1XILA

Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
190
Chain Sequence
KHSLPDLPDGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHALQKNVRPDLKAIWNVINWENVTERMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 62
structure length 190
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xilA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xilA02
1B06A 1D5NA 4X9QA 1QNMA 4BR6A 4GUNA 4YIPA 3MDSA 1LUVA 1VEWA 1AR4A 3AK2A 1MMMA 3RN4A 1SZXA 1JA8A 2ADPA 1AR5A 3QVNA 1IX9A 4FFKA 5AG2A 2QKCA 1KKCA 1IXBA 3C3TA 2P4KA 1ZUQA 1LUWA 3KKYA 4E4EA 3EVKA 3LSUA 1GN2A 3AK1A 1PM9A 1GN4A 1N0JA 1EN5A 2ADQB 3CEIA 1EM1A 3IC9A 4JYYA 1BSMA 3DC6A 2CDYA 1XILA 1BT8A 3K9SA 1ZTEA 2GDSA 3DC5A 1ZSPA 1EN6A 4C7UA 1XUQA 2AW9A 1IDSA 4YIOA 1GN3A 2CE4A 3TJTA 3AK3A 1ZLZA 1WB8A 2RCVA 4JZ2A 1Y67A 1MA1A 1EN4A 1VARA 1N0NA 1WB7A 3BFRA 1AVMA 1MSDA 4JZGA 1I08A 1BS3A 1P7GA 4F6EA 1MNGA 5A9GA 1GN6A 3OT7A 1JR9A 3C3SA 1AP6A 1XREA 1AP5A 1PL4A 1XDCA 1I0HA 2QKAA
chains in the Genus database with same CATH superfamily
2YXLA 3MAQA 4DRXA 3CHXA 3RYIA 3CXHF 1ZAUA 1QU7A 1NVPB 3JD4A 4GX1A 4FZ1A 3CRMA 3E8FA 1EZJA 3D3QA 4B08A 3A8TA 5GTIZ 2VWKA 4NXNO 3TGUH 3FAVB 3WB2A 2PTMA 1K9MW 3HKDB 1VQNV 1M4UA 2FYUH 4UCRA 1Q6HA 4GYCB 3WB0A 4GKJO 3M99B 5KHJA 1KKCA 2XHBA 4JYAB 5L3BA 2OCHA 3BA8A 3W7XA 1QLEB 2OT5A 1H2KA 2JGDA 4D7SA 1GRJA 3L74H 2EIKB 3W7UA 2VQEB 4AHCA 3A0HZ 5KX5A 4UCOA 4CH4A 1VQLV 2ZXWC 1P7BA 1XILA 2BSKB 4RQEA 1E79G 5IYZA 3H1JH 3IAYA 2GSMB 5J2TA 1KYOF 2E74B 4JI5O 5E1AC 2OYQA 4WFEA 2NNUA 4ZBMA 4AQYB 2DMXA 5JJNB 1I7FA 4X65O 2B1GA 1ENVA 3BHPA 4QNHB 1XL6A 4DR6B 1UPGA 3VQYA 3G67A 3UKMA 5J2UB 5LGUA 5FPRA 4LNUA 3CC4V 1QR9A 5BMVA 4G28B 2QM7A 3CSXA 3ML0A 2DYRC 1VARA 1WB7A 1SESA 2OTLV 2HG5C 1MSDA 4B7KA 3F7VC 3CCSV 1SZTA 1OCOC 3QNEA 3RYFB 2F95B 1ZL8B 1VIBA 3H9VA 2OCCC 2W0FC 1XMQO 4DV7O 1L8DA 4N21A 3U0ZA 3CRCA 2JRIA 1H2GA 3ASOC 2M7WA 2HVKC 3CD6V 1GH6A 5JVDB 2QWNB 3PJSK 1CP9A 1SQPH 5KLVH 3BABA 5DN6G 1VQOV 4PDRA 1AR4A 4UB8Z 4JI6O 1R3KC 3JYCA 5CA1A 3L72H 5JQGB 1IX9A 4TWKA 3CXCU 3SPCA 2GHYA 5AG2A 1TUBB 3P3PA 2GTSA 4JYCA 2PGGA 4EB6B 5IWAO 1JMKC 4MVOA 4WBNA 3FB8C 1US6A 1SQXH 3ABLB 2UXBO 3OEHG 2XAHA 3H1KH 3MD0A 2DN9A 3K5LA 1VQ4V 4JYYA 1BSMA 5JH7B 3HKBA 2XT9A 1HNZO 4NYKA 4MTFA 2WLIB 5LMUB 3SPJA 3FX7A 4DR5B 1YVWA 5LOVA 3A0RA 3CMAV 1JCHA 4DK0A 2O57A 2UU9B 4RUFA 5ITZA 2XUMA 4Z1MG 3SJBC 5BXZA 2WLNA 5IY5C 3H1LH 4LF4O 1L0LH 4JYBA 3W7SA 1N33B 5IJ9B 3FD9A 4X66O 2Y69C 1N36B 5B1AB 3F5WC 4L8JA 4MVZA 4IGGA 2RMKB 2P6JA 4ZHQB 2IM9A 3M7MX 4DV4O 1SETA 2Q68A 4FM0A 5D5PA 3O9OA 5J9PC 1YDXA 2R9AA 2HLDG 1YJ9V 3JCZA 1RP3B 4JTCB 3ETEA 3CPWU 2CK3G 3QO7A 2HVJC 1K5SA 1VQ8V 1XQ8A 3STLC 3E22A 5JWPA 3BVOA 4I50B 1VQ7V 3DXRA 2RQ6A 2KG7A 3N2GA 4O2AB 5B3SB 1LUVA 5LYJB 3AK2A 2QR4A 4OX9B 2Q4PA 2HR3A 5BY1A 4LF8O 1QVGU 2N05A 4K8XA 5BZBA 2DOSA 3K58A 2C2AA 4F6RA 2QA4V 2PYLA 2GUZB 2UXNA 4TSFG 5LP6A 1FXVA 4LF7O 5CA3A 4O4JA 4ICGA 1QCEA 2ADQB 1VF6A 5GTHZ 4D7TA 1CPYA 5LA6A 4PV1B 1W2BU 1KU9A 1BHBA 2LW7A 4X89A 2EJRA 2IJIA 4OPHA 2IH1C 4G27B 3LSQA 1SQGA 2WLLA 2AW9A 3E89A 1IDSA 5CN0A 3TJTA 4I55B 4Z2WA 4DR7B 4HBNA 4DV2O 4X64O 2F4VO 3CP1A 1XNRB 2ZE5A 3CS5A 5EBMC 1Y74B 2PF4E 3CCQV 2HHHB 1H2SB 2UUBB 1N8RW 2A06H 3F7YC 3TXSA 3AG4B 1M5IA 3IC7A 3CCLV 4DR3B 4MW3A 4QPJA 4LF6O 1IURA 3B4SA 4ASUG 4B3MB 4DW0A 3HR0A 4YY3B 4J7JA 2X7RB 3ABMC 4JI8O 2ZCEA 1Q6UA 3DTUB 4J10A 2ZINA 4IHJA 5JCOA 2ZDIA 4DV6O 1WA8B 2VQFB 4ABMA 4UVCA 1IBKB 3TXQA 2HP8A 3CRAA 2Z5UA 2IU3A 2Y4UA 4JI3O 4B3RO 2ATKC 4FFKA 4DUZB 1MG1A 4DV3B 5KA6A 3FKSG 3H01A 5EYPA 1SA0A 5EZYA 2EULA 2JEUA 1WPBA 3LSUA 4YHHB 2BTQB 4FFBB 2ZT9B 3ETGA 2YUAA 1HNXO 1N0JA 1AILA 1Y4MA 4X62B 4FLZA 1Y76B 1XNQO 5B1OA 3OE7G 4R6ZA 5KAFZ 3L9DA 1PKXA 3WG7B 3W7WA 1GAXA 1OCCC 4W4KA 4HNAA 3JCUZ 2R70A 1FXKB 1R3LC 4X88A 2DE0X 2PZSA 5CBHA 2Q7HA 2XAQA 3BY6A 3J7AU 2VRZA 1ZLZA 2UXXA 2LFSA 3GB7C 2AGAA 4DV0B 1AI7A 4JZ2A 3APQA 1HW7A 5LGTA 3B2EE 2A79B 1Q43A 2CGNA 1P84F 2QTSA 3Q4HB 1JJOA 4L87A 2GTAA 1HDJA 3OEEG 4UCVA 3U11A 4WFHA 2Y4TA 3ZHRA 2XAJA 4JI7B 2IU0A 1AP5A 1R3IC 4R50A 1IVSA 1G6UA 3BA9A 1QLEC 2JEXA 2P90A 3RGBA 4JYAO 3THOA 3OW2U 3LSSA 5L3DA 4ZOLA 2BTOA 4IYIA 1W0KG 4JPRA 4E2LA 2UUAB 2UUCO 4X1YB 4TV9A 2BCCH 5EIBC 3L71H 2VQEO 4LFAO 2ODMA 3KCYA 4KUMA 3ZHUA 2RNBA 4KFMA 4LFBB 3ABUA 1R6NA 3ASNB 3T1HB 3UT5B 1SS3A 1S3JA 4P30A 4JGSA 2F43G 4LWSB 1L0NH 4FLWA 4MVQA 4O2BB 1IZ3A 3A0BZ 1R73A 2ZNJA 2DWDC 1NH2D 1JNBA 1AJPA 1Z2GA 3VBBA 1KMIZ 2F66C 4X1IA 5GONA 3QF7A 3ZBHA 2DJVA 1S76D 4FLVA 4J9YB 3JSLA 2BOCC 5B1BB 1AR1B 4YJ3A 5LHGA 4H33A 1NVPD 1BL8A 3FB6C 4KXRA 2CTPA 4CZZA 3G6EV 1GMGA 3E83A 1NR1A 2YC0A 4CH6A 1DF4A 4PI2A 1H2MA 1K73W 2DQ0A 5K1XA 3GWOA 4HAMA 3SYAA 4UCSA 1UJWB 2WLHA 2YICA 2D3OW 1M90W 1H8HG 3C3SA 3J81N 3APOA 5KX5B 5EIBD 3JD3A 3T4ZA 3HKCA 3DSQA 4ZI7A 1XMOB 1YI2V 4PA4A 5IYZB 3EHBB 2ZE8A 2FTKA 3ABLC 1F4MA 2V7QG 5J2TB 2F1MA 3OFNG 1ORQC 5CA0B 3EFFK 4U3JA 2XTAA 2K1EA 3MDSA 4FIPC 5KMGA 4LNUB 2EIMB 1BQZA 3U10A 5LMUO 1QQCA 1HP8A 3SJQC 3SPIA 4LP8A 4DR5O 4XBFA 1MABG 5EC1C 2Q73A 5EC2C 2EINB 1NTZH 4E4EA 3KZIZ 1THZA 1BZKA 2OWOA 5B1AC 2F93B 3OR7C 4PHZA 5JJJB 4I0XA 3K5NA 4KHPB 4B3SO 3AG7A 5FNVA 1GM9A 1XBLA 1F23A 1SKVA 4C7UA 1HR0B 5KHHA 4UUJC 1OCZC 4LFCB 4YIOA 4JV5O 2YIBD 4LH6A 3CCEV 3HPLC 4O4IA 1DF5A 5CA1B 5C8YA 4PDVA 2LO1A 3OTFA 3ETDA 4K0KB 4DV1B 5FLXN 1G1XB 1PNKA 2E3CA 5B3SC 5LMNO 1Q5OA 4IYHA 4DUYB 4JZGA 4F4LA 1JFFB 4LBEC 5LBQA 3RYCB 3A2FA 1MZFA 4OX9O 1PL0A 1FKAO 3RYHA 3T1YO 4WF9V 1VQ9V 4DV5O 2QKAA 4YJ2A 3RFRA 3ABKB 5BR8B 4O4LA 4LF9B 3OMAB 3VOUA 3ICXA 1H38A 1K3EA 2M6YA 2GBOA 3JSNA 1FS0G 5LOVB 5EK0A 3TK1A 4GUNA 4LF5O 3SPHA 3N2KA 2E5LO 1M56B 3RBZA 4H13B 3SYQA 1KBHA 1MOFA 4PJ0Z 4DO2A 1B04A 4JI0B 2Q7EA 3OR6C 4IIJB 1Q7YW 1QR8A 4NXMB 2YI9A 1EZVH 3OTOO 1S72V 3STZC 1V54B 3ZMUA 4FLTA 4NTXA 5LXTB 2ITCC 1DGSA 1NU1H 4RWUA 3HKDA 3JD0A 4RAIA 4WFBV 3VQWA 1BT8A 4DR2B 1KUQA 4MVSA 2XNDG 1S77D 2P22C 4DR3O 4TT3G 1WP8A 4DR4B 1J5EO 1MZEA 2NR5A 1HNWO 3DXRB 1NTKH 3FB5C 2ETNA 2KG7B 2QM8A 3N2GB 1WNSA 2F23A 1AI6A 2JVDA 3OUFA 4NB5A 3JAMN 4DR1O 3CB2A 1XOUA 1SF9A 4XDKA 3ZHSA 4F6RB 1N0NA 3SYCA 2ZQMA 1AJQA 3E86A 2GV9A 5DEDA 4LH7A 3CWBH 3HKEA 4PDMA 4TQDA 2X6BA 1QLNA 4O4JB 4CBCA 1SQVH 5J2UA 1WP7A 1YEWA 5LA6B 4DUZO 2D2CB 1IBMB 4BIUA 2QKSA 4QE9A 3FYEB 4JAVA 2IJHA 2KKWA 3CCUV 4YHHO 3K04A 1B06A 3X2QB 2Y0IA 3P30A 2QEXV 4FMTA 5CB4B 2ZE6A 1NS1A 1UFIA 4X62O 3G6BA 5KA5A 1YTFB 3ABTA 4MS2A 1R6KA 4QE7A 2IW5A 3WG7C 1FOUA 1IBLO 1FJGO 1FXKC 4NXNB 3AG2B 3I56V 4MVUA 4B3TO 1FFTB 2QKCA 2XOKG 3B8MA 3C3TA 2QWRB 1R1BA 2B9ZA 1WJZA 4D6TH 3WB1A 2WLMA 4PA6A 4U7OA 2G38A 4EFBA 4DV0O 1O9HA 2QWPB 2YIBA 3ZRWB 1XHXA 3CEIA 1KC8W 3IC9A 2CTWA 5JQGA 5LHHA 1OCRB 2VWJA 4H37A 4CH5A 1TUBA 3I55V 2YEVA 3FFQA 4IHJB 2QWOB 2ZR2A 2ZD9A 4UB6Z 3S3WA 4EB6A 4JI5B 1XUQA 4BAYA 1JPXA 4R7CA 4BWAA 4K3AA 4I4TA 4X65B 3AK3A 1J95A 1TVKB 1M57B 1P49A 2RCVA 2DW4A 1IXMA 2LFRA 1LNQA 4G2KA 2WA4A 1K7DA 1VQMV 2WLIA 2RJZA 3D36C 3OMNB 3B8NA 5EYPB 1SA0B 1ZWIC 2ZIMA 3UCSC 3ASNC 3CX5F 4Q6GA 3ZX6A 1D5AA 3W7TA 2ZKOA 4K35A 2YI8A 3T1HO 3GVMA 4PDLA 4UV9A 1I0HA 4DV7B 4A5UB 2P67A 2EILB 5FPOA 4ZKIA 1PV0A 3JATA 3ASOB 3QO8A 1VQKV 3JD1A 1QNMA 1BMFG 1PPJH 3CRQA 3E8BA 3PN1A 1VEWA 4QGPA 4X1KA 1Q3EA 4JI6B 1AR5A 5B1BC 4KL1A 3D3IA 1AI5A 1VF5B 1FFXA 4CS2A 4JI1O 3CCMV 4I7ZB 2P4KA 3LDEA 3J80N 1BHAA 3ZEDA 2OIEA 2IJJA 4O2AA 4FM1A 1I94B 4J41A 1W0JG 3JALB 5EBLC 2MK3A 1V9PA 2UXBB 2E75B 2IBZH 5HFMA 3ZHQA 3DC6A 3K9AA 2AXTZ 3JARB 4R8CA 5KUMA 4DK1A 2AZ2A 1HNZB 1GO3F 2GUZA 4ZOLB 4FM2A 2RN9A 4GKKO 4TV9B 4FPPA 1K92A 1N34B 2UXDO 3ZMZA 3JAWA 1FD9A 2CE4A 1FXHA 1WB8A 5CBFA 1OV9A 4MVRA 1Y67A 2EBOA 3UQ8A 1KP2A 3OUSA 1NKDA 4WCEV 2FMLA 4LF4B 4AILC 1SC5B 4TUYA 4X66B 2V1DA 5H6RA 1SQQH 2EIMC 1WLEA 1Q82W 1EBOA 3K03A 5IJ0A 3RW0A 1HWYA 4YXWG 4DV4B 1AB3A 4J42A 1JOYA 3VQXA 1KECA 2LGQA 1COWG 2NN4A 1GKFA 1N4CA 1S5HC 3H1HH 2EINC 2FB5A 2HFEC 4HYOA 5JJEB 5GONB 5IYBO 3CCVV 1XEQA 4YJ3B 2WPDG 1TGOA 1H2LA 2PYJA 4CS4A 3IJ4A 4UVBA 2EZOA 5H9CA 3R65A 2P7TC 3AG3B 2WSSG 5KAIZ 3B09A 5IDJA 3CJHA 1YIJV 1VQ6V 3QTCA 4OGQB 1RSOA 2P06A 4P9OA 1F51A 2XAFA 2EIKC 1WA8A 1GTOA 3EVKA 2YS8A 4NKGB 2DWEC 4LF7B 3ZJZA 3UO3A 4K0KO 3HKCB 4DV1O 4X20A 4IT5A 3AG1B 1VQPV 2P5OA 5IT9N 3DC5A 3CCRV 4AQYO 3KDRA 3OAAG 4DR6O 4FFBA 1PNMA 2KQXA 1CEZA 4U3JB 3R66A 5KHGA 2Q8VA 3ABKC 1D2DA 1PD3A 4XDLA 1E1RG 4X64B 3CC2V 2JJ1G 2F4VB 4NR1A 4I9WA 3VQVA 3E8GA 4GX0A 3NR7A 1OZ0A 4PA9A 3JAKA 3BRCA 1LR1A 1M56C 4DRXB 1NT2B 3RYIB 4CS3A 3RT3C 1FXKA 5E79Z 5A9GA 2XAGA 1V55B 1M9NA 3OT7A 1DLBA 2YXYA 1JR9A 3IGAC 4LF6B 3N27A 3RVZA 2Z3YA 3JASA 1GM8A 4NXMO 2KSDA 2RDCA 3MHHC 4I0XB 4O4HA 2A7WA 1NBMG 1V54C 4JI8B 1TUEB 4UV8A 3QG5A 3RWRD 1Y66A 3P3NA 4BR6A 2JGDB 4MT8A 4DV6B 1AJNA 3FB7C 3FYIB 5CMUA 4GZRB 4O4IB 4PA7A 2Y48A 2ADPA 4U3FH 5CBGA 4PI0A 4W4LA 3K0GA 4B3RB 1QBZA 4X1YA 3O65A 1ZUQA 3ZMTA 2PI4A 3KKYA 2AHYA 1I5XA 3D36A 5EBWC 1EN5A 4I5SA 2K9PA 5K1PA 1BQ0A 1JVMA 1HNXB 2ZE7A 3CYOA 3ZHVA 1WPXA 3E8HA 5BMVB 2CDYA 3UT5A 4YJ2B 3T2MA 3L75H 4O4LB 4KP4A 2GDSA 2Y0PA 4X8AA 1S5LZ 5IE9A 3I5DA 4EFEA 1VF6C 1O9GA 1TAEA 4GCZA 3SJCC 3ZN1A 2UU9O 4LWSA 2UXCB 3N2KB 4TV8A 4JF3A 4MSWC 2DYSB 4J7ZA 1NH2B 3X2QC 1N33O 2QWQB 4OPAA 1X4TA 1N36O 2CH7A 5L3FA 1VF7A 2A9HA 1EN4A 4N23A 3LDDA 4MW8A 1I5YA 1YXBA 3RVYA 2YIAA 1RPRA 1K33A 3ZN0A 5KUKA 3AG2C 1BE3H 1XI1A 4GX2A 5GW7A 1PL4A 1XDCA 3QO5A 4MTGA 4UCTA 2WWWA 1Q81W 4RQFA 4JI4B 3K79A 3BPZA 2W6JG 3ZIAG 2EIJB 2EX3A 1BGYH 1S5JA 1FAFA 4BW5A 2UUCB 1OCRC 4WBNB 1NZ6A 4J80A 4HZ3A 1MMMA 2ZR3A 4LFAB 3RN4A 2XASA 1SZXA 4EEQA 2QJ1A 5JCOC 2ZDIC 3HKBB 2X6CA 3SYPA 2QSAA 2JS5A 3ZHTA 2Q69A 3WU2Z 1M57C 2V4DA 1YCIA 3ZMSA 1P4RA 1VP7A 5CA0A 3HKEB 3AK1A 4JI2B 5C93A 4FZ0A 1GN4A 1OHHG 5ITZB 2N04A 3UO2A 1N32B 2KB1A 5LGNA 3G71V 1ZSPA 2OTJV 1EN6A 4J11A 3NXSA 5TISZ 2IJKA 1KD1W 4DR7O 1XNRO 1YTFD 2VS0A 2EILC 2JIZG 3FAVA 4GX5A 1NJIW 4LCUC 5H5NA 3AG4C 2LW1A 2HHHO 2UUBO 1SQFA 2ZM6B 2X0LA 4NVPA 4JAUA 1I08A 3E22B 2YXHA 1RM1B 1G8MA 2N74A 2WLJA 4B3MO 4H0LB 2L6LA 1AROP 3WFVA 1FPOA 4YY3O 3ZRXA 1Q90D 1NTMH 4JTDB 3K0DA 1Q8IA 2BSKA 2Q0OC 2B1IA 2YEVB 1PNLA 5B1NA 2VQFO 1JFFA 1IBKO 5L3GA 4MTOA 1I94O 3RYCA 5LP6B 4NTWA 2JJ2G 4I4TB 3E2EA 3IFXA 1YZBA 3SR2C 1JA8A 3C90A 1T5EA 3SYOA 3LNMB 1K8AW 4DV3O 4JAAA 1RFYA 1N34O 1IXBA 1Q86W 4XDJA 1GN2A 2Q7GA 2PUSA 2WLLB 5IYCO 1B3QA 1URFA 2ITDC 3LDCA 3RYFA 2PY5A 1ZL8A 3L70H 2AZ0A 5H6QA 5DECA 2CTQA 3K06A 4FLYA 1SRYA 5KHKA 4IIJA 3ZS8C 4QJFB 3T4DA 1CXZB 5JVDA 4B3SB 4GKJB 3JATB 2CGOA 2L35A 4RUEA 2FKXA 1YHQV 2Q6AA 4X1KB 3ZRVA 5LXTA 2Q0AA 2JK5C 4JV5B 1OCZB 2LJ2A 5KHIA 2ZNIA 2FL4A 1MA1A 3SDLA 4GT1A 1FFXB 1K5QA 1K34A 1GK9A 1H2NA 5L3EA 2LQTA 5LMNB 2ZXWB 1P7GA 3AG3C 2HJDA 1H5WA 4EKWA 1YITV 1MNGA 4JI7O 3OMIB 1R3JC 5DM6V 3K59A 5F2VO 1MSWD 5B5EZ 3K08A 5JH7A 3T1YB 1SQBH 4TQFA 2ZIOA 4DV5B 2UUAO 2MW2B 4MTXA 4RO2A 1KP3A 3B77A 5EZYB 4NTYA 5A2QN 3CCJV 2DYRB 3JAWB 4LFBO 4YIPA 2QTOA 3AG1C 3KG2A 2JS3A 4JASA 3DGEA 4LC1A 5LL6Y 4LF5B 2E5LB 5L3CA 2NLJC 1OCOB 4UCUA 1XMQB 1ROPA 5IJ9A 4J7KA 2OCCB 2Q67A 4TUYB 5LHIA 3ZRSA 1YF2A 4ZHQA 4Q20A 4HNAB 5CB4A 5IJ0B 3OTOB 3B40A 3OGCC 2A0LA 2CUGA 2YDEA 4U7NA 2JDIG 3ZMVA 1SERA 2QE7G 3EXAA 2HJFC 1V55C 1ZTEA 2WA3A 3K5OA 1G4YB 2W0XA 3OM3B 5H2FZ 1DK1A 3K5MA 4I50A 1J5EB 2JGUA 4CH3A 1HNWB 1YJWV 3ZRWA 5LYJA 5IWAB 2DQ3A 3P32A 1JJ2U 1NQTA 4OXSA 2R9IA 2X6AA 3CJHB 1WN7A 2YSUB 4DR1B 1M93A 3SJAC 1VQ5V 1RSOB 1XL4A 3BCCH 3CC7V 5IYDO 4MVMA 3BFRA 1U97A 2R9RB 1Z5WA 4FLUA 4DXWA 1TVKA 1YJNV 1XMOO 1DTOA 3S3XA 2ARHA 4X20B 4FK5C 3CMEV 2Q9LA 3CE2A 4J9ZB 2QM4A 3SPGA 3LNNA 1FYJA 1S0VA 5IY5B 2LP7A 1GM7A 1A32A 1D5NA 5D5QA 3G4SV 2Y69B 4CC6A 3MHSC 4I55A 1Q6IA 3SGIA 3CRRA 4PA3A 3E35A 3K57A 1KB9F 3GWKC 3QVNA 2Q5ZA 2CTRA 1VMGA 1Y74A 4X1IB 2WAMA 1X59A 1IBLB 1FJGB 1R6TA 3JAKB 3M8AA 4B3TB 2DYSC 2E76B 2UXCO 4B7EA 4BIOA 4FVMA 3L73H 2IH3C 2P4VA 3TCUA 1K4DC 1F4NA 3JD2A 2HEPA 1EM1A 3JASB 1QHTA 1KQSU 2H94A 4KHPO 3K3WA 3LUTB 4O4HB 1H8EG 3K9SA 4LF8B 2EJ7A 4H44B 1HR0O 2W6IG 2CAZC 2WLKA 1Y6XA 1AI4A 4LFCO 3D8CA 3ZCCA 1NR7A 1GN3A 2ILMA 3T1CA 4JTAB 3JALA 4GLXA 4FLXA 1BCCH 2EIJC 3AEIA 4JI4O 4WFAV 3JARA 4ZI7B 3ETQA 3TETA 4DUYO 4AI8A 2BTQA 1M1KW 1GN6A 4PD4F 1AP6A 5KMGB 3F5TA 4ZIBA 1JX9A 1Y76A 4DV2B 5BR8O 1OJHA 4LF9O 2OIGA 2BOBC 4DYLA 4JI2O 4UVAA 4X9QA 2EZPA 3H1IH 4P9PA 4TV8B 4WFGA 4TOIA 1N32O 1B6QA 1JQ0A 1RPOA 3OD4A 4JI0O 4QIWF 4DW1A 2CH7B 3Q4HA 1Z5VA 5FNVB 3OGIB 1W59A 1IJGA 4JI1B 1LUWA 1ZX3A 3BEHA 4K8ZA 3ABMB 3KCXA 1PM9A 4LR3A 2QGNA 2R72A 2H3OA 1E1QG 1K4CC 2ZM6O 2Z0AA 5C8YB 4DR2O 1TA8A 1RM1C 4JI3B 5B66Z 4I9QA 1F7YA 3G80A 4DR4O 5FL7G 1XHZA 1QVFU 4FJCC 4BW9A 2B5UA 1WAZA 4PELA 4GKKB 4CC5A 2UXDB 1K97A 3RYHB 5HFLA 4QPKA 4BIZA 4UXNA 2A3QA 2LGWA 2BE3A 5LP6C 4IL6Z 2YIDA 1XNQB 4WFFA 1AVMA 1BS3A 1YSCA 1NI8A 1EFRG 4F6EA 1U96A 1L1FA 3UM7A 2PI5A 1PP9H 2H8PC 2QDOA 3HB3B 2HKOA 3BAAA 4O2BA 1OCCB 1KKDA 4Z1VA 1XREA 1IBMO 4P2ZA 2AHZA 4UFZA
chains in the Genus database with same CATH topology
1B06A 1D5NA 4X9QA 1QNMA 4BR6A 4GUNA 4YIPA 3MDSA 1LUVA 1VEWA 1AR4A 3AK2A 1MMMA 3RN4A 1SZXA 1JA8A 2ADPA 1AR5A 3QVNA 1IX9A 4FFKA 5AG2A 2QKCA 1KKCA 1IXBA 3C3TA 2P4KA 1ZUQA 1LUWA 3KKYA 4E4EA 3EVKA 3LSUA 1GN2A 3AK1A 1PM9A 1GN4A 1N0JA 1EN5A 2ADQB 3CEIA 1EM1A 3IC9A 4JYYA 1BSMA 3DC6A 2CDYA 1XILA 1BT8A 3K9SA 1ZTEA 2GDSA 3DC5A 1ZSPA 3KDRA 1EN6A 4C7UA 1XUQA 2AW9A 1IDSA 4YIOA 1GN3A 2CE4A 3TJTA 3AK3A 1ZLZA 1WB8A 2RCVA 4JZ2A 1Y67A 1MA1A 1EN4A 1VARA 1N0NA 1WB7A 3BFRA 1AVMA 1MSDA 4JZGA 1I08A 1BS3A 1P7GA 4F6EA 1MNGA 5A9GA 1GN6A 3OT7A 1JR9A 3C3SA 1AP6A 1XREA 1AP5A 1PL4A 1XDCA 1I0HA 2QKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B06 A;  1D5N A;  4X9Q A;  1QNM A;  4BR6 A;  4GUN A;  4YIP A;  3MDS A;  1LUV A;  1VEW A;  1AR4 A;  3AK2 A;  1MMM A;  3RN4 A;  1SZX A;  1JA8 A;  2ADP A;  1AR5 A;  3QVN A;  1IX9 A;  4FFK A;  5AG2 A;  2QKC A;  1KKC A;  1IXB A;  3C3T A;  2P4K A;  1ZUQ A;  1LUW A;  3KKY A;  4E4E A;  3EVK A;  3LSU A;  1GN2 A;  3AK1 A;  1PM9 A;  1GN4 A;  1N0J A;  1EN5 A;  2ADQ B;  3CEI A;  1EM1 A;  3IC9 A;  4JYY A;  1BSM A;  3DC6 A;  2CDY A;  1XIL A;  1BT8 A;  3K9S A;  1ZTE A;  2GDS A;  3DC5 A;  1ZSP A;  1EN6 A;  4C7U A;  1XUQ A;  2AW9 A;  1IDS A;  4YIO A;  1GN3 A;  2CE4 A;  3TJT A;  3AK3 A;  1ZLZ A;  1WB8 A;  2RCV A;  4JZ2 A;  1Y67 A;  1MA1 A;  1EN4 A;  1VAR A;  1N0N A;  1WB7 A;  3BFR A;  1AVM A;  1MSD A;  4JZG A;  1I08 A;  1BS3 A;  1P7G A;  4F6E A;  1MNG A;  5A9G A;  1GN6 A;  3OT7 A;  1JR9 A;  3C3S A;  1AP6 A;  1XRE A;  1AP5 A;  1PL4 A;  1XDC A;  1I0H A;  2QKA A; 
#chains in the Genus database with same CATH topology
 2YXL A;  3MAQ A;  4DRX A;  3CHX A;  3RYI A;  3CXH F;  1ZAU A;  1QU7 A;  1NVP B;  3JD4 A;  4GX1 A;  4FZ1 A;  3CRM A;  3E8F A;  1EZJ A;  3D3Q A;  4B08 A;  3A8T A;  5GTI Z;  2VWK A;  4NXN O;  3TGU H;  3FAV B;  3WB2 A;  2PTM A;  1K9M W;  3HKD B;  1VQN V;  1M4U A;  2FYU H;  4UCR A;  1Q6H A;  4GYC B;  3WB0 A;  4GKJ O;  3M99 B;  5KHJ A;  1KKC A;  2XHB A;  4JYA B;  5L3B A;  2OCH A;  3BA8 A;  3W7X A;  1QLE B;  2OT5 A;  1H2K A;  2JGD A;  4D7S A;  1GRJ A;  3L74 H;  2EIK B;  3W7U A;  2VQE B;  4AHC A;  3A0H Z;  5KX5 A;  4UCO A;  4CH4 A;  1VQL V;  2ZXW C;  1P7B A;  1XIL A;  2BSK B;  4RQE A;  1E79 G;  5IYZ A;  3H1J H;  3IAY A;  2GSM B;  5J2T A;  1KYO F;  2E74 B;  4JI5 O;  5E1A C;  2OYQ A;  4WFE A;  2NNU A;  4ZBM A;  4AQY B;  2DMX A;  5JJN B;  1I7F A;  4X65 O;  2B1G A;  1ENV A;  3BHP A;  4QNH B;  1XL6 A;  4DR6 B;  1UPG A;  3VQY A;  3G67 A;  3UKM A;  5J2U B;  5LGU A;  5FPR A;  4LNU A;  3CC4 V;  1QR9 A;  5BMV A;  4G28 B;  2QM7 A;  3CSX A;  3ML0 A;  2DYR C;  1VAR A;  1WB7 A;  1SES A;  2OTL V;  2HG5 C;  1MSD A;  4B7K A;  3F7V C;  3CCS V;  1SZT A;  1OCO C;  3QNE A;  3RYF B;  2F95 B;  1ZL8 B;  1VIB A;  3H9V A;  2OCC C;  2W0F C;  1XMQ O;  4DV7 O;  1L8D A;  4N21 A;  3U0Z A;  3CRC A;  2JRI A;  1H2G A;  3ASO C;  2M7W A;  2HVK C;  3CD6 V;  1GH6 A;  5JVD B;  2QWN B;  3PJS K;  1CP9 A;  1SQP H;  5KLV H;  3BAB A;  5DN6 G;  1VQO V;  4PDR A;  1AR4 A;  4UB8 Z;  4JI6 O;  1R3K C;  3JYC A;  5CA1 A;  3L72 H;  5JQG B;  1IX9 A;  4TWK A;  3CXC U;  3SPC A;  2GHY A;  5AG2 A;  1TUB B;  3P3P A;  2GTS A;  4JYC A;  2PGG A;  4EB6 B;  5IWA O;  1JMK C;  4MVO A;  4WBN A;  3FB8 C;  1US6 A;  1SQX H;  3ABL B;  2UXB O;  3OEH G;  2XAH A;  3H1K H;  3MD0 A;  2DN9 A;  3K5L A;  1VQ4 V;  4JYY A;  1BSM A;  5JH7 B;  3HKB A;  2XT9 A;  1HNZ O;  4NYK A;  4MTF A;  2WLI B;  5LMU B;  3SPJ A;  3FX7 A;  4DR5 B;  1YVW A;  5LOV A;  3A0R A;  3CMA V;  1JCH A;  4DK0 A;  2O57 A;  2UU9 B;  4RUF A;  5ITZ A;  2XUM A;  4Z1M G;  3SJB C;  5BXZ A;  2WLN A;  5IY5 C;  3H1L H;  4LF4 O;  1L0L H;  4JYB A;  3W7S A;  1N33 B;  5IJ9 B;  3FD9 A;  4X66 O;  2Y69 C;  1N36 B;  5B1A B;  3F5W C;  4L8J A;  4MVZ A;  4IGG A;  2RMK B;  2P6J A;  4ZHQ B;  2IM9 A;  3M7M X;  4DV4 O;  1SET A;  2Q68 A;  4FM0 A;  5D5P A;  3O9O A;  5J9P C;  1YDX A;  2R9A A;  2HLD G;  1YJ9 V;  3JCZ A;  1RP3 B;  4JTC B;  3ETE A;  3CPW U;  2CK3 G;  3QO7 A;  2HVJ C;  1K5S A;  1VQ8 V;  1XQ8 A;  3STL C;  3E22 A;  5JWP A;  3BVO A;  4I50 B;  1VQ7 V;  3DXR A;  2RQ6 A;  2KG7 A;  3N2G A;  4O2A B;  5B3S B;  1LUV A;  5LYJ B;  3AK2 A;  2QR4 A;  4OX9 B;  2Q4P A;  2HR3 A;  5BY1 A;  4LF8 O;  1QVG U;  2N05 A;  4K8X A;  5BZB A;  2DOS A;  3K58 A;  2C2A A;  4F6R A;  2QA4 V;  2PYL A;  2GUZ B;  2UXN A;  4TSF G;  5LP6 A;  1FXV A;  4LF7 O;  5CA3 A;  4O4J A;  4ICG A;  1QCE A;  2ADQ B;  1VF6 A;  5GTH Z;  4D7T A;  1CPY A;  5LA6 A;  4PV1 B;  1W2B U;  1KU9 A;  1BHB A;  2LW7 A;  4X89 A;  2EJR A;  2IJI A;  4OPH A;  2IH1 C;  4G27 B;  3LSQ A;  1SQG A;  2WLL A;  2AW9 A;  3E89 A;  1IDS A;  5CN0 A;  3TJT A;  4I55 B;  4Z2W A;  4DR7 B;  4HBN A;  4DV2 O;  4X64 O;  2F4V O;  3CP1 A;  1XNR B;  2ZE5 A;  3CS5 A;  5EBM C;  1Y74 B;  2PF4 E;  3CCQ V;  2HHH B;  1H2S B;  2UUB B;  1N8R W;  2A06 H;  3F7Y C;  3TXS A;  3AG4 B;  1M5I A;  3IC7 A;  3CCL V;  4DR3 B;  4MW3 A;  4QPJ A;  4LF6 O;  1IUR A;  3B4S A;  4ASU G;  4B3M B;  4DW0 A;  3HR0 A;  4YY3 B;  4J7J A;  2X7R B;  3ABM C;  4JI8 O;  2ZCE A;  1Q6U A;  3DTU B;  4J10 A;  2ZIN A;  4IHJ A;  5JCO A;  2ZDI A;  4DV6 O;  1WA8 B;  2VQF B;  4ABM A;  4UVC A;  1IBK B;  3TXQ A;  2HP8 A;  3CRA A;  2Z5U A;  2IU3 A;  2Y4U A;  4JI3 O;  4B3R O;  2ATK C;  4FFK A;  4DUZ B;  1MG1 A;  4DV3 B;  5KA6 A;  3FKS G;  3H01 A;  5EYP A;  1SA0 A;  5EZY A;  2EUL A;  2JEU A;  1WPB A;  3LSU A;  4YHH B;  2BTQ B;  4FFB B;  2ZT9 B;  3ETG A;  2YUA A;  1HNX O;  1N0J A;  1AIL A;  1Y4M A;  4X62 B;  4FLZ A;  1Y76 B;  1XNQ O;  5B1O A;  3OE7 G;  4R6Z A;  5KAF Z;  3L9D A;  1PKX A;  3WG7 B;  3W7W A;  1GAX A;  1OCC C;  4W4K A;  4HNA A;  3JCU Z;  2R70 A;  1FXK B;  1R3L C;  4X88 A;  2DE0 X;  2PZS A;  5CBH A;  2Q7H A;  2XAQ A;  3BY6 A;  3J7A U;  2VRZ A;  1ZLZ A;  2UXX A;  2LFS A;  3GB7 C;  2AGA A;  4DV0 B;  1AI7 A;  4JZ2 A;  3APQ A;  1HW7 A;  5LGT A;  3B2E E;  2A79 B;  1Q43 A;  2CGN A;  1P84 F;  2QTS A;  3Q4H B;  1JJO A;  4L87 A;  2GTA A;  1HDJ A;  3OEE G;  4UCV A;  3U11 A;  4WFH A;  2Y4T A;  3ZHR A;  2XAJ A;  4JI7 B;  2IU0 A;  1AP5 A;  1R3I C;  4R50 A;  1IVS A;  1G6U A;  3BA9 A;  1QLE C;  2JEX A;  2P90 A;  3RGB A;  4JYA O;  3THO A;  3OW2 U;  3LSS A;  5L3D A;  4ZOL A;  2BTO A;  4IYI A;  1W0K G;  4JPR A;  4E2L A;  2UUA B;  2UUC O;  4X1Y B;  4TV9 A;  2BCC H;  5EIB C;  3L71 H;  2VQE O;  4LFA O;  2ODM A;  3KCY A;  4KUM A;  3ZHU A;  2RNB A;  4KFM A;  4LFB B;  3ABU A;  1R6N A;  3ASN B;  3T1H B;  3UT5 B;  1SS3 A;  1S3J A;  4P30 A;  4JGS A;  2F43 G;  4LWS B;  1L0N H;  4FLW A;  4MVQ A;  4O2B B;  1IZ3 A;  3A0B Z;  1R73 A;  2ZNJ A;  2DWD C;  1NH2 D;  1JNB A;  1AJP A;  1Z2G A;  3VBB A;  1KMI Z;  2F66 C;  4X1I A;  5GON A;  3QF7 A;  3ZBH A;  2DJV A;  1S76 D;  4FLV A;  4J9Y B;  3JSL A;  2BOC C;  5B1B B;  1AR1 B;  4YJ3 A;  5LHG A;  4H33 A;  1NVP D;  1BL8 A;  3FB6 C;  4KXR A;  2CTP A;  4CZZ A;  3G6E V;  1GMG A;  3E83 A;  1NR1 A;  2YC0 A;  4CH6 A;  1DF4 A;  4PI2 A;  1H2M A;  1K73 W;  2DQ0 A;  5K1X A;  3GWO A;  4HAM A;  3SYA A;  4UCS A;  1UJW B;  2WLH A;  2YIC A;  2D3O W;  1M90 W;  1H8H G;  3C3S A;  3J81 N;  3APO A;  5KX5 B;  5EIB D;  3JD3 A;  3T4Z A;  3HKC A;  3DSQ A;  4ZI7 A;  1XMO B;  1YI2 V;  4PA4 A;  5IYZ B;  3EHB B;  2ZE8 A;  2FTK A;  3ABL C;  1F4M A;  2V7Q G;  5J2T B;  2F1M A;  3OFN G;  1ORQ C;  5CA0 B;  3EFF K;  4U3J A;  2XTA A;  2K1E A;  3MDS A;  4FIP C;  5KMG A;  4LNU B;  2EIM B;  1BQZ A;  3U10 A;  5LMU O;  1QQC A;  1HP8 A;  3SJQ C;  3SPI A;  4LP8 A;  4DR5 O;  4XBF A;  1MAB G;  5EC1 C;  2Q73 A;  5EC2 C;  2EIN B;  1NTZ H;  4E4E A;  3KZI Z;  1THZ A;  1BZK A;  2OWO A;  5B1A C;  2F93 B;  3OR7 C;  4PHZ A;  5JJJ B;  4I0X A;  3K5N A;  4KHP B;  4B3S O;  3AG7 A;  5FNV A;  1GM9 A;  1XBL A;  1F23 A;  1SKV A;  4C7U A;  1HR0 B;  5KHH A;  4UUJ C;  1OCZ C;  4LFC B;  4YIO A;  4JV5 O;  2YIB D;  4LH6 A;  3CCE V;  3HPL C;  4O4I A;  1DF5 A;  5CA1 B;  5C8Y A;  4PDV A;  2LO1 A;  3OTF A;  3ETD A;  4K0K B;  4DV1 B;  5FLX N;  1G1X B;  1PNK A;  2E3C A;  5B3S C;  5LMN O;  1Q5O A;  4IYH A;  4DUY B;  4JZG A;  4F4L A;  1JFF B;  4LBE C;  5LBQ A;  3RYC B;  3A2F A;  1MZF A;  4OX9 O;  1PL0 A;  1FKA O;  3RYH A;  3T1Y O;  4WF9 V;  1VQ9 V;  4DV5 O;  2QKA A;  4YJ2 A;  3RFR A;  3ABK B;  5BR8 B;  4O4L A;  4LF9 B;  3OMA B;  3VOU A;  3ICX A;  1H38 A;  1K3E A;  2M6Y A;  2GBO A;  3JSN A;  1FS0 G;  5LOV B;  5EK0 A;  3TK1 A;  4GUN A;  4LF5 O;  3SPH A;  3N2K A;  2E5L O;  1M56 B;  3RBZ A;  4H13 B;  3SYQ A;  1KBH A;  1MOF A;  4PJ0 Z;  4DO2 A;  1B04 A;  4JI0 B;  2Q7E A;  3OR6 C;  4IIJ B;  1Q7Y W;  1QR8 A;  4NXM B;  2YI9 A;  1EZV H;  3OTO O;  1S72 V;  3STZ C;  1V54 B;  3ZMU A;  4FLT A;  4NTX A;  5LXT B;  2ITC C;  1DGS A;  1NU1 H;  4RWU A;  3HKD A;  3JD0 A;  4RAI A;  4WFB V;  3VQW A;  1BT8 A;  4DR2 B;  1KUQ A;  4MVS A;  2XND G;  1S77 D;  2P22 C;  4DR3 O;  4TT3 G;  1WP8 A;  4DR4 B;  1J5E O;  1MZE A;  2NR5 A;  1HNW O;  3DXR B;  1NTK H;  3FB5 C;  2ETN A;  2KG7 B;  2QM8 A;  3N2G B;  1WNS A;  2F23 A;  1AI6 A;  2JVD A;  3OUF A;  4NB5 A;  3JAM N;  4DR1 O;  3CB2 A;  1XOU A;  1SF9 A;  4XDK A;  3ZHS A;  4F6R B;  1N0N A;  3SYC A;  2ZQM A;  1AJQ A;  3E86 A;  2GV9 A;  5DED A;  4LH7 A;  3CWB H;  3HKE A;  4PDM A;  4TQD A;  2X6B A;  1QLN A;  4O4J B;  4CBC A;  1SQV H;  5J2U A;  1WP7 A;  1YEW A;  5LA6 B;  4DUZ O;  2D2C B;  1IBM B;  4BIU A;  2QKS A;  4QE9 A;  3FYE B;  4JAV A;  2IJH A;  2KKW A;  3CCU V;  4YHH O;  3K04 A;  1B06 A;  3X2Q B;  2Y0I A;  3P30 A;  2QEX V;  4FMT A;  5CB4 B;  2ZE6 A;  1NS1 A;  1UFI A;  4X62 O;  3G6B A;  5KA5 A;  1YTF B;  3ABT A;  4MS2 A;  1R6K A;  4QE7 A;  2IW5 A;  3WG7 C;  1FOU A;  1IBL O;  1FJG O;  1FXK C;  4NXN B;  3AG2 B;  3I56 V;  4MVU A;  4B3T O;  1FFT B;  2QKC A;  2XOK G;  3B8M A;  3C3T A;  2QWR B;  1R1B A;  2B9Z A;  1WJZ A;  4D6T H;  3WB1 A;  2WLM A;  4PA6 A;  4U7O A;  2G38 A;  4EFB A;  4DV0 O;  1O9H A;  2QWP B;  2YIB A;  3ZRW B;  1XHX A;  3CEI A;  1KC8 W;  3IC9 A;  2CTW A;  5JQG A;  5LHH A;  1OCR B;  2VWJ A;  4H37 A;  4CH5 A;  1TUB A;  3I55 V;  2YEV A;  3FFQ A;  4IHJ B;  2QWO B;  2ZR2 A;  2ZD9 A;  4UB6 Z;  3S3W A;  4EB6 A;  4JI5 B;  1XUQ A;  4BAY A;  1JPX A;  4R7C A;  4BWA A;  4K3A A;  4I4T A;  4X65 B;  3AK3 A;  1J95 A;  1TVK B;  1M57 B;  1P49 A;  2RCV A;  2DW4 A;  1IXM A;  2LFR A;  1LNQ A;  4G2K A;  2WA4 A;  1K7D A;  1VQM V;  2WLI A;  2RJZ A;  3D36 C;  3OMN B;  3B8N A;  5EYP B;  1SA0 B;  1ZWI C;  2ZIM A;  3UCS C;  3ASN C;  3CX5 F;  4Q6G A;  3ZX6 A;  1D5A A;  3W7T A;  2ZKO A;  4K35 A;  2YI8 A;  3T1H O;  3GVM A;  4PDL A;  4UV9 A;  1I0H A;  4DV7 B;  4A5U B;  2P67 A;  2EIL B;  5FPO A;  4ZKI A;  1PV0 A;  3JAT A;  3ASO B;  3QO8 A;  1VQK V;  3JD1 A;  1QNM A;  1BMF G;  1PPJ H;  3CRQ A;  3E8B A;  3PN1 A;  1VEW A;  4QGP A;  4X1K A;  1Q3E A;  4JI6 B;  1AR5 A;  5B1B C;  4KL1 A;  3D3I A;  1AI5 A;  1VF5 B;  1FFX A;  4CS2 A;  4JI1 O;  3CCM V;  4I7Z B;  2P4K A;  3LDE A;  3J80 N;  1BHA A;  3ZED A;  2OIE A;  2IJJ A;  4O2A A;  4FM1 A;  1I94 B;  4J41 A;  1W0J G;  3JAL B;  5EBL C;  2MK3 A;  1V9P A;  2UXB B;  2E75 B;  2IBZ H;  5HFM A;  3ZHQ A;  3DC6 A;  3K9A A;  2AXT Z;  3JAR B;  4R8C A;  5KUM A;  4DK1 A;  2AZ2 A;  1HNZ B;  1GO3 F;  2GUZ A;  4ZOL B;  4FM2 A;  2RN9 A;  4GKK O;  4TV9 B;  4FPP A;  1K92 A;  1N34 B;  2UXD O;  3ZMZ A;  3JAW A;  1FD9 A;  2CE4 A;  1FXH A;  1WB8 A;  5CBF A;  1OV9 A;  4MVR A;  1Y67 A;  2EBO A;  3UQ8 A;  1KP2 A;  3OUS A;  1NKD A;  4WCE V;  2FML A;  4LF4 B;  4AIL C;  1SC5 B;  4TUY A;  4X66 B;  2V1D A;  5H6R A;  1SQQ H;  2EIM C;  1WLE A;  1Q82 W;  1EBO A;  3K03 A;  5IJ0 A;  3RW0 A;  1HWY A;  4YXW G;  4DV4 B;  1AB3 A;  4J42 A;  1JOY A;  3VQX A;  1KEC A;  2LGQ A;  1COW G;  2NN4 A;  1GKF A;  1N4C A;  1S5H C;  3H1H H;  2EIN C;  2FB5 A;  2HFE C;  4HYO A;  5JJE B;  5GON B;  5IYB O;  3CCV V;  1XEQ A;  4YJ3 B;  2WPD G;  1TGO A;  1H2L A;  2PYJ A;  4CS4 A;  3IJ4 A;  4UVB A;  2EZO A;  5H9C A;  3R65 A;  2P7T C;  3AG3 B;  2WSS G;  5KAI Z;  3B09 A;  5IDJ A;  3CJH A;  1YIJ V;  1VQ6 V;  3QTC A;  4OGQ B;  1RSO A;  2P06 A;  4P9O A;  1F51 A;  2XAF A;  2EIK C;  1WA8 A;  1GTO A;  3EVK A;  2YS8 A;  4NKG B;  2DWE C;  4LF7 B;  3ZJZ A;  3UO3 A;  4K0K O;  3HKC B;  4DV1 O;  4X20 A;  4IT5 A;  3AG1 B;  1VQP V;  2P5O A;  5IT9 N;  3DC5 A;  3CCR V;  4AQY O;  3KDR A;  3OAA G;  4DR6 O;  4FFB A;  1PNM A;  2KQX A;  1CEZ A;  4U3J B;  3R66 A;  5KHG A;  2Q8V A;  3ABK C;  1D2D A;  1PD3 A;  4XDL A;  1E1R G;  4X64 B;  3CC2 V;  2JJ1 G;  2F4V B;  4NR1 A;  4I9W A;  3VQV A;  3E8G A;  4GX0 A;  3NR7 A;  1OZ0 A;  4PA9 A;  3JAK A;  3BRC A;  1LR1 A;  1M56 C;  4DRX B;  1NT2 B;  3RYI B;  4CS3 A;  3RT3 C;  1FXK A;  5E79 Z;  5A9G A;  2XAG A;  1V55 B;  1M9N A;  3OT7 A;  1DLB A;  2YXY A;  1JR9 A;  3IGA C;  4LF6 B;  3N27 A;  3RVZ A;  2Z3Y A;  3JAS A;  1GM8 A;  4NXM O;  2KSD A;  2RDC A;  3MHH C;  4I0X B;  4O4H A;  2A7W A;  1NBM G;  1V54 C;  4JI8 B;  1TUE B;  4UV8 A;  3QG5 A;  3RWR D;  1Y66 A;  3P3N A;  4BR6 A;  2JGD B;  4MT8 A;  4DV6 B;  1AJN A;  3FB7 C;  3FYI B;  5CMU A;  4GZR B;  4O4I B;  4PA7 A;  2Y48 A;  2ADP A;  4U3F H;  5CBG A;  4PI0 A;  4W4L A;  3K0G A;  4B3R B;  1QBZ A;  4X1Y A;  3O65 A;  1ZUQ A;  3ZMT A;  2PI4 A;  3KKY A;  2AHY A;  1I5X A;  3D36 A;  5EBW C;  1EN5 A;  4I5S A;  2K9P A;  5K1P A;  1BQ0 A;  1JVM A;  1HNX B;  2ZE7 A;  3CYO A;  3ZHV A;  1WPX A;  3E8H A;  5BMV B;  2CDY A;  3UT5 A;  4YJ2 B;  3T2M A;  3L75 H;  4O4L B;  4KP4 A;  2GDS A;  2Y0P A;  4X8A A;  1S5L Z;  5IE9 A;  3I5D A;  4EFE A;  1VF6 C;  1O9G A;  1TAE A;  4GCZ A;  3SJC C;  3ZN1 A;  2UU9 O;  4LWS A;  2UXC B;  3N2K B;  4TV8 A;  4JF3 A;  4MSW C;  2DYS B;  4J7Z A;  1NH2 B;  3X2Q C;  1N33 O;  2QWQ B;  4OPA A;  1X4T A;  1N36 O;  2CH7 A;  5L3F A;  1VF7 A;  2A9H A;  1EN4 A;  4N23 A;  3LDD A;  4MW8 A;  1I5Y A;  1YXB A;  3RVY A;  2YIA A;  1RPR A;  1K33 A;  3ZN0 A;  5KUK A;  3AG2 C;  1BE3 H;  1XI1 A;  4GX2 A;  5GW7 A;  1PL4 A;  1XDC A;  3QO5 A;  4MTG A;  4UCT A;  2WWW A;  1Q81 W;  4RQF A;  4JI4 B;  3K79 A;  3BPZ A;  2W6J G;  3ZIA G;  2EIJ B;  2EX3 A;  1BGY H;  1S5J A;  1FAF A;  4BW5 A;  2UUC B;  1OCR C;  4WBN B;  1NZ6 A;  4J80 A;  4HZ3 A;  1MMM A;  2ZR3 A;  4LFA B;  3RN4 A;  2XAS A;  1SZX A;  4EEQ A;  2QJ1 A;  5JCO C;  2ZDI C;  3HKB B;  2X6C A;  3SYP A;  2QSA A;  2JS5 A;  3ZHT A;  2Q69 A;  3WU2 Z;  1M57 C;  2V4D A;  1YCI A;  3ZMS A;  1P4R A;  1VP7 A;  5CA0 A;  3HKE B;  3AK1 A;  4JI2 B;  5C93 A;  4FZ0 A;  1GN4 A;  1OHH G;  5ITZ B;  2N04 A;  3UO2 A;  1N32 B;  2KB1 A;  5LGN A;  3G71 V;  1ZSP A;  2OTJ V;  1EN6 A;  4J11 A;  3NXS A;  5TIS Z;  2IJK A;  1KD1 W;  4DR7 O;  1XNR O;  1YTF D;  2VS0 A;  2EIL C;  2JIZ G;  3FAV A;  4GX5 A;  1NJI W;  4LCU C;  5H5N A;  3AG4 C;  2LW1 A;  2HHH O;  2UUB O;  1SQF A;  2ZM6 B;  2X0L A;  4NVP A;  4JAU A;  1I08 A;  3E22 B;  2YXH A;  1RM1 B;  1G8M A;  2N74 A;  2WLJ A;  4B3M O;  4H0L B;  2L6L A;  1ARO P;  3WFV A;  1FPO A;  4YY3 O;  3ZRX A;  1Q90 D;  1NTM H;  4JTD B;  3K0D A;  1Q8I A;  2BSK A;  2Q0O C;  2B1I A;  2YEV B;  1PNL A;  5B1N A;  2VQF O;  1JFF A;  1IBK O;  5L3G A;  4MTO A;  1I94 O;  3RYC A;  5LP6 B;  4NTW A;  2JJ2 G;  4I4T B;  3E2E A;  3IFX A;  1YZB A;  3SR2 C;  1JA8 A;  3C90 A;  1T5E A;  3SYO A;  3LNM B;  1K8A W;  4DV3 O;  4JAA A;  1RFY A;  1N34 O;  1IXB A;  1Q86 W;  4XDJ A;  1GN2 A;  2Q7G A;  2PUS A;  2WLL B;  5IYC O;  1B3Q A;  1URF A;  2ITD C;  3LDC A;  3RYF A;  2PY5 A;  1ZL8 A;  3L70 H;  2AZ0 A;  5H6Q A;  5DEC A;  2CTQ A;  3K06 A;  4FLY A;  1SRY A;  5KHK A;  4IIJ A;  3ZS8 C;  4QJF B;  3T4D A;  1CXZ B;  5JVD A;  4B3S B;  4GKJ B;  3JAT B;  2CGO A;  2L35 A;  4RUE A;  2FKX A;  1YHQ V;  2Q6A A;  4X1K B;  3ZRV A;  5LXT A;  2Q0A A;  2JK5 C;  4JV5 B;  1OCZ B;  2LJ2 A;  5KHI A;  2ZNI A;  2FL4 A;  1MA1 A;  3SDL A;  4GT1 A;  1FFX B;  1K5Q A;  1K34 A;  1GK9 A;  1H2N A;  5L3E A;  2LQT A;  5LMN B;  2ZXW B;  1P7G A;  3AG3 C;  2HJD A;  1H5W A;  4EKW A;  1YIT V;  1MNG A;  4JI7 O;  3OMI B;  1R3J C;  5DM6 V;  3K59 A;  5F2V O;  1MSW D;  5B5E Z;  3K08 A;  5JH7 A;  3T1Y B;  1SQB H;  4TQF A;  2ZIO A;  4DV5 B;  2UUA O;  2MW2 B;  4MTX A;  4RO2 A;  1KP3 A;  3B77 A;  5EZY B;  4NTY A;  5A2Q N;  3CCJ V;  2DYR B;  3JAW B;  4LFB O;  4YIP A;  2QTO A;  3AG1 C;  3KG2 A;  2JS3 A;  4JAS A;  3DGE A;  4LC1 A;  5LL6 Y;  4LF5 B;  2E5L B;  5L3C A;  2NLJ C;  1OCO B;  4UCU A;  1XMQ B;  1ROP A;  5IJ9 A;  4J7K A;  2OCC B;  2Q67 A;  4TUY B;  5LHI A;  3ZRS A;  1YF2 A;  4ZHQ A;  4Q20 A;  4HNA B;  5CB4 A;  5IJ0 B;  3OTO B;  3B40 A;  3OGC C;  2A0L A;  2CUG A;  2YDE A;  4U7N A;  2JDI G;  3ZMV A;  1SER A;  2QE7 G;  3EXA A;  2HJF C;  1V55 C;  1ZTE A;  2WA3 A;  3K5O A;  1G4Y B;  2W0X A;  3OM3 B;  5H2F Z;  1DK1 A;  3K5M A;  4I50 A;  1J5E B;  2JGU A;  4CH3 A;  1HNW B;  1YJW V;  3ZRW A;  5LYJ A;  5IWA B;  2DQ3 A;  3P32 A;  1JJ2 U;  1NQT A;  4OXS A;  2R9I A;  2X6A A;  3CJH B;  1WN7 A;  2YSU B;  4DR1 B;  1M93 A;  3SJA C;  1VQ5 V;  1RSO B;  1XL4 A;  3BCC H;  3CC7 V;  5IYD O;  4MVM A;  3BFR A;  1U97 A;  2R9R B;  1Z5W A;  4FLU A;  4DXW A;  1TVK A;  1YJN V;  1XMO O;  1DTO A;  3S3X A;  2ARH A;  4X20 B;  4FK5 C;  3CME V;  2Q9L A;  3CE2 A;  4J9Z B;  2QM4 A;  3SPG A;  3LNN A;  1FYJ A;  1S0V A;  5IY5 B;  2LP7 A;  1GM7 A;  1A32 A;  1D5N A;  5D5Q A;  3G4S V;  2Y69 B;  4CC6 A;  3MHS C;  4I55 A;  1Q6I A;  3SGI A;  3CRR A;  4PA3 A;  3E35 A;  3K57 A;  1KB9 F;  3GWK C;  3QVN A;  2Q5Z A;  2CTR A;  1VMG A;  1Y74 A;  4X1I B;  2WAM A;  1X59 A;  1IBL B;  1FJG B;  1R6T A;  3JAK B;  3M8A A;  4B3T B;  2DYS C;  2E76 B;  2UXC O;  4B7E A;  4BIO A;  4FVM A;  3L73 H;  2IH3 C;  2P4V A;  3TCU A;  1K4D C;  1F4N A;  3JD2 A;  2HEP A;  1EM1 A;  3JAS B;  1QHT A;  1KQS U;  2H94 A;  4KHP O;  3K3W A;  3LUT B;  4O4H B;  1H8E G;  3K9S A;  4LF8 B;  2EJ7 A;  4H44 B;  1HR0 O;  2W6I G;  2CAZ C;  2WLK A;  1Y6X A;  1AI4 A;  4LFC O;  3D8C A;  3ZCC A;  1NR7 A;  1GN3 A;  2ILM A;  3T1C A;  4JTA B;  3JAL A;  4GLX A;  4FLX A;  1BCC H;  2EIJ C;  3AEI A;  4JI4 O;  4WFA V;  3JAR A;  4ZI7 B;  3ETQ A;  3TET A;  4DUY O;  4AI8 A;  2BTQ A;  1M1K W;  1GN6 A;  4PD4 F;  1AP6 A;  5KMG B;  3F5T A;  4ZIB A;  1JX9 A;  1Y76 A;  4DV2 B;  5BR8 O;  1OJH A;  4LF9 O;  2OIG A;  2BOB C;  4DYL A;  4JI2 O;  4UVA A;  4X9Q A;  2EZP A;  3H1I H;  4P9P A;  4TV8 B;  4WFG A;  4TOI A;  1N32 O;  1B6Q A;  1JQ0 A;  1RPO A;  3OD4 A;  4JI0 O;  4QIW F;  4DW1 A;  2CH7 B;  3Q4H A;  1Z5V A;  5FNV B;  3OGI B;  1W59 A;  1IJG A;  4JI1 B;  1LUW A;  1ZX3 A;  3BEH A;  4K8Z A;  3ABM B;  3KCX A;  1PM9 A;  4LR3 A;  2QGN A;  2R72 A;  2H3O A;  1E1Q G;  1K4C C;  2ZM6 O;  2Z0A A;  5C8Y B;  4DR2 O;  1TA8 A;  1RM1 C;  4JI3 B;  5B66 Z;  4I9Q A;  1F7Y A;  3G80 A;  4DR4 O;  5FL7 G;  1XHZ A;  1QVF U;  4FJC C;  4BW9 A;  2B5U A;  1WAZ A;  4PEL A;  4GKK B;  4CC5 A;  2UXD B;  1K97 A;  3RYH B;  5HFL A;  4QPK A;  4BIZ A;  4UXN A;  2A3Q A;  2LGW A;  2BE3 A;  5LP6 C;  4IL6 Z;  2YID A;  1XNQ B;  4WFF A;  1AVM A;  1BS3 A;  1YSC A;  1NI8 A;  1EFR G;  4F6E A;  1U96 A;  1L1F A;  3UM7 A;  2PI5 A;  1PP9 H;  2H8P C;  2QDO A;  3HB3 B;  2HKO A;  3BAA A;  4O2B A;  1OCC B;  1KKD A;  4Z1V A;  1XRE A;  1IBM O;  4P2Z A;  2AHZ A;  4UFZ A; 
#chains in the Genus database with same CATH homology
 1B06 A;  1D5N A;  4X9Q A;  1QNM A;  4BR6 A;  4GUN A;  4YIP A;  3MDS A;  1LUV A;  1VEW A;  1AR4 A;  3AK2 A;  1MMM A;  3RN4 A;  1SZX A;  1JA8 A;  2ADP A;  1AR5 A;  3QVN A;  1IX9 A;  4FFK A;  5AG2 A;  2QKC A;  1KKC A;  1IXB A;  3C3T A;  2P4K A;  1ZUQ A;  1LUW A;  3KKY A;  4E4E A;  3EVK A;  3LSU A;  1GN2 A;  3AK1 A;  1PM9 A;  1GN4 A;  1N0J A;  1EN5 A;  2ADQ B;  3CEI A;  1EM1 A;  3IC9 A;  4JYY A;  1BSM A;  3DC6 A;  2CDY A;  1XIL A;  1BT8 A;  3K9S A;  1ZTE A;  2GDS A;  3DC5 A;  1ZSP A;  3KDR A;  1EN6 A;  4C7U A;  1XUQ A;  2AW9 A;  1IDS A;  4YIO A;  1GN3 A;  2CE4 A;  3TJT A;  3AK3 A;  1ZLZ A;  1WB8 A;  2RCV A;  4JZ2 A;  1Y67 A;  1MA1 A;  1EN4 A;  1VAR A;  1N0N A;  1WB7 A;  3BFR A;  1AVM A;  1MSD A;  4JZG A;  1I08 A;  1BS3 A;  1P7G A;  4F6E A;  1MNG A;  5A9G A;  1GN6 A;  3OT7 A;  1JR9 A;  3C3S A;  1AP6 A;  1XRE A;  1AP5 A;  1PL4 A;  1XDC A;  1I0H A;  2QKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...