1XILA

Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
190
Chain Sequence
KHSLPDLPDGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHALQKNVRPDLKAIWNVINWENVTERMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 62
structure length 190
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xilA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xilA02
1AVMA 3OT7A 1XILA 1LUWA 1WB8A 3C3TA 1QNMA 2CDYA 3CEIA 1IDSA 1EN4A 3AK1A 4X9QA 1VEWA 1XDCA 4YIPA 2ADPA 3IC9A 3K9SA 1EN5A 2AW9A 1GN6A 1B06A 1MSDA 1XUQA 2P4KA 4C7UA 1GN3A 4JZGA 1BT8A 1D5NA 1JR9A 1I0HA 2CE4A 3TJTA 3KKYA 1XREA 1SZXA 1AP5A 2ADQB 1MA1A 3MDSA 1PM9A 4F6EA 1AP6A 3LSUA 4FFKA 5AG2A 1ZLZA 1AR5A 1VARA 1WB7A 2GDSA 1N0NA 4JZ2A 1BS3A 3QVNA 2QKCA 3RN4A 1ZSPA 1GN4A 1JA8A 1IX9A 1AR4A 2RCVA 1MNGA 2QKAA 1MMMA 1KKCA 3DC6A 1N0JA 1BSMA 4JYYA 1P7GA 3AK2A 1ZUQA 1LUVA 3BFRA 3DC5A 3C3SA 1EN6A 1PL4A 4E4EA 4YIOA 1IXBA 1EM1A 1ZTEA 4GUNA 1GN2A 4BR6A 3AK3A 5A9GA 1I08A 1Y67A 3EVKA
chains in the Genus database with same CATH superfamily
1WLEA 3OMIB 3HR0A 2M7WA 2UUBO 4MSWC 3KG2A 2O57A 5IYZA 3PN1A 1M9NA 2XOKG 1JPXA 4B3TB 1LR1A 1BZKA 3E8BA 1G4YB 1CP9A 1AILA 3DGEA 3ZEDA 2X6BA 2YIBD 3H01A 5CN0A 3JD2A 1WP8A 3JALB 1QBZA 1G8MA 1S77D 5IJ9B 4FJCC 1GH6A 4UCTA 4FM2A 1CXZB 3ZRVA 1XQ8A 2GUZB 4W4KA 1SQQH 4L8JA 1YSCA 1AJQA 3FX7A 4NVPA 1IBKO 1H2MA 3JAKA 2ODMA 2WPDG 4FFKA 1R3LC 1Z2GA 4I7ZB 4PDLA 2ZR2A 4DYLA 1Q86W 2Y0IA 3ABTA 4GYCB 2QWRB 2WLHA 2IJJA 2YIAA 2VQEO 1N8RW 2ITCC 3T1YO 1W0KG 2L6LA 3K57A 3TETA 2AXTZ 2UXBO 1N4CA 5EC2C 1N34B 3X2QB 3X2QC 1N36O 1HDJA 2Z5UA 4X65O 1YTFB 3BFRA 4W4LA 2P22C 4DR3O 4JI6O 2A3QA 4DR4B 2LQTA 1GN2A 1WJZA 4UFZA 1SESA 3L75H 3B40A 1VQMV 3CC7V 4QJFB 2QWOB 1QVFU 4JYAB 4DV0B 1OCZB 5KHIA 1OCZC 3VOUA 3ZHRA 3SPHA 2WAMA 3I55V 5EBLC 1EN4A 4FPPA 1EZJA 3ABMB 1WAZA 1W0JG 3ABMC 3ZS8C 2VWJA 4CH4A 1XUQA 2F23A 2OIGA 3W7TA 2UUCB 2P4KA 4R50A 4QE7A 4B3SB 3DXRA 1X4TA 2IM9A 3TXSA 3OAAG 3APOA 2W0FC 5LYJA 3JARA 2BTQA 5JQGB 4FLXA 3AG7A 2XAQA 3SYAA 1JQ0A 4I0XA 1HNZB 2JGUA 3BPZA 4G28B 3CCMV 3RYIA 1VP7A 1KECA 5EYPB 5IY5B 4JGSA 4YY3O 3LDCA 5B5EZ 1RSOA 2W6JG 2HP8A 1K4CC 1Q7YW 4JYBA 1VQ8V 1R6KA 1N32B 1U97A 3T2MA 5ITZB 2V4DA 3MHHC 4DR1O 3LNMB 4U7OA 1R73A 1HNWB 1NVPD 4BIUA 1BS3A 2JEUA 3CRQA 3GVMA 4LF9O 2GTAA 4FIPC 4I4TA 4WFGA 2LO1A 1TVKB 1SRYA 3HKCA 4YHHO 1Q81W 3E86A 1ENVA 1Y74A 2UUBB 1ROPA 2QE7G 3JYCA 4ZHQB 4LFCO 4LNUB 3I5DA 3VQYA 4K3AA 3P3NA 2P90A 4NR1A 5JJNB 4DV7O 4YIOA 5FNVA 2VQFO 2F93B 1AI7A 2N74A 2Q7HA 3BA8A 1FPOA 2UU9O 2Z3YA 3D36C 3W7WA 2YEVA 1B6QA 2QGNA 3ZHTA 2RNBA 3C3TA 2F95B 1O9HA 3H9VA 1SKVA 1XMOO 5LHIA 5LXTB 4JF3A 1NKDA 5H2FZ 1HNXO 1B3QA 4DO2A 4JI1B 2ZE5A 5J2UA 2RDCA 3IC9A 1IBKB 1OCOC 2ZE6A 4MW3A 5B66Z 1SA0A 3RT3C 5KMGB 2PYJA 1QHTA 1FFXA 1H2SB 2H8PC 3H1JH 2IJIA 2KG7A 4B3MO 3SJQC 1K34A 2N05A 3N2GB 2NNUA 2XAGA 2XUMA 2JS5A 2PZSA 3OD4A 1SC5B 2F1MA 1RP3B 5B3SB 2VQEB 2BOBC 5B3SC 4DV3O 3T1YB 5CB4B 1K5QA 4OX9B 2WA3A 2UXBB 2ADQB 2YICA 3A0HZ 4PA6A 3U11A 1N36B 3THOA 3O9OA 1NZ6A 3ZHVA 5LMNO 1AI6A 4JPRA 5LMUO 4LCUC 4JI6B 4CC5A 3BY6A 3NR7A 4HYOA 4I9WA 1EBOA 2LGWA 3LDEA 4D7SA 1HR0O 1SQFA 1RPRA 1DGSA 3CCJV 3LNNA 1BGYH 2KSDA 2QKAA 1NVPB 1KKCA 4PHZA 4GKJO 4KUMA 3KCYA 2X6AA 3G71V 2QTSA 3FB6C 1F51A 1PKXA 1SQVH 1EN6A 2JDIG 4PA4A 2P7TC 3OEEG 1SQBH 3F7YC 5LGNA 1KYOF 3L73H 4BR6A 1FYJA 2HJFC 4O2BB 2JS3A 4MS2A 4JTAB 4UCUA 1BQZA 4P9PA 1P7BA 1THZA 2BSKB 4FZ0A 2Y0PA 4R6ZA 4YY3B 2QA4V 5L3GA 4JI5O 1EN5A 1CPYA 1FOUA 3OUFA 1RFYA 1GMGA 2JJ1G 4DV4O 1NS1A 4DR1B 4EFBA 5LHHA 1WN7A 2IH1C 1Q6IA 2B5UA 5CA1A 1D2DA 1ORQC 4GZRB 5IDJA 4LF9B 4UB6Z 1J95A 3N2KB 4QNHB 4R8CA 1PPJH 2ZXWB 2ZXWC 1FXHA 2IU3A 1ZL8A 4YHHB 3H1IH 1V55B 5EIBD 1FXKB 1V55C 1FXKC 3MDSA 5GW7A 2ZT9B 4O2AB 1P4RA 3K0DA 3SYCA 5FLXN 4LFCB 5EZYA 2EZOA 2GHYA 4EB6B 3VQXA 1QU7A 3T1CA 4J7KA 3RWRD 4DR2O 3CWBH 4X8AA 1VF5B 3E2EA 2VQFB 3CCSV 3RYCA 2FKXA 1SETA 1GN4A 4IIJB 3QO8A 1IBLO 3L70H 1YI2V 1WPBA 1IURA 1PP9H 3QNEA 5L3EA 1XMOB 3ABKB 4IL6Z 2QSAA 4QGPA 3ABKC 1HNXB 2CTPA 3FD9A 5TISZ 3L72H 1K73W 3S3XA 4MTGA 5JCOC 5JVDB 2CK3G 1EZVH 1H8EG 4DR5O 3CCEV 4B3MB 2WLJA 3A2FA 4XBFA 5EC1C 3CHXA 5H6QA 5A9GA 1H2NA 3MD0A 4MVZA 2R9AA 3K0GA 2VRZA 1HP8A 4JI2O 3EVKA 1UPGA 1NH2D 4PA3A 2OT5A 2Q7GA 5KAIZ 1NR7A 5K1PA 1M56B 1M56C 3HKEA 3D36A 4Q20A 5BMVB 1K97A 3G6BA 3K9SA 1GN6A 5CBFA 4O4LB 1I94B 2KQXA 1GN3A 2EILB 5LMNB 2XAJA 3K9AA 3UT5A 5LMUB 4I55B 4MVUA 4TQDA 3OGCC 2A7WA 2LJ2A 3OEHG 3T4DA 3SPJA 1XREA 3RYFA 5J9PC 1HR0B 4O4IB 4I9QA 1AP5A 3CC2V 1NTZH 2JJ2G 1FJGO 1PNKA 2ZQMA 4JTCB 5JJJB 1I7FA 3LDDA 4GKJB 4MTOA 4LH7A 4JTDB 3ABUA 5GONA 1IXMA 2Y69C 3E83A 3CC4V 5EIBC 1I5YA 4UV8A 4FM1A 2RJZA 2AZ2A 2Y4TA 4BWAA 5LA6A 5CBHA 3G6EV 1VF6C 3CRRA 4DW0A 1ZSPA 1IX9A 4Z2WA 2BCCH 2E76B 1K8AW 2OTJV 3BA9A 1MOFA 4B3SO 4I5SA 4J42A 4JI5B 2ATKC 5A2QN 3C3SA 2ZIOA 1YDXA 4UCOA 4QPKA 2P5OA 4GUNA 4RUEA 5J2TB 1ZWIC 1AVMA 3QF7A 4PI0A 2CAZC 2RQ6A 1K7DA 1NJIW 4N21A 1IBMO 4MVMA 1K4DC 3DSQA 4TV9A 3OW2U 2E5LO 1K3EA 4O4JB 4RQFA 3S3WA 4UVBA 1Q43A 1HNWO 4IHJA 1SQPH 2PF4E 3APQA 4B7KA 4DR6O 2QWPB 2ZNJA 3FAVB 3F7VC 3HKDA 4JZGA 2BTOA 5KHGA 4DR2B 1EFRG 2OWOA 2Q69A 3OUSA 3KKYA 3B4SA 1XNQO 3KZIZ 3D3IA 3SYPA 1TUBA 4DK1A 1IBLB 1YJ9V 5IJ0A 3HKBB 4LP8A 1NQTA 5JH7A 2CUGA 3SYOA 4JAAA 4LF5B 3AG2B 3AG2C 5B1AB 5B1AC 1K5SA 1VF7A 4J9ZB 3TGUH 2X0LA 4DR5B 1N0NA 3E22A 3G67A 2HFEC 1IZ3A 4JI1O 4JI2B 4ZI7B 1AR4A 4CS3A 1L0NH 2GV9A 1Y76A 3JATB 1N0JA 1BSMA 4JYYA 4X1IA 2OYQA 2LGQA 4IYIA 4JI7O 1GM9A 3CD6V 2CGOA 2EIJB 2EIJC 5H6RA 2JGDB 1AJPA 2DYSB 4FVMA 2DYSC 3EFFK 2DW4A 1COWG 2E3CA 2YI9A 4D7TA 1SZTA 1U96A 4OX9O 4WBNB 4CZZA 4MVSA 1WNSA 1JNBA 2A0LA 3A8TA 2CDYA 4FLWA 2H3OA 4PA9A 3CPWU 4U3JA 1FJGB 4DR7O 1P49A 2DQ0A 4CS2A 4UV9A 4MT8A 1B06A 3AEIA 5GTHZ 3J81N 4WFAV 3BABA 3FB7C 2PTMA 3E8FA 2D3OW 2NN4A 5CA0A 1ZAUA 2F66C 4ZOLA 2QR4A 4EKWA 2WA4A 4G27B 3TCUA 2A9HA 4JI8O 4AQYO 1L0LH 2Q5ZA 1R1BA 4DRXB 3K3WA 1BL8A 3F5TA 4YJ2A 5C8YA 4DV1O 1AP6A 2EINB 2EINC 4F6RB 2C2AA 4U3FH 5EK0A 5DN6G 5L3BA 4X66B 1IJGA 2AHYA 2DWEC 4JZ2A 3JSNA 1DK1A 3JASB 1BE3H 5IY5C 2G38A 1A32A 3UM7A 4HAMA 1BQ0A 4PV1B 1VF6A 2JIZG 4HNAA 2V7QG 3JD4A 4P2ZA 3W7SA 1IBMB 1KKDA 3OTOO 1SERA 4TUYA 4LWSA 2WLNA 1W59A 2E5LB 1DF4A 1ZUQA 3VBBA 3MAQA 1GK9A 3K5OA 3U10A 3IC7A 4GX2A 3H1LH 4OXSA 4E4EA 2BE3A 4DR6B 2CTWA 3ETQA 4Z1VA 4EEQA 4NTWA 5KUKA 4CH6A 4IYHA 2WLLA 3WU2Z 3WB0A 2ZCEA 2Q0OC 3D3QA 4J41A 3IGAC 5LOVA 1XNQB 5IYCO 1IDSA 2QJ1A 2WLIB 4MVQA 1OJHA 4ZBMA 3JSLA 4JAVA 1H5WA 4UUJC 1GM8A 3RYHA 1KMIZ 1M93A 3EHBB 2DQ3A 3MHSC 2CH7B 4LF4O 2ILMA 4J9YB 1Z5WA 3OE7G 3R66A 4NB5A 1FD9A 3ZCCA 4X1KB 4XDKA 4WFBV 1F4NA 4TV8B 2DJVA 2IU0A 4X20B 3CP1A 4GX1A 3LSUA 3ZMTA 1MZEA 3ABLB 5LP6B 4JI7B 3ABLC 3HKBA 5LP6C 3ZBHA 4DV6B 4YJ3B 2PUSA 1GM7A 1R6NA 3L71H 1S5HC 1VQ5V 4GCZA 1XL6A 2Q68A 4FLVA 3FKSG 4AILC 3JALA 2NR5A 2JEXA 4NXMO 2P06A 1Q6HA 3C90A 2MK3A 4DV2O 1WA8B 5IJ9A 3SJBC 1YJNV 4JI0B 2LW1A 1SS3A 1RPOA 1R6TA 2CTQA 3B09A 2GUZA 3K5MA 3ETDA 4D6TH 4MTFA 1S0VA 3ZX6A 2RN9A 4OPAA 2LFSA 1NR1A 1I94O 1JFFB 1IVSA 4DR7B 5KA6A 3T1HO 2LW7A 1VQ9V 4YXWG 1PL4A 2DOSA 1CEZA 4I50B 3JCUZ 4DV5O 3RVZA 4H44B 2OCHA 1R3KC 1YVWA 2HHHO 3I56V 2MW2B 2GSMB 1WB8A 4MW8A 4JI8B 2OCCB 4AQYB 2OCCC 1PD3A 3P32A 1Y4MA 3RGBA 3D8CA 1K33A 3K59A 1HWYA 4DV1B 5KLVH 3UO3A 3B2EE 2FMLA 1KQSU 4TT3G 1JR9A 4UCVA 2CE4A 3W7UA 4FLYA 3CJHB 1FFTB 3RFRA 3IJ4A 4X1YB 2PI4A 3QG5A 2LFRA 2H94A 3ZMVA 1MA1A 1XL4A 2K9PA 3ZRWB 3JAWB 4A5UB 1W2BU 2UXNA 1H2KA 3OTOB 2JVDA 2QWQB 4BW5A 2DYRB 3ETGA 1S3JA 2DYRC 5IYBO 5DECA 3Q4HB 5KX5B 1VARA 5IWAO 2Z0AA 3OMNB 4FMTA 5JQGA 1GAXA 4IT5A 2YIBA 1MNGA 5EYPA 2YXLA 3K58A 1P7GA 5HFMA 3AK2A 3ZN0A 1Q6UA 5ITZA 2P67A 1EM1A 5B1NA 2ITDC 4LF4B 4KP4A 4FFBB 5KAFZ 1TVKA 1OCRB 3OT7A 2XAHA 1OCRC 1Q8IA 5BR8O 4LF5O 2DN9A 3K5NA 5JJEB 2L35A 1KP3A 5B1OA 3LSQA 3JAKB 2N04A 4PDVA 3K5LA 1QR8A 1XDCA 2Q7EA 4ZHQA 4LNUA 2PY5A 2AW9A 4JI3O 2QEXV 5DM6V 1F7YA 2W0XA 3CXCU 2QDOA 5L3CA 4K0KO 1G6UA 4LC1A 2EULA 4N23A 2XASA 2FL4A 2B1IA 4NXMB 1I0HA 3TJTA 4HZ3A 4ZKIA 4H13B 4DV2B 2ARHA 4DK0A 1J5EO 1V54B 1V54C 1FKAO 5LXTA 1AI4A 3K79A 4GT1A 2Q4PA 4UCSA 5B1BB 5CMUA 1JOYA 5B1BC 4UXNA 5AG2A 1FAFA 1VQPV 2EILC 3FYEB 1XI1A 5KMGA 3T1HB 3SPIA 1YHQV 3CXHF 4ASUG 3E8HA 1NU1H 4DV5B 3N2GA 5GTIZ 1FXVA 1VMGA 1PNMA 2HHHB 1VQ7V 2R9IA 1N33O 5K1XA 5CB4A 1T5EA 1NTKH 3L9DA 3ZMSA 4FK5C 1PL0A 5EBWC 4KXRA 3OR7C 3ZMZA 3P3PA 3CSXA 4JASA 1E79G 2EIMB 2EIMC 3J7AU 3G4SV 2CGNA 3CMAV 5LYJB 1JCHA 1QR9A 3JARB 2BTQB 1VQNV 2PI5A 3AK3A 4I0XB 1S5JA 3RYIB 4NXNO 2HVKC 4DUZO 1S5LZ 5KHKA 3QTCA 1M5IA 1RSOB 4JYCA 1BMFG 2M6YA 1O9GA 4LH6A 1URFA 4X66O 2KKWA 5IT9N 2Y48A 5D5PA 2AGAA 5F2VO 1GO3F 1V9PA 3SGIA 4ZIBA 5IWAB 2VWKA 4I4TB 4RWUA 2EX3A 2Q6AA 1D5AA 2Q0AA 3OM3B 4O2BA 3HKCB 3ZMUA 3CX5F 3CRCA 1F23A 1HW7A 4LF6O 1F4MA 3EXAA 1Y74B 1NH2B 3UQ8A 1P84F 4BIZA 2HVJC 1M57B 2BSKA 2DMXA 4F6EA 1VQKV 1YTFD 1M57C 4B08A 3AG4B 3AG4C 1NBMG 1BHBA 5FNVB 1MSWD 1XEQA 2A79B 2GDSA 4O4HB 4XDLA 2YEVB 4GKKO 2ZDIC 4MTXA 1AJNA 3UCSC 2D2CB 2Q9LA 1GRJA 3N2KA 1WPXA 3FYIB 3WG7B 4X89A 3K08A 3WG7C 1Q82W 5BR8B 3UKMA 3BCCH 4CH5A 3SDLA 5J2UB 1FXKA 1L1FA 4O2AA 1SA0B 4H37A 5E1AC 3ZRXA 1FFXB 3FB5C 4JI3B 2FB5A 2YI8A 4EB6A 2KG7B 2YXHA 1YIJV 2Q73A 4J10A 1IXBA 4K0KB 5FL7G 4L87A 2HLDG 4H0LB 5H9CA 1XILA 2ZM6O 1VQOV 1OZ0A 4IIJA 4FFBA 1J5EB 3KCXA 4DV6O 2YSUB 1KUQA 1AI5A 1JX9A 3CB2A 5JCOA 3JD1A 1MABG 4UVAA 5JVDA 4JI0O 3ZIAG 4PA7A 1R3JC 1D5NA 4KL1A 5KA5A 5BZBA 1YITV 4LFAO 4QE9A 2FYUH 4RQEA 2X7RB 4QIWF 3O65A 4B3RO 2DE0X 2IW5A 2WLKA 4LBEC 1N33B 2XTAA 5C93A 3N27A 2QKSA 2V1DA 3ASNB 4RAIA 1KB9F 5BMVA 3ASNC 2ZIMA 5L3FA 2UXXA 3FB8C 3PJSK 3WFVA 4X64O 4PDRA 4O4LA 3M7MX 2VS0A 2NLJC 1S72V 1KBHA 1YJWV 3RN4A 4I55A 4NTYA 2F4VO 2RCVA 1G1XB 4NXNB 5LHGA 1KP2A 4DUZB 1M4UA 1MMMA 3SYQA 2KB1A 4O4IA 1H38A 4LF8O 4TWKA 3SPCA 2F43G 3JD3A 4WFEA 3P30A 4WCEV 2QM7A 2PYLA 2QWNB 4PJ0Z 1XNRO 3H1HH 1E1QG 3M99B 5EBMC 1ZTEA 2E74B 3CYOA 3CCUV 2R9RB 4JI4O 5CA1B 4J80A 3CE2A 1I08A 5LL6Y 1H2LA 2Y4UA 1ZL8B 5DEDA 4LF6B 1SQXH 4DXWA 1Q3EA 2YC0A 3ML0A 3RBZA 1AB3A 2GBOA 3HB3B 1XMQO 5EZYB 4RO2A 3JCZA 4F4LA 2P4VA 1E1RG 2YDEA 1TA8A 3GB7C 2E75B 5CA3A 1QLEB 5H5NA 4PELA 1BT8A 1QLEC 3ZJZA 4JAUA 4GX0A 3BHPA 3RYCB 2R70A 3CCVV 5BY1A 5J2TA 5BXZA 1XBLA 2WWWA 4GKKB 1TAEA 1BCCH 3ZHUA 4G2KA 2QM8A 2X6CA 1YXBA 1US6A 2PGGA 4U7NA 4AI8A 4O4JA 4E2LA 3L74H 4BIOA 4KFMA 2B9ZA 3SR2C 3AG3B 2GTSA 3AG3C 2CTRA 1ZLZA 3DTUB 1WB7A 3FAVA 2HKOA 3OTFA 4X62O 3SPGA 3QVNA 2QKCA 3VQVA 3SJCC 2JK5C 3WB2A 4OPHA 4O4HA 1RM1B 2WLMA 1L8DA 1S76D 1RM1C 1YCIA 2ZM6B 3HKEB 4K35A 3ZHSA 4GLXA 2ZDIA 3K06A 3BRCA 1JVMA 2UXDO 3DC6A 3H1KH 5FPOA 3CCLV 1KU9A 1Z5VA 3E89A 1QQCA 3LUTB 2HJDA 4GX5A 2IJHA 1I5XA 4LF7O 1OCOB 3CS5A 4TSFG 2XT9A 3OR6C 1K9MW 3E8GA 3UT5B 4K8ZA 1Y67A 4LFAB 1X59A 3RYFB 1LUWA 3IFXA 5KHJA 4R7CA 1K92A 1ZX3A 4ZI7A 4B3RB 4BW9A 2EIKB 3ASOB 4LFBO 2EIKC 3ASOC 3CEIA 3U0ZA 1AROP 4UVCA 4X9QA 1R3IC 1VEWA 3JATA 3LSSA 2YUAA 5GONB 1DLBA 2JGDA 4WFFA 4X64B 4X65B 1YEWA 5LA6B 1B04A 2YS8A 3TXQA 1OV9A 4NTXA 4UB8Z 4DR3B 5D5QA 4DUYO 1QLNA 4MVRA 3HPLC 4WBNA 4KHPO 4OGQB 2F4VB 1SZXA 1MG1A 4X88A 3OFNG 2EBOA 5LGTA 4J7JA 3K03A 3SJAC 4LF8B 2W6IG 2XAFA 2ZINA 4LR3A 3QO7A 1DTOA 3JAMN 4XDJA 4PD4F 2ZE7A 1XNRB 3K04A 1JJOA 1VIBA 4BAYA 4JV5O 2ZKOA 3R65A 5HFLA 2ZR3A 2R72A 4JI4B 3CMEV 2P6JA 2HR3A 1JA8A 1PV0A 5KUMA 1OHHG 5JWPA 4CH3A 4TV9B 1M1KW 2UUAO 3ZHQA 3IAYA 3T4ZA 4AHCA 2IH3C 4DRXA 2UXCO 4TQFA 1XMQB 4IHJB 3GWOA 1PNLA 4F6RA 4J11A 4WFHA 3HKDB 1LNQA 1H8HG 3VQWA 4ICGA 2XNDG 1NI8A 3B8NA 5IYZB 2OTLV 2ZNIA 4ABMA 3JASA 1QNMA 1TUBB 3FFQA 5IJ0B 3TK1A 5JH7B 1VQ4V 2EJRA 3STLC 4YIPA 1XHZA 3RVYA 1QCEA 4FLZA 2A06H 2Q8VA 1MSDA 3W7XA 5IE9A 1VQ6V 2QM4A 1JMKC 5IYDO 3E22B 3E35A 3ICXA 4UCRA 3NXSA 4X62B 1QVGU 4DV7B 3BAAA 3A0RA 1JJ2U 1OCCB 1UFIA 1OCCC 3JD0A 3J80N 1SF9A 4DW1A 4RUFA 1Y6XA 2ZD9A 2YIDA 1Y76B 1NTMH 1M90W 2UU9B 4X1IB 2WLIA 3CRAA 1PM9A 3B77A 4B3TO 2UXDB 3KDRA 4H33A 1TUEB 1Q90D 4LF7B 1Q5OA 2EZPA 2CH7A 4Z1MG 4CC6A 5LGUA 4FLTA 4CBCA 1GTOA 2WSSG 1UJWB 4MVOA 4X1KA 4U3JB 1KC8W 1AR1B 4LFBB 3BVOA 4TV8A 4DV3B 1GKFA 4X20A 2K1EA 1LUVA 4HBNA 5LP6A 4YJ3A 3ZRSA 4IGGA 2QTOA 3RW0A 5CA0B 1FS0G 1MZFA 2B1GA 3G80A 4ZOLB 1YF2A 2HG5C 1WA8A 1VQLV 4P30A 3WB1A 4DUYB 4WF9V 5E79Z 4FZ1A 4KHPB 1N34O 4J7ZA 3QO5A 4NKGB 1KD1W 4YJ2B 3AK1A 5C8YB 2ADPA 2HEPA 2EJ7A 3DXRB 1XOUA 1JFFA 2FTKA 5FPRA 4DR4O 4C7UA 4I50A 2RMKB 2Y69B 4JV5B 3UO2A 4EFEA 3BEHA 4QPJA 4TOIA 1DF5A 2AHZA 4DV0O 4JYAO 3B8MA 4PI2A 1WP7A 4HNAB 4Q6GA 1TGOA 3CCRV 4FM0A 4TUYB 4LWSB 1NT2B 2UUAB 2OIEA 2UUCO 2UXCB 4P9OA 1H2GA 4PDMA 4CS4A 3GWKC 1AR5A 2AZ0A 3OGIB 1SQGA 2WLLB 1HNZO 5CBGA 5KHHA 4DV4B 1Y66A 2BOCC 3ETEA 3CJHA 2JRIA 5LOVB 2DWDC 1YZBA 1XHXA 1BHAA 4X1YA 2XHBA 3OMAB 3M8AA 3CCQV 3ZRWA 3JAWA 2YXYA 4B7EA 1N32O 2IJKA 3RYHB 3DC5A 2Q67A 3A0BZ 3CRMA 3F5WC 4K8XA 3Q4HA 5KX5A 2ETNA 4FLUA 2ZE8A 4NYKA 2LP7A 2IBZH 3ZN1A 3STZC 3AG1B 5L3DA 3AG1C 5LBQA
chains in the Genus database with same CATH topology
1AVMA 3OT7A 1XILA 1LUWA 1WB8A 3C3TA 1QNMA 2CDYA 3CEIA 1IDSA 1EN4A 3AK1A 4X9QA 1VEWA 1XDCA 4YIPA 2ADPA 3IC9A 3K9SA 1EN5A 2AW9A 1GN6A 1B06A 1MSDA 1XUQA 2P4KA 4C7UA 1GN3A 4JZGA 1BT8A 1D5NA 1JR9A 1I0HA 2CE4A 3TJTA 3KKYA 1XREA 1SZXA 1AP5A 2ADQB 1MA1A 3MDSA 1PM9A 4F6EA 3KDRA 1AP6A 3LSUA 4FFKA 5AG2A 1ZLZA 1AR5A 1VARA 1WB7A 2GDSA 1N0NA 4JZ2A 1BS3A 3QVNA 2QKCA 3RN4A 1ZSPA 1GN4A 1JA8A 1IX9A 1AR4A 2RCVA 1MNGA 2QKAA 1MMMA 1KKCA 3DC6A 1N0JA 1BSMA 4JYYA 1P7GA 3AK2A 1ZUQA 1LUVA 3BFRA 3DC5A 3C3SA 1EN6A 1PL4A 4E4EA 4YIOA 1IXBA 1EM1A 1ZTEA 4GUNA 1GN2A 4BR6A 3AK3A 5A9GA 1I08A 1Y67A 3EVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVM A;  3OT7 A;  1XIL A;  1LUW A;  1WB8 A;  3C3T A;  1QNM A;  2CDY A;  3CEI A;  1IDS A;  1EN4 A;  3AK1 A;  4X9Q A;  1VEW A;  1XDC A;  4YIP A;  2ADP A;  3IC9 A;  3K9S A;  1EN5 A;  2AW9 A;  1GN6 A;  1B06 A;  1MSD A;  1XUQ A;  2P4K A;  4C7U A;  1GN3 A;  4JZG A;  1BT8 A;  1D5N A;  1JR9 A;  1I0H A;  2CE4 A;  3TJT A;  3KKY A;  1XRE A;  1SZX A;  1AP5 A;  2ADQ B;  1MA1 A;  3MDS A;  1PM9 A;  4F6E A;  1AP6 A;  3LSU A;  4FFK A;  5AG2 A;  1ZLZ A;  1AR5 A;  1VAR A;  1WB7 A;  2GDS A;  1N0N A;  4JZ2 A;  1BS3 A;  3QVN A;  2QKC A;  3RN4 A;  1ZSP A;  1GN4 A;  1JA8 A;  1IX9 A;  1AR4 A;  2RCV A;  1MNG A;  2QKA A;  1MMM A;  1KKC A;  3DC6 A;  1N0J A;  1BSM A;  4JYY A;  1P7G A;  3AK2 A;  1ZUQ A;  1LUV A;  3BFR A;  3DC5 A;  3C3S A;  1EN6 A;  1PL4 A;  4E4E A;  4YIO A;  1IXB A;  1EM1 A;  1ZTE A;  4GUN A;  1GN2 A;  4BR6 A;  3AK3 A;  5A9G A;  1I08 A;  1Y67 A;  3EVK A; 
#chains in the Genus database with same CATH topology
 1WLE A;  3OMI B;  3HR0 A;  2M7W A;  2UUB O;  4MSW C;  3KG2 A;  2O57 A;  5IYZ A;  3PN1 A;  1M9N A;  2XOK G;  1JPX A;  4B3T B;  1LR1 A;  1BZK A;  3E8B A;  1G4Y B;  1CP9 A;  1AIL A;  3DGE A;  3ZED A;  2X6B A;  2YIB D;  3H01 A;  5CN0 A;  3JD2 A;  1WP8 A;  3JAL B;  1QBZ A;  1G8M A;  1S77 D;  5IJ9 B;  4FJC C;  1GH6 A;  4UCT A;  4FM2 A;  1CXZ B;  3ZRV A;  1XQ8 A;  2GUZ B;  4W4K A;  1SQQ H;  4L8J A;  1YSC A;  1AJQ A;  3FX7 A;  4NVP A;  1IBK O;  1H2M A;  3JAK A;  2ODM A;  2WPD G;  4FFK A;  1R3L C;  1Z2G A;  4I7Z B;  4PDL A;  2ZR2 A;  4DYL A;  1Q86 W;  2Y0I A;  3ABT A;  4GYC B;  2QWR B;  2WLH A;  2IJJ A;  2YIA A;  2VQE O;  1N8R W;  2ITC C;  3T1Y O;  1W0K G;  2L6L A;  3K57 A;  3TET A;  2AXT Z;  2UXB O;  1N4C A;  5EC2 C;  1N34 B;  3X2Q B;  3X2Q C;  1N36 O;  1HDJ A;  2Z5U A;  4X65 O;  1YTF B;  3BFR A;  4W4L A;  2P22 C;  4DR3 O;  4JI6 O;  2A3Q A;  4DR4 B;  2LQT A;  1GN2 A;  1WJZ A;  4UFZ A;  1SES A;  3L75 H;  3B40 A;  1VQM V;  3CC7 V;  4QJF B;  2QWO B;  1QVF U;  4JYA B;  4DV0 B;  1OCZ B;  5KHI A;  1OCZ C;  3VOU A;  3ZHR A;  3SPH A;  2WAM A;  3I55 V;  5EBL C;  1EN4 A;  4FPP A;  1EZJ A;  3ABM B;  1WAZ A;  1W0J G;  3ABM C;  3ZS8 C;  2VWJ A;  4CH4 A;  1XUQ A;  2F23 A;  2OIG A;  3W7T A;  2UUC B;  2P4K A;  4R50 A;  4QE7 A;  4B3S B;  3DXR A;  1X4T A;  2IM9 A;  3TXS A;  3OAA G;  3APO A;  2W0F C;  5LYJ A;  3JAR A;  2BTQ A;  5JQG B;  4FLX A;  3AG7 A;  2XAQ A;  3SYA A;  1JQ0 A;  4I0X A;  1HNZ B;  2JGU A;  3BPZ A;  4G28 B;  3CCM V;  3RYI A;  1VP7 A;  1KEC A;  5EYP B;  5IY5 B;  4JGS A;  4YY3 O;  3LDC A;  5B5E Z;  1RSO A;  2W6J G;  2HP8 A;  1K4C C;  1Q7Y W;  4JYB A;  1VQ8 V;  1R6K A;  1N32 B;  1U97 A;  3T2M A;  5ITZ B;  2V4D A;  3MHH C;  4DR1 O;  3LNM B;  4U7O A;  1R73 A;  1HNW B;  1NVP D;  4BIU A;  1BS3 A;  2JEU A;  3CRQ A;  3GVM A;  4LF9 O;  2GTA A;  4FIP C;  4I4T A;  4WFG A;  2LO1 A;  1TVK B;  1SRY A;  3HKC A;  4YHH O;  1Q81 W;  3E86 A;  1ENV A;  1Y74 A;  2UUB B;  1ROP A;  2QE7 G;  3JYC A;  4ZHQ B;  4LFC O;  4LNU B;  3I5D A;  3VQY A;  4K3A A;  3P3N A;  2P90 A;  4NR1 A;  5JJN B;  4DV7 O;  4YIO A;  5FNV A;  2VQF O;  2F93 B;  1AI7 A;  2N74 A;  2Q7H A;  3BA8 A;  1FPO A;  2UU9 O;  2Z3Y A;  3D36 C;  3W7W A;  2YEV A;  1B6Q A;  2QGN A;  3ZHT A;  2RNB A;  3C3T A;  2F95 B;  1O9H A;  3H9V A;  1SKV A;  1XMO O;  5LHI A;  5LXT B;  4JF3 A;  1NKD A;  5H2F Z;  1HNX O;  1B3Q A;  4DO2 A;  4JI1 B;  2ZE5 A;  5J2U A;  2RDC A;  3IC9 A;  1IBK B;  1OCO C;  2ZE6 A;  4MW3 A;  5B66 Z;  1SA0 A;  3RT3 C;  5KMG B;  2PYJ A;  1QHT A;  1FFX A;  1H2S B;  2H8P C;  3H1J H;  2IJI A;  2KG7 A;  4B3M O;  3SJQ C;  1K34 A;  2N05 A;  3N2G B;  2NNU A;  2XAG A;  2XUM A;  2JS5 A;  2PZS A;  3OD4 A;  1SC5 B;  2F1M A;  1RP3 B;  5B3S B;  2VQE B;  2BOB C;  5B3S C;  4DV3 O;  3T1Y B;  5CB4 B;  1K5Q A;  4OX9 B;  2WA3 A;  2UXB B;  2ADQ B;  2YIC A;  3A0H Z;  4PA6 A;  3U11 A;  1N36 B;  3THO A;  3O9O A;  1NZ6 A;  3ZHV A;  5LMN O;  1AI6 A;  4JPR A;  5LMU O;  4LCU C;  4JI6 B;  4CC5 A;  3BY6 A;  3NR7 A;  4HYO A;  4I9W A;  1EBO A;  2LGW A;  3LDE A;  4D7S A;  1HR0 O;  1SQF A;  1RPR A;  1DGS A;  3CCJ V;  3LNN A;  1BGY H;  2KSD A;  2QKA A;  1NVP B;  1KKC A;  4PHZ A;  4GKJ O;  4KUM A;  3KCY A;  2X6A A;  3G71 V;  2QTS A;  3FB6 C;  1F51 A;  1PKX A;  1SQV H;  1EN6 A;  2JDI G;  4PA4 A;  2P7T C;  3OEE G;  1SQB H;  3F7Y C;  5LGN A;  1KYO F;  3L73 H;  4BR6 A;  1FYJ A;  2HJF C;  4O2B B;  2JS3 A;  4MS2 A;  4JTA B;  4UCU A;  1BQZ A;  4P9P A;  1P7B A;  1THZ A;  2BSK B;  4FZ0 A;  2Y0P A;  4R6Z A;  4YY3 B;  2QA4 V;  5L3G A;  4JI5 O;  1EN5 A;  1CPY A;  1FOU A;  3OUF A;  1RFY A;  1GMG A;  2JJ1 G;  4DV4 O;  1NS1 A;  4DR1 B;  4EFB A;  5LHH A;  1WN7 A;  2IH1 C;  1Q6I A;  2B5U A;  5CA1 A;  1D2D A;  1ORQ C;  4GZR B;  5IDJ A;  4LF9 B;  4UB6 Z;  1J95 A;  3N2K B;  4QNH B;  4R8C A;  1PPJ H;  2ZXW B;  2ZXW C;  1FXH A;  2IU3 A;  1ZL8 A;  4YHH B;  3H1I H;  1V55 B;  5EIB D;  1FXK B;  1V55 C;  1FXK C;  3MDS A;  5GW7 A;  2ZT9 B;  4O2A B;  1P4R A;  3K0D A;  3SYC A;  5FLX N;  4LFC B;  5EZY A;  2EZO A;  2GHY A;  4EB6 B;  3VQX A;  1QU7 A;  3T1C A;  4J7K A;  3RWR D;  4DR2 O;  3CWB H;  4X8A A;  1VF5 B;  3E2E A;  2VQF B;  3CCS V;  3RYC A;  2FKX A;  1SET A;  1GN4 A;  4IIJ B;  3QO8 A;  1IBL O;  3L70 H;  1YI2 V;  1WPB A;  1IUR A;  1PP9 H;  3QNE A;  5L3E A;  1XMO B;  3ABK B;  4IL6 Z;  2QSA A;  4QGP A;  3ABK C;  1HNX B;  2CTP A;  3FD9 A;  5TIS Z;  3L72 H;  1K73 W;  3S3X A;  4MTG A;  5JCO C;  5JVD B;  2CK3 G;  1EZV H;  1H8E G;  4DR5 O;  3CCE V;  4B3M B;  2WLJ A;  3A2F A;  4XBF A;  5EC1 C;  3CHX A;  5H6Q A;  5A9G A;  1H2N A;  3MD0 A;  4MVZ A;  2R9A A;  3K0G A;  2VRZ A;  1HP8 A;  4JI2 O;  3EVK A;  1UPG A;  1NH2 D;  4PA3 A;  2OT5 A;  2Q7G A;  5KAI Z;  1NR7 A;  5K1P A;  1M56 B;  1M56 C;  3HKE A;  3D36 A;  4Q20 A;  5BMV B;  1K97 A;  3G6B A;  3K9S A;  1GN6 A;  5CBF A;  4O4L B;  1I94 B;  2KQX A;  1GN3 A;  2EIL B;  5LMN B;  2XAJ A;  3K9A A;  3UT5 A;  5LMU B;  4I55 B;  4MVU A;  4TQD A;  3OGC C;  2A7W A;  2LJ2 A;  3OEH G;  3T4D A;  3SPJ A;  1XRE A;  3RYF A;  5J9P C;  1HR0 B;  4O4I B;  4I9Q A;  1AP5 A;  3CC2 V;  1NTZ H;  2JJ2 G;  1FJG O;  1PNK A;  2ZQM A;  4JTC B;  5JJJ B;  1I7F A;  3LDD A;  4GKJ B;  4MTO A;  4LH7 A;  4JTD B;  3ABU A;  5GON A;  1IXM A;  2Y69 C;  3E83 A;  3CC4 V;  5EIB C;  1I5Y A;  4UV8 A;  4FM1 A;  2RJZ A;  2AZ2 A;  2Y4T A;  4BWA A;  5LA6 A;  5CBH A;  3G6E V;  1VF6 C;  3CRR A;  4DW0 A;  1ZSP A;  1IX9 A;  4Z2W A;  2BCC H;  2E76 B;  1K8A W;  2OTJ V;  3BA9 A;  1MOF A;  4B3S O;  4I5S A;  4J42 A;  4JI5 B;  2ATK C;  5A2Q N;  3C3S A;  2ZIO A;  1YDX A;  4UCO A;  4QPK A;  2P5O A;  4GUN A;  4RUE A;  5J2T B;  1ZWI C;  1AVM A;  3QF7 A;  4PI0 A;  2CAZ C;  2RQ6 A;  1K7D A;  1NJI W;  4N21 A;  1IBM O;  4MVM A;  1K4D C;  3DSQ A;  4TV9 A;  3OW2 U;  2E5L O;  1K3E A;  4O4J B;  4RQF A;  3S3W A;  4UVB A;  1Q43 A;  1HNW O;  4IHJ A;  1SQP H;  2PF4 E;  3APQ A;  4B7K A;  4DR6 O;  2QWP B;  2ZNJ A;  3FAV B;  3F7V C;  3HKD A;  4JZG A;  2BTO A;  5KHG A;  4DR2 B;  1EFR G;  2OWO A;  2Q69 A;  3OUS A;  3KKY A;  3B4S A;  1XNQ O;  3KZI Z;  3D3I A;  3SYP A;  1TUB A;  4DK1 A;  1IBL B;  1YJ9 V;  5IJ0 A;  3HKB B;  4LP8 A;  1NQT A;  5JH7 A;  2CUG A;  3SYO A;  4JAA A;  4LF5 B;  3AG2 B;  3AG2 C;  5B1A B;  5B1A C;  1K5S A;  1VF7 A;  4J9Z B;  3TGU H;  2X0L A;  4DR5 B;  1N0N A;  3E22 A;  3G67 A;  2HFE C;  1IZ3 A;  4JI1 O;  4JI2 B;  4ZI7 B;  1AR4 A;  4CS3 A;  1L0N H;  2GV9 A;  1Y76 A;  3JAT B;  1N0J A;  1BSM A;  4JYY A;  4X1I A;  2OYQ A;  2LGQ A;  4IYI A;  4JI7 O;  1GM9 A;  3CD6 V;  2CGO A;  2EIJ B;  2EIJ C;  5H6R A;  2JGD B;  1AJP A;  2DYS B;  4FVM A;  2DYS C;  3EFF K;  2DW4 A;  1COW G;  2E3C A;  2YI9 A;  4D7T A;  1SZT A;  1U96 A;  4OX9 O;  4WBN B;  4CZZ A;  4MVS A;  1WNS A;  1JNB A;  2A0L A;  3A8T A;  2CDY A;  4FLW A;  2H3O A;  4PA9 A;  3CPW U;  4U3J A;  1FJG B;  4DR7 O;  1P49 A;  2DQ0 A;  4CS2 A;  4UV9 A;  4MT8 A;  1B06 A;  3AEI A;  5GTH Z;  3J81 N;  4WFA V;  3BAB A;  3FB7 C;  2PTM A;  3E8F A;  2D3O W;  2NN4 A;  5CA0 A;  1ZAU A;  2F66 C;  4ZOL A;  2QR4 A;  4EKW A;  2WA4 A;  4G27 B;  3TCU A;  2A9H A;  4JI8 O;  4AQY O;  1L0L H;  2Q5Z A;  1R1B A;  4DRX B;  3K3W A;  1BL8 A;  3F5T A;  4YJ2 A;  5C8Y A;  4DV1 O;  1AP6 A;  2EIN B;  2EIN C;  4F6R B;  2C2A A;  4U3F H;  5EK0 A;  5DN6 G;  5L3B A;  4X66 B;  1IJG A;  2AHY A;  2DWE C;  4JZ2 A;  3JSN A;  1DK1 A;  3JAS B;  1BE3 H;  5IY5 C;  2G38 A;  1A32 A;  3UM7 A;  4HAM A;  1BQ0 A;  4PV1 B;  1VF6 A;  2JIZ G;  4HNA A;  2V7Q G;  3JD4 A;  4P2Z A;  3W7S A;  1IBM B;  1KKD A;  3OTO O;  1SER A;  4TUY A;  4LWS A;  2WLN A;  1W59 A;  2E5L B;  1DF4 A;  1ZUQ A;  3VBB A;  3MAQ A;  1GK9 A;  3K5O A;  3U10 A;  3IC7 A;  4GX2 A;  3H1L H;  4OXS A;  4E4E A;  2BE3 A;  4DR6 B;  2CTW A;  3ETQ A;  4Z1V A;  4EEQ A;  4NTW A;  5KUK A;  4CH6 A;  4IYH A;  2WLL A;  3WU2 Z;  3WB0 A;  2ZCE A;  2Q0O C;  3D3Q A;  4J41 A;  3IGA C;  5LOV A;  1XNQ B;  5IYC O;  1IDS A;  2QJ1 A;  2WLI B;  4MVQ A;  1OJH A;  4ZBM A;  3JSL A;  4JAV A;  1H5W A;  4UUJ C;  1GM8 A;  3RYH A;  1KMI Z;  1M93 A;  3EHB B;  2DQ3 A;  3MHS C;  2CH7 B;  4LF4 O;  2ILM A;  4J9Y B;  1Z5W A;  3OE7 G;  3R66 A;  4NB5 A;  1FD9 A;  3ZCC A;  4X1K B;  4XDK A;  4WFB V;  1F4N A;  4TV8 B;  2DJV A;  2IU0 A;  4X20 B;  3CP1 A;  4GX1 A;  3LSU A;  3ZMT A;  1MZE A;  3ABL B;  5LP6 B;  4JI7 B;  3ABL C;  3HKB A;  5LP6 C;  3ZBH A;  4DV6 B;  4YJ3 B;  2PUS A;  1GM7 A;  1R6N A;  3L71 H;  1S5H C;  1VQ5 V;  4GCZ A;  1XL6 A;  2Q68 A;  4FLV A;  3FKS G;  4AIL C;  3JAL A;  2NR5 A;  2JEX A;  4NXM O;  2P06 A;  1Q6H A;  3C90 A;  2MK3 A;  4DV2 O;  1WA8 B;  5IJ9 A;  3SJB C;  1YJN V;  4JI0 B;  2LW1 A;  1SS3 A;  1RPO A;  1R6T A;  2CTQ A;  3B09 A;  2GUZ A;  3K5M A;  3ETD A;  4D6T H;  4MTF A;  1S0V A;  3ZX6 A;  2RN9 A;  4OPA A;  2LFS A;  1NR1 A;  1I94 O;  1JFF B;  1IVS A;  4DR7 B;  5KA6 A;  3T1H O;  2LW7 A;  1VQ9 V;  4YXW G;  1PL4 A;  2DOS A;  1CEZ A;  4I50 B;  3JCU Z;  4DV5 O;  3RVZ A;  4H44 B;  2OCH A;  1R3K C;  1YVW A;  2HHH O;  3I56 V;  2MW2 B;  2GSM B;  1WB8 A;  4MW8 A;  4JI8 B;  2OCC B;  4AQY B;  2OCC C;  1PD3 A;  3P32 A;  1Y4M A;  3RGB A;  3D8C A;  1K33 A;  3K59 A;  1HWY A;  4DV1 B;  5KLV H;  3UO3 A;  3B2E E;  2FML A;  1KQS U;  4TT3 G;  1JR9 A;  4UCV A;  2CE4 A;  3W7U A;  4FLY A;  3CJH B;  1FFT B;  3RFR A;  3IJ4 A;  4X1Y B;  2PI4 A;  3QG5 A;  2LFR A;  2H94 A;  3ZMV A;  1MA1 A;  1XL4 A;  2K9P A;  3ZRW B;  3JAW B;  4A5U B;  1W2B U;  2UXN A;  1H2K A;  3OTO B;  2JVD A;  2QWQ B;  4BW5 A;  2DYR B;  3ETG A;  1S3J A;  2DYR C;  5IYB O;  5DEC A;  3Q4H B;  5KX5 B;  1VAR A;  5IWA O;  2Z0A A;  3OMN B;  4FMT A;  5JQG A;  1GAX A;  4IT5 A;  2YIB A;  1MNG A;  5EYP A;  2YXL A;  3K58 A;  1P7G A;  5HFM A;  3AK2 A;  3ZN0 A;  1Q6U A;  5ITZ A;  2P67 A;  1EM1 A;  5B1N A;  2ITD C;  4LF4 B;  4KP4 A;  4FFB B;  5KAF Z;  1TVK A;  1OCR B;  3OT7 A;  2XAH A;  1OCR C;  1Q8I A;  5BR8 O;  4LF5 O;  2DN9 A;  3K5N A;  5JJE B;  2L35 A;  1KP3 A;  5B1O A;  3LSQ A;  3JAK B;  2N04 A;  4PDV A;  3K5L A;  1QR8 A;  1XDC A;  2Q7E A;  4ZHQ A;  4LNU A;  2PY5 A;  2AW9 A;  4JI3 O;  2QEX V;  5DM6 V;  1F7Y A;  2W0X A;  3CXC U;  2QDO A;  5L3C A;  4K0K O;  1G6U A;  4LC1 A;  2EUL A;  4N23 A;  2XAS A;  2FL4 A;  2B1I A;  4NXM B;  1I0H A;  3TJT A;  4HZ3 A;  4ZKI A;  4H13 B;  4DV2 B;  2ARH A;  4DK0 A;  1J5E O;  1V54 B;  1V54 C;  1FKA O;  5LXT A;  1AI4 A;  3K79 A;  4GT1 A;  2Q4P A;  4UCS A;  5B1B B;  5CMU A;  1JOY A;  5B1B C;  4UXN A;  5AG2 A;  1FAF A;  1VQP V;  2EIL C;  3FYE B;  1XI1 A;  5KMG A;  3T1H B;  3SPI A;  1YHQ V;  3CXH F;  4ASU G;  3E8H A;  1NU1 H;  4DV5 B;  3N2G A;  5GTI Z;  1FXV A;  1VMG A;  1PNM A;  2HHH B;  1VQ7 V;  2R9I A;  1N33 O;  5K1X A;  5CB4 A;  1T5E A;  1NTK H;  3L9D A;  3ZMS A;  4FK5 C;  1PL0 A;  5EBW C;  4KXR A;  3OR7 C;  3ZMZ A;  3P3P A;  3CSX A;  4JAS A;  1E79 G;  2EIM B;  2EIM C;  3J7A U;  3G4S V;  2CGN A;  3CMA V;  5LYJ B;  1JCH A;  1QR9 A;  3JAR B;  2BTQ B;  1VQN V;  2PI5 A;  3AK3 A;  4I0X B;  1S5J A;  3RYI B;  4NXN O;  2HVK C;  4DUZ O;  1S5L Z;  5KHK A;  3QTC A;  1M5I A;  1RSO B;  4JYC A;  1BMF G;  2M6Y A;  1O9G A;  4LH6 A;  1URF A;  4X66 O;  2KKW A;  5IT9 N;  2Y48 A;  5D5P A;  2AGA A;  5F2V O;  1GO3 F;  1V9P A;  3SGI A;  4ZIB A;  5IWA B;  2VWK A;  4I4T B;  4RWU A;  2EX3 A;  2Q6A A;  1D5A A;  2Q0A A;  3OM3 B;  4O2B A;  3HKC B;  3ZMU A;  3CX5 F;  3CRC A;  1F23 A;  1HW7 A;  4LF6 O;  1F4M A;  3EXA A;  1Y74 B;  1NH2 B;  3UQ8 A;  1P84 F;  4BIZ A;  2HVJ C;  1M57 B;  2BSK A;  2DMX A;  4F6E A;  1VQK V;  1YTF D;  1M57 C;  4B08 A;  3AG4 B;  3AG4 C;  1NBM G;  1BHB A;  5FNV B;  1MSW D;  1XEQ A;  2A79 B;  2GDS A;  4O4H B;  4XDL A;  2YEV B;  4GKK O;  2ZDI C;  4MTX A;  1AJN A;  3UCS C;  2D2C B;  2Q9L A;  1GRJ A;  3N2K A;  1WPX A;  3FYI B;  3WG7 B;  4X89 A;  3K08 A;  3WG7 C;  1Q82 W;  5BR8 B;  3UKM A;  3BCC H;  4CH5 A;  3SDL A;  5J2U B;  1FXK A;  1L1F A;  4O2A A;  1SA0 B;  4H37 A;  5E1A C;  3ZRX A;  1FFX B;  3FB5 C;  4JI3 B;  2FB5 A;  2YI8 A;  4EB6 A;  2KG7 B;  2YXH A;  1YIJ V;  2Q73 A;  4J10 A;  1IXB A;  4K0K B;  5FL7 G;  4L87 A;  2HLD G;  4H0L B;  5H9C A;  1XIL A;  2ZM6 O;  1VQO V;  1OZ0 A;  4IIJ A;  4FFB A;  1J5E B;  3KCX A;  4DV6 O;  2YSU B;  1KUQ A;  1AI5 A;  1JX9 A;  3CB2 A;  5JCO A;  3JD1 A;  1MAB G;  4UVA A;  5JVD A;  4JI0 O;  3ZIA G;  4PA7 A;  1R3J C;  1D5N A;  4KL1 A;  5KA5 A;  5BZB A;  1YIT V;  4LFA O;  4QE9 A;  2FYU H;  4RQE A;  2X7R B;  4QIW F;  3O65 A;  4B3R O;  2DE0 X;  2IW5 A;  2WLK A;  4LBE C;  1N33 B;  2XTA A;  5C93 A;  3N27 A;  2QKS A;  2V1D A;  3ASN B;  4RAI A;  1KB9 F;  5BMV A;  3ASN C;  2ZIM A;  5L3F A;  2UXX A;  3FB8 C;  3PJS K;  3WFV A;  4X64 O;  4PDR A;  4O4L A;  3M7M X;  2VS0 A;  2NLJ C;  1S72 V;  1KBH A;  1YJW V;  3RN4 A;  4I55 A;  4NTY A;  2F4V O;  2RCV A;  1G1X B;  4NXN B;  5LHG A;  1KP2 A;  4DUZ B;  1M4U A;  1MMM A;  3SYQ A;  2KB1 A;  4O4I A;  1H38 A;  4LF8 O;  4TWK A;  3SPC A;  2F43 G;  3JD3 A;  4WFE A;  3P30 A;  4WCE V;  2QM7 A;  2PYL A;  2QWN B;  4PJ0 Z;  1XNR O;  3H1H H;  1E1Q G;  3M99 B;  5EBM C;  1ZTE A;  2E74 B;  3CYO A;  3CCU V;  2R9R B;  4JI4 O;  5CA1 B;  4J80 A;  3CE2 A;  1I08 A;  5LL6 Y;  1H2L A;  2Y4U A;  1ZL8 B;  5DED A;  4LF6 B;  1SQX H;  4DXW A;  1Q3E A;  2YC0 A;  3ML0 A;  3RBZ A;  1AB3 A;  2GBO A;  3HB3 B;  1XMQ O;  5EZY B;  4RO2 A;  3JCZ A;  4F4L A;  2P4V A;  1E1R G;  2YDE A;  1TA8 A;  3GB7 C;  2E75 B;  5CA3 A;  1QLE B;  5H5N A;  4PEL A;  1BT8 A;  1QLE C;  3ZJZ A;  4JAU A;  4GX0 A;  3BHP A;  3RYC B;  2R70 A;  3CCV V;  5BY1 A;  5J2T A;  5BXZ A;  1XBL A;  2WWW A;  4GKK B;  1TAE A;  1BCC H;  3ZHU A;  4G2K A;  2QM8 A;  2X6C A;  1YXB A;  1US6 A;  2PGG A;  4U7N A;  4AI8 A;  4O4J A;  4E2L A;  3L74 H;  4BIO A;  4KFM A;  2B9Z A;  3SR2 C;  3AG3 B;  2GTS A;  3AG3 C;  2CTR A;  1ZLZ A;  3DTU B;  1WB7 A;  3FAV A;  2HKO A;  3OTF A;  4X62 O;  3SPG A;  3QVN A;  2QKC A;  3VQV A;  3SJC C;  2JK5 C;  3WB2 A;  4OPH A;  4O4H A;  1RM1 B;  2WLM A;  1L8D A;  1S76 D;  1RM1 C;  1YCI A;  2ZM6 B;  3HKE B;  4K35 A;  3ZHS A;  4GLX A;  2ZDI A;  3K06 A;  3BRC A;  1JVM A;  2UXD O;  3DC6 A;  3H1K H;  5FPO A;  3CCL V;  1KU9 A;  1Z5V A;  3E89 A;  1QQC A;  3LUT B;  2HJD A;  4GX5 A;  2IJH A;  1I5X A;  4LF7 O;  1OCO B;  3CS5 A;  4TSF G;  2XT9 A;  3OR6 C;  1K9M W;  3E8G A;  3UT5 B;  4K8Z A;  1Y67 A;  4LFA B;  1X59 A;  3RYF B;  1LUW A;  3IFX A;  5KHJ A;  4R7C A;  1K92 A;  1ZX3 A;  4ZI7 A;  4B3R B;  4BW9 A;  2EIK B;  3ASO B;  4LFB O;  2EIK C;  3ASO C;  3CEI A;  3U0Z A;  1ARO P;  4UVC A;  4X9Q A;  1R3I C;  1VEW A;  3JAT A;  3LSS A;  2YUA A;  5GON B;  1DLB A;  2JGD A;  4WFF A;  4X64 B;  4X65 B;  1YEW A;  5LA6 B;  1B04 A;  2YS8 A;  3TXQ A;  1OV9 A;  4NTX A;  4UB8 Z;  4DR3 B;  5D5Q A;  4DUY O;  1QLN A;  4MVR A;  3HPL C;  4WBN A;  4KHP O;  4OGQ B;  2F4V B;  1SZX A;  1MG1 A;  4X88 A;  3OFN G;  2EBO A;  5LGT A;  4J7J A;  3K03 A;  3SJA C;  4LF8 B;  2W6I G;  2XAF A;  2ZIN A;  4LR3 A;  3QO7 A;  1DTO A;  3JAM N;  4XDJ A;  4PD4 F;  2ZE7 A;  1XNR B;  3K04 A;  1JJO A;  1VIB A;  4BAY A;  4JV5 O;  2ZKO A;  3R65 A;  5HFL A;  2ZR3 A;  2R72 A;  4JI4 B;  3CME V;  2P6J A;  2HR3 A;  1JA8 A;  1PV0 A;  5KUM A;  1OHH G;  5JWP A;  4CH3 A;  4TV9 B;  1M1K W;  2UUA O;  3ZHQ A;  3IAY A;  3T4Z A;  4AHC A;  2IH3 C;  4DRX A;  2UXC O;  4TQF A;  1XMQ B;  4IHJ B;  3GWO A;  1PNL A;  4F6R A;  4J11 A;  4WFH A;  3HKD B;  1LNQ A;  1H8H G;  3VQW A;  4ICG A;  2XND G;  1NI8 A;  3B8N A;  5IYZ B;  2OTL V;  2ZNI A;  4ABM A;  3JAS A;  1QNM A;  1TUB B;  3FFQ A;  5IJ0 B;  3TK1 A;  5JH7 B;  1VQ4 V;  2EJR A;  3STL C;  4YIP A;  1XHZ A;  3RVY A;  1QCE A;  4FLZ A;  2A06 H;  2Q8V A;  1MSD A;  3W7X A;  5IE9 A;  1VQ6 V;  2QM4 A;  1JMK C;  5IYD O;  3E22 B;  3E35 A;  3ICX A;  4UCR A;  3NXS A;  4X62 B;  1QVG U;  4DV7 B;  3BAA A;  3A0R A;  1JJ2 U;  1OCC B;  1UFI A;  1OCC C;  3JD0 A;  3J80 N;  1SF9 A;  4DW1 A;  4RUF A;  1Y6X A;  2ZD9 A;  2YID A;  1Y76 B;  1NTM H;  1M90 W;  2UU9 B;  4X1I B;  2WLI A;  3CRA A;  1PM9 A;  3B77 A;  4B3T O;  2UXD B;  3KDR A;  4H33 A;  1TUE B;  1Q90 D;  4LF7 B;  1Q5O A;  2EZP A;  2CH7 A;  4Z1M G;  4CC6 A;  5LGU A;  4FLT A;  4CBC A;  1GTO A;  2WSS G;  1UJW B;  4MVO A;  4X1K A;  4U3J B;  1KC8 W;  1AR1 B;  4LFB B;  3BVO A;  4TV8 A;  4DV3 B;  1GKF A;  4X20 A;  2K1E A;  1LUV A;  4HBN A;  5LP6 A;  4YJ3 A;  3ZRS A;  4IGG A;  2QTO A;  3RW0 A;  5CA0 B;  1FS0 G;  1MZF A;  2B1G A;  3G80 A;  4ZOL B;  1YF2 A;  2HG5 C;  1WA8 A;  1VQL V;  4P30 A;  3WB1 A;  4DUY B;  4WF9 V;  5E79 Z;  4FZ1 A;  4KHP B;  1N34 O;  4J7Z A;  3QO5 A;  4NKG B;  1KD1 W;  4YJ2 B;  3AK1 A;  5C8Y B;  2ADP A;  2HEP A;  2EJ7 A;  3DXR B;  1XOU A;  1JFF A;  2FTK A;  5FPR A;  4DR4 O;  4C7U A;  4I50 A;  2RMK B;  2Y69 B;  4JV5 B;  3UO2 A;  4EFE A;  3BEH A;  4QPJ A;  4TOI A;  1DF5 A;  2AHZ A;  4DV0 O;  4JYA O;  3B8M A;  4PI2 A;  1WP7 A;  4HNA B;  4Q6G A;  1TGO A;  3CCR V;  4FM0 A;  4TUY B;  4LWS B;  1NT2 B;  2UUA B;  2OIE A;  2UUC O;  2UXC B;  4P9O A;  1H2G A;  4PDM A;  4CS4 A;  3GWK C;  1AR5 A;  2AZ0 A;  3OGI B;  1SQG A;  2WLL B;  1HNZ O;  5CBG A;  5KHH A;  4DV4 B;  1Y66 A;  2BOC C;  3ETE A;  3CJH A;  2JRI A;  5LOV B;  2DWD C;  1YZB A;  1XHX A;  1BHA A;  4X1Y A;  2XHB A;  3OMA B;  3M8A A;  3CCQ V;  3ZRW A;  3JAW A;  2YXY A;  4B7E A;  1N32 O;  2IJK A;  3RYH B;  3DC5 A;  2Q67 A;  3A0B Z;  3CRM A;  3F5W C;  4K8X A;  3Q4H A;  5KX5 A;  2ETN A;  4FLU A;  2ZE8 A;  4NYK A;  2LP7 A;  2IBZ H;  3ZN1 A;  3STZ C;  3AG1 B;  5L3D A;  3AG1 C;  5LBQ A; 
#chains in the Genus database with same CATH homology
 1AVM A;  3OT7 A;  1XIL A;  1LUW A;  1WB8 A;  3C3T A;  1QNM A;  2CDY A;  3CEI A;  1IDS A;  1EN4 A;  3AK1 A;  4X9Q A;  1VEW A;  1XDC A;  4YIP A;  2ADP A;  3IC9 A;  3K9S A;  1EN5 A;  2AW9 A;  1GN6 A;  1B06 A;  1MSD A;  1XUQ A;  2P4K A;  4C7U A;  1GN3 A;  4JZG A;  1BT8 A;  1D5N A;  1JR9 A;  1I0H A;  2CE4 A;  3TJT A;  3KKY A;  1XRE A;  1SZX A;  1AP5 A;  2ADQ B;  1MA1 A;  3MDS A;  1PM9 A;  4F6E A;  3KDR A;  1AP6 A;  3LSU A;  4FFK A;  5AG2 A;  1ZLZ A;  1AR5 A;  1VAR A;  1WB7 A;  2GDS A;  1N0N A;  4JZ2 A;  1BS3 A;  3QVN A;  2QKC A;  3RN4 A;  1ZSP A;  1GN4 A;  1JA8 A;  1IX9 A;  1AR4 A;  2RCV A;  1MNG A;  2QKA A;  1MMM A;  1KKC A;  3DC6 A;  1N0J A;  1BSM A;  4JYY A;  1P7G A;  3AK2 A;  1ZUQ A;  1LUV A;  3BFR A;  3DC5 A;  3C3S A;  1EN6 A;  1PL4 A;  4E4E A;  4YIO A;  1IXB A;  1EM1 A;  1ZTE A;  4GUN A;  1GN2 A;  4BR6 A;  3AK3 A;  5A9G A;  1I08 A;  1Y67 A;  3EVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...