1XI1A

Phi29 dna polymerase ssdna complex, monoclinic crystal form
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Correction of X-ray intensities from single crystals containing lattice-translocation defects
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/dna
molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
total genus 147
structure length 571
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xi1A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xi1A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xi1A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xi1A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xi1A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xi1A06
1RT5A 2YNIA 4CEBA 3DRPA 4OPJA 1VSIA 5CYQA 4TSXA 1TAUA 4AHRA 3ZT0A 4CEFA 1ASWA 3HO1A 3BGRA 2P1JA 4FK2A 4DMNA 4GW6A 4JS4A 2JLEA 4CJFA 4JRQA 3MXIA 1NJZA 4M41A 2XO7A 3L2QA 1VSLA 2IOCA 4FJJA 1VSDA 4Z4GA 1XI1A 3AVJA 5KGWA 4CEEA 1LW2A 4WE1A 4I2QA 4CHPA 1L3UA 3LP0A 1KRPA 4CHNA 2B4JA 3AA3A 4DSLA 3NH2A 2Z1GA 2HB5A 4DTUA 1QHTA 5FDLA 5J2MA 2FC0A 4DSEA 4CFCA 2IC3A 1GOCA 1WN7A 4CJVA 4CF9A 3VQAA 1KFDA 1ZBFA 4HUEA 5CY4A 1T05A 2XHBA 1RT4A 4KTZA 1RT7A 1GOAA 3KKRA 1Q9XA 4DS4A 5HBMA 3VQ8A 3RR7A 1MU2A 1EP4A 3LDSA 2HHSA 3MEDA 4E3SA 4Q5VA 5KRTA 4KTWA 2GUIA 1A5VA 4ICLA 4BE0A 4LH5A 1N6QA 4DQPA 3VA0A 4F3OA 4DTMA 1JLGA 4KO0A 3VQPA 3MECA 4YNQA 3OVNA 4CGIA 3L2RA 4W5RA 3THVA 4CGGA 2DY4A 4CFBA 3K5LA 1HYVA 1VSFA 1X9SA 1CZ9A 1SKWA 3M8QA 3ASMA 2RF2A 3QIOA 4KI6A 4DF8A 3SNNA 2W42A 1CZBA 1B92A 1DTQA 1JLEA 1LAVA 4Z4HA 4FJHA 4CEDA 2BDPA 2BANA 4CF0A 3WNGA 2QK9A 4LH4A 1CXUA 1J53A 1B9FA 4FZYA 3DYAA 1S1WA 4H8KA 5HP1A 2X6NA 4J2EA 1VSMA 1RT6A 4HUFA 2IGIA 1KTQA 1IKWA 2LSNA 3LP2A 4O4GA 4DTNA 3HK2A 1HNVA 1TKXA 4CK1A 4B9NA 5DMRA 1UWBA 3KK2A 3ZSZA 1FXXA 1JLFA 4E7KA 2VG5A 4DTPA 1NK8A 1RTDA 4F2RA 4OGEA 1JKHA 1NKBA 3UIQA 4Z4IA 1S1VA 1IKVA 3IRXA 4HUGA 2XRIA 2G8WA 5KGXA 2YKMA 4FJKA 2G8IA 2HHVA 1UOCA 3D45A 3PX6A 1QTMA 3LWLA 3AO1A 2Q3SA 2WOMA 3QERA 3L3VA 2BGGA 2JGUA 4ZHRA 3SQ4A 2Y1IA 4O5BA 3AA2A 4CEQA 2IDOA 1LV5A 3LAKA 4CECA 1L5UA 1WAJA 2HW3A 3HVRA 1NK4A 1QSSA 3DI6A 3KK1A 4CEAA 4PUOA 1NKCA 4FJXA 1UAXA 4PQUA 3ZSQA 3U3YA 1YTAA 4B08A 1T03A 1Q8IA 1WAFA 2E6MA 3V9ZA 1R0AA 4BDPA 4RW6A 3VQ9A 2A1RA 1JLBA 3G0ZA 3TABA 1RDDA 1X9WA 2KZMA 3PO5A 3OYNA 4O0JA 4RG8A 4G1QA 3RRGA 3VQDA 4RW8A 4M45A 3O3FA 1J9AA 1S6PA 1NK0A 4B9TA 1KSPA 3JYTA 4FK4A 4FJGA 1I39A 4CHQA 3VA3A 3AVNA 4I9LA 3SYZA 3DM2A 1ZYQA 4ID5A 3K57A 3KJVA 1CXQA 2P5GA 3C6TA 4Z4CA 3DRRA 3RWUA 4FJ8A 4F8RA 4FLVA 3AVIA 2GV9A 3LPUA 3V1QA 3ZSWA 3OYLA 3OYMA 3QEVA 3RMCA 3SQ0A 3KD5E 3O4QA 4JS5A 3C94A 3V1RA 2OZSA 5FRMA 4CF2A 4AH9A 2D0CA 4IG0A 5CZ1A 3WNHA 4DTSA 3AVBA 4J2DA 5FRNA 1WNSA 2X6SA 3LAMA 4CJKA 5J2NA 4EZ6A 1ITGA 3LPTA 3HL8A 3OYHA 3OYDA 1YTUA 1WSJA 4DLEA 3RRHA 4KHQA 4FM2A 1RTJA 1U04A 3V81A 1EKEA 1RBVA 3BDPA 3ISNC 4IDKA 2HNZA 3HYFA 5C42A 4BE2A 3MEGA 3EYZA 5I42A 4DF4A 4CGFA 4NCAA 3B6OA 4DU1A 4DWIA 1LAWA 1IKXA 3TI0A 4DTJA 3MEEA 4N76A 2DFFA 3TANA 2YHAA 2EHGA 5HROA 4M3WA 1X1PA 4C8MA 4UQGA 4FCYA 1L3SA 3CM6A 4AHUA 4CF1A 1IKYA 2FBXA 4H4MA 1TK5A 2D0BA 1J5OA 2QKKA 4E7JA 1RCHA 4CEOA 5KI6A 3OYCA 4FJ5A 3WNEA 1SKRA 4L8RB 2KFNA 4KKOA 1C0TA 1WSEA 3S3NA 3KKSA 4E1NA 5HRRA 3V9XA 3AVAA 3NH0A 3PV8A 4F4KA 4Z4EA 3AVLA 3LZIA 4AILC 3C95A 3U6FA 4OLAA 3I0RA 2IS3A 4HVJA 3ZSXA 3LP3A 4BWMA 3QINA 4DU4A 4ZTJA 1VSHA 2BE2A 3P5JA 4CF8A 3PUFA 2QKBA 3KTQA 3K5MA 3HPHA 3HM9A 2OYQA 4W5OA 4CJ4A 1LW0A 3SPZA 4OLBA 2PYLA 1JL2A 1FK9A 3KLFA 3S3OA 4N41A 1ZBUA 2Z1HA 4KFBA 2PY5A 4RW4A 5T7BA 1L3TA 3OJUA 2HHXA 4DQSA 4LD0A 3ZT1A 4DTXA 4IBNA 4J2AA 2PW9A 1TAQA 1W9HA 3ZT4A 1NK6A 3SUOA 4DSJA 4FLUA 3RMAA 4ELTA 3HT3A 3G10A 3K5OA 2VWKA 4FLWA 3K2PA 4K8XA 4IFVA 3SZ2A 4LY7A 3NCIA 4DSFA 1NK9A 2FBTA 1TKDA 1NJYA 3IS9A 1LWFA 3QLHA 4M3XA 3DMJA 4N5SA 3RR8A 1BCMA 4KREA 3OS1A 3HP6A 4ELUA 4KAZA 1BHLA 2KTQA 4FVMA 3QETA 4CJWA 4IFYA 3CFRA 4IKFA 3AO3A 3ZSVA 4RW7A 4DTRA 4KHYA 1BISA 1KVBA 4E7HA 1TK0A 2G8FA 2XY6A 1IG9A 1GOBA 4DLGA 3TAQA 3TAEA 3I8DA 2YHBA 4FJLA 2KQ2A 2PYJA 2A1SA 3KLEA 1I3AA 1NOYA 2KFZA 1S1XA 3MAQA 3O3HA 1RNHA 3ULDA 4K8ZA 2G8UA 2KW4A 2OPQA 4DFJA 4IG3A 4FLXA 3NE6A 4M3ZA 4I9QA 1QE1A 2YV0X 2YKNA 2DFHA 3DOKA 4FW1A 3ALYA 4N47A 5JS2A 3OYKA 3TAFA 1KVAA 2RKIA 3RMDA 1BGXT 1RT2A 3FFIA 4GVMA 1D8YA 4CHZA 4AHCA 3DLBA 4HHTA 1CLQA 1D5AA 4FYDA 2HNYA 3L2UA 1YVUA 3KLIA 1FKOA 1RBUA 3HVTA 3VQEA 3SQ1A 1UA0A 1RTIA 1RTHA 2HHTA 1NJXA 4KHUA 3LWMA 4DSIA 4PWDA 1NJWA 4FK0A 2RN2A 1TL1A 3QO9A 4C8NA 1L3VA 1ZBIA 4B3OA 1A5WA 3MXJA 1K6YA 4EZ9A 2HHQA 2FBVA 3M8SA 2ZE2A 4HCCA 5K14A 5J2QA 1SUQA 2VG6A 1BQMA 1U48A 3K5NA 1QSYA 5D3GA 4KRFA 3CYMA 2ITGA 4E89A 2Z1JA 2RPIA 4CJ5A 3EZ5A 4DSKA 4NYFA 3SUQA 4DFMA 3V9UA 3S9HA 3KD1E 3FI7A 1TK8A 3P1GA 3T1AA 4CE9A 4FJIA 2R7YA 3C6UA 3T19A 2NUBA 1BI4A 1U47A 3QEPA 3QEIA 4FLYA 1HPZA 4CEZA 2EX3A 1VSJA 4CHOA 1S6QA 4NYNA 5J1EA 1HMVA 3HP9A 3L2WA 3NFAA 4LSNA 4B9MA 1WSIA 3AVFA 2ZD1A 3ZT2A 4HCBA 3D0PA 4M3YA 2WONA 3LZJA 3O3GA 4OKEA 3PX4A 4ID1A 1D9FA 1F21A 1LWCA 1EX4A 3CQ8A 2P5OA 3QEXA 1SL0A 1KCFA 1HJRA 2D5RA 3DOLA 3SUNA 3K58A 4FW2A 4EP5A 1RDAA 2O4GA 3DLEA 3TAGA 4QCLA 3OJSA 2Y1JA 1RT3A 1Q9YA 4O55A 1VSEA 3L2VA 4J2BA 3V4IA 1B9DA 5SZTA 4B9VA 1WSHA 4M3UA 3NHGA 2ZQBA 3AO2A 1U49A 3T3FA 3AVHA 3HXMA 4O44A 4KHNA 4O0IA 3KLGA 3ZSRA 1C1AA 1RBSA 2HNDA 4OPKA 4M3RA 1XC9A 3LALA 1KLMA 3AVMA 1WSFA 2IAJA 1TV6A 3HSTB 1HNIA 4OGCA 1S9GA 5CZ2A 4MQ3A 4YFUA 4W5TA 3F73A 3H08A 3SJJA 1ASUA 1W0HA 2GBZA 3AO5A 1LWEA 1NKEA 1VSKA 1VRUA 4BDYA 3QESA 1D9DA 1Z25A 4KHSA 5I3UA 1U4BA 4B9LA 3CFOA 1C0MA 3NDKA 1C6VA 1REVA 2OPSA 4DFPA 4E0DA 4FJ9A 3ZSOA 4DU3A 1N5YA 3VQ4A 3AA5X 3AVGA 1T8EA 4HTUA 5JS1A 4Q0BA 2DFEA 2R7FA 4ELVA 2VWJA 3NBPA 2YNFA 1ZBHA 4DQQA 3AA4A 2ETJA 4CERA 3TWHA 4DS5A 4DTOA 4AHVA 4CJ3A 3PX0A 4Y1CA 4KTQA 4BE1A 4QOZB 1TVRA 3LP1A 3L8BA 2O4IA 4CJTA 4B9UA 3NAEA 2YNHA 1IH7A 3U3GA 3VQ7A 4CHYA 3QEWA 4AHSA 4FJNA 4NCBA 2F96A 1WLJA 3F9KA 1TKTA 4I2PA 3VQ6A 4CIFA 3S3MA 1J54A 3DLGA 2XY5A 2B6AA 3RMBA 4DQIA 4FM0A 2P51A 3CG7A 1ASVA 3ZT3A 4CJEA 2YNGA 1TL3A 3L3UA 3PO4A 2HVHA 5E41A 1Y97A 4C8KA 2HHUA 4H4OA 4OVLA 4CJQA 4CIEA 4OKKA 5DK5A 4DG1A 4EP4A 3NGIA 5J2PA 1UA1A 3OYGA 4NCGA 1U45A 1RBTA 3OYIA 4RW9A 2XY8A 1S5JA 4CFDA 3TARA 3CFPA 1JXEA 5C24A 5HLFA 1NK7A 1SL1A 1XHXA 3SCXA 4KHWA 4F3TA 4FJ7A 3P83D 1HYZA 4FM1A 1JXBA 4PA1A 3IG1A 1TKZA 3I0SA 1XWLA 2E4LA 4CESA 3K59A 1C1CA 3NGZA 3ZSYA 4BDZA 2X78A 4N56A 3AVKA 1HYSA 4BACA 4FZZA 3EY1A 3SPYA 4FJMA 2DTUA 3TR8A 4CK3A 1O1WA 2QXFA 1ZBLA 1IO2A 4CJPA 1VK0A 3OY9A 4E19A 3NF8A 4E7IA 2X74A 4E1MA 4C8OA 4I7FA 3KLHA 4CK2A 3NGYA 1BL3A 3AO4A 1YT3A 1HQUA 2B5JA 3OS0A 4QAGA 5KRSA 2KZZA 4GMJB 3VQ5A 3NF7A 3SV4A 1NK5A 3OYJA 1BIZA 4W5QA 1BCOA 1DLOA 1HQEA 1RDCA 1S9EA 4LSLA 3E01A 4CCHA 1JLQA 3JSMA 1RT1A 3A2FA 4CGJA 4PY5A 4OKJA 4W5NA 3VQQA 1C0UA 3AV9A 3M8PA 2OA8A 4Z4FA 3DLRA 4B8AB 1SKSA 3OYFA 3MXMA 1S1UA 5FROA 1KLNA 4KPYA 5CYMA 1HRHA 1QS4A 3KK3A 5HRPA 2OPRA 3HJFA 1JLCA 4R5PA 3V9WA 4CGDA 1XHZA 3KIOA 3NF9A 4F2SA 2HVIA 3DLHA 3IAYA 3VQCA 4CFAA 1WSGA 3OYBA 4KI4A 4DFKA 4BWJA 1EETA 4CIGA 3RTVA 4ZTFA 4M42A 1BIUA 1T7PA 3SUPA 1BQNA 3NF6A 4JLHA 3WNFA 3QNOA 2FBYA 4Y1DA 3V6DA 2G8VA 1QQCA 3SI6A 3B6PA 4FLZA 4CJSA 4KB1A 3PY8A 3V1OA 2OPPA 4CGHA 4DQRA 4Z0UA 1RBRA 5KTQA 2G8KA 3M8RA 4MFBA 1KVCA 5SWMA 4B9SA 3O4NA 3HPGA 1RILA 4JRPA 2ATQA 3QNNA 4FXDA 3V9SA 2F8TA 2XY7A 3TAPA 2E6LA 1X9MA 4E7LA 1DTTA 1G15A 4KV8A 3VN5A 3ZCMA 5HRSA 1SV5A 1BI4B 3AVCA 3TAMA 1QSLA 4C8LA 1TGOA 3QIPA 1JLAA 2AJQA 4XIUA 3OS2A 1A5XA 3OYEA 1KFSA 2HMIA 3CM5A 3HPOA 1JL1A 1EXQA 2Z1IA 5HRNA 4FZXC 4CJLA 3LANA 3ITHA 2HHWA 1VRTA 2PZSA 4AHTA 2D0AA 3SQ2A 1Z26A 4KB0A 4FLTA 4CJUA 1C1BA 1SL2A 3OYAA 4M3TA 1NOZA 1FKPA 2G8HA 4CJRA 2I5JA 5C25A 2F8SA 3DLKA 3SV3A 5EU7A 4OJRA 3DRSA 2VG7A 3NH1A 3VQBA 4B8CA 2OZMA 1RDBA 1S1TA
chains in the Genus database with same CATH superfamily
1RT5A 4CEBA 3DRPA 3DAWA 3IGAC 4OPJA 3HO1A 4CEFA 3ABLB 3BGRA 1M4UA 3L73H 3HOSA 2YC0A 1P7BA 4CJFA 2A3ZA 2PI5A 5E79Z 4M41A 3L2QA 3FZLA 1C0FA 1NENA 1XI1A 3AVJA 4CHPA 3CC7N 1L3UA 3RYFA 1NM1A 3LP0A 1QBZA 3P32A 5M1PA 2B4JA 4CHNA 1QHTA 3EXAA 2FC0A 4CFCA 4G27B 1SS6A 1WN7A 4O8KA 4HUEA 5CY4A 5B5EZ 1NR1A 5FPOA 3FAVB 3K0DA 3OGIB 1XMOK 5BN8A 1IURA 3KKRA 3HKEA 3JALA 5AQZA 5HBMA 3VQ8A 3RR7A 3P4SA 1Y76B 1HP8A 2GUZA 4KTWA 2GUIA 4K3AA 4ICLA 3K06A 4DQPA 3D2FA 4F3OA 3DC5A 4DTMA 2V4DA 1NTKH 4H0OA 3VQPA 4U7OA 4GV6A 4G9ZA 4PA9A 4GKKO 1P8ZA 5GADP 4HNAB 4LFAO 3K5LA 1HYVA 3HTVA 3KWGA 1GMGA 4LF9O 1CZ9A 5F1XA 3M8QA 1TAEA 4P9PA 3OW2M 4KI6A 1CZBA 4TUYB 2A42A 2RS54 1DF4A 4CEDA 2QK9A 4BC4A 3ZMTA 1CXUA 4LH4A 1B9FA 3KVGA 1M56C 1MOFA 3ZX3A 1VQNN 4B3RK 2F93B 4H8KA 2AXTZ 1AILA 4JI0K 2E3CA 5C12A 1SZTA 3D2EA 4PA7A 4DR6B 5LGUA 1RT6A 4FOIA 4HUFA 2IGIA 3N27A 3QNEA 3IFRA 2AGAA 3LP2A 4TQFA 3EE9A 4O4GA 2ZCEA 4B9NA 2Y4UA 4UB8Z 4WFAV 1UWBA 2XAFA 3OBYA 1NT2B 5DMRA 3A8TA 4LC1A 4EFHA 2H89A 5F2RA 1QCEA 4AQYO 1JLFA 3H3OB 3ZSZA 4E7KA 1MNGA 2VG5A 4Q4V4 2QE7G 2EJRA 1JKHA 1AR74 3IRXA 5JICA 3CCQN 5GTIZ 3L72H 1RDWX 1TA8A 1YJ9V 1E3MA 2G8WA 1RUG4 3OEHG 3E86A 1BL8A 2ZIOA 4B1WB 3VEYA 5IT9N 2UXBK 2O8FB 4IO8A 3LWLA 1WJZA 3J8AA 4GKKK 2HF4A 2WOMA 2VS0A 1NI8A 2JGUA 3SMPA 1EM1A 4RWTA 3OM3B 1F4MA 2IDOA 4A59A 1LV5A 5IYZA 2HW3A 1WAJA 1YQ4A 1I08A 2WSSG 3HKCA 3QFPA 3HVRA 1QSSA 2Q7HA 4LF9K 1FJGO 1NKCA 4WFEA 4NLBA 5AQLA 4DK1A 1R59O 3WQUA 3U3YA 1GRJA 1YTAA 1NKDA 1AP6A 3THOA 3VQ9A 3DC6A 3AARA 1VBA4 1X9WA 4JI0B 3VF6A 3PO5A 4JYAB 3OYNA 4O0JA 4C1NI 2UUAK 4H5RA 3RRGA 3W7WA 4M45A 1K4CC 2ZE6A 2XAHA 1NVPD 1J9AA 2QI2A 4A2AA 1NK0A 3SJBC 2QWPA 3SMSA 3JYTA 4FK4A 4FJGA 3VA3A 4ILGB 3AVNA 3DM2A 4XH1A 3H1LH 2Q6AA 4Z4CA 3AG2C 3RWUA 3ZHUA 4JI1O 4F8RA 4FJ8A 3LPUA 5AQFA 4JI8B 4B1ZA 1IDSA 5LA6B 2NRXA 1AI6A 4H0YB 3KD5E 1R084 2FSJA 5FRMA 4X8AA 4CF2A 4FWQA 1KYOF 4O4JA 1SF9A 1Q81O 5FRNA 2YI8A 4YJ3B 1NR7A 1NMNA 5J2NA 3BAAA 3OYHA 2BSKA 3CE2A 3OYDA 3BY5A 4B7KA 5AQTA 4DLEA 1OKJA 4FM2A 3A5LC 3JXUA 2YXYA 2UXDK 4LF8B 2P4VA 2JEXA 5JCOA 3JSNA 4CZZA 1E4FT 3HYFA 1T6CA 5FPNA 4BE2A 3MEGA 3EYZA 5L3FA 3ZN0A 1N34B 3THWA 1IKXA 2CTQA 3RVCA 3RYIB 3CCEN 3T7ZA 2WS3A 1VBE4 5IDJA 2NRTA 4LH6A 2WLKA 4BW5A 3RYCB 3T1YO 5AQJA 1FXKC 2PTMA 3ZRWA 4O5FA 4UQGA 3CM6A 4AHUA 5LGTA 2FBXA 3O6WA 4CEOA 2JS3A 4Z94A 3AE5A 4YJ3A 1SKRA 1VBD4 3RYCA 4LF6B 4GY2B 4KKOA 5M1OA 4FVUA 1WSEA 1ZOYA 4KX6A 4DHYA 5HRRA 3I56V 3OA9A 4E1NA 3F5WC 3NH0A 4F4KA 3VR8A 2V52B 3DXKA 2EIMC 4AILC 3U6FA 3MX2A 1H38A 1P90A 1DLBA 1NGJA 1OCZB 3LP3A 3MDQA 2BE2A 3FB7C 1KU9A 2CE4A 1N36O 2AZ0A 3KTQA 3I56N 1LUWA 5BR8K 3HM9A 2XT9A 4W5OA 3K9KA 2DOSA 3SPZA 3PIPL 3DSQA 1GLJO 5L3DA 4KP4A 3T1YK 4KFBA 3P4PA 2QWLA 2YIBA 3OJUA 4DQSA 3UB5A 1KD1O 1NTZH 3CQXA 2JEUA 2V7ZA 1KECA 2PW9A 4Q4X4 4YSZA 2CH7B 1W9HA 2OIGA 2JVDA 3E22B 4FLUA 4ISGA 4JD2B 5LBQA 4YDUA 1Q90D 3JD0A 3K5OA 3O5BA 1PO14 2JGDB 2E2QA 1HNWB 1XQSC 3NCIA 2GEMA 1QVFM 4NXMB 4ISFA 3KZIZ 4U3FH 1YCIA 4H44B 3T1YB 4JKHA 3MX5A 3C90A 4GX2A 3QLHA 4BAYA 5AQHA 4KREA 4GV3A 4PV1B 3HKEB 3FD9A 5BMVB 4DR1O 1ZUQA 1BHLA 4AI8A 3KK7A 2CH6A 1MA9B 4EFBA 3CFRA 3AG3B 3AO3A 1VBB4 1D9FA 4FFKA 4RW7A 4CZFA 2YIAA 4KHYA 3VERA 1OCRC 2XOKG 3R66A 3TAQA 3CCVN 5EIBD 3AG7A 1R3JC 3IUCA 3BF3A 3P30A 1I3AA 1LOTB 4LF6K 1RNHA 5C2TA 3CD6N 2G8UA 2OPQA 1ZXOA 2Q0UA 4FPPA 5EOYA 4I9QA 1QE1A 2VGMA 2YKNA 4N47A 3TAFA 1EWQA 4FSVA 2RKIA 4CD1A 1BGXT 1CLQA 3FFIA 1HRV4 4HHTA 2HNYA 4U7BA 3L2UA 3THYA 1JJOA 3STLC 1SQBH 1RTIA 3LWMA 1YZBA 2B5UA 4DK0A 4Q6GA 1HNWK 4CZGA 3AE3A 4GX5A 1WB7A 2AZ2A 3W3DA 1A5WA 5JVDA 2ZINA 2F9WA 3CJ1A 5BPNA 3E8BA 1K6YA 3CCJN 3KCYA 2ZE2A 1AR84 2VG6A 1U48A 1NNEA 4CC5A 1PD3A 2CUGA 3CYMA 2ITGA 4NO7A 1YAGA 2RPIA 3ZRSA 2Q97A 4HWIA 3TJTA 3CCMV 1KAZA 3EZ5A 3SUQA 3S9HA 4QJFB 2UUCK 4H13B 3T1AA 5IY5B 2FLOA 3AE1A 4ABMA 2RDCA 2R7YA 2GWJA 1RP3B 1NGAA 3T19A 2NUBA 4WYBA 4RQEA 5JLHA 3D6RA 2CTPA 1Q6UA 4CHOA 2UUCB 5IJ9A 1S6QA 4NYNA 2LFRA 2QWQB 4UY8O 4JV5B 3ASNC 5EIBC 4C1NK 2IVOA 3ZT2A 4M3YA 3LDEA 4J41A 2ZDIA 4DUYO 5ITZA 3U0ZA 2WONA 4OKEA 5BRHA 3SUCA 1F21A 4JAAA 2QWOA 5KX5A 1N32K 1HJRA 2NRVA 2GWKA 3DOLA 3FFKB 2E2NA 2ZE7A 3TAGA 3APQA 1VQ9V 4JI2O 3DLEA 1I94K 4QCLA 1RT3A 2RS34 2WP9A 1V4SA 4GB34 3LDOA 4RQFA 1RVF4 1B9DA 5DECA 3VEVA 4CS2A 4M7XA 5SZTA 3NHGA 1A32A 3T3FA 3AE7A 4KHNA 2W6KA 2Q1NA 5E1AC 3EVKA 2JWKA 3JARB 4WFHA 3N4PA 1XC9A 3LALA 1HX1A 3AVMA 5CBFA 2IAJA 3RSEB 4I0XB 5CZ2A 3G71N 4MQ3A 4ZOLB 2VQEB 1ASUA 2QEXV 2UXBB 2PF4E 3RYFB 2X6BA 5LMNB 1W0HA 2GBZA 1LWEA 2Q31A 4YOYA 5KQ8A 1SQQH 4DV5B 1U4BA 4WQ4C 3ASOB 4E0DA 2X5ID 1H2KA 4CZMA 4FJ9A 3ZSOA 1N5YA 1I94O 1S5HC 2W0XA 5JS1A 1MSWD 3E8GA 4PDRA 2FSNA 2WFBA 1IG8A 2R7FA 2YNFA 5CR4A 1XMQB 1I5XA 3SBTA 4CERA 5AQXA 5KLVH 4DQ8A 5DM6L 4CJ3A 4DS5A 1WBDA 4DV1K 2Z0AA 2ZQMA 1GLBG 4BE1A 2XUMA 3BZKA 4DV6B 1UPGA 4B9UA 1V54C 1YEWA 1SQKA 2BH1A 2YNHA 3WFVA 2HG5C 4AHSA 4BR7A 4FJNA 3ZETA 1GO3F 2DW4A 2PI4A 3S3MA 1GH6A 3L70H 3CCRV 4JI2B 4JYAK 4O2AA 2UXCO 2R72A 3VBBA 2E5LO 1VQKN 1RUI4 2B76A 3ZT3A 2EIMB 3SYOA 4A57A 2UXDO 1NTMH 4OVLA 4CJQA 4FWPA 3RVYA 3AEGA 3OYGA 2KQXA 4OPHA 1QZ5A 2XY8A 3O1BA 1VQPN 1NK7A 3AG4B 1GN4A 1KMIZ 3SCXA 4F3TA 4R79A 3E2EA 1HYZA 4F9OA 4LBEC 5LMNO 1XWLA 2QKAA 3K59A 2Q8VA 2N74A 3W0LA 3NGZA 2MW2B 2X78A 1XNQK 4OXSA 4LFBO 3LNNA 5BN9A 1NJIO 2ZJPL 4CVNE 1ENVA 1ZBLA 1IO2A 4GNIA 1VK0A 3OY9A 1JFFA 2R9AA 4C8OA 1Q86W 4ZHQA 3OS0A 4QAGA 2UUAO 3MWPA 5KRSA 4BR5A 5F2VO 2KZZA 3VQ5A 3NF7A 3T1HK 3SV4A 1BA0A 2QWPB 5L3GA 1MDUB 5L3BA 1DLOA 2UYTA 3Q7BA 3LNMB 4KH5A 1YIJN 3S3WA 3JSMA 3SYQA 1RT1A 1AR4A 3GB7C 4UV8A 3VF4A 4BRQA 1VEWA 3MN6A 4D7TA 3QO5A 1TUBB 2VCPA 3SLCA 4WBNB 3CC4N 3MXMA 4L8JA 1JR9A 1KLNA 5IY5C 5LMUO 1QS4A 4WFNL 1K8AO 5AZIA 4BQLA 4C7UA 4DR7O 1KQSM 1K34A 2ZT9B 3V9WA 3HJFA 1G8MA 1XHZA 4JK7A 2HVIA 1N33O 3IAYA 4X62K 3FZFA 3OEEG 4CFAA 3OYBA 1PIV4 3C7NB 2UUBB 1XNRB 3RTVA 4ZTFA 3ZMUA 3J81N 1BGYH 1DGSA 1BQNA 4X1KA 2QW9A 2JGDA 3KZBA 4JLHA 2E20A 1SQPH 2QEXN 3V6DA 2JJ2G 1QQCA 1Y6XA 3SI6A 5CA1B 5M1FA 4LWSB 5IYCO 1RM1B 1M90W 4CGHA 1IBMK 3F7VC 3N4QA 3P31A 3K3WA 4FZ0A 3G71V 2G8KA 3K0GA 2A7WA 5ITZB 3FKSG 3FE1A 3QNNA 1AB3A 2V7QG 3NXSA 5CB4A 4JI4O 3GDQA 1XMOB 4IIJA 3V9SA 2F8TA 1MMMA 4BVOA 3CC7V 2CAZC 4WBNA 4E7LA 4B3TO 2EILC 1NGHA 2ZE5A 4JYYA 2HBMA 4FO0A 3VN5A 3HOTA 4K0KB 1SV5A 3AVCA 3TAMA 1RMU4 4O4LA 4U67L 3IC9A 1ZX3A 4C8LA 5JJJB 3B77A 1LCUA 4FWSA 1Q7YO 4CBXA 3H1KH 2NR5A 4X64K 2QGNA 2Z1IA 1IJJA 1F23A 4LF5O 1HUXA 2ZGYA 1NS1A 5JH7B 3O9OA 5C8YA 3SPGA 4IZ9A 4FJCC 2ADPA 1FFTB 4WFFA 1LR1A 1JCFA 2FF3B 3NVMA 4M3TA 2ZDIC 5EYPA 2W41A 2QM4A 3DLKA 4YTNA 5AJ3K 2CTRA 2Q67A 2CGNA 4JTDB 1NGEA 4OJRA 3F9MA 4YIPA 2QWMA 3ABMB 1HNZB 4JYCA 3CJ9A 3EFFK 1RDBA 5AQGA 2DE0X 4DKWA 5IE9A 4U3JA 3HBTA 4YT0A 3D36A 4AQYB 4F6EA 3PSIA 3E9LA 2P1JA 2FKXA 4DMNA 3VMFB 4JRQA 4U7NA 2XO7A 4KUMA 2IOCA 1XMOO 1VSDA 1N0NA 2QM7A 4CEEA 4WE1A 1KRPA 1BWFO 4DR6K 4DV0O 1OCOC 3AA3A 3I55N 4DTUA 5J9PC 3BCCH 2FSKA 2HLDG 2B1GA 3G6EV 1VQ8V 5FDLA 4DSEA 4FPAA 4B9SA 4CJVA 1MZEA 3ML0A 3HKDA 3MMVA 2CH5A 2YHWA 4GVEA 2R074 4ILHA 1GOAA 2QSAA 5AQNA 1EZJA 2ASPA 5F0XA 3HZ6A 2OANA 1EN6A 3SJQC 3P39A 3BFRA 5AQQA 2HHSA 5KRTA 1JX9A 2I7PA 4BE0A 1N6QA 4LH5A 2HSTA 3M1FA 1K97A 3VA0A 1Q6HA 3HI0A 2OA8A 4CI6A 4KO0A 4DR2B 1O13A 2RHKA 4CGIA 1XREA 1NVPB 4W5RA 4CGGA 3FB8C 2A9HA 4TOIA 4BR9A 4CFBA 1X9SA 4QOZB 4JD2A 3ASMA 1TVKB 5A2QN 3FYIB 4TT3G 3CRAA 1JLEA 1BS3A 4XEIA 5LHIA 4FJHA 4CF0A 4IO9L 3RN4A 1WB9A 1J53A 4FZYA 2OT5A 3NR7A 3CMEN 2X6NA 4YOXA 1FXKB 1QLEC 2WLHA 2VQFK 4BC5A 1E4GT 1KTQA 3NMUA 1H2SB 4DTNA 1Z6RA 4BWAA 1G99A 1ESVA 1R3KC 3B09A 1OCCB 1YXBA 2GSMB 2B1IA 1FXXA 4BR4A 1NK8A 4CD3A 3CJHA 4ICGA 3R8EA 4DV2K 1S72N 2QXLA 4F2RA 4B1YB 1NKBA 4LF8O 1S1VA 2E76B 4X65B 1EFRG 4IJAA 1KC8W 4ZHQB 3SDLA 4U3JB 4BRGA 3L0QA 4GCZA 2YKMA 2G8IA 2HHVA 3D45A 1OJHA 3CEIA 3A5OC 3WXLA 2ZNIA 1QTMA 1CEZA 4J80A 2FXUA 3UQ8A 4IYIA 2WAMA 2Q3SA 3CCLN 3MK6A 1OH7A 2OCCB 4O5BA 4CEQA 4XH4A 4DV3K 2IVPA 1VMGA 3JCUZ 1NK4A 1Q82O 2P9IB 1BHBA 4EAHD 3KK1A 4PUOA 3O4WA 1UAXA 3WXIA 1VQ5N 3ZSQA 3BA9A 1HKBA 1GLLO 4B08A 3CJ7A 3SFDA 3V9ZA 1R0AA 2L6LA 1WPXA 2DYSC 5GONB 4JI6K 1ORQC 2K9PA 4PI2A 1JLBA 2ILMA 1BQ0A 1R1BA 3OUFA 2KZMA 4OX9O 4RG8A 4MVOA 4G1QA 4DV0K 2WU2A 4BG9A 2D4WA 1COV4 4JAXA 1S6PA 1MSDA 4JI7O 1VP7A 3GL1A 4FZ1A 4CHQA 4E1JA 2O8EA 3SYZA 1ZYQA 4JEPA 3QBXA 2YDEA 2WUSA 3KJVA 2P5GA 1SS3A 1JFFB 3DRRA 1OH5A 1RUH4 3ULEA 1E1QG 2GV9A 3O9TA 3OYLA 1U96A 3OYMA 3RMCA 1RUF4 2E8AA 3ZX0A 1UFIA 1AI5A 3K03A 2KKWA 1NGCA 4AH9A 4CZIA 2H88A 4GX1A 2D0CA 4IG0A 4DTSA 3CYOA 3GOIA 1OOPD 3ZCCA 2X6SA 3LAMA 1W2BM 1H1VA 1ITGA 3LPTA 1T5EA 1RPOA 4PHTX 1YTUA 1KP2A 4BRNA 1QR8A 3RRHA 2F4VO 1KBHA 2HJDA 3P4RA 4AM7A 1EKEA 3MDSA 4R7CA 3ZMZA 3V81A 1RBVA 2YS8A 5IWAK 4BR0A 5AZIB 2HNZA 4LF5K 3SYPA 2IIRA 1PO24 3JAMO 1RPRA 3SK3A 4NCAA 2R70A 2W6LA 3OE7G 1QR9A 1K5QA 1QNMA 2JDIG 2P9PB 2D2CB 2DFFA 5MLCQ 4OX9B 3J80O 2WPDG 1R6KA 4X1KB 1D4XA 2EHGA 4ILJA 2HBJA 2LW1A 1FXHA 2LW7A 1YVNA 4FCYA 1L3SA 1OCRB 4H4MA 2A06H 5JQGA 4JI7B 2D0BA 4JI4K 1TK5A 5A9GA 2QKKA 5KI6A 1KC8O 5D5PA 1IX9A 1B06A 3IFXA 3WXJA 3KKSA 3ABKB 1NGDA 3S3NA 1M57B 3GVMA 4A5BA 2OWOA 4B3TK 3I0RA 3CERA 1YF5L 4IDHA 4PL8A 4BWMA 3K9AA 1M5IA 1VSHA 3P5JA 1SQGA 3PUFA 2JIZG 3WU2Z 3G80A 3CPWM 4J9ZB 2OYQA 5GONA 4CJ4A 1Q82W 1HWYA 4CH4A 4M7YA 2PYLA 1ZC6A 3UT5A 3OMNB 3VRAA 3HKDB 4YXWG 5BXZA 1QLEB 4UUJC 1OCOB 4E2LA 1K73W 2Z1HA 3J7YP 1ASJ4 1EZVH 1RFQA 2HHXA 4LD0A 5H1SQ 4DTXA 4IBNA 3E35A 4XDKA 4GYCB 3U10A 1MZFA 3GG4A 4YOTA 3FX7A 3ZT4A 4DR5K 2BTQA 3SUOA 4DSJA 3SYCA 4IGGA 1Q3EA 4PL7A 4H5TA 3VTIA 4K8XA 3BUZB 4LY7A 4DSFA 1T44A 4BRLA 1M9NA 5JLFA 2QTOA 3A0RA 3THXB 3TXSA 2OCHA 4Z2WA 1RSOB 2BOBC 4JTCB 1LWFA 1BU6O 3DMJA 2JWLA 4N5SA 4LF7K 2KTQA 1CZAN 4ELUA 4KAZA 1ZP0A 4J7KA 5IWAO 4CJWA 1NGIA 2YCHA 5GTHZ 3THXA 4IKFA 1RHI4 1X3NA 4DV3B 3CMAN 2ODMA 5LGNA 3QO8A 1C0GA 3D2FB 4DTRA 3QEXA 1KVBA 1TK0A 3T2MA 2XY6A 2NLJC 1HNZK 1GOBA 4DLGA 1NQTA 3TAEA 3AE6A 5LMNK 5TISZ 1JOYA 2A1SA 2KFZA 4YSXA 4PA4A 1S1XA 2YXLA 4K8ZA 4BRFA 4DFJA 1ZAUA 4IG3A 2DMXA 3DOKA 2A0LA 4BGBA 4TUYA 4X65K 3TANA 1KVAA 3RMDA 1RT2A 2KSDA 2P9LB 3JS6A 4AHCA 3JD2A 4GKJB 4LFBK 2WLJA 4OX9K 2WDRA 4YSYA 1FKOA 1RBUA 3R9PA 3CCSV 3VQEA 4BRKA 3QFUA 1HKCA 2MK3A 5GW7A 2VQEO 3CXCM 2W6IG 4GUNA 3VETA 2VQFB 3SPJA 1TL1A 3QO9A 1NU0A 1SAZA 4OPAA 1YJNN 1L3VA 4B3OA 1HXS4 3IC7A 5D5QA 1AVMA 5J2UA 4DR5B 1NMDA 4JHDA 5FL7G 4HCCA 2L35A 3JAWA 4JZ2A 1L0LH 1XQ8A 1BQMA 3MN9A 1V55C 4B7EA 5D3GA 4KRFA 1XMQO 4E89A 4L87A 4JYAO 2GTDA 2Z1JA 4CJ5A 4MVQA 3U4LA 3CCLV 1L8DA 4CE9A 4NLCA 4DV6O 3C6UA 1FXKA 2X6CA 4EKWA 4IOXA 2RQ6A 3QEPA 4GV9A 1QVGU 4FLYA 1BUPA 4KH6A 4M3ZA 1Q6IA 3CCUN 3WXKA 4DV2O 2HWB4 3KLGA 1RGIA 4H03B 1FJGK 3WG7B 3PJSK 3IKMA 2EZOA 1ZLZA 5B1AC 4YOUA 3HP9A 4B9MA 2QDOA 3AVFA 4X1YB 4LH7A 5H6QA 2ZD1A 1NEKA 1GM9A 4KHPB 1J5EO 5JCOC 3LZJA 3O3GA 2BE3A 5AQVA 4B3MK 3CETA 5FPRA 1SL0A 4BY9C 1EX4A 2F7TA 2P5OA 1YDXA 4H37A 3W7SA 2QM8A 2HHHO 3P38A 4EHUA 4H33A 3RYIA 2O4GA 1KP3A 2D0OA 4YTMA 3VQVA 3AG2B 4O55A 1VSEA 1QZ6A 5I9EB 1NH2B 3V4IA 5KHKA 2ZQBA 1U49A 1SQXH 3AG4C 5EYPB 3HXMA 1Y76A 1XILA 3WB1A 4O0IA 1W59A 5JVHL 1UJWB 1RSOA 1RBSA 2HNDA 1P84F 1F51A 2EIJB 4B3SO 1YSCA 4IHJA 1L0NH 1Z2GA 4OGCA 1TV6A 4MLEA 4W5TA 3F73A 4LP8A 2M6YA 3H08A 5EZYB 3SJJA 1TUBA 1MA1A 4O4HA 3AO5A 3S3XA 3F5TA 1VRUA 3VPZA 4X62O 1EV14 4KHSA 3LDPA 5I3UA 2BSKB 3A0IX 4DFPA 4B9LA 1C6VA 2OPSA 3SPIA 1T8EA 3UT5B 3FYEB 3D8CA 2EIKC 3N2KA 1GLCG 3PSFA 4DCHA 2P7TC 4YJ2A 2HJFC 1ZBHA 2PLV4 3AA4A 2GELA 5M1KA 1FFXB 4KTQA 1N33K 2UU9K 2F9TA 4DR7B 4PDWD 4XBFA 3QO7A 1MWKA 3CC2V 3E9PA 3O9UA 5CA1A 5HOOA 3NAEA 1IH7A 1JA8A 3QEWA 1N8RO 2E1ZA 1NLVA 4UCTA 3HSCA 1WLJA 5AQIA 1HLUA 1TKTA 4BRMA 1H8HG 3O9QA 1J54A 1VIBA 4CIFA 2B6AA 4CS3A 3RMBA 4QS9A 4DQIA 4FM0A 5C2FA 4PD4F 2P51A 1Q5OA 3CG7A 1ASVA 4X9QA 3MD0A 3JD1A 1FPOA 4WCEV 3L3UA 5JMVA 3C6AA 3B4SA 2P6JA 3P4IA 4DV6K 4PQUA 4FWOA 4DG1A 5J2PA 5DK5A 3NGIA 3E66A 1UA1A 4LF4B 5K1XA 3VRBA 5LYJA 4XH5A 2RR14 5EC2C 4RW9A 4DRXA 4G2KA 1ZWIC 4WQ5C 3ABMC 4FJ7A 2ZWHA 3P83D 3BZCA 3M99B 4O2BB 4B3TB 3AECA 4DR1K 1HYSA 3TSUA 2A6AA 3OGCC 4FZZA 3OMIB 4MW8A 3SPYA 5C2DA 4CK3A 4HYOA 4JF3A 3WB0A 5H5NA 4CJPA 4O4IA 4E19A 4UCSA 2YI1A 3K9JA 3KLHA 3NGYA 1WA8A 3AO4A 2HF3A 2B5JA 1HQUA 3F2KA 4EIAA 3ASOC 3CWBH 4LNUB 4UFZA 1NK5A 1Q18A 3U9ZA 1BIZA 2OTLN 1RDCA 1WBBA 4W4LA 3ZHVA 5CA0A 3E01A 5BRFA 3A2FA 4IT5A 4PY5A 4W5NA 4DV1O 3T1HB 1XUQA 3VQQA 3OTOO 4Z4FA 1S3XA 4DRXB 4O4HB 3ZSRA 1S1UA 1XOUA 2A79B 3SBGA 1RUC4 5CYMA 5DN6G 3ETEA 4H0TB 3C65A 3JARA 1JLCA 4R5PA 4LF8K 3D3IA 4F2SA 3KIOA 3DLHA 4JV5K 2ZIMA 1K8AW 4DFKA 4BIOA 2WQYA 1QHAA 1XNQB 1BQZA 3AEDA 3L4IA 3M6GA 2HP8A 1T7PA 3OHRA 3CJCA 3NF6A 4BVPA 2FBYA 2G8VA 2ITMA 2IU0A 2BOCC 3B6PA 5DM6V 1Z5VA 2EINC 3PY8A 3V1OA 1H2NA 4R6ZA 2OPPA 4Z0UA 2KB1A 1DF5A 4OGQB 4MFBA 5EVZA 1CP9A 4BC3A 4JRPA 3HPGA 4DR3K 5LMUK 1XEQA 4BRDA 1XUPO 3T69A 4A5UB 4NXNK 3LUTB 2P9IA 4NB5A 2O57A 3ETGA 4MTGA 1V4TA 4JI6B 3ZCMA 1QSLA 1PL4A 1TGOA 3QIPA 3B2EE 3AG1B 2HMPA 4K41A 4DUYK 2DYSB 3CS5A 5C10A 3OTOB 1KFSA 2Q7EA 1THZA 1GTOA 4DO2A 3VEWA 4TV9B 1W0KG 4CJLA 5CHIA 3LANA 3SGIA 2HHWA 1HNXB 4AHTA 3G4SN 4I55A 2D0AA 3W7XA 1J95A 5B66Z 3SQ2A 2P9NA 1B6QA 1C1BA 5IYZB 3EKUA 5M1QA 4WCEL 1VQ9N 4MTXA 4YOVA 4KL1A 4P9OA 2XAGA 3L9DA 4LR3A 1FKPA 4A5AA 4CJRA 3GWOA 5C25A 1AI7A 1VQMN 5EY4A 2X6AA 3CJHB 1XNQO 5DEDA 3ID6A 4BR2A 2CGKA 1BA1A 2VG7A 2C2AA 4MVUA 1MABG 3FLCO 1O1WA 1KKDA 2YNIA 3LM9A 1M1KW 1TAUA 1PPJH 1VSIA 4TSXA 4JHDB 5CYQA 3SYAA 2JS5A 1PKXA 4FK2A 5EBWC 4B9QA 1BMFG 1VQKV 1YXQA 4JS4A 4DR4B 1NJZA 2WLIA 2Y4TA 3IMXA 4JK9A 2ZJQL 2ITDC 1US6A 1VQLV 4FJJA 4WFBV 4TSFG 4JI5K 4RCHA 1JCEA 3CPEA 1LW2A 5KGWA 2F4VK 5GIPA 4FFBB 4EB6B 5B3SB 4FWLA 5ADXH 4J9YB 1X9JA 2HB5A 4UVCA 3H1QA 5J2MA 2OIEA 5EK0A 5FLXN 4DR6O 1GOCA 2KHOA 4CF9A 4LCUC 1KFDA 1Q43A 1ZBFA 2XHBA 1RT4A 4KTZA 3ABVA 1HR0K 1Q9XA 1MU2A 3LDSA 3R65A 4J11A 3JATA 5KHGA 2E5LB 1A5VA 3H46O 1VQ4V 2QWQA 4HTLA 5IT9O 1DTOA 4DV4B 1JLGA 2O8CA 3MECA 4YNQA 3OVNA 3L2RA 3THVA 1TUEB 4YORA 4IFEA 2AHZA 2Y48A 2CH7A 3M7MX 1XC3A 5AQWA 4N21A 1U2VB 2ASOA 2BTQB 5HFMA 3AAQA 1SKWA 1D4M4 5AQUA 4YOWA 1GM8A 2CTWA 2DYRB 1H2LA 2IJIA 2UXXA 1NG9A 5CMUA 2ZXWC 2BDPA 1ATSA 4PELA 4X88A 2BANA 5KAFZ 1QQMA 3WNGA 3CCVV 2EINB 3DYAA 1RM1C 3N2GA 4CZKA 5HP1A 2ATKC 1GLAG 3I8BA 5CA0B 4O4JB 2D1KA 2LSNA 4CK1A 4JI5B 2GBOA 2J4RA 2QM1A 4NB4A 1N8RW 3KK2A 1I5YA 5LP6A 3I55V 3DXRB 1RTDA 3M8AA 3EN9A 2Q0OC 1I0HA 4I50A 5IJ0B 1IKVA 4UCVA 1FAFA 3CI5A 1KF6A 5EBLC 2ZR2A 3D3QA 2XRIA 4HUGA 3O1WA 1AJPA 4MTOA 1M90O 3SPCA 4O2BA 1NGBA 4JI1B 2IH3C 1COWG 5LJWA 3QERA 3MCPA 3L3VA 1U97A 2DWEC 3JD4A 3THYB 3SQ4A 1J5EK 2NRRA 4F6RA 1K7DA 3LL3A 1MG1A 3AE9A 2E1YA 1L5UA 4MO4A 2FF6A 3R3LA 2HHHK 2AHYA 3DI6A 5LHHA 3RWRD 3TTDA 3TSPA 4FJXA 2H94A 2IJJA 3B8MA 3RBZA 4QE9A 5LYJB 1T03A 1WAFA 2RMKB 2E6MA 1WAZA 2N04A 4UCRA 4RW6A 3CQYA 5H9CA 4BRPA 2A1RA 3G0ZA 3TABA 1RDDA 4KFMA 5FPMA 4MVMA 4KPYA 4GT1A 5KA5A 1VQOV 4RW8A 2X7RB 3O3FA 1N34O 1HR0O 1SQVH 3RSEA 4XDJA 1I39A 3PIOL 2W0FC 2ZD9A 3BA8A 5AG2A 4I9LA 1G1XB 3K57A 2P22C 1URFA 4J7ZA 1CXQA 3C6TA 3SAHA 3ZRVA 4IJNA 4FLVA 3ZSWA 4FWMA 3V1QA 4UCOA 1ROPA 3QEVA 1GLFO 5JVDB 1XMQK 3O4QA 4JS5A 3C94A 1L1FA 3DXKB 3Q7CA 2O8EB 2ZF5O 1QU7A 2LJ2A 3VEOA 4NKGB 4KBOA 3WNHA 2E74B 4Q20A 4J2DA 1WNSA 4CJKA 4EEQA 4I6MA 3VF2A 2UUBK 2PGGA 4EZ6A 4NR1A 1HJOA 4JI1K 4BRCA 3ZLJA 4IL6Z 4KHQA 4BIUA 1RTJA 3G67A 1M1KO 1CXZB 2WLLB 4IEIA 1RDUA 3BDPA 3ISNC 4PJ0Z 3SAFA 2QKCA 4ZKIA 3AG1C 4YHHK 3B8AX 2ZM6K 4A2BA 5I42A 1IZ3A 3X2QB 4DF4A 1PV0A 1HNZO 3B6OA 4DU1A 4DWIA 3CMAV 2FMLA 1LAWA 3TI0A 4DTJA 2BTOA 2I7NA 1HPMA 3MEEA 5JVGL 3OW2U 4N76A 2HKOA 3JCZA 3FR0A 1AJQA 1HW7A 1M93A 3O80A 4M3WA 2NZTA 1X1PA 2ZM6B 3E9OA 1N32B 3EL2A 5C15A 1R094 4CF1A 1IKYA 5BPLA 5JJEB 4D6TH 4B3RB 2NRWA 1J5OA 4E7JA 3OYCA 3VGMA 5KPRA 2QJ1A 3FFQA 3HM8A 5FLXO 4WF9V 3R6MA 5EX5A 4Z4EA 3JD74 2HFEC 3C95A 4DR1B 3VTHA 5BRDA 3E22A 4HVJA 3AE2A 4DU4A 3L4QA 3QINA 5AQMA 4ZTJA 3B40A 4PKHA 4CF8A 1N36K 1POV0 3K5MA 2ITCC 2DQ0A 1Q86O 3SJHA 4JI8K 3QVNA 3P4QA 4NTYA 3S3OA 1VF5B 2HBKA 2Q7GA 4NXMK 3OR6C 3OBWA 1L3TA 3DXMA 4W4KA 4JKFA 3P3PA 1SA0B 2LFSA 4J2AA 2DQ3A 4MVRA 4FPBA 3RVZA 5B1BB 3U11A 4ELTA 3RMAA 5EXWA 2F66C 3G10A 3HT3A 3UKRA 1V55B 2YEVA 3H1JH 4X66B 4FLWA 5JWPA 1DGKN 4IFVA 4LFCK 2P9PA 1VQMV 3BF1A 2ASMA 1BT8A 1QVFU 1GAXA 1VRH4 3OMAB 4M3XA 1VQ7V 3RR8A 2DN9A 1N32O 1BCMA 1FXVA 4E4EA 4B3RO 1PNKA 4P2ZA 2F95B 2FYUH 2JJ1G 1J5EB 1N36B 2P9UB 3HB3B 2GDSA 4PKGA 2HEPA 3S41A 3FGUA 3ZSVA 2O8DB 2W6JG 1BISA 2G8FA 5AZJB 4E7HA 1IG9A 3K04A 2OTJN 5FNVA 4LFAK 3I8DA 4FFBA 4EB6A 1KQSU 2KQ2A 2YHBA 4FJLA 3DWLA 3CC4V 3B8NA 4AM6A 3ZMSA 3K08A 4HAMA 3NE6A 4PA6A 4FLXA 3UO2A 4IOCL 2Y0PA 4TV9A 3WB2A 2OTJV 2YV0X 4FW1A 5JS2A 3VESA 3OYKA 3NVKA 3UO3A 4GVMA 3DLBA 3ZJZA 1BHAA 4QGPA 4FYDA 2WLMA 3H6EA 1HNWO 3HVTA 3KLIA 1NA1D 1VQON 4JKCA 3SQ1A 1Z5WA 2HHTA 2QWRB 1N34K 1BDGA 1Q7YW 1QQOA 1NBMG 4DUYB 5HL7L 4IWVA 5H2FZ 1NJXA 4DSIA 2RN2A 4FK0A 3LDQA 4LFCB 4JI3O 4X66K 3CF5L 2ARHA 3STZC 1SZ2A 1VQLN 3ZHQA 1RUJ4 2F1MA 1VAZA 2FBVA 2HHQA 5K14A 3VOVA 5J2QA 2P9LA 1KB9F 1QSYA 4CJ7A 3LDLA 1YJ9N 3VQYA 1R3LC 3P3NA 3H9VA 4DFMA 3C6HA 3KD1E 1TYQB 4GX0A 4FOEA 4FJIA 2QKSA 4I4TA 4PI0A 4CW7B 5DM7L 1R6NA 5LXTB 1WP8A 5BR8B 4DV4K 1YIJV 1EN4A 3QEIA 2P67A 2K1EA 1HPZA 1R6TA 4LNUA 3H1HH 3LSUA 2OCEA 1PM9A 3A0BZ 5J1EA 1HMVA 2QR4A 4JNEA 3HR0A 3L2WA 4LSNA 1WSIA 4HCBA 1K5SA 1P4RA 3D0PA 4HNAA 4LF4O 4J8FA 3PX4A 3CC2N 3CQ8A 3RFRA 1KCFA 3AGRA 3VGKA 5BR9A 2RJZA 3SUNA 4LWSA 3TTCA 3J81O 3UM7A 4NXNO 4QS8A 2F4VB 1BG3A 4CBWA 2Y1JA 1Q9YA 4J2BA 3OTFA 1K9MW 1SC5B 1K4DC 3IJ4A 4DR3O 3JAKB 5J2TB 1WSHA 5CE3A 4RO2A 4B9VA 1IV0A 2ADQB 1S72V 3AVHA 5B1BC 3WEEB 3ABKC 4CBCA 2WTUA 2IW5A 1ATRA 3AEIA 4PDVA 2LGQA 3JASA 5JQGB 1C1AA 2QWNB 2LGWA 4R8CA 3WT0A 5A2QO 4OPKA 4O8UA 4M3RA 5L3CA 1RUD4 1KLMA 4H0LB 1VQ6V 1WSFA 3HSTB 1QVGM 1S9GA 4YFUA 2UXDB 3EKSA 3JD3A 4Z1MG 1NKEA 1VSKA 1DEJA 5AZJA 4BDYA 3QESA 4HZ3A 1Z25A 4JV5O 3ATVA 1GKFA 5BR8O 3CFOA 1C0MA 3NDKA 1H2GA 2BTFA 3CJAA 4YHHB 4IEEA 5AQYA 4FK5C 4NTWA 3AA5X 3AVGA 3AEAA 3JAWB 4MO5A 2VWJA 3NBPA 5B8HA 2A41A 5B1NA 4LF7B 3PX0A 1K92A 1KKCA 3LP1A 3L8BA 3BEHA 5LY3A 5KX5B 3U3GA 3FZMA 2YEVB 2BUPA 3VQ7A 4UVBA 2XTAA 2QWRA 3F9KA 4MLHA 2UUAB 3QG5A 4NXNB 3VQ6A 3DLGA 4JN4A 2QA4N 2RM24 2P9NB 1IBLO 1R73A 4DR3B 2M7WA 4CJEA 1NWKA 1TL3A 4EHTA 1Y97A 1NGFA 4H4OA 4IXCA 4CIEA 1OCZC 4OKKA 3VENA 2UXCK 1P49A 5GINA 3AK3A 1O9GA 4K42A 4NCGA 1JJ2U 1RBTA 1U45A 4LF9B 4CFDA 1JXEA 4JKBA 5HLFA 2RS14 1XHXA 1OZ0A 4PA1A 1YI2N 3TK1A 3IG1A 4D7SA 5LXTA 3JYCA 5EC1C 5AFUH 3CRCA 3ZSYA 3ETDA 3KHYA 3N2GB 4BACA 1WUAA 1BEV4 5C3JA 2DTUA 3ZEDA 2ZE8A 3TR8A 4YHHO 3K0SA 4Z1VA 3UKUA 2FL4A 1JPXA 2QXFA 4DV3O 2R044 3NF8A 4E7IA 2X74A 4E1MA 3VQXA 4H5VA 2KKZA 2HOEA 4LF7O 3CB2A 3ZMVA 2ZKOA 2WU5A 2JRIA 3O08A 3GE1A 2QA4V 1YF2A 1BO5O 1HQEA 2LO1A 2WC9A 4EFEA 1VF6A 2Q4PA 4O4LB 4ISEA 4QE7A 2FBWA 3KWIA 1BZKA 5TKWA 3AG3C 4FIPC 4WFGA 4DW1A 4B8AB 1NCQD 1HRI4 1XDCA 2AW9A 3A5MC 1Y4MA 4MDBA 3OAAG 1OHHG 3CCEV 5ELZA 1FD9A 1ATNA 4B3MB 3MN5A 3EEQA 5HRPA 3KK3A 2GX9A 2OPRA 3CRRA 3ABTA 3ZX2A 4CGDA 4QPKA 3CCJV 2FB5A 4WF9L 2VQFO 4DR4O 1XL4A 2A5XA 3VQCA 2X0LA 1WPBA 1FJGB 3MN7A 4CIGA 2YIDA 4NVPA 1F4NA 4YY3K 4DR5O 3QB0A 5FNVB 4YXDA 3SUPA 1P7GA 4Q4Y4 1KAYA 2YI9A 3QNOA 3WNFA 4PDMA 5TKYA 4H5WA 3LM2A 4CJSA 4FLZA 2R064 4KB1A 1GN6A 3BY6A 3LDCA 4TQDA 4B1VA 1Y74A 3WUHA 1IBMO 3ZN1A 1QLNA 1AROP 2ZR3A 3HPLC 1KVCA 3G6EN 4DUZB 1VQ8N 1RILA 4GZRB 4RUEA 4DXWA 2BCCH 1S0VA 2ATQA 1IBKK 4RAIA 2PBDA 3MCAB 3TAPA 4YIOA 3CRMA 1YUWA 4ASUG 1DTTA 1G15A 1NGGA 4KV8A 2OTLV 1Y64A 3ZS8C 4BREA 3ATUA 1D5NA 5LMUB 1BI4B 1JLAA 2AJQA 4ZOLA 2HR3A 3OYEA 1J6ZA 2HWC4 1N33B 3HPOA 4JAVA 1YJWN 1JL1A 3VQWA 5HRNA 1JQ0A 3BPZA 4IHJB 2HHHB 4DR4K 1XNRO 3J8F4 4B3MO 3ITHA 3M3ZA 2UXNA 2PZSA 4KB0A 4F6RB 1Y67A 4CJUA 1SL2A 3ZRXA 1NOZA 2G8HA 4I4TB 3RT3C 1AP5A 2I5JA 1H8EG 2F23A 3CCQV 3ABUA 5EU7A 5BREA 1VQPV 3DRSA 1CPYA 1G4YB 4JKGB 3ULEB 4TV8B 1Q81W 2OZMA 2IBZH 4JI5O 1S1TA 2H3OA 3OD4A 4JI4B 5IYDO 3RYHA 4PA3A 4JI7K 4A61A 3PN1A 4AHRA 3ZT0A 1ASWA 3T1CA 3BP8A 2YICA 2D0PA 2E2OA 1HNXK 4GW6A 5C0YA 2JLEA 4K35A 3MXIA 1DKGD 2P9SB 1VSLA 1R3IC 2WA3A 3CCRN 4Z4GA 3AAPA 1IVSA 3KCXA 4I2QA 5GIOA 2RN9A 3L75H 4JK8A 4LF6O 2N05A 3QF7A 2B9ZA 4DSLA 3NH2A 2Z1GA 3JALB 4J10A 4LF5B 2P9SA 1QQNA 4KHPK 2IC3A 3TGUH 1T05A 4WQ4A 3VQAA 2KG7A 2Q5ZA 3ZHSA 2NNUA 3ZHRA 4BW9A 5GAGP 3AK1A 1RT7A 5CN0A 3FB5C 4DS4A 2HVJC 1EP4A 1LNQA 5J2UB 3MEDA 4E3SA 4TV8A 4Q5VA 1ZBSA 3QBWA 1K5MD 4BRHA 3H1VX 1NH2D 3D36C 2E5LK 3DLLL 2DY4A 1YVWA 1VHXA 1VSFA 4MTFA 1HR0B 2VWBA 4L3QA 4LC9B 2YHYA 4YJ2B 2RF2A 5GAHP 2Q9LA 3QIOA 1Y74B 4DF8A 2W42A 1DTQA 1B92A 4CC6A 1JVMA 1LAVA 3AGKA 4JKAA 4Z4HA 5KPTA 1AR94 2LQTA 4NXMO 4B3SK 4X20B 4DV0B 1JCGA 5IJ9B 2YJEA 3J7AP 3APOA 1EBOA 1S1WA 2E2PA 5C93A 3ZBHA 2Q0RA 2R9IA 3BRCA 4Y0WA 4YTPA 1VQ5V 3TCUA 4J2EA 1VSMA 3HRGA 2PAVA 5HFLA 3ABLC 3HK2A 1IKWA 4X20A 1HNVA 1TKXA 4DR7K 3DXMB 4QS7A 1X4TA 1VQ7N 4PKIA 5AQOA 1TVKA 4DW0A 1MWMA 4DTPA 1YTFD 4GLXA 4OGEA 3LDDA 3UIQA 4Z4IA 1YITV 2O8BA 4MVSA 1B3QA 4DR2O 1OH8A 4I55B 5KGXA 4FJKA 5LP6B 1UOCA 3PX6A 5LOVA 3AK2A 4CZLA 2EZPA 3AO1A 4I7ZB 1T6DA 2BGGA 2H8PC 4ZHRA 3OS1A 2Y1IA 3AA2A 2V51B 2HBLA 2F43G 3I5DA 3DXRA 3LAKA 2V1DA 3FZKA 4CECA 4PDLA 5IJ0A 4CEAA 1DK1A 4WFBL 4QPJA 3UCSC 4B1UB 1EO1A 2ETNA 5CBHA 3OTOK 1JJ2M 5KUKA 1Q8IA 2YUAA 1K8KB 3RW0A 4BDPA 2WLLA 1YHQN 1EQYA 3SJAC 3ZX6A 2Q68A 2VYPA 3PLAA 1PVC4 2DYRC 3E89A 5JH7A 3QMLA 1OV9A 3CCSN 1EWRA 3VQDA 2Z5UA 4X65O 3CSXA 3TTFA 4B9TA 1KSPA 3C0BA 4IIJB 4H0VB 3SPHA 4QIWF 5BMVA 3CMEV 4ID5A 4G28B 3W7TA 5CBGA 4RUFA 1KUQA 3SNNA 3ICXA 3AVIA 3SQ0A 3CD6V 2NRZA 5LL6Y 4HBNA 5K1PA 3DTUB 3V1RA 2OZSA 5KUMA 3I33A 3JATB 5CZ1A 4AF1A 3SAGA 3AVBA 1Z7S4 3AEFA 2NNWA 1W2BU 4BGAA 1WA8B 4X66O 3HL8A 3ZEUA 4JI3K 5C8YB 3ENHA 1XNRK 3ENOA 1GK9A 4I5SA 1WSJA 1HNXO 4RHV4 1VQNV 1K8KA 3F7YC 1NU1H 3H3NO 3U9DA 2O8DA 1U04A 4MT8A 3SJCC 2A3QA 3KKYA 5LHGA 4IDKA 3H1IH 2IJHA 3HKBA 3WEEA 5C42A 3CXCU 1GN3A 1OVQA 4J7JA 2WDQA 4CGFA 4UV9A 4FMTA 2QWNA 3TU5A 1T3VA 5B1OA 1KD1W 4OO1J 1SKVA 3ZETB 1IBKO 1K33A 5CB4B 1FYJA 2YHAA 2P06A 4GKJK 3OT7A 1FKAO 2UU9O 5HROA 4CH6A 2EBOA 5LOVB 5LA6A 4DV7B 2Q69A 1SQFA 4C8MA 2O8FA 4AQYK 1SESA 4A62A 3H01A 3EO3A 3CXHF 1RCHA 4J42A 3CIPA 4YDUC 4FJ5A 4MSWC 3WNEA 4CZJA 4L8RB 2KFNA 1OCCC 1C0TA 3JAKA 5J2TA 3V9XA 3PV8A 3AVAA 2ACZA 2RCVA 3OFNG 3SFEA 4JZGA 3AVLA 4JI0O 3LZIA 1GN2A 4OLAA 3WG7C 2IS3A 3ZSXA 2P90A 3ASNB 2ZJRL 3CCMN 2QKBA 1BCCH 1ZL8A 3HPHA 5LP6C 3HKBB 3O9RA 1GM7A 1LW0A 4OLBA 4CH5A 2HVKC 5EZYA 1JL2A 1FK9A 5KMGA 3KLFA 4ZI7A 4N41A 1TYQA 1ZBUA 3R1XA 3JBG4 1NZ6A 3VR9A 4RW4A 2PY5A 2UXCB 4JI8O 5T7BA 4H0XB 4DV4O 4Q4W4 1F7YA 3ZT1A 5KHJA 2IM9A 1K73O 4K0KK 2EIKB 1TAQA 4UB6Z 1NK6A 3ZRWB 3TSQA 3N2KB 1RUE4 4GKJO 1N0JA 2VWKA 3K2PA 4X1IB 4XDLA 1PNLA 3AE8A 3GWKC 3SZ2A 1RFYA 3RGBA 1NK9A 3LSQA 1N4CA 4BIZA 1IBKB 4KH4A 1V9PA 3KG2A 2FBTA 3TPQA 5AQSA 3MHSC 2UU9B 1YJNV 2Q0AA 3IS9A 1TKDA 4DV7O 5AQPA 4JKEA 4I50B 3VOUA 2IJKA 2VGNA 3BEXA 4LFBB 3HP6A 2O8BB 1AR5A 1SZXA 4JAUA 1IXMA 1K3EA 4FVMA 4X1YA 1KAXA 3WQTA 3QETA 4IFYA 3AEBA 4WQ5A 1EN5A 1NBWA 3VEXA 5B1AB 1SETA 3D7EO 3E1YA 1NOYA 2PYJA 4I6MB 3KLEA 1VQ4N 2P9UA 4JTAB 1JCHA 3OR7C 3MAQA 3O3HA 3ULDA 3E8HA 2D3OW 3FB6C 2KW4A 3GQKA 5BZBA 3K9SA 3T4ZA 4BR6A 4IYHA 4K25A 2DFHA 1WLEA 3ID8A 3ALYA 2RMU4 1NJIW 3MHHC 1MQTD 3H45C 5H6RA 5AR0A 1D8YA 4DV2B 4CHZA 1X3MA 2EJ7A 4N23A 3ZHTA 1D5AA 3ZIAG 1YVUA 2NRHA 4DB3A 1UA0A 4NYKA 3U8XA 1RTHA 3K79A 4CH3A 5LJVA 1S77D 2AP1A 4PWDA 4KHPO 2EIJC 1NJWA 2E88A 2E75B 4TWKA 1VF7A 4C8NA 4V19S 1ZBIA 2GTSA 1SRYA 3MXJA 1AR1B 2UUBO 5IWAB 1BOTO 4EZ9A 5M1NA 3M8SA 1PNMA 3A8YA 5JJNB 4RWUA 5KA6A 1SUQA 3BHPA 3K5NA 4BC2A 4BRAA 4DUZK 3OUSA 1IBLK 4DSKA 4NYFA 3AE4A 1AI4A 2YSUB 3V9UA 1TK8A 3P1GA 3CRQA 2QWOB 3JASB 3FZHA 3J7AU 3CIRA 3L71H 1BI4A 3C3TA 3O9SA 1U47A 5KHIA 2GHYA 1WP7A 4CEZA 2EX3A 1M57C 1VSJA 4JASA 3CHXA 2Y0IA 1IBLB 2WLIB 2KG7B 4K43A 4X64O 3TETA 5FPDA 4K0KO 4X62B 1IXBA 1FS0G 4IOAL 3A0HZ 4X89A 2YIBD 5IYBO 1HDJA 3NFAA 1FFXA 2P4KA 3G4SV 2Q2RA 1X59A 4KHUA 4FXDA 4JI2K 2RE2A 3M5RA 1LWCA 4JYBA 2WBNA 4ID1A 5BPMA 1TUUA 3VEZA 3QTCA 1G6UA 2D5RA 4MDAA 3K58A 4FW2A 4EP5A 4DV7K 2G38A 2XNDG 1AJNA 3C3SA 1RDAA 3OJSA 3UKRB 3L2VA 1AR64 5CA3A 4M3UA 3AO2A 5AFUA 4O44A 3RYHB 1L0VA 2EILB 2XASA 5E84A 4RTFD 3EHBB 3FAVA 5KPZA 3FI7A 1NJYA 1HNIA 2Q36A 3J80N 4DV5K 1W0JG 4DYLA 3D2EB 2LP7A 4YY3O 1U2VA 1VARA 4JPRA 2ZM6O 3J7ZO 4KXRA 1D9DA 3JAMN 1REVA 3ZYYX 3BVOA 3X2QC 4DU3A 4C23A 1OVYA 3VQ4A 2Y69C 5KMGB 1TUYA 4HTUA 3QDKA 4Q0BA 2DFEA 4ELVA 3LDNA 4X64B 2PUSA 4QNHB 4DQQA 3CP1A 2ETJA 5ADXA 4BROA 3TWHA 4DTOA 4AHVA 3TXQA 2NLXA 4Y1CA 2NN4A 4JKGA 1TVRA 4UCUA 4O2AB 5EBMC 3UKUB 4R50A 2O4IA 2Z3YA 3O65A 4B1XB 4CJTA 4LF4K 3CJBA 1HKGA 3CX5F 4CHYA 4FWNA 2YHXA 4WFAL 1JMKC 2F96A 4I2PA 4NCBA 5KHHA 5L3EA 2XY5A 2UUCO 1K9MO 4B3SB 1ZL8B 2DWDC 2CGLA 2W40A 1YI2V 5AQKA 4I0XA 2YNGA 4F4LA 5LL6Z 2GTAA 3VGLA 3PO4A 1BSMA 5E41A 2HVHA 3LSSA 3Q4HB 4C8KA 2HHUA 5AQRA 4CZEA 2H3GX 4JGSA 4EP4A 4DV1B 2VRZA 3T1HO 1IBMB 3EZWA 3E83A 3SR2C 5KAIZ 1FW6A 3TARA 4DUZO 2V7YA 3OYIA 1S5JA 1AL24 3CFPA 3ENBA 5C24A 1SL1A 2P9KA 1YJWV 3C7NA 3Q4HA 4KHWA 2GUPA 3AEEA 3A5NC 3GBTA 1Y66A 3ETQA 4FM1A 1JXBA 4YY3B 1TKZA 3I0SA 2PFUA 2E4LA 3QICA 4CESA 1C1CA 4BDZA 1ZSPA 4N56A 3AVKA 1ILYA 4H0PA 4MVZA 1XBLA 3EY1A 4FJMA 2QTDA 2CDYA 4CS4A 2VQEK 3HKCB 1H2MA 2ZGZA 3DJCA 1GLEG 4I7FA 4CK2A 1BL3A 2XAQA 1YT3A 3CHWA 2OCCC 5FPEA 4GMJB 2A40A 2UXBO 2XAJA 3OYJA 2RNBA 1BE3H 4W5QA 4DV5O 1BCOA 3G25A 2IVNA 2ZXWB 1S9EA 3UE5A 4LSLA 1E79G 1JLQA 4JKDA 4CCHA 4CGJA 4P30A 1I7FA 1E1RG 1PP9H 3E8FA 2CGJA 4OKJA 5KQDA 2JK5C 1I94B 1C0UA 3AV9A 1YTFB 3EE8A 1WB8A 3M8PA 2WLNA 3DLRA 2YXHA 3OYFA 1SKSA 4CZHA 1V54B 5FROA 4JI6O 2AA4A 1HRHA 3BABA 1LUVA 4ZI7B 1ZTEA 2WWWA 2YX6A 5GAEP 1GLDG 3NF9A 1S5LZ 3ZEUB 4JI3B 4LFCO 1WSGA 4KI4A 4MS2A 3UKMA 2QTSA 4I9WA 3O8MA 4BWJA 1EETA 1S3JA 4M42A 3JSLA 1BIUA 1S76D 4MW3A 4X1IA 2Q73A 4FWKA 4DR2K 1VBC4 4Y1DA 1H8TD 2YJFA 2DPNA 4DQRA 1YQ3A 1SERA 1RBRA 1O9HA 1VF6C 5B3SC 5KTQA 4O4IB 5SWMA 3M8RA 1OH6A 1W97L 3O4NA 4H5NA 4CBUA 1PL0A 3L74H 2R9RB 2Y69B 2XY7A 2DJVA 2E6LA 1X9MA 1B04A 4NTXA 2WA4A 3THWB 3T4DA 3IDHA 4ZIBA 2IH1C 3MWTA 4BG8A 5HRSA 1VQ6N 4ZBMA 1WOQA 3AY9A 4M63C 1D2DA 4UXNA 2P9KB 1A5XA 3DGEA 4XIUA 3OS2A 2EWSA 2EULA 4FWRA 2HMIA 3CM5A 3G6BA 3W7UA 4UVAA 1XL6A 1EXQA 1DT9A 4FZXC 1KXPA 3GQHA 1EAH4 1YHQV 1VRTA 1S22A 1Z26A 5E26A 4FLTA 2FTKA 2ZNJA 1Z05A 2CGOA 3OYAA 1U6ZA 1KFYA 5BY1A 1W7AA 3CCUV 2F8SA 4BRIA 4BQZA 1YITN 3L6QA 4PHZA 3SV3A 2O8CB 2CK3G 4GKKB 4FL9A 3NH1A 4LFAB 3VQBA 2KLAA 3WXMB 2IU3A 4B8CA 1M56B 2WDVA 2GUZB 3CPWU 1SA0A
chains in the Genus database with same CATH topology
1RT5A 4CEBA 3DRPA 4OPJA 3HO1A 4CEFA 3BGRA 1M4UA 4CJFA 4M41A 3L2QA 1XI1A 3AVJA 4CHPA 1L3UA 3RYFA 3LP0A 4CHNA 2B4JA 1QHTA 2FC0A 4CFCA 1WN7A 4HUEA 5CY4A 5FPOA 3KKRA 3HKEA 3JALA 5HBMA 3VQ8A 3RR7A 4KTWA 2GUIA 4ICLA 4DQPA 4F3OA 4DTMA 2V4DA 3VQPA 4HNAB 3K5LA 1HYVA 1CZ9A 3M8QA 1TAEA 4KI6A 1CZBA 4TUYB 4CEDA 2QK9A 4LH4A 1CXUA 1B9FA 2F93B 4H8KA 2E3CA 4DR6B 1RT6A 4HUFA 2IGIA 3LP2A 4TQFA 4O4GA 2ZCEA 4B9NA 5DMRA 1UWBA 1NT2B 3ZSZA 1JLFA 4E7KA 2VG5A 1JKHA 3IRXA 1TA8A 2G8WA 2ZIOA 3LWLA 2WOMA 2JGUA 2IDOA 1LV5A 5IYZA 2HW3A 1WAJA 3HVRA 3HKCA 1QSSA 2Q7HA 1NKCA 4DK1A 3U3YA 1YTAA 3THOA 3VQ9A 1X9WA 4JI0B 3PO5A 4JYAB 3OYNA 4O0JA 3RRGA 4M45A 1J9AA 1NK0A 3SJBC 3JYTA 4FK4A 4FJGA 3VA3A 3AVNA 3DM2A 4Z4CA 3RWUA 4FJ8A 4F8RA 3LPUA 4JI8B 5LA6B 3KD5E 5FRMA 4CF2A 4O4JA 5FRNA 2YI8A 4YJ3B 5J2NA 3BAAA 3OYHA 3OYDA 4DLEA 4FM2A 4LF8B 5JCOA 3JSNA 3HYFA 4BE2A 3MEGA 3EYZA 1N34B 1IKXA 3RYIB 4LH6A 3RYCB 2PTMA 4UQGA 3CM6A 4AHUA 2FBXA 4CEOA 4YJ3A 1SKRA 3RYCA 4LF6B 4KKOA 1WSEA 4E1NA 5HRRA 4F4KA 3NH0A 4AILC 3U6FA 3LP3A 2BE2A 1KU9A 3KTQA 3HM9A 4W5OA 3SPZA 3DSQA 4KFBA 2YIBA 3OJUA 4DQSA 2PW9A 1W9HA 2JVDA 3E22B 4FLUA 3K5OA 1HNWB 3NCIA 4NXMB 3T1YB 3QLHA 4KREA 3OS1A 3HKEB 5BMVB 1BHLA 4EFBA 3CFRA 3AO3A 4RW7A 4KHYA 2YIAA 3TAQA 5EIBD 1I3AA 1RNHA 2G8UA 2OPQA 4I9QA 1QE1A 2YKNA 4N47A 3TAFA 2RKIA 1BGXT 1CLQA 3FFIA 4HHTA 2HNYA 3L2UA 1JJOA 1RTIA 3LWMA 4DK0A 4Q6GA 1A5WA 5JVDA 2ZINA 1K6YA 2ZE2A 2VG6A 1U48A 4CC5A 3CYMA 2ITGA 2RPIA 3EZ5A 3SUQA 3S9HA 3T1AA 2R7YA 3T19A 2NUBA 4CHOA 2UUCB 5IJ9A 1S6QA 4NYNA 4JV5B 5EIBC 3ZT2A 4M3YA 2WONA 5ITZA 3U0ZA 4OKEA 1F21A 5KX5A 1HJRA 3DOLA 3TAGA 3DLEA 4QCLA 1RT3A 1B9DA 5SZTA 4CS2A 3NHGA 3T3FA 4KHNA 3JARB 1XC9A 3LALA 3AVMA 2IAJA 5CZ2A 4MQ3A 4ZOLB 2VQEB 1ASUA 2UXBB 3RYFB 1W0HA 2GBZA 5LMNB 1LWEA 4DV5B 1U4BA 4E0DA 4FJ9A 3ZSOA 1N5YA 5JS1A 2R7FA 2YNFA 1XMQB 4CERA 4DS5A 4QOZB 4CJ3A 4BE1A 4DV6B 4B9UA 1YEWA 2YNHA 4AHSA 4FJNA 3S3MA 4JI2B 4O2AA 2R72A 3ZT3A 4OVLA 4CJQA 3OYGA 2XY8A 1NK7A 1KMIZ 3SCXA 4F3TA 1HYZA 1XWLA 3K59A 3NGZA 2X78A 3LNNA 1ZBLA 1IO2A 1VK0A 3OY9A 2R9AA 1JFFA 4C8OA 4ZHQA 3OS0A 4QAGA 5KRSA 2KZZA 3VQ5A 3NF7A 3SV4A 1DLOA 3JSMA 1RT1A 4D7TA 1TUBB 4WBNB 3MXMA 4L8JA 1KLNA 1QS4A 3HJFA 3V9WA 1XHZA 2HVIA 3IAYA 4CFAA 3OYBA 2UUBB 1XNRB 3RTVA 4ZTFA 1DGSA 1BQNA 4X1KA 4JLHA 3V6DA 1QQCA 3SI6A 5CA1B 4CGHA 2G8KA 5ITZB 3QNNA 4FXDA 5CB4A 1XMOB 4IIJA 3V9SA 2F8TA 2CAZC 4WBNA 4E7LA 3VN5A 4K0KB 1SV5A 3AVCA 3TAMA 4O4LA 4C8LA 5JJJB 2Z1IA 5JH7B 5C8YA 4M3TA 5EYPA 2QM4A 3DLKA 4OJRA 1HNZB 1RDBA 4U3JA 4AQYB 2P1JA 4DMNA 4JRQA 2XO7A 2IOCA 1VSDA 4CEEA 4WE1A 1KRPA 3AA3A 4DTUA 5FDLA 4DSEA 4B9SA 4CJVA 3HKDA 1GOAA 2HHSA 5KRTA 1N6QA 4BE0A 4LH5A 3VA0A 4KO0A 4DR2B 4CGIA 4W5RA 4CGGA 4TOIA 4CFBA 1X9SA 3ASMA 1TVKB 1JLEA 4FJHA 4CF0A 4FZYA 1J53A 2X6NA 1KTQA 1H2SB 4DTNA 4BWAA 1FXXA 1NK8A 4F2RA 1NKBA 1S1VA 4X65B 4ZHQB 4U3JB 2YKMA 2G8IA 2HHVA 3D45A 2ZNIA 1QTMA 3UQ8A 2Q3SA 4O5BA 4CEQA 1NK4A 3KK1A 4PUOA 1UAXA 3ZSQA 3BA9A 4B08A 3V9ZA 1R0AA 5GONB 4PI2A 1JLBA 2KZMA 4RG8A 4G1QA 1S6PA 4CHQA 3SYZA 1ZYQA 3KJVA 2P5GA 1JFFB 3DRRA 3OYLA 2GV9A 3OYMA 3RMCA 2KKWA 4AH9A 2D0CA 4IG0A 4DTSA 2X6SA 3LAMA 1ITGA 3LPTA 1T5EA 1YTUA 3RRHA 3V81A 1EKEA 1RBVA 2HNZA 4NCAA 2R70A 2DFFA 4OX9B 4X1KB 2EHGA 4FCYA 1L3SA 4H4MA 1TK5A 5JQGA 4JI7B 2D0BA 2QKKA 5KI6A 5D5PA 3S3NA 3KKSA 2OWOA 3I0RA 4BWMA 1M5IA 1VSHA 3P5JA 1SQGA 3PUFA 2OYQA 5GONA 4CJ4A 4CH4A 2PYLA 3UT5A 3HKDB 2Z1HA 2HHXA 4LD0A 4DTXA 4IBNA 4GYCB 3U10A 3ZT4A 4DSJA 3SUOA 2BTQA 1Q3EA 4K8XA 4LY7A 4DSFA 1LWFA 3DMJA 4N5SA 2KTQA 4ELUA 4KAZA 4CJWA 4IKFA 4DV3B 4DTRA 1KVBA 1TK0A 2XY6A 1GOBA 4DLGA 3TAEA 2A1SA 2KFZA 1S1XA 2YXLA 4K8ZA 4DFJA 1ZAUA 4IG3A 3DOKA 4TUYA 3TANA 1KVAA 3RMDA 1RT2A 4AHCA 4GKJB 1FKOA 1RBUA 3VQEA 2VQFB 1TL1A 3QO9A 1L3VA 4B3OA 5D5QA 5J2UA 4DR5B 4HCCA 3JAWA 1XQ8A 1BQMA 5D3GA 4KRFA 4E89A 2Z1JA 4CJ5A 1L8DA 4CE9A 3C6UA 2RQ6A 3QEPA 4FLYA 3HP9A 4B9MA 3AVFA 4X1YB 4LH7A 2ZD1A 4KHPB 5JCOC 3LZJA 3O3GA 5FPRA 1SL0A 1EX4A 2P5OA 3RYIA 2O4GA 3VQVA 4O55A 1VSEA 3V4IA 5KHKA 2ZQBA 1U49A 5EYPB 3HXMA 3WB1A 4O0IA 1RSOA 1RBSA 2HNDA 4IHJA 4OGCA 1TV6A 4W5TA 3F73A 3H08A 5EZYB 3SJJA 1TUBA 4O4HA 3AO5A 1VRUA 4KHSA 5I3UA 4B9LA 4DFPA 1C6VA 2OPSA 1T8EA 3UT5B 3N2KA 4YJ2A 1ZBHA 3AA4A 1FFXB 4KTQA 4DR7B 5CA1A 3NAEA 1IH7A 3QEWA 4UCTA 1WLJA 4CIFA 1TKTA 1J54A 3RMBA 4DQIA 2B6AA 4CS3A 4FM0A 2P51A 1Q5OA 3CG7A 1ASVA 3L3UA 4PQUA 4DG1A 5J2PA 5DK5A 3NGIA 1UA1A 4LF4B 5K1XA 5LYJA 4RW9A 4DRXA 4FJ7A 3P83D 4O2BB 4B3TB 1HYSA 4FZZA 3SPYA 4CK3A 3WB0A 4CJPA 4O4IA 4E19A 4UCSA 3KLHA 3NGYA 3AO4A 2B5JA 1HQUA 4LNUB 4UFZA 1NK5A 1BIZA 1RDCA 5CA0A 3E01A 3A2FA 4PY5A 4W5NA 3T1HB 3VQQA 4Z4FA 4DRXB 4O4HB 1S1UA 5CYMA 3JARA 1JLCA 4R5PA 4F2SA 3KIOA 3DLHA 2ZIMA 4DFKA 1XNQB 1T7PA 3NF6A 2FBYA 2G8VA 3B6PA 1Z5VA 3PY8A 3V1OA 2OPPA 4Z0UA 4MFBA 4JRPA 3HPGA 3ZCMA 4JI6B 1QSLA 1TGOA 3QIPA 3B2EE 3OTOB 1KFSA 2Q7EA 4TV9B 4CJLA 3LANA 3SGIA 2HHWA 1HNXB 4AHTA 4I55A 2D0AA 3SQ2A 1C1BA 5IYZB 4KL1A 1FKPA 4LR3A 4CJRA 5C25A 2VG7A 1O1WA 2YNIA 1TAUA 1VSIA 5CYQA 4TSXA 2JS5A 4FK2A 4JS4A 4DR4B 1NJZA 4FJJA 5KGWA 1LW2A 4FFBB 4EB6B 2HB5A 5J2MA 1GOCA 4CF9A 1KFDA 1Q43A 1ZBFA 2XHBA 1RT4A 4KTZA 1Q9XA 1MU2A 3LDSA 3JATA 5KHGA 2E5LB 1A5VA 4DV4B 1JLGA 3MECA 4YNQA 3OVNA 3L2RA 3THVA 3M7MX 1SKWA 2BTQB 2BDPA 2BANA 3WNGA 3DYAA 3N2GA 5HP1A 5CA0B 4O4JB 2LSNA 4CK1A 4JI5B 3KK2A 5LP6A 1RTDA 4I50A 5IJ0B 1IKVA 4UCVA 4HUGA 2XRIA 4O2BA 4JI1B 3QERA 3L3VA 3SQ4A 4F6RA 1L5UA 3DI6A 4FJXA 3RWRD 5LYJB 1T03A 1WAFA 2E6MA 4UCRA 4RW6A 2A1RA 3G0ZA 3TABA 1RDDA 4RW8A 3O3FA 1I39A 3BA8A 4I9LA 3K57A 2P22C 1CXQA 3C6TA 4FLVA 3ZSWA 3V1QA 4UCOA 3QEVA 5JVDB 3O4QA 4JS5A 3C94A 3WNHA 4J2DA 1WNSA 4CJKA 4EEQA 2PGGA 4EZ6A 4KHQA 1RTJA 3BDPA 3ISNC 5I42A 4DF4A 3B6OA 4DU1A 4DWIA 1LAWA 3TI0A 4DTJA 2BTOA 3MEEA 4N76A 1HW7A 1M93A 4M3WA 1X1PA 2ZM6B 1N32B 4CF1A 1IKYA 5JJEB 1J5OA 4B3RB 4E7JA 3OYCA 2QJ1A 3FFQA 4Z4EA 3C95A 4DR1B 3E22A 4HVJA 4DU4A 3QINA 4ZTJA 4CF8A 3K5MA 3S3OA 2Q7GA 1L3TA 1SA0B 4J2AA 3U11A 4ELTA 3RMAA 2F66C 3G10A 3HT3A 4FLWA 4X66B 4IFVA 4M3XA 3RR8A 1BCMA 2F95B 1J5EB 1N36B 2HEPA 3ZSVA 1BISA 2G8FA 4E7HA 1IG9A 5FNVA 3I8DA 4FFBA 4EB6A 2KQ2A 2YHBA 4FJLA 3NE6A 4FLXA 4M3ZA 3WB2A 4TV9A 2YV0X 4FW1A 5JS2A 3OYKA 4GVMA 3DLBA 4FYDA 3KLIA 3HVTA 3SQ1A 1Z5WA 2HHTA 1NJXA 4KHUA 4DSIA 4DUYB 4FK0A 2RN2A 4LFCB 2F1MA 2FBVA 2HHQA 5K14A 5J2QA 1QSYA 3VQYA 4DFMA 3KD1E 4FJIA 4I4TA 4PI0A 5LXTB 5BR8B 3QEIA 1HPZA 4LNUA 5J1EA 1HMVA 3L2WA 4LSNA 1WSIA 4HCBA 3D0PA 4HNAA 3PX4A 3CQ8A 3RFRA 3SUNA 1KCFA 2RJZA 2F4VB 2Y1JA 1Q9YA 4J2BA 3OTFA 4B9VA 3JAKB 5J2TB 1WSHA 3AVHA 3KLGA 5JQGB 3ZSRA 3JASA 1C1AA 4OPKA 4M3RA 1KLMA 1WSFA 3HSTB 1S9GA 4YFUA 2UXDB 1NKEA 1VSKA 4BDYA 3QESA 1Z25A 3CFOA 1C0MA 3NDKA 4YHHB 3AA5X 3AVGA 3JAWB 2VWJA 3NBPA 3PX0A 4LF7B 3LP1A 3L8BA 5KX5B 3U3GA 3VQ7A 3F9KA 2UUAB 3QG5A 4NXNB