOUA 3QINA 5FL7G 1NENA 1YHQN 3AEBA 1WSIA 5GONA 4J9ZB 3UT5A 1GN6A 3ZRVA 4E2LA 4Z1MG 1VQ5V 4NXNB 1RBTA 1QHAA 3F5TA 5EYPB 1W9HA 1NK4A 3RW0A 2P9LA 2UXCK 3VQYA 5F0XA 3H46O 4DV6K 1VQMN 2HW3A 4PA1A 3OYCA 2UU9K 4MVUA 3LDEA 4PDLA 2Q36A 2QWPA 3GWOA 3THXA 4MO4A 4I2QA 1PP9H 4JV5K 4F6RA 4JKBA 4CFAA 1DTQA 1OCCB 2N05A 5IE9A 3C94A 3HL8A 5JMVA 4E7LA 1V54B 2QTSA 4X1YA 4GB34 3K5OA 1XWLA 4H0TB 4A2BA 3E2EA 4FK2A 1K8KB 5A9GA 5B1NA 3AVGA 4Q6GA 4BQZA 3PV8A 3LALA 3KZIZ 4B1XB 5ITZA 1LW0A 4CJVA 3ATVA 2XY5A 3KK3A 3PX6A 4FJCC 3SBTA 4FZ1A 5JVDA 1OCZC 3OGCC 4PWDA 2WUSA 3LNMB 5KMGA 5BR8O 4CZMA 4BG8A 1IBLK 3QFUA 1YCIA 2UXBO 3SUPA 4M3YA 2V7QG 5CMUA 4LH4A 3RSEA 5EY4A 1VRH4 4NLBA 1BDGA 4HBNA 3P4SA 3CYMA 4YDUA 4BRAA 3APOA 4O4JB 4NB4A 3VEZA 1PNLA 3L70H 1KVBA 2RCVA 3KK7A 5JWPA 1KC8W 2A06H 3MXJA 3JATB 3VQVA 3P31A 1AR5A 4TQDA 3S3MA 4BR0A 3WFVA 3IUCA 4J8FA 4CJ5A 2YXLA 3NH2A 4BWAA 1OVQA 5CHIA 4B9SA 3ZMSA 2L35A 4PKIA 4P9OA 3DLRA 2WLIA 2UXCB 4ZHRA 5C2TA 3S9HA 1NGIA 3FZFA 3J81O 3SQ1A 3VQ9A 2P9UA 3VF4A 1L3SA 4LH7A 3VRBA 5IJ9B 1WBDA 1TUYA 3VEWA 3OYGA 4UVCA 4WFHA 3VF2A 2E8AA 3VGLA 5T7BA 1KRPA 2HMPA 3CQXA 3ABMB 4F4KA 1LWEA 1RDUA 1ATRA 4UY8O 3DRRA 3HYFA 4H4OA 4DV2K 2ZE5A 2DMXA 3ETGA 1CXZB 3DLHA 3JAMN 2QWLA 2HF4A 1BZKA 3DTUB 2DYSC 2W0XA 4QOZB 1GLJO 4CEDA 4K3AA 3QNOA 4OVLA 2QTOA 2FC0A 4RO2A 3SYAA 4W5TA 3OM3B 4GX2A 5AQUA 4CVNE 5LYJA 2D0PA 1BWFO 5J2TB 3TR8A 4X66K 4K0KK 2HP8A 5GW7A 4LF5O 3FYIB 1Y74B 4CC6A 3ZSZA 2ZDIC 2Y4TA 3RYCA 5FNVB 5KLVH 3BF1A 2X74A 5DN6G 4YY3B 1NK7A 1AI7A 4KFMA 4J80A 3A5MC 2O8CA 2BSKA 5LBQA 3BAAA 3JD1A 1QBZA 3PSFA 4EHUA 2IDOA 4Q4Y4 1BIZA 3AEFA 4KFBA 5CA1B 3HBTA 3NXSA 5KPRA 4DV0O 2I7NA 2P67A 4E89A 3G67A 1VQNN 2V51B 3CJHB 3CFOA 4FZZA 2OZMA 4LY7A 2N74A 4LC1A 1TL1A 1SAZA 4DV1O 1TKTA 1E1QG 4CHOA 4H0VB 4CIEA 1J5OA 4F8RA 4FFBA 1LAVA 1L3TA 5JVHL 1BUPA 3DM2A 1X9MA 5EBMC 2V7ZA 3ZMTA 5KI6A 4ILJA 2Y69C 3HKDA 5BMVB 1XHZA 1VEWA 3Q7BA 4Y0WA 4U67L 4E7KA 3QEPA 2H89A 2ZM6K 4O4HB 3DXMA 2HEPA 4PHTX 2JDIG 3EYZA 3WEEA 4OPJA 4FJ8A 3AE7A 4CHQA 1VIBA 1OCOC 4OPHA 3E8FA 4OGCA 3A2FA 3V6DA 1Y4MA 5I9EB 4ZBMA 3QTCA 2O8DA 4E0DA 5LMUO 1OOPD 1TA8A 3OBYA 1VQ9V 1OCZB 2CH6A 3FLCO 4OO1J 2GBZA 2RJZA 4IT5A 3AO2A 4GKJK 1N32K 1NU1H 5EBLC 5LJVA 1GLDG 4WFNL 2IJIA 3OW2U 3HTVA 3WXLA 3FZLA 3B8MA 5AZJB 4C8NA 2F7TA 2BE3A 1M90O 2BTOA 5C12A 2AHZA 2LJ2A 1HNXO 3DOLA 1UFIA 4CGIA 4FZYA 1RNHA 2PW9A 4JYCA 2L6LA 2D0OA 5CA0A 4BE1A 4EZ9A 4KRFA 1S5HC 3CJAA 1NK0A 1C1CA 1I08A 1EFRG 3OS0A 4BIZA 1KXPA 3HSTB 4LF5K 4RW4A 1HNXB 2GUZB 1T03A 4O4LB 4DR7B 1SF9A 2HJDA 2A3ZA 4GV9A 2EINC 5H1SQ 1NM1A 3QIOA 1I7FA 5CBHA 1HYVA 3FGUA 1U48A 1LR1A 4CZHA 3MECA 3VTHA 4XH5A 4F2RA 4B3MB 1VQ4N 1N34K 3T1YB 4WFAL 4PKHA 2Z1HA 2OIEA 1YITV 3L3VA 3PIOL 1VSKA 3EKSA 3ZRWB 2BTQA 1NJIO 3IDHA 3AE1A 5C8YB 2B5UA 4HUGA 3M5RA 2E6MA 1Y67A 5LOVA 2WDRA 4JI0B 1HKGA 4FZ0A 1Q6UA 1YIJV 1GM7A 1I94B 4JYAO 1THZA 1AP5A 2BTFA 2YKNA 4X1IA 1S3JA 4KHQA 2B76A 1PL4A 1NMDA 1H2KA 2ASOA 1R59O 1ZBUA 3JAWA 4PDVA 1RMU4 3X2QB 3C0BA 3RBZA 1Q7YO 4KHWA 1RHI4 4AI8A 3RRGA 4AHVA 1H1VA 2LFSA 2Y0IA 1IXMA 5LL6Z 2IVOA 2WS3A 2W6KA 3AE4A 4B1WB 3RRHA 1RSOA 1XBLA 2B1IA 2UUBB 1XEQA 1RT1A 5KGWA 1BGYH 1M57B 1S6QA 4NXMK 2IJHA 1YJ9N 4AF1A 3K9SA 2YV0X 1JCEA 3V4IA 1FFXA 3CYOA 1IDSA 1NG9A 4DR6K 1N36O 3VBBA 3P4IA 2PI4A 3MXMA 3BCCH 5C0YA 3D2FB 1IBMB 2R044 1QZ6A 1IKXA 3FFIA 3E8GA 2Z1JA 3AG2B 3SPGA 1YTFB 1FK9A 3QFPA 3TABA 3HO1A 1QNMA 1X3MA 4DQRA 4FOEA 5HFLA 3JARA 4HTLA 2GV9A 5E26A 2QWRB 2Q0RA 1DKGD 3L4IA 1B3QA 4B3RK 1GTOA 4JKGA 4R5PA 4PKGA 4KB0A 1JKHA 4JI0O 4ELUA 1HYZA 1PNKA 1VQLN 1LV5A 2IJJA 3CPEA 5AZIB 5LOVB 2HLDG 2X6CA 5KA5A 1FXXA 5AQPA 3AA3A 4J2EA 5B1AB 4M3ZA 4TUYB 1UPGA 3W7TA 1JCHA 3TI0A 1ATNA 4DMNA 5BREA 4PDMA 3LL3A 4CFCA 3SUOA 5AQNA 2UUAB 5LP6B 3AEIA 4AQYB 1T6DA 3JAKA 4JHDB 2KSDA 5H9CA 2AA4A 1YVWA 5FPRA 1G99A 1IXBA 4LFBO 4ID1A 3ZSWA 4DQ8A 1OH8A 2GTSA 1IBMK 4FK5C 1PO24 1N33O 2VG6A 4CZFA 3FYEB 4G2KA 1J5EO 1RDWX 2ILMA 2CGKA 4QE9A 5JVGL 1HMVA 2FLOA 4KH5A 2HHSA 4JASA 3AVJA 4GKJB 3JAMO 4GX0A 4H0OA 3T7ZA 4F9OA 3K5NA 2F23A 1KYOF 1RDDA 3HKCA 4DR1O 4PDWD 4K42A 3MCAB 1ZL8B 2HHHK 2KKWA 2HNDA 2P7TC 3JAKB 3OD4A 3RFRA 5AZJA 3CJ9A 3W7WA 4J2DA 3VQ8A 2ZGYA 1HNWK 2QKKA 3JALB 3L2WA 1NGJA 4MTGA 4JD2A 3TSPA 3VRAA 4MLEA 3VF6A 4UCOA 3BFRA 2W6LA 2BCCH 2B6AA 1YAGA 3L9DA 3AGRA 2ZNIA 1VSEA 2KQ2A 5KUKA 4DFPA 4JI0K 3F5WC 4A5UB 3KZBA 4CJ7A 1POV0 3DXRA 2RN2A 3PIPL 3O4QA 3BABA 3SK3A 4KTZA 3GDQA 4RWTA 4JKGB 5BXZA 3S3NA 3VR8A 1RCHA 1TUBB 4I50A 5LXTA 1DEJA 4OPKA 2EZPA 4MFBA 1X1PA 4W5QA 3ZT2A 1B9FA 4BWMA 1YXQA 1JJOA 3AVNA 1BOTO 2NN4A 3OTFA 1XREA 4AM6A 4CJPA 4ZTFA 1Q6IA 1H2LA 4RW6A 3WT0A 3CJBA 1S22A 2W41A 4X9QA 2YHAA 4Q0BA 1CXQA 1E4GT 4HAMA 3D2EB 3CC4V 3O9RA 3ULDA 1U49A 1N33K 1A5WA 1KAYA 3EE9A 2OTLV 1EN6A 5KHIA 2DYSB 4AM7A 1IBKK 2WLNA 3R65A 4GCZA 1A5XA 3DSQA 1DGKN 4Z2WA 3R1XA 5EZYA 3G25A 1XQ8A 4IDKA 1HLUA 3LSQA 5ADXH 4YOVA 2ZR3A 2DFEA 1MDUB 1IURA 4JF3A 5H5NA 1PD3A 3RYIB 3JAWB 2ATKC 3VA3A 5I3UA 1N8RO 2Q69A 2E88A 2EZOA 2UU9O 2B5JA 3DXKA 1Q81W 1RDBA 4HUEA 1DT9A 3RT3C 1SRYA 5B66Z 2NRZA 2RF2A 3NF8A 2ASPA 5GAGP 3CRQA 3C7NA 3WU2Z 5LGTA 2ZQBA 3RR7A 2QXLA 3DLGA 3ITHA 1KP2A 3C95A 4B1ZA 3LPTA 1T44A 2P06A 3ZRWA 3G6BA 2ADPA 1TAUA 2HHWA 4CIGA 1GLBG 1VSMA 1NJIW 2ZJRL 4QS9A 4DTMA 3EY1A 1VQON 4B9TA 4G9ZA 1QTMA 2HVIA 1IH7A 3QMLA 2ACZA 1VSIA 3ETDA 2G8WA 3NE6A 1NVPD 2YI8A 3KVGA 3VEYA 1JQ0A 4BDPA 4H5NA 3NHGA 3THWB 3CCRN 3ZHSA 1SQPH 4I0XA 5EOYA 3O1WA 4DXWA 3G4SN 4OXSA 1HRV4 2HHUA 4ZHQB 1BMFG 3WB1A 1BS3A 2KG7A 2OCHA 3RWRD 2ITMA 3K9JA 1ZC6A 4BWJA 1J53A 4ILGB 1G4YB 1C6VA 2ZNJA 3SMPA 2DY4A 2JK5C 4B9NA 3T1YO 4MQ3A 2H88A 3H1VX 2ZQMA 2UXCO 3B2EE 4YOTA 3SJBC 2ZD1A 2VG5A 1BG3A 3CI5A 3WQTA 5M1KA 3RMAA 3UQ8A 4H0YB 2GSMB 2YUAA 3VESA 1ILYA 1ASJ4 3PJSK 3TSUA 2IVPA 5LHHA 4DYLA 3VQDA 3ENBA 4BRKA 4RUFA 1YJNN 4CJ3A 3OE7G 4EFBA 3O3FA 1QLNA 5IT9O 2YNGA 1U2VB 4X1YB 2O8FB 1BI4B 2XY8A 2ADQB 4LF6K 2P90A 2G8IA 3JD2A 1WLJA 5LGNA 3WEEB 4FFKA 3HPGA 1FD9A 2R9IA 1VRUA 2IM9A 1QHTA 1W0JG 3CX5F 1L3UA 1WPBA 2ZE8A 3ASMA 4O4GA 2GEMA 4LNUB 2UXXA 2WLJA 4Z4IA 5C25A 2EX3A 3P4RA 2Y1IA 4KHSA 3UT5B 4LF7B 1YJ9V 5GONB 2QWNA 4Q5VA 3TK1A 1WP7A 1GMGA 3I0SA 3GE1A 3ABVA 1D5NA 1W0HA 1WSFA 4R7CA 3THOA 3CPWM 4CD1A 3H3NO 4DQIA 5E79Z 1RPOA 2WBNA 2JLEA 3QO7A 4DV0B 1SUQA 4FWNA 3KIOA 3DOKA 3JSLA 2UXBB 1HPZA 4CJKA 3O9OA 1CLQA 1YI2V 2O8CB 2RN9A 4O8KA 4KTWA 3OBWA 1Y76A 1IBKO 5FNVA 3JASA 1DTTA 4YTNA 3TAMA 1HR0B 3UM7A 1RT2A 3P30A 2DN9A 3TJTA 2UXDO 3ETQA 3ZCCA 4YY3O 3SPZA 3WNEA 2G8FA 4BR2A 5LHGA 4JS4A 3JS6A 4DU3A 4YT0A 2EWSA 3RMCA 3T1YK 1KSPA 2QK9A 4JK9A 3H3OB 2XASA 4DUYB 1BU6O 1WB7A 2BOBC 3KLFA 3K08A 4CF8A 1I3AA 3CERA 3DAWA 2EULA 3WB2A 1KFDA 2HB5A 1YTFD 2LGQA 5HRRA 1W2BM 1KF6A 4OPAA 4I6MB 4NKGB 2GWJA 3AO4A 1XNRB 4JLHA 4MS2A 3SGIA 3SFEA 5IYZB 3J7AU 3THVA 1COWG 2A40A 1DLBA 1JFFA 3H9VA 3SJAC 4EFEA 4B3TB 4DR4B 3L3UA 4BRHA 4LH6A 4KH6A 3SYOA 2IIRA 4WFEA 3CF5L 3VQAA 3AECA 5LMUK 2ZJQL 5CYMA 4B7KA 1AVMA 2YI9A 4F4LA 3MK6A 4JS5A 4LWSB 2P9PB 5AQYA 4FJNA 2HVJC 3C6AA 3I33A 3RVYA 1GM8A 1OHHG 2ARHA 3ASNB 3I55V 1GLAG 1RT6A 5KPTA 3OYNA 4FLUA 5B1OA 1FXVA 2A79B 3VQWA 3OT7A 3M8PA 4EKWA 3SJCC 1JOYA 1AJPA 1VF6C 4CJ4A 4LF9K 4XH1A 3ZMUA 3LUTB 2G8HA 4QS8A 4DV0K 4CGJA 3EXAA 4PELA 2WLHA 3DLLL 1RT4A 3IRXA 3IJ4A 5FROA 4X64B 1HNZO 3O9UA 2JEXA 4FJHA 3GB7C 1HDJA 1N36B 4IFEA 5AQSA 4UCSA 5CN0A 4ABMA 2F9WA 1HP8A 4BC3A 4JI7K 4U3FH 4BDYA 4DR1K 5J2UB 3ABKB 4X64O 4QPJA 1QLEC 1HNZB 4PL7A 3OYKA 3UO2A 4BG9A 2P9SA 1VQ8V 4DV5O 1ASWA 4YOUA 3HKBA 2HHTA 2FB5A 4JTAB 3F73A 4RCHA 3LP0A 3ZSYA 4DS4A 1BQZA 1GLCG 3G6EN 2Y4UA 4OLBA 2F8SA 2LW7A 4F6RB 3U10A 3SYZA 4OGQB 3ZIAG 2OANA 3J7ZO 4O5BA 4DF4A 3M6GA 4Z4CA 3N2KA 4JRPA 4M41A 4B3SB 4N41A 2P9LB 1NZ6A 5IWAO 2WDVA 2F8TA 2GX9A 2O8FA 1NVPB 3LPUA 4OJRA 1VSFA 3RVCA 1SS3A 1NJYA
chains in the Genus database with same CATH topology
1S5JA 5LA6B 3T3FA 1HQUA 4N5SA 2F93B 4LSNA 3PUFA 3NAEA 3ZEDA 3O3GA 3LZIA 4NXMB 4N56A 5IJ0A 1SKRA 2XRIA 1UA0A 3BRCA 4IG3A 3AVKA 4CEZA 4JI2B 2X6NA 3NGZA 4B9VA 2P5GA 1M93A 2D5RA 3KKSA 4JYAB 3LANA 1T5EA 3L2UA 3OVNA 4AHUA 3T1AA 3HT3A 1TKDA 4IKFA 4LF6B 3B6OA 4B8CA 1J5EB 2Q7GA 3O3HA 2VG7A 2BANA 4O55A 3DRPA 4LD0A 2FBTA 4EZ6A 1Q3EA 5D3GA 4AHSA 4TSXA 2KFZA 4GW6A 5HROA 1BL3A 4HCBA 2E5LB 3BA9A 5FRMA 4AILC 2DTUA 1SA0A 4W5NA 3JASB 4UCTA 3OY9A 2OPQA 4DLGA 4X20A 3AVAA 2XY7A 3HKEB 1S1TA 2IAJA 2IC3A 4BW9A 4DSEA 4DSLA 2CAZC 1S9GA 4CF0A 1L3VA 4CHNA 3DRSA 1HNVA 1Y97A 4YJ3A 2YIBD 3PO5A 4L8JA 5FDLA 3E01A 4H8KA 3SUQA 5HRPA 4FLWA 1H2SB 3MEGA 1Q5OA 3NBPA 3CHXA 4FJGA 4DR1B 1RDCA 5SZTA 1JL2A 4K8ZA 3CQ8A 2E4LA 3HKCB 3TAGA 1IKYA 4WE1A 4FM2A 3QLHA 4CEEA 4DS5A 3OYMA 3L8BA 2VWKA 1XC9A 3FI7A 4YHHB 1HNWB 4I9LA 1ASVA 3CSXA 1J9AA 3LP1A 1KFSA 4DTUA 4DU4A 4B3OA 1WAFA 3H08A 2OPRA 4DF8A 2D0CA 1G15A 1SV5A 3QNNA 4FJ9A 4ZI7A 4I9QA 4KI4A 1YEWA 4DTJA 3ZT4A 3V9SA 1JLQA 1BHLA 4CK1A 2KZZA 4LR3A 5J1EA 1A5VA 2E6LA 4B9LA 4KI6A 1TL3A 3KTQA 3JSNA 2RPIA 3HVRA 3E22B 3KLHA 3VQ5A 2QM4A 1RTDA 3PX0A 4LF8B 4Z4GA 4DSIA 4DFKA 5EIBD 5LXTB 3K2PA 4TV8B 3ZSRA 2HVHA 3KLIA 1D9DA 1QSYA 1NJXA 5DMRA 1RBUA 3OJSA 1L8DA 4CGHA 4TOIA 1RT3A 1Z26A 5C8YA 1D9FA 4O4IB 3QF7A 3JALA 3D0PA 4CEOA 1VSJA 4LH5A 4I4TB 3HK2A 4O4LA 1NT2B 4DV2B 4OX9B 4M3TA 3ZSOA 4CJWA 4FCYA 3NDKA 4CH4A 3LWMA 3TARA 2KW4A 2JS5A 5LMUB 2PUSA 3QO9A 3G0ZA 1VSLA 1UA1A 2HHQA 2PY5A 1QSSA 4KPYA 3P1GA 4X1KA 3M8RA 3S3OA 2OPPA 3V9WA 2OZSA 4CFBA 5IWAB 4OKKA 3RTVA 5KX5B 5HP1A 3DMJA 3PY8A 3JARB 5D5QA 4B9MA 4E19A 2IOCA 4CIFA 4QCLA 4NVPA 5DK5A 5KRTA 5LP6C 1BIUA 4FJKA 3DLBA 4KKOA 4LFAB 4LSLA 4GVMA 4Z0UA 2XY6A 1FKOA 4JI4B 4YJ2B 4O2AB 4EB6A 2QXFA 4EB6B 4YJ2A 4IIJB 4DQQA 1XMOB 2F4VB 3ZT0A 3L2VA 1EXQA 4CJLA 4GYCB 3M8SA 1NK6A 5SWMA 4X1IB 4IFYA 3AVLA 1JLEA 3MEDA 5IJ9A 4JI7B 3SV4A 1B9DA 4I7FA 1VF7A 2BTQB 2ZM6B 2O4IA 1ZBHA 3ZSXA 4KHUA 3QERA 4ID5A 2R7FA 4BE2A 3AO1A 4X62B 4FLYA 4NYNA 5K14A 3QEVA 2HNZA 2PTMA 4DTPA 3HM9A 4CF9A 1XMQB 3ZSQA 3QEWA 5CA0B 4E1MA 3MAQA 3RYHB 3ICXA 1N5YA 1EETA 1JXEA 3RYHA 3K5LA 1FKPA 5KHKA 4FJJA 4DV4B 4F3TA 1C1BA 1RBSA 5EU7A 3OYBA 4J2AA 4HNAB 4CJTA 1J54A 1R0AA 4F3OA 4DFMA 4I4TA 4ELTA 1NOYA 4HUFA 1HQEA 3KLEA 4CCHA 2I5JA 3LAMA 5K1PA 5J2NA 1M4UA 4O4HA 1C0UA 1KTQA 1RDAA 3CB2A 3HKDB 5BMVA 3C6TA 2R9AA 3K57A 4IBNA 3EZ5A 2ITGA 1WNSA 5HBMA 4B08A 2LSNA 1S1XA 5JQGA 4W5RA 1KVCA 2AJQA 4DUZB 3CFPA 5JS1A 4TV9A 2QKBA 3TWHA 5C24A 4FM1A 3QEIA 1IBLB 2FBXA 2P1JA 1TVKB 3OS2A 4CH3A 2Q7HA 4O2AA 5KHHA 2QJ1A 2Q7EA 1V9PA 1C1AA 4Z4HA 2R7YA 1VSHA 4O0JA 3HP9A 1Q8IA 4JV5B 1TK5A 1UWBA 3NH0A 4GLXA 4OGEA 2YIAA 4PHZA 3QESA 4DSKA 5KX5A 3RWUA 4CJSA 3WNFA 3JATA 4X1KB 4HTUA 5LMNB 4I2PA 3ZS8C 4RW7A 3OJUA 3TAFA 3NFAA 2F1MA 1ZYQA 2Z1GA 1NKBA 4H4MA 4C8LA 3WNGA 4Y1DA 1HJRA 3ZT1A 4EP5A 4RG8A 2PYLA 1LWCA 4M3UA 3I0RA 4O0IA 4GMJB 1JXBA 4CGGA 4KHPB 4DLEA 5JJNB 1YTUA 3CM6A 2RQ6A 4LNUA 3V9XA 5LP6A 4CK3A 2F95B 4D7TA 3QEXA 4M3XA 4AH9A 5J2PA 4O4IA 5J2MA 4DR3B 1KVAA 3NF7A 4FK4A 2X78A 4I55B 3AA5X 2HMIA 3AVCA 3SQ4A 4TV8A 3B6PA 3OYIA 1NK9A 4W5OA 1TKZA 4FJXA 3VQ6A 5J2QA 3O4NA 4JI6B 4DU1A 1RTJA 4CEQA 4CESA 4BACA 4ZHQA 4X20B 4M45A 2XO7A 1SA0B 3U11A 4ICLA 2R72A 1LAWA 4FJLA 2YNIA 3D45A 4JRQA 1RTHA 1RBRA 4CJUA 5BR8B 3KKRA 2D0AA 4CJFA 4L8RB 4CEAA 3OYAA 1Q43A 2IS3A 4DTOA 4IHJB 1DGSA 1S9EA 1CZ9A 2P5OA 5EZYB 1SKWA 3OS1A 2PYJA 2A1SA 1GOCA 4CS4A 4XIUA 3K59A 3HPHA 3TAPA 4E3SA 1MU2A 4F2SA 2OYQA 3V1OA 2FBVA 5C42A 3RMBA 2ETJA 3LNNA 3V1QA 2ZE2A 1GOBA 4RW9A 1U47A 4M3WA 1TAQA 4E7JA 4FK0A 4O44A 3WNHA 3AVFA 2KFNA 4DV6B 2F66C 2OPSA 4KAZA 3MEEA 2BE2A 3ZCMA 4CEBA 3N2KB 4ZIBA 3QIPA 4CK2A 3TAEA 3OYDA 1NK8A 4JI1B 3KD5E 3HP6A 1IKVA 3U3GA 1JLBA 4Z4EA 3HKEA 1ZBLA 5J2UA 3TANA 2R70A 3HXMA 4N47A 4CGFA 3LZJA 4IHJA 1O9GA 4HVJA 3G10A 4HHTA 1S1WA 3SR2C 3BPZA 5FPOA 3SNNA 2BDPA 4CGDA 3IAYA 5JH7A 2HHVA 1SKVA 4M3RA 3U3YA 1C0TA 2XHBA 2YKMA 4E1NA 1XI1A 3HPOA 5IJ0B 5KGXA 4NCBA 4FJIA 4TV9B 3C6UA 4ZOLB 5JQGB 1CXUA 1BGXT 3OYHA 3U6FA 3AO3A 1TKXA 4EP4A 4OKEA 3T19A 2P51A 4X65B 4JI3B 5KTQA 1T05A 4KHNA 3K58A 3N2GA 3ISNC 3VN5A 1L5UA 2YIBA 4CEFA 4DV5B 2ZIOA 3DLKA 2OA8A 4UQGA 4CE9A 3IG1A 1VK0A 3SQ2A 5I42A 4FVMA 4YFUA 4AHTA 1O1WA 1U4BA 4FJ5A 1S1VA 4ELVA 3F9KA 3M8QA 4DRXA 3VQQA 1BCOA 1IG9A 1REVA 3PO4A 2KTQA 1HW7A 3NGIA 4CHPA 1UAXA 4O2BB 3LAKA 1YTAA 1BQMA 2HHHB 2F96A 2OWOA 1IKWA 1JFFB 1VSDA 2GUIA 1WSEA 4DQSA 1YT3A 4PI0A 3QG5A 4NCGA 1U45A 1NJZA 1KMIZ 4DV3B 4KO0A 2PGGA 1NK5A 1KLMA 2D0BA 4IIJA 4OKJA 4UCVA 4AHCA 2P22C 1C0MA 1T8EA 1TVKA 3OTOB 1ASUA 1SQGA 5JCOA 3K5MA 3V9ZA 3SJJA 2HNYA 1FJGB 4CH5A 1TVRA 4CH6A 1ZBIA 4IG0A 4C8OA 1BCMA 5K1XA 4LFBB 2YNFA 4N76A 1S6PA 2X6SA 4QAGA 4UCRA 1LW2A 3P83D 2DFHA 1X9WA 3SI6A 3OYJA 1BI4A 1TGOA 3T1HB 3AVHA 2UUCB 4HNAA 3M7MX 2EHGA 2IGIA 1I39A 3FFQA 2O4GA 1GOAA 4DQPA 2PZSA 1U04A 4AHRA 4DR5B 2WONA 5ITZB 1UOCA 3I8DA 2VQEB 1N33B 2E3CA 2YHBA 4HCCA 2JGUA 4KL1A 4E7IA 3RYFA 3AO5A 3NCIA 4BE0A 3DLEA 4J2BA 5EYPA 4TUYA 3AA4A 2G8VA 3UIQA 4Z4FA 3SPYA 4PY5A 1NKEA 4DTSA 5FRNA 5JCOC 3P5JA 3L2QA 3ZSVA 4ZOLA 1NOZA 4CECA 3BHPA 3AVMA 4B9UA 4KHYA 4DR2B 3KK2A 4DTXA 4DR6B 3RYIA 1KCFA 1SL0A 4CJQA 2UU9B 4FLTA 3QETA 3V9UA 4ZTJA 5EIBC 1DLOA 4CF1A 4KV8A 1JLCA 4TQFA 1K6YA 3NF9A 1NJWA 2WOMA 4CHYA 1G6UA 4CS2A 1HRHA 4WBNA 1X4TA 1QE1A 4CERA 1TUBA 4I50B 4K8XA 4NCAA 1JMKC 2UXDB 3TAQA 4DSFA 3VQEA 1RTIA 3OYEA 1N34B 1SKSA 4DRXB 1EKEA 1NKCA 3KK1A 4DK1A 3VQ4A 4FXDA 4C8KA 1TK0A 4DSJA 2G8UA 5CZ1A 2DFFA 3ALYA 4RW8A 2V4DA 3BGRA 4OLAA 3CG7A 5KHJA 3OYFA 2ATQA 3N2GB 3LDSA 4FW2A 3NH1A 4B3RB 3V81A 4X66B 4K0KB 1RBVA 2ZCEA 1Z25A 4FJMA 3OYLA 2A1RA 4LFCB 1JL1A 4FM0A 4FW1A 1EP4A 4YJ3B 4NYFA 1WN7A 4WBNB 2HHXA 4FFBB 1HNIA 2JVDA 4CFDA 4LF4B 2NUBA 4JI8B 1N6QA 3LWLA 5CA1A 5HLFA 1TK8A 1JLAA 1KLNA 1FFXB 3E22A 4C8MA 3KJVA 5E41A 1M5IA 4LF5B 4KREA 1RILA 4E7HA 3AVIA 1Q9XA 2Q3SA 5CB4B 5J2TA 3NGYA 3MXIA 4GKKB 3LP2A 1QSLA 5JH7B 2VWJA 1X9SA 5HRSA 4FYDA 1EX4A 4YNQA 4PQUA 1T7PA 5JJEB 3SV3A 4CS3A 4ZI7B 3LP3A 4JI5B 5HRNA 4Y1CA 3PN1A 3AA2A 4CJEA 3WB0A 1WAJA 3JYTA 1IO2A 3RYFB 3VQPA 5CB4A 3V1RA 1B92A 4FZXC 3VQXA 4O4JA 3HJFA 1LWFA 1Q9YA 2G8KA 4M42A 1SL1A 5KRSA 4DTRA 3DYAA 5JS2A 1XHXA 4DV7B 5JVDB 3RMDA 2Z1IA 4FLZA 4BDZA 1D8YA 1HYSA 1P49A 5LA6A 4I55A 4G1QA 4D7SA 1WSHA 3SQ0A 1VRTA 4UFZA 3IS9A 1N32B 1KU9A 5CY4A 4FJ7A 2YNHA 1XNQB 3CFRA 1Z5VA 1RT5A 5CYQA 3VQBA 4CJRA 1ITGA 1S1UA 3SZ2A 3JSMA 4DWIA 1WSGA 2VQFB 3HKBB 3VA0A 1F21A 3CM5A 1JLGA 3KD1E 4CF2A 3RYCB 2B4JA 3L2RA 1TAEA 1RT7A 4EEQA 5LYJB 4U3JB 3KLGA 4KTQA 1JLFA 2FBYA 4CC5A 4B8AB 1SL2A 2Q0AA 4CHZA 2BGGA 4FLVA 1YVUA 2W42A 2Y1JA 3RGBA 1ZAUA 5CZ2A 4FLXA 4IFVA 1BQNA 1O9HA 3NF6A 2ZINA 4DFJA 4UCUA 3BA8A 3SUNA 1D5AA 1QQCA 2ZIMA 5JJJB 3BDPA 4LF9B 1CZBA 1QS4A 5D5PA 3RR8A 4O2BA 3U0ZA 5IYZA 3SCXA 1WSJA