1XI1A

Phi29 dna polymerase ssdna complex, monoclinic crystal form
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
publication title Correction of X-ray intensities from single crystals containing lattice-translocation defects
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
total genus 147
structure length 571
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xi1A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xi1A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xi1A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xi1A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xi1A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xi1A06
2X6SA 4CJPA 3HL8A 3M8PA 4BE1A 4FJ9A 1VSKA 1Q9XA 1U48A 3RMBA 1IKVA 4DFMA 1TL3A 2HVHA 1TVRA 1BQMA 4W5RA 2OPSA 4OPKA 5D3GA 3SQ0A 2DFFA 4KV8A 4CF8A 4N5SA 3HPGA 1UAXA 5FRNA 1W9HA 2Z1GA 4FLVA 3PO5A 2KZMA 1JL1A 3K58A 3C6TA 3KLHA 2G8UA 1WAJA 4DTOA 5HROA 1UWBA 1WSFA 4CERA 5KRTA 3EYZA 3OYIA 1NK9A 4FJNA 2KQ2A 5C25A 3QEXA 4DSEA 1NK0A 4IFYA 5SZTA 1LAWA 3JYTA 3AA4A 1LW0A 2HHXA 1XHXA 3OYBA 2JGUA 4LD0A 4IKFA 1IKWA 2D0CA 5CYMA 1RDBA 4DG1A 3KK1A 4PWDA 1ASWA 3WNHA 3ZT0A 2FBXA 3SQ2A 2YHBA 1A5XA 4AHTA 3PY8A 3VQEA 1BI4A 5C42A 3TAGA 1CXUA 4ZTJA 1SL1A 4FK2A 2ITGA 4RG8A 1G15A 1ZYQA 3T3FA 4FJIA 4CGHA 1NK7A 4FJ5A 3MEGA 1KFDA 3DLHA 4HTUA 4OKKA 1WSEA 1RBVA 1TK5A 1NOZA 3KLIA 4DS4A 5C24A 4O4GA 4DFJA 4KHNA 3NHGA 4BACA 1B92A 4CEAA 1VSHA 4CK3A 3KJVA 3AVIA 4DTSA 5KI6A 3G10A 4XIUA 1N6QA 3WNEA 1F21A 3DLRA 3SUPA 1WLJA 3K5OA 2X6NA 3AO4A 1EETA 3OYCA 4JLHA 3VN5A 3TAMA 4E3SA 3TAEA 2OA8A 3KD1E 4Y1CA 4F2SA 2GUIA 1BHLA 3PX6A 3AV9A 4KI4A 4M3YA 4E7KA 4NYFA 4K8ZA 3AA5X 4DWIA 4FW1A 3AO3A 1EX4A 3SV4A 3RMDA 4OVLA 1ITGA 2FC0A 3TR8A 2XY6A 3MECA 4F4KA 1BI4B 4O0IA 2A1RA 1KLNA 4C8OA 4FJJA 4M3UA 2HHQA 3ZCMA 3F9KA 3B6OA 4CF1A 4CJQA 3SV3A 4O55A 3K59A 2YNGA 5FDLA 3VQAA 4CJKA 1WSGA 4IFVA 3FI7A 4M45A 4F8RA 3LPTA 4I9LA 3LDSA 1ZBLA 1KRPA 3DLBA 3PO4A 4B9TA 4KFBA 1RNHA 1S1WA 4AHVA 3NGZA 2XO7A 3V9ZA 3MXMA 2B4JA 1S9EA 2YNFA 4FZYA 4KTWA 2XY5A 1VSEA 4LSNA 4CGGA 5E41A 3H08A 4B8CA 4DU4A 4ELVA 4ICLA 3RRHA 4CHNA 1HRHA 1X9WA 3VQ5A 1IKXA 4CJUA 2QKKA 3NF7A 3PV8A 1RTJA 4KPYA 2BGGA 1RTHA 3U3GA 4B3OA 2WONA 5HBMA 3O3FA 1IH7A 3DM2A 4DSFA 3V4IA 3P83D 3HPHA 3TI0A 1N5YA 4AHRA 1C0UA 4NYNA 3FFIA 1CZ9A 3OYHA 3KKSA 2OPQA 3HPOA 2W42A 3HP6A 4KREA 1JLBA 2RKIA 2PY5A 1YTAA 3I8DA 5J2PA 3CQ8A 3C95A 2XRIA 1SL0A 3PX4A 1RCHA 3V9SA 5HRNA 4C8KA 4JS5A 1WN7A 1KTQA 3M8RA 1TKZA 4E19A 4NCBA 1Y97A 3CM5A 2A1SA 2HMIA 2DFEA 2HHVA 3BGRA 5FRMA 1JL2A 4K8XA 3AVBA 4DLGA 4B08A 3BDPA 3G0ZA 4N47A 3A2FA 1TK0A 1U47A 3ZSWA 2ZQBA 3O4QA 4IDKA 3DYAA 1IO2A 4FJGA 1QS4A 1TGOA 1FK9A 4DMNA 3KLGA 3L2VA 4FJXA 3KLEA 4CJ4A 2Z1JA 1NK6A 5FROA 1JXBA 1FXXA 3AVLA 1NJZA 1D5AA 3THVA 4I9QA 4ID5A 2PZSA 5HLFA 4M3ZA 4HUGA 3VQ6A 5J1EA 3RMAA 4FLUA 1J5OA 2ZD1A 1QSLA 2HNDA 1HQEA 2DFHA 4F3TA 3AO1A 3ITHA 3AA3A 2VG6A 1EXQA 3VQ9A 1RT5A 2E6LA 3LP1A 3SCXA 3RR8A 4KKOA 1CXQA 1QTMA 2P1JA 2HW3A 1VRUA 3CM6A 3VQPA 1RT1A 3NGIA 5SWMA 4BDPA 1JKHA 4W5OA 1NKBA 1RT3A 3NF9A 4OGCA 1RBTA 1RT4A 1U04A 1BQNA 2GV9A 1NK4A 3L2UA 4CF2A 1RT2A 1JLQA 3CYMA 4RW9A 3DRSA 4LH4A 2PYLA 4KHWA 1NK5A 3RR7A 3T1AA 1D9FA 4JS4A 1HJRA 3QEVA 4KHQA 1JLCA 2KZZA 1LAVA 1W0HA 1HNVA 3VA3A 3HVTA 3V81A 2YNHA 4CJ5A 1NJXA 3HJFA 1BIUA 1DTTA 3HO1A 4YNQA 4Z4EA 4CK1A 2G8KA 2G8IA 3DLGA 1RDAA 4CJSA 4W5QA 3VQCA 1L5UA 4DQPA 3QNNA 3K57A 3K5MA 3I0SA 4CHZA 3L2RA 3VQQA 3TAQA 2BANA 4CHOA 4ELTA 4PQUA 3AVGA 1HPZA 3DLKA 3NF8A 3ZSZA 1ZBUA 4E7IA 4E1MA 4DTMA 4C8LA 4CK2A 3ZSRA 1LWCA 1YTUA 4WE1A 4HVJA 5DMRA 3DI6A 1X1PA 4B9NA 1C1AA 3AA2A 1BL3A 2YNIA 2F96A 3AVHA 3OYAA 4PUOA 4Q5VA 4FXDA 4J2AA 4ID1A 4EP5A 3DRRA 4ELUA 5EU7A 4W5NA 2Z1IA 4AILC 2VWJA 1QE1A 4CHPA 4E7HA 1SKSA 4DQIA 4N76A 1C1BA 2IDOA 2D0AA 5K14A 4FZXC 2XHBA 4IBNA 4KI6A 2DTUA 4CIFA 4KRFA 1A5WA 4Z0UA 3QLHA 5KTQA 5JS2A 3LZJA 3HYFA 3V9UA 3QINA 3K5LA 3QEIA 4FLYA 1C1CA 1SUQA 3D45A 3P1GA 1RBRA 4CJRA 3TABA 3JSMA 2VG7A 4CJFA 3NGYA 4M41A 3ZSXA 2O4GA 3ZT2A 3NH1A 4KB0A 4Z4HA 4E7LA 3ZSYA 3AVMA 3AO5A 1D8YA 4IG0A 3OYEA 3SUOA 2F8TA 1T03A 2G8WA 4CECA 3IRXA 3AO2A 3AVJA 3LALA 2VWKA 4KB1A 2WOMA 4CEBA 2HVIA 3QERA 4MFBA 4FLTA 1S6QA 4N41A 3SI6A 4FW2A 1KFSA 4BE0A 1GOAA 3HSTB 2P51A 3LP3A 3NE6A 3SPYA 1RBSA 1BISA 3KIOA 4DSLA 1WSHA 1RT6A 4DQRA 3KTQA 1J54A 3U3YA 1T05A 2QXFA 3E01A 2AJQA 4CJEA 1HYVA 3DMJA 4W5TA 3KK2A 3ISNC 3RRGA 1IKYA 4KAZA 2QK9A 2ZE2A 3O3GA 1LWFA 3OYNA 3S9HA 2KW4A 2X74A 2NUBA 4ZTFA 1KVAA 2IS3A 4MQ3A 3NDKA 3OYGA 3SQ1A 3QETA 3ZSOA 2HHUA 1X9SA 3OS2A 3AVKA 3MXJA 3L3VA 4LSLA 4OKEA 2ETJA 3NAEA 4N56A 1MU2A 3OY9A 2OPPA 4J2EA 3LWLA 2HB5A 5HRPA 4OPJA 2OZSA 4AH9A 4JRQA 1B9FA 1TV6A 3P5JA 1NKEA 1XI1A 2XY8A 1ZBFA 1I39A 3ZT4A 4J2BA 4DQSA 3TWHA 3KLFA 3SPZA 1TKDA 2YKMA 4FJ8A 1T7PA 3SQ4A 4B9VA 2RF2A 1SKRA 4Z4GA 4CHYA 4DSJA 4FZZA 4CGJA 1T8EA 3OYLA 3ASMA 4KTZA 1C6VA 1RILA 1JLGA 1XHZA 1HQUA 4FK4A 2HHSA 1Z25A 2B5JA 5KGWA 4PY5A 1HYZA 4M42A 1VSJA 3V1RA 4B9LA 3SUNA 5T7BA 4L8RB 1NOYA 1JLAA 2BE2A 3HXMA 1C0TA 4FLZA 1U45A 4FYDA 2R7YA 1QQCA 1WSJA 3AVCA 4Z4FA 3PUFA 4Y1DA 4C8MA 3VQDA 3C94A 1IG9A 2FBVA 2E4LA 4CIGA 1DTQA 1S6PA 2X78A 3RTVA 4B8AB 5J2QA 3IS9A 3HT3A 1NKCA 1GOCA 3NH2A 1S5JA 3S3MA 4F3OA 1ASVA 2OYQA 1B9DA 3ZSVA 4EP4A 3V9XA 4O44A 1UA0A 3OS1A 1RTIA 4DTXA 2GBZA 4EZ9A 1L3TA 2HNYA 1Q8IA 2ATQA 4GW6A 4H8KA 3U6FA 4AHUA 3S3NA 4NCAA 3DOKA 2Z1HA 3EY1A 1NJYA 4EZ6A 1S1TA 1WSIA 4DSIA 2LSNA 5KRSA 1RDCA 3WNGA 1VSIA 4H4MA 3K2PA 1JLEA 5CZ1A 4FJHA 2KFZA 4I2QA 1LWEA 1S1VA 4AHCA 3M8SA 1SL2A 1L3SA 4B9SA 4E7JA 4FLXA 1VSFA 4YFUA 3OYJA 3EZ5A 4DSKA 4UQGA 1YT3A 4HCBA 4FM0A 5CZ2A 4R5PA 3UIQA 4Z4CA 3TAPA 4KHSA 1UOCA 4E1NA 3DLEA 3KKRA 4DTPA 3NFAA 3RMCA 1Z26A 4FM1A 4E89A 4F2RA 1QSYA 3O4NA 2D5RA 4DLEA 4RW4A 2VG5A 3S3OA 1U49A 4BWJA 2R7FA 3RWUA 3CG7A 4QAGA 4RW8A 3OYKA 1BIZA 2Q3SA 3HVRA 4PA1A 4H4OA 2P5OA 1RTDA 4QCLA 3LP2A 1JXEA 2PYJA 4CEEA 1KSPA 4BE2A 4OLBA 2JLEA 3OJUA 3NBPA 2OPRA 4DFPA 4CE9A 1WNSA 3CFPA 3AVFA 2OZMA 1ASUA 4CFBA 1KVBA 3OJSA 3LWMA 3LAMA 3HP9A 4QOZB 1EP4A 1SV5A 2EX3A 1NK8A 3CFRA 4M3TA 4LY7A 3V1QA 4HHTA 4HUEA 1S9GA 1GOBA 4RW6A 4HUFA 1RT7A 2IGIA 4B9UA 1D9DA 4KO0A 4FJLA 4G1QA 4FLWA 1FKOA 1J53A 2E6MA 3VQ7A 4DF8A 2HNZA 3VQ8A 5HRSA 1ZBHA 5J2NA 4CGDA 4CJ3A 3HM9A 1HNIA 1LW2A 1CZBA 3QESA 5CYQA 1KVCA 1KLMA 1S1UA 3OVNA 1REVA 2RPIA 3LAKA 5HP1A 3MXIA 4O0JA 4CGIA 4FCYA 4DQQA 1KCFA 3L8BA 2Y1IA 5CY4A 5J2MA 3PX0A 4CFDA 1TKXA 4CJVA 4Z4IA 3QEPA 4CF0A 4FJKA 1I3AA 3QO9A 4JRPA 4LH5A 4DU3A 4DTJA 1XC9A 1UA1A 4CFCA 1BGXT 3LANA 3MEEA 3LPUA 4IG3A 5DK5A 4DTNA 5HRRA 3TARA 3K5NA 1Q9YA 3TAFA 3CFOA 4FK0A 4AHSA 4OLAA 3SNNA 1SKWA 5I42A 1TAQA 3L2QA 2IC3A 3T19A 3SYZA 2Y1JA 2QKBA 3ZSQA 3LZIA 1CLQA 3OYMA 4DU1A 3B6PA 2YV0X 4GVMA 3ALYA 4CFAA 4TSXA 4FJMA 1FKPA 5KGXA 2BDPA 1VK0A 1K6YA 2G8VA 3MEDA 4CESA 1HYSA 1VRTA 4E0DA 2F8SA 1X9MA 1XWLA 2PW9A 2IOCA 1A5VA 3VQ4A 3OYFA 3L3UA 4O5BA 4FM2A 4ZHRA 3KK3A 3NCIA 2EHGA 4CJWA 3V9WA 4FJ7A 3L2WA 4I7FA 4CEQA 4KHYA 3NH0A 3I0RA 1EKEA 1L3VA 3V6DA 4FVMA 3WNFA 3C6UA 1RBUA 1O1WA 4DF4A 2D0BA 3ZT3A 4BDYA 1VSLA 4CIEA 4DTRA 2I5JA 3DOLA 4Q0BA 2KTQA 3F73A 3D0PA 2B6AA 3VA0A 3QEWA 4CGFA 4CEFA 3QIOA 3O3HA 1C0MA 4B9MA 2IAJA 2YHAA 1YVUA 3NF6A 4OGEA 2KFNA 3VQBA 4CEOA 3AVAA 1L3UA 2FBYA 1TL1A 1LV5A 1J9AA 1S1XA 4OJRA 3ULDA 4J2DA 4M3RA 3QIPA 4CEDA 4BDZA 4RW7A 4CHQA 1QSSA 3IG1A 3IAYA 1JLFA 1BCMA 3V1OA 1RDDA 3OYDA 1HMVA 4HCCA 3HK2A 1TAUA 1U4BA 2O4IA 1WAFA 1TK8A 2FBTA 5JS1A 3SZ2A 1ZBIA 4DFKA 4CJTA 3SUQA 4NCGA 4KHUA 4GMJB 4BWMA 1NJWA 1QHTA 4KTQA 1VSMA 4DS5A 3QNOA 2G8HA 3AVNA 4DTUA 2RN2A 2P5GA 1BCOA 4CF9A 3KD5E 2G8FA 4M3XA 2HHTA 2YKNA 4CJLA 1VSDA 4CEZA 1TKTA 3OS0A 5I3UA 3TANA 2HHWA 4CCHA 2DY4A 1DLOA 3MAQA 3LP0A 3ZT1A 3DRPA 4I2PA 4C8NA 4M3WA 4OKJA 3SJJA 3M8QA 2XY7A 1R0AA
chains in the Genus database with same CATH superfamily
2HFEC 3G6EV 3K04A 1DEJA 2X6SA 1VQMN 1HKGA 1FFXA 4B3MB 3CCMV 4DV3B 3DXMB 1J5EK 1TL3A 4OPKA 4NXNK 5EXWA 3SQ0A 1RPOA 2X6BA 5FRNA 5KQ8A 2FF6A 4BIZA 2Q68A 3OM3B 1VQ7V 4FK5C 3D2EA 1SA0B 3KLHA 4ZHQA 3E22B 3CF5L 5HROA 1HNWO 1UWBA 2H3GX 1FW6A 4CERA 4GT1A 5AQMA 3EYZA 1POV0 1QCEA 3CS5A 1F7YA 2KQ2A 1NK0A 1RSOB 3VF2A 3ZMUA 5SZTA 2DOSA 4B3TK 1CXZB 3AA4A 4JI0B 1KQSU 1FJGO 4LFBK 1VQNV 2B1IA 2H8PC 3UCSC 1Y67A 4EFEA 4O8UA 4IKFA 1K5SA 1IKWA 1RDBA 4DG1A 4PWDA 5JJEB 1LNQA 4PDLA 3WNHA 3ZT0A 3SQ2A 4AHTA 1A5XA 1HW7A 3AE5A 4ILJA 3QF7A 5C42A 2DQ3A 1CXUA 3DJCA 1C0FA 4DR2B 1YCIA 1P90A 2ITGA 2Q2RA 3ENHA 3T3FA 1ZYQA 1HRI4 4LF9O 4ISEA 1BQZA 4CGHA 1FD9A 1VQ5V 5M1QA 3DLHA 4HTUA 4JI3O 3GDQA 1NJIO 5B1OA 4BRHA 4NB4A 2FLOA 4DS4A 2FSNA 5AQLA 3TTDA 4PV1B 4R50A 4DFJA 1XQSC 1VSHA 2GTSA 3CSXA 5EIBD 3ZCCA 4J80A 3CHWA 3HSCA 4AQYK 1E4GT 1RFQA 3DLLL 4YDUC 1XUPO 4XIUA 3WNEA 1GO3F 2GUZA 3SJCC 2B76A 2ZQMA 4ZIBA 1HX1A 2E8AA 2X6NA 3AO4A 1JOYA 1EETA 4BW5A 1CP9A 4A57A 3VN5A 3E66A 4F2SA 4UY8O 2OA8A 3KD1E 4Y1CA 2ZJPL 3D7EO 3FAVA 3AV9A 4QS9A 4DQ8A 2Z5UA 2OCEA 2Y69C 4PKGA 1ITGA 4RCHA 4F4KA 1QVGM 3CPEA 4O0IA 4FJJA 2XAQA 1N33B 4CF1A 2DYRB 3SV3A 3ULEB 5FDLA 4YTNA 3CC7N 2Q4PA 5GIPA 4QS7A 4M45A 2JJ1G 3LPTA 1KRPA 5JH7A 4LF8B 3O9UA 1ZBLA 4UCTA 4BG8A 1OOPD 3SBGA 4WQ4C 1HRV4 1G4YB 1S9EA 1NBWA 2YNFA 2N74A 3AGRA 2EIKB 3L70H 4JI4B 4DU4A 4JI2B 2ZM6K 3RRHA 4PKHA 3VQ5A 2ZNIA 2QKKA 1BGYH 1RTHA 4C23A 3O3FA 1IH7A 2ODMA 4MTOA 1D5NA 2VRZA 1AI6A 4FIPC 2YX6A 2CH7A 1CZ9A 3ABUA 3KKSA 2W42A 4YSXA 3B2EE 1YQ4A 5KA6A 1BT8A 2VYPA 1SZXA 1N34B 4MDAA 4YY3O 4IL6Z 2A41A 2Q0AA 2ZXWC 1JQ0A 4JS5A 1OH7A 4MVZA 4DRXB 4WBNB 3OHRA 1JCFA 1K5QA 5BMVA 4YXDA 5IJ9A 4YDUA 4IHJB 5KAIZ 2HHVA 4U3JA 4JI8O 1JL2A 3BY5A 4DLGA 1JJ2M 4B08A 4Z1VA 2O8FA 1Z6RA 4N47A 4J7KA 1N36B 1TK0A 4BRLA 5AQZA 3ZSWA 4IDKA 1L8DA 3AG1C 1KQSM 3KLGA 1FK9A 2DYSC 1K8KA 1VQPN 1YJ9V 4KH4A 1NK6A 1YF2A 2P9UA 3TI0A 2ZWHA 2IIRA 5GIOA 2A0LA 3AVLA 1NJZA 3THVA 1A32A 1QR8A 4ID5A 2PZSA 5HLFA 2NRRA 1TUBA 2FTKA 1VQ4N 1XNRO 1R094 5IYZB 3N27A 1Y6XA 4F3TA 3ITHA 2V1DA 3AA3A 3WQUA 5CHIA 1Q3EA 5AQSA 2E6LA 3LP1A 1OCOC 1WB8A 3G6BA 1PL0A 4KKOA 4TSFG 3SCXA 2O8EA 2FSKA 1Z7S4 1Y74B 3IC7A 1US6A 2EILB 1IVSA 1VQ9V 3CM6A 1VQKN 1WA8B 4DR4B 1QU7A 3THWA 1HNZK 5SWMA 3SAGA 4W5OA 4D6TH 3JAWA 4P9OA 4OGCA 1M1KW 1RBTA 3B8MA 4WFNL 2Q1NA 3N2GA 3X2QB 4FFBA 4PELA 4CS4A 1NA1D 1PP9H 2RDCA 4KHWA 2UXBK 2RMKB 3G6EN 4H37A 3VF4A 3AK1A 4A2BA 1D9FA 1S0VA 4JHDB 3OGIB 3CCMN 2KZZA 1U2VA 3H3OB 4DW0A 5AQGA 4OPHA 3CJBA 3ZX3A 5EBWC 3H1LH 3V81A 3Q4HB 4CJ5A 1PNKA 3F5TA 4J9ZB 2C2AA 1W2BU 3HJFA 4Z4EA 3CCEV 1I94B 3DLGA 4W5QA 2YICA 4X65B 1L5UA 1IBMK 5B1NA 4DQPA 1VQ7N 3I0SA 4CHZA 3TAQA 1GLBG 1DF4A 1M4UA 2B9ZA 2CAZC 4ELTA 2F23A 2OT5A 1KC8O 5LP6C 4C8LA 3A0HZ 1YITV 4CZLA 4DTMA 4J42A 5BR8O 4WE1A 3TTFA 4HVJA 4J11A 4X64K 3AA2A 5LY3A 3CERA 2YNIA 3AVHA 4PUOA 3ETEA 4RQFA 4FXDA 1IDSA 3U0ZA 5LMNO 4J2AA 2W0XA 1K7DA 5JVHL 5EU7A 2Z1IA 3AK3A 4JD2B 4GV6A 2VWJA 4JI5O 5E26A 4E7HA 4DQIA 4GB34 5CA1B 2FYUH 5CMUA 1C1BA 3TPQA 3TU5A 2KB1A 5LA6B 4IBNA 3O8MA 4PHZA 1VQ5N 4QPKA 2DTUA 3P4SA 4BGBA 3LZJA 1J5EO 4GKKO 2XUMA 3V9UA 1XNQB 4FLYA 1C1CA 1H38A 1SUQA 1EBOA 3PIPL 1JFFA 3OMAB 3P31A 3BABA 5BY1A 2VG7A 3NGYA 4CJFA 5FPRA 4E7LA 3LDCA 3QBXA 3SAHA 5ITZA 1D8YA 4IG0A 1HPMA 5JWPA 2XOKG 1YIJN 1M90O 1EQYA 3N2KB 4B3TO 1OCZB 2G8WA 4CECA 1SERA 3AARA 3IRXA 4DV5K 1K9MO 4JYAK 5IT9O 2VWKA 4EFHA 4KB1A 2KHOA 5KQDA 4XDKA 3PN1A 2R72A 4X62K 2VQEO 4JYYA 3LDPA 3CC2N 3A0RA 4ZI7A 3FE1A 2P51A 3LP3A 4BWAA 3O9TA 2QTOA 1RBSA 1BISA 1WUAA 1T5EA 4HWIA 1T44A 5BPMA 1O9GA 2ITCC 1V9PA 5FL7G 3SJAC 1VQOV 2QXFA 2AJQA 5GONB 2ZD9A 1EWQA 4RUEA 3O3GA 1GLAG 1LWFA 2DPNA 2KW4A 3UKUB 3S9HA 2WLMA 2OIEA 4LWSA 4I0XA 2NUBA 1WP7A 1QQNA 5LP6A 1FFTB 2DQ0A 4DR3B 2HHUA 2M7WA 4AF1A 3T7ZA 3AVKA 1SQXH 4IOXA 1ZWIC 5LGTA 3OY9A 1XDCA 1XREA 3BRCA 4QE7A 2CGLA 4AH9A 4NXMB 1QQOA 3P5JA 1VQ6V 1XI1A 3ZT4A 1I39A 3ZHTA 4DR1B 2Q97A 4J2BA 4MVOA 3KLFA 2UUBB 1S3XA 4XH5A 2CTWA 2OIGA 4JPRA 4DV2K 4YIPA 2PF4E 5H9CA 4YOYA 2A40A 3CRCA 4IIJB 4ILGB 2RF2A 1AR74 4FOEA 2A79B 5C8YB 4CHYA 3QB0A 4U67L 1H2LA 2QTDA 1XMQB 1Q90D 1FKAO 3OYLA 5KPTA 1JPXA 4KTZA 3FZKA 2HHHK 1GKFA 3EN9A 3JARA 2ZKOA 1XHZA 4CZJA 4UCUA 4O4LB 3K9SA 4UFZA 5DN6G 4DV0B 2NRXA 4PDRA 4DR4K 1HYZA 1VSJA 3PSIA 5BXZA 5HFLA 2I7NA 3A5LC 4JI6B 1C0TA 4FLZA 4MT8A 4FYDA 2R7YA 3GE1A 1QQCA 2X0LA 3F5WC 3AVCA 4GV9A 2F95B 4Y1DA 4C8MA 2ZM6O 3Q7BA 3K0SA 1YJ9N 3A0BZ 1VBA4 4CIGA 3RTVA 2X78A 3IS9A 3CCUV 3BFRA 3DC5A 1ASVA 3JD3A 5LHIA 2OYQA 4EP4A 3V9XA 4O44A 1N32O 5L3DA 1K92A 2FBWA 3PJSK 4QPJA 3JCUZ 1H1VA 1VF6C 3OR7C 4EZ9A 2YI8A 1TA8A 2E2QA 4AHUA 3U6FA 3DOKA 1WSIA 3A5NC 4ILHA 2P9SB 1VQ9N 4H4MA 2HOEA 4DXWA 1M56B 2ZJQL 4FVUA 4I2QA 2NN4A 2RNBA 4U7OA 2QWPA 1DGSA 4NO7A 1W0JG 1ZL8B 1I7FA 1KKDA 4FL9A 4Z4CA 1UOCA 4PJ0Z 1BZKA 3LDNA 4KX6A 1AILA 3M7MX 1HWYA 3I8BA 3RMCA 4E89A 1AR64 3ZHVA 1MQTD 4DLEA 1NU1H 2VG5A 1FJGB 5EZYA 3RWUA 3OYKA 5LYJB 3ZEDA 1K8AO 3ZRWB 1Z5WA 2QWNB 4B3SB 3VOVA 4YHHK 2Q0OC 3OJUA 1WNSA 2ASPA 2Z3YA 3CFPA 3AVFA 1HXS4 4GUNA 3C90A 5AQIA 2FMLA 5CBHA 1SV5A 2IVPA 1NK8A 3CFRA 2CUGA 3LDEA 3E9PA 1YITN 3V1QA 4JI3B 4HHTA 4HUFA 3K0DA 2F93B 4WFFA 3IGAC 2EINB 3WXLA 3D2FB 4KO0A 4HNAA 3OAAG 1PIV4 5LHHA 2D0PA 1J53A 4DV4O 2P9IA 3EZWA 5CA3A 1QNMA 5HRSA 1KF6A 2VCPA 4CJ3A 2X6CA 1VF6A 2QTSA 3AAQA 3V4IA 2EILC 2KG7A 1KVCA 1REVA 4O0JA 4CGIA 5C12A 1KP3A 3APOA 4JYCA 4CS2A 4NVPA 2Y1IA 4DR5B 4ZBMA 4X20A 5FPDA 4CFDA 2YI1A 1XQ8A 2K1EA 3OD4A 4O4HA 1QZ5A 1NR7A 1NI8A 3HKCA 1TKXA 3C7NB 2L35A 4J7ZA 4ABMA 4CJVA 1I3AA 3QEPA 3AEGA 4B7KA 1U96A 3QO9A 3O4WA 4LH5A 2ITMA 1VBD4 3C0BA 3CCLV 4CFCA 3MHHC 2CGNA 3LPUA 1VF5B 3TARA 1RHI4 5CA0A 2GELA 1SQGA 1NEKA 3RYHA 3CFOA 4R7CA 4AHSA 5I42A 1R3LC 3M99B 4G9ZA 1TAQA 3T19A 3SYZA 4E1JA 4H0YB 2UU9K 3WXJA 3LZIA 4DU1A 3HOSA 4GVMA 4CFAA 4IHJA 4TSXA 1Q5OA 5B3SC 1IZ3A 2G8VA 3SFEA 4KBOA 1VRTA 1VQON 1X9MA 4PDVA 1IXMA 4LF4O 1XWLA 1NLVA 3BA9A 3E8BA 3CCSV 2PW9A 2B1GA 3OUFA 5J2UB 4O5BA 4FM2A 3TSPA 3VQ4A 4BRGA 4ZHRA 4MVSA 3B8NA 4I7FA 1B04A 5BREA 2HR3A 2W0FC 1R6TA 4MW3A 3TK1A 3THYB 1AR5A 3CP1A 3SJQC 5EY4A 2QKSA 4FVMA 5KPZA 1BUPA 1G6UA 5C3JA 4YY3B 1B6QA 1YUWA 2CH5A 3ZT3A 3HM8A 2YXLA 2KTQA 5CB4A 2I5JA 2RE2A 1PO24 1ZSPA 2AHZA 1VQ6N 3QIOA 3O3HA 3IC9A 2YHAA 4DV7O 1YVUA 3NF6A 4OGEA 2Y0PA 3DXKA 1Y4MA 1Y74A 4CZIA 2Q9LA 1WA8A 2GHYA 2QA4V 2OTJV 2FBYA 4OXSA 1J9AA 1S1XA 4OJRA 2KQXA 3SMSA 2CH6A 4J2DA 2QXLA 4CBCA 4BDZA 4RW7A 1QSSA 1GLLO 1VF7A 3RYIA 1N8RO 3IAYA 4A5AA 1IBLK 3O6WA 3HK2A 1OCZC 2BH1A 2IJIA 3ABTA 1Q86W 4O4JB 1HNXK 2O4IA 1WAFA 1R59O 4BREA 1SQPH 5JS1A 2FKXA 4DFKA 3RFRA 2E2PA 3SUQA 4I50A 4NCGA 1XNRB 4JAVA 2GEMA 4GMJB 1NJWA 3O1BA 1QHTA 1C0GA 1VSMA 3QNOA 3AVNA 4JV5K 4CF9A 1Q81O 2P4VA 4LCUC 4KH6A 4M3XA 2IU0A 2YKNA 1TKTA 2GWJA 4YORA 2F4VK 3CEIA 3D36A 4ZKIA 1DLOA 2DY4A 1RMU4 3DRPA 3CCUN 1JCHA 1R6NA 3CXCU 3SYOA 3M8QA 5E79Z 2ZDIA 4DR6K 2P67A 4QNHB 3N4QA 1BCCH 1RUF4 4OX9K 1OCRB 3OTOK 2NLXA 4FJ9A 4TV9B 3CX5F 3TXSA 1IKVA 4YSYA 2OPSA 2UXNA 2DFFA 4CF8A 1Q82O 1UAXA 2QW9A 2Z1GA 2NRVA 2OTLN 3CC4V 3AE9A 2KZMA 2UYTA 1Q6UA 1IBKB 3JCZA 3K58A 1NGHA 4JKGB 2V7QG 3UKRB 4CI6A 3R9PA 1HUXA 4LF6K 3ICXA 4FWRA 4H0TB 4K41A 1S72V 5C25A 3QEXA 4H33A 4IFYA 4H5TA 4P9PA 3B40A 2ZR2A 2YEVA 3T1YK 4DUYO 1XHXA 3OYBA 2EJRA 3UB5A 4LD0A 2HWC4 5GTIZ 1H8HG 5BR8B 5CYMA 4PA6A 1ASWA 3B8AX 3ZX6A 2YHBA 1XEQA 3JASB 5CBGA 4P30A 3VQEA 1H2NA 5LMNB 2GX9A 4DR5K 4ZTJA 3O5BA 4FK2A 4RG8A 1AP6A 1G15A 4FJIA 4MO4A 1MWKA 4LC1A 1NK7A 4JI5B 4FJ5A 1S5HC 2Q6AA 3BEXA 4JAUA 3ASOB 1KD1W 3KLIA 4GX2A 4IO8A 5IT9N 3CQYA 4CEAA 1GRJA 1T6CA 5AQYA 3KCXA 1FYJA 3KJVA 3AVIA 2PGGA 4YJ2A 4H5VA 4RTFD 3G10A 3CHXA 2Z0AA 2A9HA 3UKUA 3RGBA 4X1KA 3MK6A 2O8BB 3QFPA 1S22A 3OYCA 2E5LO 1BHLA 5JVDB 3PX6A 4KI4A 4QJFB 3KK7A 3VEWA 3P32A 4E7KA 2CGKA 4NYFA 1M56C 2QWOB 4K8ZA 3AA5X 4FWLA 4JK8A 4MLEA 1YHQV 4DWIA 3HKEB 1DT9A 4FW1A 3RSEB 3SV4A 2VQEB 2FC0A 2UUAB 4WFAV 1OV9A 2XY6A 3DC6A 1BI4B 3I33A 2R074 3ZMSA 2E74B 4M3UA 3B6OA 3W7TA 3ZYYX 1X4TA 2UXCB 1EFRG 1HR0K 4O55A 1E4FT 4CJKA 3SPHA 4A2AA 3FI7A 1WSGA 5KLVH 5EC1C 4WYBA 5C8YA 1K4DC 4G27B 4JAAA 4I9LA 3PO4A 3NVMA 1I0HA 4KFBA 4AHVA 3V9ZA 4FZZA 3FR0A 5AQOA 1RUE4 4LF5K 2A5XA 4CGGA 4B8CA 3WEEB 3AEAA 3R6MA 1HRHA 2I7PA 1YF5L 3PV8A 3J81N 2BGGA 3U3GA 3DWLA 1RP3B 3TXQA 3DM2A 3MWPA 1N5YA 4G2KA 4JI1K 1DTOA 1TVKA 1C0UA 4KP4A 1G8MA 3CI5A 3CRMA 2UXDK 3CCSN 3HP6A 1JLBA 2EINC 1T3VA 2RKIA 2PY5A 1YTAA 3I8DA 3CQXA 4N21A 1JCGA 2YDEA 3C95A 4Q4V4 1BSMA 2WLLA 1K73W 1SL0A 1RCHA 4C8KA 2V52B 4NB5A 2JK5C 3WG7B 1KTQA 3K3WA 4NLCA 4BC4A 3JALB 1BG3A 2LP7A 1TKZA 4E19A 4DV6O 4YOVA 1Y97A 3M6GA 2A1SA 2HMIA 1RUG4 1ZOYA 2VGNA 4NYKA 3QICA 3QG5A 4XH4A 3AVBA 2JDIG 4K8XA 3A2FA 3SYPA 2R064 4BQZA 2ZQBA 3O4QA 4BRIA 2EBOA 1TUYA 4RUFA 3DYAA 3PLAA 2BTQB 2N05A 3ETGA 3HZ6A 3L2VA 1TGOA 2QA4N 2OTJN 3KLEA 4CH6A 5KHKA 3H9VA 3ZETB 1EWRA 4U7NA 4BC3A 5JQGB 1MZFA 4I9QA 1F51A 4M3ZA 5DECA 5FNVB 4LFCO 5J1EA 5EOYA 4FLUA 1QSLA 4X88A 2HNDA 3G4SV 2YC0A 4UV8A 3AO1A 1N32B 4YOUA 2VG6A 4Y0WA 2Q31A 1RT5A 2V7YA 2ZF5O 4FWMA 5KMGB 1CXQA 1QTMA 4FWSA 4B1WB 3SYAA 4B1VA 3UE5A 3CWBH 3W3DA 1VQ8V 3NF9A 5TKWA 4BRMA 2WC9A 5AQXA 1RT2A 1X3NA 4X66B 3J8AA 1JJ2U 1KKCA 2IU3A 3T1AA 5CE3A 3K0GA 1HJRA 5AQRA 3QEVA 4IWVA 1JJOA 4O4IA 1W0HA 1SZTA 5ADXA 3VA3A 2GSMB 3L4QA 1NJXA 1BIUA 3HO1A 2LW1A 3BP8A 3O1WA 4YNQA 3S3WA 4CK1A 5IYCO 2WQYA 1RDAA 2HSTA 2PUSA 3VQCA 3C3TA 5HOOA 5EYPA 5DEDA 3VQQA 1YZBA 4H03B 4CHOA 2Q67A 2V51B 3E8HA 2O8DA 1HPZA 3DLKA 3NF8A 4KHPK 5IWAB 1SS6A 4LH7A 3EKUA 4E7IA 1K3EA 4BQLA 4X1IA 1SQVH 4E1MA 1LWCA 1YTUA 4AM7A 4I5SA 4DUZK 1OH8A 4B9NA 3HBTA 1ENVA 2QGNA 3OYAA 2P9KB 4K0KK 1JX9A 4Q5VA 1D4M4 5LL6Z 2YHWA 4LFAO 1J6ZA 3OA9A 2UXXA 5EX5A 5BRFA 2KSDA 2O8CB 1SKSA 4DR6O 1QLEB 3IMXA 3SUPA 2UUAK 4N76A 4DR7K 2IDOA 4DV4B 2VGMA 4FZXC 2XHBA 3I5DA 4KI6A 3GOIA 3JS6A 4FWNA 1A5WA 2UXCK 3K5LA 2QKCA 4UB6Z 3WB0A 1BMFG 2VS0A 2GDSA 2ZE6A 3ABKB 4G28B 3ZSXA 3NH1A 4KB0A 3I55V 3CRAA 1YI2V 3ZSYA 1OCCB 3BF1A 5JLHA 1OCRC 1UFIA 4MS2A 4BC2A 3TSUA 4JKCA 1T03A 2F8TA 3T1YO 3AVJA 4B1YB 2H89A 2WOMA 1DF5A 4GY2B 4LNUB 3AG3B 4CC6A 3CCVV 4FLTA 4MFBA 4N41A 3ASNB 2BSKA 4F6EA 4CBWA 1GOAA 3HSTB 1YHQN 1VIBA 3NE6A 2UUCB 4GKJK 4DSLA 5J2TB 3T69A 1NGJA 5AQTA 3KTQA 1J54A 3FB5C 1HYVA 4W5TA 4RQEA 4BGAA 3RW0A 3E35A 4KL1A 2E2NA 1OHHG 4ZTFA 2P9LA 4LF4B 5AQWA 2NZTA 4QGPA 4BRFA 1EM1A 3I56V 2CDYA 3QETA 2AZ0A 3CJ7A 4DV1K 3NVKA 3OS2A 3CCQV 2X5ID 1YXBA 2QM7A 2DJVA 2XTAA 3DAWA 4J2EA 3LWLA 1KP2A 5HRPA 3MHSC 4ZOLB 4FO0A 1COV4 1AL24 2CGOA 3WXMB 3ASOC 3L72H 4IFEA 5GTHZ 1NKEA 1ZBFA 5LXTA 3TWHA 4LH6A 1TKDA 1Y64A 2Y0IA 2WLKA 1T7PA 3W0LA 4B9VA 1CEZA 2ZIOA 4DV7B 2EIJB 2JWLA 3H3NO 4JI7O 1MA9B 1T8EA 2HP8A 3VQWA 3AAPA 1KAZA 3ASMA 1C6VA 2WLIB 3OTFA 3ABLC 4B3RB 4B3MK 1E1QG 1Z25A 4DV3K 1RPRA 4LF7O 4PY5A 4B9LA 4CZGA 3RYFB 4L8RB 1DLBA 1JLAA 3HXMA 5AQPA 5FPOA 4O2AB 1XMOO 3HOTA 1U45A 1WSJA 4B7EA 5IYDO 3ENOA 4X66K 3RT3C 3U9DA 3VQDA 1QHAA 2RCVA 1ESVA 3H6EA 2RS54 4WQ4A 3T1HB 1DTQA 1AVMA 3LNNA 4B8AB 5M1OA 4J41A 3NH2A 1S5JA 1M9NA 3AG4B 3FYEB 3THXA 1B9DA 4F3OA 4JI0K 2EZPA 3ZRXA 2ZT9B 3ATUA 3GB7C 2GBZA 3E1YA 5KA5A 4PA9A 1FXHA 1Y76B 4L87A 2CTPA 2NRZA 3U8XA 4JYBA 3O80A 5B5EZ 1NJYA 4JKHA 2F9WA 3A8TA 2LSNA 4DSIA 5KRSA 4DR2K 5IWAK 1ATNA 1VSIA 3K2PA 5CZ1A 2WUSA 2KFZA 1IURA 1VQ8N 4AHCA 3L74H 2WBNA 1SL2A 4E7JA 1L3SA 4FLXA 1VSFA 1F4NA 2E1YA 3EZ5A 4UQGA 5JICA 4FM0A 3VENA 5LMUO 4R5PA 1P7GA 3QTCA 4E1NA 4DTPA 5L3BA 4BRPA 1ZBSA 1Z26A 5M1NA 1KB9F 3L73H 3A5OC 3O4NA 2D5RA 4IJAA 4FFKA 1U49A 1HDJA 4BWJA 4MW8A 3H01A 1YJWV 3FFQA 4DUYB 4QAGA 2Q3SA 1T6DA 3HVRA 1VQNN 3JSNA 4QCLA 2IBZH 3SMPA 4FMTA 4CEEA 2ZE8A 1ZC6A 4BE2A 2JLEA 3DXRB 3GVMA 2OPRA 1FXKB 4DFPA 2OCHA 2OZMA 3CRQA 1ASUA 3Q7CA 3LL3A 1KVBA 2QWOA 3BHPA 5AZIB 3LWMA 1TYQA 4YIOA 4J7JA 3CPWU 3MWTA 5AZJB 3JD74 5JCOC 4EHUA 1P4RA 4LY7A 3RSEA 2E3CA 4RW6A 1S3JA 1BU6O 2IGIA 2HKOA 3JD2A 1N33K 1NVPB 4NXNO 4JTDB 4FLWA 2VQFB 2GTAA 3LNMB 1FKOA 3M5RA 3CCJV 4LF8K 3UT5B 1S5LZ 2P6JA 4UUJC 4O2BA 5BN8A 3NMUA 2ATKC 3VQ8A 4DF8A 4O8KA 4ASUG 4CGDA 1WPBA 5CYQA 4JI4K 2E5LB 1KLMA 4TV8B 1HLUA 3JD1A 5AR0A 4JI2K 5FLXN 4BR0A 1D9DA 1YDXA 4LFBO 1KCFA 2FSJA 2PI5A 3F7YC 2GBOA 3PX0A 5F0XA 2QWRA 3E86A 2JEUA 5KX5A 3CE2A 4Z1MG 3O9SA 5JVGL 4RAIA 5CN0A 2QWLA 3VPZA 2JVDA 4JRPA 4DTJA 3PSFA 1UA1A 1X59A 2OWOA 3LANA 4IG3A 1N34K 5DK5A 2QM8A 3K5NA 1GN6A 3T2MA 1O13A 3D8CA 3TAFA 1GN2A 4WFGA 4I9WA 1D4XA 3LDDA 4JAXA 5JJNB 1L0NH 4BVPA 4PL8A 4OLAA 3L2QA 4CD3A 1NCQD 3ZSQA 1NMNA 2YHYA 4PI2A 2QWQA 4I6MB 3CJHA 2MK3A 4BR2A 4AQYO 2P9NB 1VK0A 1K6YA 1N36K 1VARA 2BOCC 4DR7O 1HYSA 4I4TB 1SF9A 2P7TC 1GLEG 1MSWD 1ATSA 4B3RK 2IOCA 3FZLA 3OYFA 3NCIA 1DKGD 4CEQA 3NH0A 2H94A 1QZ6A 3I0RA 3AE4A 5B1BB 3I56N 2Q5ZA 3OW2U 3HTVA 3WNFA 5JQGA 3ZEUA 1O1WA 1VAZA 1QLEC 2D0BA 3J81O 1ORQC 3QO5A 3DOLA 2WDVA 1V55B 1NH2D 3D0PA 4DV6B 3QEWA 3BZCA 4CGFA 4YJ3B 1C0MA 2FL4A 4W4LA 2JS3A 4BRCA 2IAJA 3IJ4A 1BHBA 5KMGA 1L3UA 1H2SB 3AVAA 3AECA 3RWRD 3ABKC 3DXMA 3ML0A 4DK0A 2XT9A 1CPYA 3FB8C 4M3RA 1KAXA 5A9GA 4CHQA 1OCCC 3JATB 4CVNE 4HCCA 1HMVA 3E9OA 5ADXH 3H1KH 1SA0A 4F4LA 1XL4A 2DYRC 3E22A 2E88A 3K08A 3AG3C 4JKFA 2ETNA 3FB7C 4GVEA 4CJTA 1ZBIA 3ASNC 1RSOA 4FJCC 3VTHA 4YSZA 3B09A 1SC5B 1I94K 3CPWM 2RN2A 4X65K 3SLCA 3ZLJA 5KPRA 2EIKC 2IVNA 1R73A 1R6KA 2HHTA 1VSDA 3G67A 1NKDA 4ISFA 4DO2A 2HLDG 1Z5VA 3SUCA 3LP0A 4M3WA 3WB1A 2JIZG 2R9IA 2HBJA 3EY1A 2XY7A 1NNEA 1SESA 2RM24 3RYCB 1MDUB 3HL8A 4IJNA 3VGMA 2P9KA 1Q9XA 1U48A 3P30A 3RMBA 4DFMA 1HNWB 2HVHA 4W5RA 4KV8A 4N5SA 2D1KA 1W9HA 1RM1B 1VBC4 2DW4A 3FGUA 1KMIZ 2ZINA 1JL1A 2RHKA 2JWKA 1ZAUA 2G8UA 4DTOA 4BW9A 4TQFA 4F6RB 5KRTA 1XNQK 3OYIA 4JGSA 5GADP 3CCEN 4DSEA 1MMMA 1LAWA 3HKBB 4KFMA 3JYTA 1XOUA 1NJIW 1QR9A 1KBHA 2HHXA 2WP9A 1LUVA 3QMLA 3LDLA 1WAZA 1LR1A 2JGUA 3P39A 4LF9B 1R3KC 3JAMN 1HKBA 3LDQA 3M3ZA 5LOVB 3EL2A 4JKAA 1HNZO 4JI0O 3VF6A 2YI9A 1NGAA 3C6AA 2JGDB 5EBMC 4I55B 4LFAB 3QO8A 4YOTA 1KAYA 1QVFM 3ULEA 2WSSG 5H6RA 1FFXB 1Y66A 5TISZ 1KFDA 3MEGA 1RGIA 3MN5A 1RBVA 4P2ZA 1TK5A 1NOZA 2UXBO 1GTOA 3FD9A 5C24A 3MX2A 5B8HA 3NHGA 1O9HA 5EVZA 4FWKA 4X89A 3AG4C 1YAGA 4CK3A 2XAFA 5EK0A 3OW2M 2HG5C 3ZMZA 1GM9A 2AP1A 5KI6A 2A7WA 4ICGA 4GCZA 3SPIA 1N4CA 2G38A 3RVZA 4ZHQB 5LBQA 3X2QC 3THOA 1IBMO 1F21A 4MVQA 3K5OA 2QWMA 3SAFA 3LSSA 4N23A 3R3LA 4JLHA 4AM6A 4DR3K 4E3SA 2F43G 2N04A 2GUIA 4Q4Y4 1AI4A 1BS3A 4M3YA 1GMGA 2X7RB 3F9MA 4NXMK 3KWIA 3SBTA 4BR7A 3HB3B 5EIBC 4X64O 1NS1A 1RFYA 1D2DA 3IUCA 3G71V 3A8YA 3MECA 4DR1K 4WBNA 4DRXA 2UUBK 3QDKA 2A1RA 1KLNA 3RVYA 3F9KA 1BHAA 5KHJA 3OT7A 1LOTB 3K59A 4IFVA 2NRTA 1XMQK 1Q7YW 1KU9A 2MW2B 2YXYA 3ZS8C 3LDSA 3DLBA 4B9TA 4RWTA 4FJMA 1RNHA 2XO7A 3NGZA 4FSVA 3MXMA 3FZHA 3HR0A 4FZYA 2XY5A 4HBNA 4PA7A 4CZFA 4DV0K 3AEBA 3H08A 3OGCC 1RDWX 4CZMA 4ELVA 3U9ZA 1K5MD 4CHNA 1FXKC 1X9WA 3CMAV 4R8CA 1XC3A 2GUZB 4KPYA 1RTJA 4B3OA 3NR7A 5EC2C 5L3EA 3L75H 5KUMA 4JI6K 4AHRA 5H2FZ 2WA3A 3FFIA 3MN6A 4O2AA 3FAVB 5IYZA 2OPQA 3HPOA 5ELZA 2Y48A 4KREA 4JYAO 4DV5O 2QM4A 1M57B 2XRIA 4JI8B 4X62O 3DGEA 4K3AA 1U6ZA 5HRNA 4JASA 1WN7A 1FPOA 4JI7B 3WUHA 1V4TA 4CBUA 3D3QA 3CM5A 3E8GA 1NU0A 2DFEA 1JMKC 5F2VO 1M93A 3S41A 5JLFA 2ILMA 5FRMA 3BDPA 3G0ZA 2RQ6A 4B1XB 4BR4A 4LF7B 1U47A 3R8EA 2YS8A 1IO2A 4JHDA 2ITDC 4DMNA 4FJXA 2ZE5A 3FZMA 1XMOB 4CJ4A 3Q4HA 1YTFD 3VBBA 5FROA 1OJHA 1NGEA 3R66A 3VEVA 2AHYA 3MCPA 4K42A 3VQXA 1NTMH 3VQ6A 1GLJO 2WPDG 1VEWA 1J5OA 2CH7B 2RS34 1HQEA 3U10A 3DSQA 1FJGK 4IYHA 3VQ9A 2CE4A 4MVMA 4DV2O 1K33A 2RN9A 1AB3A 3RR8A 4B3SK 3P4PA 1F4MA 3VQPA 3LSQA 3FZFA 1RT1A 4XDJA 2F7TA 4BDPA 2RS14 1YJNV 1RT3A 5BMVB 4JNEA 2ZGYA 1VQMV 5IJ9B 1RT4A 2HHHO 2XAHA 1U04A 1BQNA 4JD2A 4LF9K 1AR4A 1MA1A 4U3JB 3ZBHA 4CF2A 5K1XA 1AJPA 4TUYB 4JI3K 2O8FB 3CYMA 4RW9A 2QR4A 5CA1A 2PYLA 4DR4O 3DRSA 4LH4A 5B1BC 3RR7A 1XBLA 5LA6A 1KC8W 5LMUB 2Q8VA 1ZTEA 3VEOA 1F23A 3H1VX 1BL8A 3EHBB 1LAVA 2QKAA 1HNVA 1K8KB 3AEFA 4UCSA 2YNHA 4IZ9A 5KHHA 2P9UB 3MN7A 3FB6C 1V55C 1SQFA 1DTTA 3VEYA 3HI0A 4EIAA 2G8IA 4CJSA 3AK2A 1M1KO 4H0OA 3K57A 1NGGA 1TUBB 3R65A 4BRDA 2PFUA 2BANA 3LDOA 1VP7A 4TV8A 2LQTA 3AVGA 2YSUB 3N2KA 4M7YA 5IY5B 3ZSZA 4MTFA 1I94O 4CK2A 2DE0X 2P4KA 2O8EB 1I5YA 3HKDB 3SYQA 4MO5A 1WJZA 1NT2B 2EWSA 3THWB 2ACZA 4ID1A 3E89A 3JAWB 3DRRA 1J5EB 4GKKB 1P8ZA 1MNGA 3N2GB 4NXNB 4AILC 2FF3B 1QE1A 4XBFA 4FFBB 5GONA 5BRHA 2HJDA 4MTGA 1M90W 3L0QA 3SPJA 3AEDA 3JD4A 2D0AA 5IYBO 2QSAA 1K9MW 1VRH4 4CIFA 4X1YB 1S76D 3QLHA 4Z0UA 3K79A 5KTQA 3H1JH 1KECA 1U2VB 3HYFA 1EV14 3LUTB 4R6ZA 3P4IA 4V19S 4B3TB 4CJRA 5HFMA 3TABA 2WS3A 4M41A 1I08A 3JSLA 2O4GA 4JKBA 3ZT2A 1PD3A 4C1NI 1H2GA 1NBMG 1W97L 1PNMA 3A0IX 4TT3G 3AGKA 3CRRA 4UVCA 3OYEA 4YHHO 3SUOA 1UJWB 3GL1A 2YJFA 5FLXO 4YY3K 2GTDA 4CEBA 5MLCQ 3CCLN 4IIJA 1RM1C 3B77A 2IJHA 1NGBA 4FW2A 3SI6A 4QIWF 3SPYA 3L71H 4JTCB 4Q4W4 3KIOA 3K03A 1WSHA 1ILYA 4BIUA 2NRWA 4CZKA 2EZOA 1W59A 3CC7V 1RT6A 4EAHD 3U3YA 4QE9A 2K9PA 4K35A 3KZIZ 1GLFO 4JI8K 4CJEA 4AQYB 3TCUA 4O4LA 3RRGA 1AP5A 4KAZA 3VMFB 1Q43A 2ZE2A 5TKYA 3BEHA 1AJQA 2QK9A 3UM7A 1ZXOA 4KUMA 4BRQA 1KVAA 4CBXA 1QQMA 4MQ3A 2Q0UA 3OYGA 5FPNA 1XILA 1X9SA 3EVKA 1YEWA 3C3SA 1JFFB 3MXJA 3L3VA 2XAJA 4LSLA 2ETJA 3NAEA 4N56A 1MU2A 4GV3A 4A5UB 2CGJA 5FPMA 2OZSA 4JRQA 4IXCA 2Q0RA 5ITZB 2LGWA 1XNRK 1TV6A 4YT0A 3OBYA 2XY8A 3WT0A 4DQSA 3SPCA 3SPZA 3MDQA 3RVCA 3TSQA 1NGDA 3GBTA 4MLHA 4MDBA 3VR9A 4JK7A 1SKRA 3AE1A 4GX5A 4WFHA 4ZI7B 1COWG 5IDJA 4CGJA 2P9SA 2UU9O 1NZ6A 3ZHQA 3AG7A 1PNLA 3D3IA 5C15A 1HP8A 1JLGA 2QI2A 1HQUA 4L3QA 2HHSA 3KCYA 5L3FA 5KGWA 3VRBA 1ZL8A 3FX7A 2LO1A 5KAFZ 4JZGA 2ZM6B 3V1RA 4M42A 4J9YB 4LWSB 3SUNA 4I0XB 1VQPV 4LC9B 3JAKB 3VR8A 1JR9A 1SKVA 5LP6B 1NOYA 4WFBL 4GYCB 4BY9C 3HRGA 1CZAN 3W7WA 2YUAA 1IBKK 4Z4FA 5KHIA 3PUFA 2HW3A 5LYJA 2VWBA 3C94A 2FBVA 1PL4A 2E4LA 3ZJZA 1S6PA 3ZRWA 1GOCA 2F9TA 2QWNA 3MMVA 3ZSVA 2ZGZA 3OS1A 2E75B 1L3TA 1SAZA 3C6HA 1GK9A 2HJFC 2W6LA 5BR8K 1VQKV 5I9EB 3ZN0A 2RJZA 1Q8IA 3T1CA 2HNYA 3JBG4 5LGNA 1E79G 3LSUA 1FAFA 2KKZA 4H5WA 5LMNK 3J7AP 5E84A 3LM2A 1MABG 1ZP0A 1AJNA 1P7BA 1JLEA 4FJHA 2JGDA 1N0NA 3ZHSA 1K8AW 1S1VA 3D2FA 3JARB 4HAMA 3M8SA 1YJNN 4B9SA 4JI5K 3OYJA 1RUI4 1IBLO 1TAEA 1YT3A 4H0LB 4HCBA 3DTUB 1HNXO 3CC4N 3TAPA 1M57C 4YOWA 2HBMA 3DLEA 4TOIA 3KKRA 4IDHA 4IYIA 4GKKK 2DN9A 3FFKB 4U3FH 3KHYA 4BRKA 1QSYA 4D7TA 4F2RA 1FXVA 1K4CC 4RW4A 3STZC 2JEXA 3S3OA 1S72N 2EIMB 2BCCH 3CG7A 4RW8A 3AE2A 4IEEA 4JV5O 1BIZA 2Y4TA 4PA1A 4H4OA 3C7NA 3SK3A 2P5OA 1R084 2A3QA 5L3GA 3VQVA 2F4VO 3K06A 1JXEA 3LP2A 1KSPA 4OLBA 1HNZB 2ZCEA 1OZ0A 2IJKA 3MD0A 3O9QA 2ZE7A 2QEXV 4EFBA 2VQEK 3HP9A 2OCCB 2Q73A 3RN4A 2EX3A 4B3SO 1EP4A 5BRDA 2KKWA 3G25A 4M3TA 4OX9O 4O5FA 2XASA 3CIRA 3OTOO 1GN3A 3EFFK 1KUQA 3JAMO 2UXBB 1AR1B 4B9UA 4G1QA 2QWPB 3CJ9A 4RWUA 4PHTX 5IE9A 2WLNA 3VQ7A 3SGIA 1M5IA 4IT5A 5M1KA 5J2NA 1IBMB 1EN4A 4LF6O 3HM9A 3QESA 1CZBA 1RUD4 4WFBV 1S1UA 5J2UA 3OVNA 3LAKA 5C10A 3MXIA 3UO2A 4JKEA 3ENBA 5EZYB 2Q69A 5CY4A 4WF9L 5J2MA 3THYA 5L3CA 2O57A 3MX5A 2W40A 1YIJV 4FWQA 3VGLA 1BO5O 3O08A 4Z4IA 4FJKA 4X64B 2WLHA 4ISGA 4BRAA 4DU3A 1Q6HA 3OFNG 4UVAA 1BGXT 3MEEA 4DR5O 5HRRA 3CC2V 1JVMA 4MTXA 3WU2Z 1Q9YA 4CH3A 2NNWA 3SNNA 1V4SA 3ZIAG 4EHTA 1SKWA 4NTYA 5E1AC 1NGCA 4EEQA 1X9JA 3OYMA 4HZ3A 2AXTZ 3AE6A 2YV0X 4UV9A 4PD4F 1EN5A 4HNAB 1BE3H 4H0XB 4UVBA 2R70A 3MEDA 2P9IB 3ZMVA 5AQVA 4BR9A 5IY5C 4CESA 2F8SA 4O4JA 1EAH4 2A42A 5LJVA 1R3IC 3D6RA 2WWWA 1NVPD 3GWOA 2KG7B 5B1AB 1A5VA 3CJCA 3V9WA 3MN9A 1AI5A 1ASJ4 1PVC4 3IFXA 2EHGA 4CJWA 4LBEC 3L2WA 4F9OA 4KHYA 1EKEA 5CR4A 1RUJ4 4X20B 1L3VA 4JYAB 4DV5B 3E2EA 3V6DA 4O4HB 4WQ5C 4GX1A 4IGGA 3C6UA 1RBUA 4FPPA 1ZLZA 3HKCB 2F1MA 3E9LA 1N8RW 4X62B 4BR6A 4BVOA 1WBDA 4CIEA 4DTRA 3CD6V 4Q0BA 1N32K 3F73A 1XL6A 1Q7YO 5BPLA 3VA0A 2B6AA 4XDLA 4CEFA 4NKGB 5CA0B 4X9QA 3APQA 1Q6IA 1SQBH 1SS3A 3UO3A 1RDUA 3RYHB 1HR0O 3T4DA 3VRAA 4TV9A 1VBB4 4PL7A 1Q81W 3ULDA 5EBLC 2QE7G 4NR1A 4D7SA 4DK1A 2JJ2G 4LF5O 3IG1A 2WU5A 3J80N 4B9QA 1L0LH 1H2KA 1BCMA 4OGQB 4TUYA 1TAUA 2WA4A 4JKGA 3UKRA 4FWPA 1TK8A 1WOQA 2FBTA 3SZ2A 1UPGA 1WB9A 4JI1O 3ID6A 2DWEC 3OE7G 2D2CB 4KTQA 1KYOF 2X6AA 2UXDO 3G4SN 2G8HA 2P5GA 4WF9V 3KD5E 5JJJB 4CJ7A 1TUUA 1U97A 1BA0A 4DV2B 1PKXA 4CEZA 4CJLA 1Q82W 2BOBC 5CBFA 3K9JA 5I3UA 3L9DA 4MVUA 1NWKA 5CB4B 4NLBA 3JASA 4CCHA 3OMIB 3MAQA 3ZT1A 4DW1A 5GINA 4C8NA 5LJWA 3SJJA 1Q86O 1R0AA 2HHHB 2DMXA 2P22C 3ETQA 3DXKB 2KLAA 4CJPA 3HKDA 4AI8A 3M8AA 3M8PA 3QNEA 4BE1A 4PA3A 1VSKA 5M1FA 2ARHA 4WFEA 2XAGA 1EO1A 1TVRA 1BQMA 5D3GA 3WG7C 3HPGA 4WQ5A 3RYIB 3QVNA 4FLVA 4CC5A 3BF3A 4DV4K 3PO5A 1EZVH 3C6TA 1WAJA 4WCEL 1WSFA 4PKIA 1K34A 3EE9A 2O8BA 4X1YA 2W6KA 1NK9A 4FJNA 1OH6A 4I50B 2Y4UA 3QBWA 1LW0A 5IJ0B 5JVDA 1IBKO 2D0OA 2WDRA 3U11A 3A5MC 5D5PA 2D0CA 3HKEA 4U7BA 3KK1A 4JF3A 1THZA 4H5RA 3ABVA 2FBXA 3PY8A 2PLV4 3JXUA 5B3SB 3STLC 5AQQA 1BI4A 4CZEA 3TAGA 1SL1A 3TETA 1SZ2A 1RUH4 4FPAA 4JEPA 2WTUA 4Q6GA 3CETA 2QEXN 4OKKA 2UUCK 1WSEA 3SJHA 2CTRA 2IW5A 2B5UA 3E83A 4O4GA 4UCOA 3R1XA 1HJOA 3OUSA 1OVQA 3ZHUA 4BACA 1B92A 4KHNA 4PDWD 4DHYA 1G99A 1DGKN 3VEZA 2JS5A 3WEEA 2BE3A 4DTSA 2IM9A 4JZ2A 2LFRA 1N6QA 1S77D 4LF4K 1WLJA 4BG9A 3TAEA 3TAMA 4FZ1A 1KD1O 5LGUA 1BQ0A 3I55N 2YEVB 5A2QN 4YHHB 1YI2N 2IVOA 2Q7EA 3JD0A 4CS3A 4KHPO 4GNIA 3TJTA 1QLNA 4BR5A 5JMVA 5AFUA 1K97A 5B66Z 4DUZO 3AO3A 2HVKC 2R9AA 1EX4A 1VQLV 4OVLA 3TR8A 3RMDA 4K0KO 4KXRA 3CCVN 1LCUA 3JALA 5C2TA 2PI4A 4C8OA 2HHQA 3ZCMA 3CJAA 4CJQA 4DV7K 3VQAA 2YIDA 2YNGA 3B4SA 4FOIA 3P3PA 3O65A 2UUAO 1QVFU 4F8RA 1H2MA 2EIMC 2GUPA 1JCEA 1E3MA 1S1WA 3L4IA 1EZJA 2ZR3A 2AZ2A 2B4JA 2BTQA 4KTWA 1VSEA 4LSNA 2UXCO 5E41A 4EB6B 4ICLA 4YJ2B 5JCOA 4YTMA 4LR3A 1IKXA 4CJUA 3NF7A 3H1QA 3ZETA 4PQUA 3CCQN 2A6AA 4WCEV 1WPXA 4X1KB 2Q36A 2WONA 5FNVA 3CXHF 5HBMA 2A06H 2OCCC 3JAKA 2E1ZA 3HPHA 3P83D 4DSFA 3P4RA 4NYNA 2WLJA 3OYHA 2ZJRL 2R9RB 5J2PA 3T1HK 3CQ8A 3VOUA 4CH4A 3CCRV 2P90A 1BOTO 3FYIB 3PX4A 2YHXA 5GAEP 3V9SA 4DB3A 3C65A 2V4DA 3GWKC 4R79A 3M8RA 4GKJO 4NCBA 1Q18A 3AE8A 2UU9B 3EE8A 5KHGA 3CD6N 5F2RA 2O8DB 2NRHA 3BGRA 1NMDA 4NTWA 1BWFO 2WU2A 3H1IH 2Q7HA 4XEIA 3TGUH 2AW9A 2NNUA 3MCAB 1V54B 3GQKA 2W41A 4IOAL 4CW7B 1ROPA 4LFCB 2W6IG 1K73O 4FJGA 1QS4A 1L0VA 1W2BM 3AE3A 1NM1A 2Z1JA 4DV1O 1JXBA 5AQHA 1AI7A 1FXXA 4H44B 1D5AA 1KFYA 4FZ0A 4PDMA 2ASOA 3P38A 5DM6L 4HUGA 3OR6C 2QJ1A 3RMAA 1DK1A 2RMU4 2ZD1A 1H8TD 1MG1A 1TVKB 4QS8A 2FXUA 2DFHA 1AR94 4DUYK 3H45C 4LP8A 1FS0G 1EXQA 1IJJA 5AQUA 3J7ZO 2QDOA 2HF3A 4CD1A 4J8FA 2WLLB 4XH1A 3ZRSA 2P1JA 1GAXA 1VRUA 3JYCA 3NGIA 5LHGA 3ZRVA 1JKHA 2IH1C 1NKBA 3BVOA 2P9PB 3WQTA 1AR84 1BDGA 5B1AC 1MZEA 2GV9A 1NK4A 3L2UA 1JLQA 2O8CA 4B3MO 5LL6Y 4DV3O 1IBLB 4UXNA 2AGAA 5J9PC 1NK5A 3SDLA 1HNXB 4JS4A 4KHQA 2OTLV 1JLCA 2EIJC 3F7VC 2PAVA 2J4RA 2YIBA 1W0KG 2VQFK 3OMNB 3MDSA 3HVTA 1PPJH 2HEPA 3VEXA 3T4ZA 4GX0A 4X66O 3ABMB 2G8KA 3LM9A 4JV5B 1YJWN 3QNNA 3K5MA 3L2RA 2E5LK 5BR9A 2LW7A 2F4VB 4L8JA 3CIPA 5BZBA 4Z94A 4BAYA 4GLXA 2LGQA 3HPLC 1ZBUA 3ZSRA 5C2DA 5DMRA 3DI6A 1X1PA 4LNUA 1C1AA 1BL3A 4DR6B 2F96A 1PV0A 4A59A 1IXBA 4OX9B 3EKSA 2PTMA 3OTOB 4EP5A 4ELUA 4DR2O 5IWAO 4W5NA 2ADQB 5J2TA 1ZUQA 2ZNJA 1EN6A 4DYLA 4CHPA 4IEIA 2QM1A 3AG2B 2CTQA 3D2EB 3FKSG 5K14A 2RR14 3OBWA 3WB2A 3CCJN 4JKDA 4BRNA 4KRFA 5JS2A 4LF6B 4O4IB 3QINA 3QEIA 3N4PA 3UQ8A 5C93A 2E2OA 3CMEV 3D45A 1Z2GA 3P1GA 4M63C 1RBRA 3JSMA 3T1YB 1WBBA 4NTXA 2GWKA 4Z4HA 4ZOLA 5DM6V 5EYPB 3AVMA 3AO5A 3VGKA 3TTCA 1Z05A 5AQFA 1N0JA 3AO2A 1NH2B 4X1IB 3LALA 3KG2A 2HVIA 2HWB4 3QERA 3ZX0A 4EKWA 1S6QA 3VESA 1KFSA 3IFRA 5M1PA 4BE0A 4BROA 4UCRA 3J7YP 4DV6K 5GW7A 1GN4A 2D3OW 1VQLN 1N33O 4DQRA 2WLIA 2PBDA 1T05A 2WFBA 3E01A 3F2KA 4DKWA 3QO7A 3DMJA 3KK2A 3ISNC 3KWGA 3BY6A 3VQYA 4LF8O 4TWKA 1IKYA 1GLDG 3OYNA 3UKMA 2UUCO 3G80A 2ADPA 2X74A 2Q7GA 3RYFA 2IS3A 2YCHA 4OO1J 3NDKA 3KVGA 3SQ1A 4JI4O 3ZSOA 2M6YA 2D4WA 4JI2O 5H5NA 1MSDA 3D36C 5F1XA 4OKEA 4TQDA 2DWDC 3M1FA 2HF4A 1YSCA 2LFSA 2OPPA 2E76B 2ZDIC 2HB5A 4OPJA 4LFCK 1NGIA 2R044 4YXWG 1B9FA 1IX9A 2A3ZA 3SR2C 2YJEA 3W7XA 3W7UA 2ZIMA 1NR1A 2AA4A 2JRIA 4UCVA 1N34O 2YKMA 4FJ8A 1Y76A 3E8FA 3SQ4A 4I7ZB 3ZX2A 1HR0B 2BSKB 5JH7B 4IO9L 4DSJA 1SRYA 1WB7A 3CCRN 3ID8A 1RILA 4LF5B 4FK4A 2B5JA 1N36O 1G1XB 2FB5A 3S3XA 1HNWK 1VMGA 1VHXA 3OEEG 3H46O 5BPNA 5T7BA 2P9LB 4J10A 1TUEB 2YXHA 5D5QA 4B3RO 2BE2A 3GG4A 1W7AA 4JI1B 4RHV4 1J95A 1B06A 1QBZA 3VTIA 1IG8A 2UXDB 1ZX3A 1IG9A 1GLCG 3CYOA 3J80O 2HBLA 4HYOA 1NKCA 1GH6A 5J2QA 3HT3A 3P4QA 3S3MA 4YOXA 4A62A 1UA0A 3GQHA 1P49A 5LXTB 3DXRA 1RTIA 4DTXA 1FXKA 5IJ0A 3KKYA 4C7UA 1URFA 2ATQA 3T1HO 4GW6A 5AZIA 4H8KA 1WP8A 3SFDA 4MSWC 5AZJA 3S3NA 4NCAA 1NQTA 2Z1HA 4EZ6A 1S1TA 4WFAL 1I5XA 3L6QA 1RDCA 3WNGA 4W4KA 4LFAK 1SQKA 3QFUA 4H0VB 1LWEA 4BC5A 2BTFA 5AG2A 1HKCA 4YFUA 2BTOA 2Y69B 4B1ZA 2WAMA 4DSKA 3J8F4 3UT5A 4K25A 3CB2A 4H0PA 4KHSA 5CZ2A 1NGFA 3UIQA 2E20A 3NFAA 4K43A 4FM1A 1YXQA 1B3QA 5AJ3K 1IV0A 2P06A 5KUKA 3NXSA 3BUZB 1L1FA 4X65O 1XUQA 2HVJC 2NLJC 4FPBA 1OVYA 2LJ2A 5HL7L 1RTDA 2OANA 3THXB 2PYJA 4B1UB 1V54C 2HMPA 5AFUH 3NBPA 4CE9A 4CFBA 5FPEA 3OJSA 3K9KA 3LAMA 4QOZB 2H88A 1YVWA 3AE7A 5C0YA 3VETA 4HUEA 1S9GA 1AROP 2IJJA 3O9OA 1GOBA 1RT7A 2NR5A 4X8AA 4I6MA 3O9RA 4FJLA 1YVNA 5GAHP 1JA8A 3OEHG 2L6LA 4LFBB 2P9NA 2ZXWB 1LUWA 2E6MA 2HBKA 3EEQA 4E2LA 4I4TA 2HNZA 1ZBHA 4CZZA 5AQNA 3ZN1A 1XNQO 1HNIA 1LW2A 1X3MA 4OPAA 1E1RG 4Z4GA 2RPIA 4A5BA 2VQFO 5HP1A 4FCYA 3P3NA 4PI0A 4IOCL 4DQQA 4EB6A 1RUC4 3L8BA 2F66C 4KHPB 3CMEN 3RBZA 3WXKA 3AG1B 4M7XA 4DUZB 4CH5A 4CF0A 3BA8A 2DYSB 3J7AU 3ABLB 4K0KB 3WXIA 1XC9A 3CJ1A 3G71N 3BPZA 1GM8A 4DTNA 4PA4A 4YJ3A 1TYQB 5A2QO 4FK0A 1GM7A 3SJBC 4JI7K 3IDHA 4DR7B 2IC3A 5DM7L 2Y1JA 1MOFA 3ABMC 3AY9A 2QKBA 3U4LA 1CLQA 3H1HH 4UB8Z 3B6PA 3ALYA 1OCOB 2EULA 3JATA 1FKPA 5KGXA 2BDPA 2XNDG 1PM9A 1YTFB 3PIOL 4O2BB 3ZHRA 4LF7K 3FLCO 4E0DA 1NENA 1VBE4 2YIBD 4CZHA 3CMAN 4MVRA 4DR3O 3KK3A 3KZBA 3L3UA 1XMOK 3AEIA 5GAGP 3ATVA 4FJ7A 2WDQA 1ATRA 3AEEA 4BIOA 5H1SQ 2W6JG 1SQQH 2QWRB 4JTAB 4NXMO 4FWOA 1P84F 3BZKA 1R1BA 3SYCA 5KX5B 1YQ3A 3AG2C 4Z2WA 4GZRB 4DF4A 4H13B 4BDYA 2CK3G 1VSLA 4DR1O 3CXCM 1NG9A 3ZMTA 2UUBO 2EJ7A 4GKJB 5K1PA 1KXPA 3EO3A 4B9MA 4E4EA 4C1NK 4A61A 3W7SA 3RYCA 4RO2A 3VERA 3BCCH 2KFNA 3VQBA 4CEOA 1XMQO 4DCHA 4HTLA 1R3JC 1TL1A 4JN4A 1LV5A 1BEV4 3DLRA 1RVF4 2QWQB 1QVGU 1BA1A 3CJHB 3QIPA 4CEDA 2P9PA 5C2FA 2V7ZA 4H5NA 4DV0O 1JLFA 3OYDA 3V1OA 1RDDA 4DV1B 5LMUK 4Q20A 3SPGA 1VQ4V 1U4BA 3ETDA 1NTKH 4YTPA 4F6RA 4Q4X4 3WFVA 3IKMA 2ASMA 4JI6O 3K9AA 1SETA 2BUPA 4KHUA 4KH5A 4BWMA 3HKBA 5AQKA 5BN9A 4DS5A 5AQJA 4DTUA 5H6QA 1BCOA 2G8FA 1WLEA 3ZEUB 2H3OA 2IH3C 3EXAA 1MWMA 1OKJA 3BAAA 3OS0A 3TANA 5LOVA 2HHWA 2YIAA 1OH5A 2R7FA 4JK9A 4I2PA 1H8EG 4OKJA 1PO14 1NTZH 4I55A
chains in the Genus database with same CATH topology
2X6SA 1FFXA 4B3MB 4DV3B 1TL3A 4OPKA 3SQ0A 5FRNA 1SA0B 3KLHA 4ZHQA 3E22B 5HROA 1UWBA 4CERA 3EYZA 2KQ2A 1NK0A 5SZTA 3AA4A 4JI0B 4EFEA 4IKFA 1IKWA 1RDBA 4DG1A 4PWDA 5JJEB 3WNHA 3ZT0A 3SQ2A 4AHTA 1A5XA 1HW7A 3QF7A 5C42A 1CXUA 2ITGA 4DR2B 1ZYQA 3T3FA 4CGHA 3DLHA 4HTUA 4DS4A 4DFJA 1VSHA 3CSXA 5EIBD 4XIUA 3WNEA 3SJCC 4ZIBA 2X6NA 3AO4A 1EETA 3VN5A 4F2SA 2OA8A 3KD1E 4Y1CA 3AV9A 1ITGA 4F4KA 4O0IA 4FJJA 1N33B 4CF1A 3SV3A 5FDLA 4M45A 3LPTA 1KRPA 5JH7A 4LF8B 1ZBLA 4UCTA 1S9EA 2YNFA 4JI4B 4DU4A 4JI2B 3RRHA 3VQ5A 2ZNIA 2QKKA 1RTHA 3O3FA 1IH7A 1CZ9A 3KKSA 2W42A 3B2EE 1N34B 2Q0AA 4JS5A 4WBNB 4DRXB 5BMVA 5IJ9A 4IHJB 2HHVA 4U3JA 1JL2A 4DLGA 4B08A 4N47A 1N36B 1TK0A 3ZSWA 4IDKA 1L8DA 3KLGA 1FK9A 1NK6A 3AVLA 1NJZA 3THVA 4ID5A 2PZSA 5HLFA 1TUBA 5IYZB 4F3TA 3ITHA 3AA3A 1Q3EA 2E6LA 3LP1A 3SCXA 4KKOA 2HW3A 3CM6A 4DR4B 5SWMA 4W5OA 3JAWA 4OGCA 1RBTA 3N2GA 4FFBA 4CS4A 4KHWA 1D9FA 2KZZA 3V81A 3HJFA 4CJ5A 4Z4EA 1I94B 3DLGA 4W5QA 4DQPA 4X65B 1L5UA 3I0SA 4CHZA 3TAQA 4ELTA 1M4UA 2CAZC 5LP6C 4C8LA 4DTMA 4WE1A 4HVJA 3AA2A 2YNIA 3AVHA 4PUOA 4FXDA 3U0ZA 4J2AA 5EU7A 2Z1IA 2VWJA 4E7HA 4DQIA 5CA1B 1C1BA 5LA6B 4IBNA 4PHZA 2DTUA 3LZJA 3V9UA 1XNQB 4FLYA 1C1CA 1SUQA 1JFFA 3BABA 2VG7A 4CJFA 3NGYA 5FPRA 4E7LA 1D8YA 5ITZA 4IG0A 3N2KB 2G8WA 4CECA 3IRXA 2VWKA 4KB1A 3PN1A 2R72A 4ZI7A 2P51A 3LP3A 4BWAA 1RBSA 1BISA 1T5EA 1O9GA 1V9PA 3SJAC 2QXFA 2AJQA 5GONB 3O3GA 1LWFA 3S9HA 2KW4A 2NUBA 5LP6A 4DR3B 2HHUA 3AVKA 3OY9A 3BRCA 4AH9A 4NXMB 3P5JA 1XI1A 3ZT4A 1I39A 4DR1B 4J2BA 3KLFA 2UUBB 4IIJB 2RF2A 5C8YB 4CHYA 1XMQB 3OYLA 4KTZA 3JARA 1XHZA 4UCUA 4O4LB 4UFZA 4DV0B 1HYZA 1VSJA 4JI6B 1C0TA 4FLZA 4FYDA 2R7YA 1QQCA 3AVCA 2F95B 4Y1DA 4C8MA 4CIGA 3RTVA 2X78A 3IS9A 1ASVA 2OYQA 4EP4A 3V9XA 4O44A 4EZ9A 2YI8A 1TA8A 4AHUA 3U6FA 3DOKA 1WSIA 4H4MA 4I2QA 1DGSA 1I7FA 4Z4CA 1UOCA 3M7MX 3RMCA 4E89A 4DLEA 2VG5A 1FJGB 5EZYA 3RWUA 3OYKA 5LYJB 3ZEDA 1Z5WA 4B3SB 3OJUA 1WNSA 3CFPA 3AVFA 1SV5A 1NK8A 3CFRA 3V1QA 4JI3B 4HUFA 4HHTA 2F93B 4KO0A 4HNAA 1J53A 5HRSA 4CJ3A 1KVCA 1REVA 4O0JA 4CGIA 4CS2A 4NVPA 2Y1IA 4DR5B 4X20A 4CFDA 1XQ8A 4O4HA 3HKCA 1TKXA 4CJVA 3QEPA 1I3AA 3QO9A 4LH5A 4CFCA 3LPUA 3TARA 5CA0A 1SQGA 3RYHA 3CFOA 4AHSA 5I42A 1TAQA 3T19A 3SYZA 3LZIA 4DU1A 4GVMA 4CFAA 4IHJA 4TSXA 1Q5OA 2G8VA 1VRTA 1X9MA 1XWLA 3BA9A 2PW9A 5J2UB 3VQ4A 4O5BA 4FM2A 4ZHRA 4I7FA 1B04A 4FVMA 1G6UA 4YY3B 3ZT3A 2YXLA 2KTQA 5CB4A 2I5JA 3QIOA 3O3HA 2YHAA 4OGEA 1YVUA 3NF6A 2FBYA 1J9AA 1S1XA 4OJRA 4J2DA 4BDZA 1QSSA 4RW7A 1VF7A 3RYIA 3IAYA 3HK2A 2O4IA 4O4JB 1WAFA 5JS1A 4DFKA 3RFRA 3SUQA 4I50A 4NCGA 1XNRB 4GMJB 1NJWA 1QHTA 1VSMA 3QNOA 3AVNA 4CF9A 4M3XA 2YKNA 1TKTA 2DY4A 1DLOA 3DRPA 3M8QA 4FJ9A 4TV9B 1IKVA 2OPSA 2DFFA 4CF8A 1UAXA 2Z1GA 2KZMA 1IBKB 3K58A 3ICXA 5C25A 3QEXA 4IFYA 1XHXA 3OYBA 4LD0A 5BR8B 5CYMA 1ASWA 2YHBA 3JASB 3VQEA 5LMNB 4ZTJA 4FK2A 4RG8A 1G15A 4FJIA 1NK7A 4JI5B 4FJ5A 3KLIA 4CEAA 3KJVA 3AVIA 2PGGA 4YJ2A 3G10A 3CHXA 3RGBA 4X1KA 3OYCA 1BHLA 5JVDB 3PX6A 4KI4A 4E7KA 4NYFA 4K8ZA 3AA5X 4DWIA 3HKEB 4FW1A 3SV4A 2VQEB 2FC0A 2UUAB 2XY6A 1BI4B 4M3UA 3B6OA 1X4TA 2UXCB 4O55A 4CJKA 3FI7A 1WSGA 5C8YA 4I9LA 3PO4A 4FZZA 4KFBA 4AHVA 3V9ZA 4CGGA 4B8CA 1HRHA 3PV8A 2BGGA 3U3GA 3DM2A 1N5YA 1TVKA 1C0UA 3HP6A 1JLBA 2RKIA 2PY5A 1YTAA 3I8DA 3C95A 1SL0A 1RCHA 4C8KA 1KTQA 3JALB 1TKZA 4E19A 1Y97A 2HMIA 2A1SA 3QG5A 3AVBA 4K8XA 3A2FA 2ZQBA 3O4QA 3DYAA 2BTQB 3L2VA 1TGOA 3KLEA 4CH6A 5KHKA 5JQGB 4I9QA 4M3ZA 5FNVB 5J1EA 4FLUA 1QSLA 2HNDA 3AO1A 1N32B 2VG6A 1RT5A 5KMGB 1CXQA 1QTMA 3NF9A 1RT2A 4X66B 3T1AA 1HJRA 3QEVA 1JJOA 4O4IA 1W0HA 3VA3A 1NJXA 1BIUA 3HO1A 4YNQA 4CK1A 1RDAA 2PUSA 3VQCA 5EYPA 3VQQA 4CHOA 1HPZA 3DLKA 3NF8A 5IWAB 4LH7A 4E7IA 4E1MA 4X1IA 1YTUA 1LWCA 4B9NA 3OYAA 4Q5VA 1SKSA 4N76A 2IDOA 4DV4B 4FZXC 2XHBA 4KI6A 1A5WA 3K5LA 3WB0A 3ZSXA 3NH1A 4KB0A 3ZSYA 2F8TA 1T03A 3AVJA 2WOMA 4MFBA 4LNUB 4CC6A 4FLTA 4N41A 1GOAA 3HSTB 3NE6A 2UUCB 4DSLA 5J2TB 3KTQA 1J54A 1HYVA 4W5TA 4KL1A 4ZTFA 4LF4B 3QETA 3OS2A 4J2EA 3LWLA 5HRPA 4ZOLB 1NKEA 1ZBFA 5LXTA 3TWHA 4LH6A 1TKDA 1T7PA 4B9VA 2ZIOA 4DV7B 1T8EA 3VQWA 3ASMA 1C6VA 3OTFA 4B3RB 1Z25A 4PY5A 4B9LA 3RYFB 4L8RB 1JLAA 3HXMA 5FPOA 4O2AB 1U45A 1WSJA 3VQDA 3T1HB 1DTQA 3LNNA 4B8AB 3NH2A 1S5JA 4F3OA 1B9DA 2GBZA 1NJYA 4DSIA 2LSNA 5KRSA 1VSIA 3K2PA 5CZ1A 2KFZA 4AHCA 1SL2A 1L3SA 4E7JA 4FLXA 1VSFA 3EZ5A 4UQGA 4FM0A 4R5PA 3QTCA 4E1NA 4DTPA 1Z26A 3O4NA 2D5RA 1U49A 4BWJA 3FFQA 4DUYB 4QAGA 2Q3SA 3HVRA 3JSNA 4QCLA 4CEEA 4BE2A 2JLEA 2OPRA 4DFPA 2OZMA 1ASUA 1KVBA 3BHPA 3LWMA 5JCOC 4LY7A 2E3CA 4RW6A 2IGIA 4FLWA 2VQFB 1FKOA 3UT5B 4O2BA 4DF8A 3VQ8A 4CGDA 1WPBA 5CYQA 2E5LB 1KLMA 4TV8B 1D9DA 1KCFA 3PX0A 5KX5A 2JVDA 4JRPA 4DTJA 1UA1A 2OWOA 3LANA 4IG3A 5DK5A 3K5NA 3TAFA 4OLAA 5JJNB 3L2QA 3ZSQA 4PI2A 1VK0A 1K6YA 1HYSA 4I4TB 2IOCA 3OYFA 3NCIA 4CEQA 3NH0A 3I0RA 3WNFA 5JQGA 1O1WA 2D0BA 3DOLA 3D0PA 4DV6B 3QEWA 4CGFA 4YJ3B 1C0MA 2IAJA 5KMGA 1L3UA 1H2SB 3AVAA 3RWRD 4DK0A 4M3RA 4CHQA 3JATB 4HCCA 1HMVA 1SA0A 3E22A 1ZBIA 4CJTA 1RSOA 2RN2A 2HHTA 1VSDA 1Z5VA 3LP0A 4M3WA 3WB1A 3EY1A 2XY7A 3RYCB 3HL8A 1Q9XA 1U48A 3RMBA 4DFMA 1HNWB 2HVHA 4W5RA 4KV8A 4N5SA 1W9HA 1KMIZ 2ZINA 1JL1A 1ZAUA 2G8UA 4DTOA 4BW9A 4TQFA 4F6RB 5KRTA 3OYIA 4DSEA 1LAWA 3JYTA 3HKBB 2HHXA 2JGUA 4LF9B 5LOVB 2YI9A 4I55B 4LFAB 3MEGA 1FFXB 1KFDA 1TK5A 1RBVA 1NOZA 5C24A 3NHGA 1O9HA 4CK3A 5KI6A 4ZHQB 1F21A 3DLRA 3SUPA 3THOA 3K5OA 4JLHA 4E3SA 2GUIA 4M3YA 5EIBC 3MECA 4WBNA 4DRXA 2A1RA 1KLNA 3F9KA 5KHJA 3K59A 4IFVA 1KU9A 3ZS8C 3LDSA 3DLBA 4B9TA 4FJMA 1RNHA 2XO7A 3NGZA 3MXMA 4FZYA 2XY5A 4HBNA 3H08A 4ELVA 4CHNA 1X9WA 4KPYA 1RTJA 4B3OA 4AHRA 3FFIA 4O2AA 5IYZA 2OPQA 3HPOA 4KREA 2QM4A 2XRIA 4JI8B 5HRNA 1WN7A 4JI7B 3CM5A 2DFEA 1JMKC 1M93A 5FRMA 3BDPA 3G0ZA 2RQ6A 4LF7B 1U47A 1IO2A 4DMNA 4FJXA 1XMOB 4CJ4A 5FROA 3VQXA 3VQ6A 1J5OA 1HQEA 3U10A 3DSQA 3VQ9A 3RR8A 3VQPA 1RT1A 4BDPA 1RT3A 5BMVB 5IJ9B 1RT4A 1U04A 1BQNA 4U3JB 4CF2A 5K1XA 4TUYB 3CYMA 4RW9A 5CA1A 3DRSA 2PYLA 4LH4A 3RR7A 5LA6A 5LMUB 1LAVA 1HNVA 4UCSA 2YNHA 5KHHA 1SQFA 1DTTA 2G8IA 4CJSA 3K57A 1TUBB 2BANA 4TV8A 3AVGA 3N2KA 3ZSZA 4CK2A 3HKDB 1NT2B 4ID1A 3JAWB 3DRRA 1J5EB 4GKKB 3N2GB 4NXNB 4AILC 1QE1A 4FFBB 5GONA 2D0AA 4CIFA 4X1YB 4Z0UA 3QLHA 5KTQA 3HYFA 4B3TB 4CJRA 3TABA 4M41A 3JSLA 2O4GA 3ZT2A 3OYEA 3SUOA 4CEBA 4IIJA 3SI6A 4FW2A 3SPYA 3KIOA 1WSHA 1RT6A 3U3YA 4CJEA 4AQYB 3RRGA 4O4LA 4KAZA 2QK9A 1Q43A 2ZE2A 1KVAA 4MQ3A 3OYGA 1X9SA 1YEWA 3NAEA 1JFFB 3MXJA 3L3VA 4LSLA 2ETJA 4N56A 1MU2A 2OZSA 4JRQA 5ITZB 1TV6A 2XY8A 4DQSA 3SPZA 1SKRA 4ZI7B 4CGJA 1JLGA 1HQUA 2HHSA 5KGWA 4M42A 2ZM6B 3V1RA 3SUNA 3JAKB 1SKVA 5LP6B 1NOYA 4GYCB 4Z4FA 5KHIA 3PUFA 5LYJA 3C94A 2FBVA 2E4LA 1S6PA 1GOCA 3ZSVA 3OS1A 1L3TA 2HNYA 2RJZA 1Q8IA 1JLEA 4FJHA 4B9SA 1S1VA 3M8SA 3JARB 3OYJA 1TAEA 1YT3A 4HCBA 3TAPA 3DLEA 4TOIA 3KKRA