1XJ2A

Co-bound structure of bjfixlh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj2A00
2EA9A 2WKRA 5A8BA 4NXGA 1G28A 1UGUA 4F3LB 4GCZA 4HI4A 2V0UA 5KIZA 1X0OA 5TBMA 2YKHA 3UE6A 3CAXA 3E4OA 4KUKA 1GSVA 3MQQA 5EFWA 4DJ3A 3SW1A 3UB7A 2ZBBA 5HDDA 2QWSA 4R70A 2PD8A 4HIAA 1GSWA 4WUJA 3F1PA 3A0VA 1T1BA 1DRMA 3K3DA 5HD5A 3G6OA 3F1OB 3LUQA 2V0WA 4JGRA 3H82A 4EW7A 1OJGA 4WN5A 3UMEA 3FC7A 2L1MA 2KDKA 1TS8A 5HDSA 2VV8A 2P7JA 4HP9A 5F69A 3IS2A 4I3IA 1LL8A 1JNUA 3LIFA 3EWKA 4WL9A 3IS2B 4HP4A 3HJKA 3F1NA 5HWVA 2VLGA 4I3AA 1V9YA 3T50A 2M1CA 2A24A 3HJIA 1TS0A 1ODVA 1OTBA 1XFQA 2VV7A 2A24B 2INWA 1WA9A 3A0RA 4GHIA 3GECA 1D7EA 1XJ4A 5DJTA 2B02A 3BY9A 4YWZA 2PR6A 2H28A 5AVFA 2V1BA 4RQ9A 2KX6A 3C8CA 1DP8A 4EQ1A 2J80A 1F98A 4NXEA 4R3AA 1OT9A 3E4PA 3LIDA 3MXQA 1OTDA 1S66L 1NWZA 3ULFA 1XJ6A 4EESA 4WLAA 1P0ZA 2ZOIA 4H6JB 1LSVA 3UB6A 4DJ2A 2JN7A 5HWWA 3P7NA 2PYPA 4I3JA 5TBMB 3BWLA 1Y28A 5F5YA 3EEHA 5HZHA 3LIAA 4PKYG 1BYWA 3F1PB 1TS6A 5J4EA 5J7EA 3MQOA 1OTEA 3H82B 2VV6A 4HJ6A 2QJ5A 2WKQA 4I39A 3LYXA 3FG8A 2QJ7A 4KQDA 1V9ZA 4JGQA 5F6AA 4HHDA 2I9VA 2HV1A 2OWJA 3C2WA 3UMDA 2WKPA 3F1NB 3H9WA 3LICA 1VB6A 3UB8A 1OT6A 4HH2A 3MFXA 2ZOHA 3IBRA 3VE3A 3H7WA 1LT0A 1T19A 2OOLA 1EW0A 4JGOA 1T1AA 4BBTA 4E04A 3UB9A 2PR5A 3E4QA 5AVEA 3RTYA 4GHIB 2W27A 1LSWA 3CWFA 1GSXA 2L0WA 2Z6CA 5DKKA 4HQAA 4HJ4A 4GS9A 1DP6A 2K7SA 3LIEA 4EXOA 4L9GA 1MZUA 3NOPC 3NOUC 3KX0X 4BBVA 2YKFA 3NOTC 1LSXA 4GW9A 1XFNA 2D01A 3ZQ5A 4HJ3A 4M4XA 2CMNA 5G4ZA 3NHQA 4LRZE 1UWNX 2V9AA 3B33A 4HNBA 2QHKA 3OLOA 3D72A 4EEUA 4NXBA 4WF0A 4K08A 5I5LA 4LRYC 1T1CA 4I5SA 1TS7A 5IS1A 2PHYA 1S4RA 3F1OA 5DKLA 1DP9A 1S4SA 5F68A 5G4YA 2GJ3A 1F9IA 1XJ2A 1N9LA 3CLOA 1OTAA 2R78A 2L4RA 4JGPA 1UWPX 2V1AA 4LRXC 4R38A 3K3CA 3MR0A 3LIBA 3NJAA 4I38A 1N9OA 3PHYA 4KUOA 3GDIA 5HD3A 4HH3A 2JHEA 4PKYA 4LPZA 4NXFA 1XJ3A 3RH8B 2W0NA 3A0SA 2VEAA 4BBUA 1KOUA 1OJ5A 2D02A 5IU1A 1D06A 2BASA 3MJQA 4MN6A 4EERA 3ICYA 4EEPA 2OWHA 1S1ZA 1S67L 5HDCA 3H7WB 2QKPA 4L9FA 4B9OA 4LLOB 1T18A 5HSQA 2Z6DA 4L9EA 3PYPA 5J3WA 1S1YA 2PDRA 3VOLA 3VE4A 3LI8A 1P97A 4GS9B 4HOIA 1N9NA 4R6LA 3BY8A 4XT2A 4MN5A 3LI9A 5HWTA 4EETB 1OTIA 4HY8A 4F3LA 4XT2B 4H6JA 2PD7A 2PYRA 5DJUA
chains in the Genus database with same CATH superfamily
5FQ9A 1LI0A 4OVDA 4WBGA 4HI4A 1ZTUA 5FEFA 5KIZA 4EUZA 1X0OA 2ZC3B 3IX8A 3CAXA 4KUKA 3P01A 1GSVA 3KYQA 4RX2A 4MNRA 5EFWA 4JKTA 2OLUA 2WYXA 3CMZA 1O7EA 4R70A 2PT7A 4B88A 3F1PA 3C7UA 3K3DA 3G6OA 3BM6A 3F1OB 4JGRA 1OJGA 4GKUA 2EX6A 1XP4A 3T4QA 4WN5A 5KSHA 3HUOA 3BYDA 1GHIA 2QYBA 1CF0A 1K54A 1XXMA 2VV8A 5FQQA 1EWZA 2P7JA 3LY3A 2Y91A 1YLTA 3FKVA 2RL3A 3WS4A 3RFBA 5F82A 1K57A 4WL9A 5DFYA 2H5SA 3LR0A 3MBZA 4HP4A 3UY6A 1KGGA 4XXRA 1ERQA 4WMCA 2M7UA 2A24A 1TS0A 1A0KA 2WGWA 2KLIA 1XFQA 3B3XA 5EVIC 4BD1A 4ETZA 4MEZA 4Y3IA 2M7VA 4EQIA 3ZG5A 3A0RA 5F1GA 4GOGA 4U0XA 4YWZA 1JTDA 1YLZA 2IWBA 3HLFA 1QMFA 2XROA 2WUQA 2V1BA 2A3UA 4K0XA 1K25A 3C8CA 3NIAA 5FATA 4PAUA 2J80A 2J3TD 5HW3A 3RJUA 4NXEA 4WELA 4O0PA 5A91A 3E4PA 4QU3A 3L9KA 4KZ5A 4E3NA 1OTDA 4HBUA 2Y4AA 1JVJA 3ULFA 3BJNA 4K0WA 3VSKA 3OOVA 4H6JB 1LSVA 3UB6A 1ZG6A 3IWOA 1PFLA 4RX3A 2FFYA 2JKTM 5HWWA 4GJ4A 4GD8A 4ME4A 2BTFP 3G2ZA 5FI2A 5F5YA 1IYSA 2OSUA 3IHAA 3ZDJA 2XDMA 3UPNA 1Q2QA 5FAQA 3BFGA 4PKYG 3PBOA 3IX4A 1BYWA 4BWIA 1ES4A 1GA0A 5DFXA 3F1PB 3K2NA 5J4EA 1FQGA 1XA1A 3NULA 5J7EA 1W79A 5CXWA 3JYIA 4KENB 2PU2A 1YLWA 4PM7A 2HDSA 2JE5A 5E2EA 2MJ6A 3FV7A 4PM8A 4I39A 2WKIA 1CK3A 3FG8A 4Z1WA 4WZ5A 4QY6A 4LV0A 1H8YA 3AGEA 3VV4A 3LR4A 5DTSA 2Y2GA 2NUPC 3ZG0A 2Y2QA 3GMWA 2ZQ9A 1OMEA 4UA7A 5EVID 3UMDA 2HDUA 3FZCA 3H9WA 3LICA 5GL9A 1VB6A 2DCFA 5EVLA 3JVVA 2WAFA 2G2UA 1PYYA 4YNRA 3QNBA 3OPHA 1K4FA 4CPKA 1ALQA 1DJAA 1EW0A 1G68A 3IF5A 3UB9A 3B42A 2ZMVA 3E4QA 5AVEA 1LL5A 3RTYA 1LSWA 4KZBA 4BQMA 3G34A 2XGNA 4FCFA 4KQOA 2Z6CA 3BRMA 3DWKA 1Z6FA 4IEDA 1HLUP 4OQHA 4IVIA 4EXOA 4L9GA 3DTEA 2AVXA 3W4PA 2E8IA 5M18A 4E3JA 5IHVA 4ZJ2A 2ZQAA 3ZCZA 2YKFA 2VZWA 1NLYA 2V20A 1XFNA 3HBRA 5FSRA 1XKZA 2D01A 3ZQ5A 4HJ3A 1YSPA 4LRZE 3N6IA 3VP1A 2VK3A 4CLCC 3E98A 4MCWA 4ZRRA 2Y2MA 4CJNA 4N9LA 3UDIA 2I72A 5D3OA 5CHJA 3NDGA 1T1CA 3OPLA 1YMSA 2GZAA 1SCWA 3IF6B 1TS7A 4UA9A 3KSFA 2H0YA 3D9YA 5C5KA 1GA9A 3U2AA 5CHMA 1W7FA 1ESIA 3IH9A 3ZFZA 4ZJ3A 5F68A 1M40A 4LGWA 5G4YA 4YINA 3SH7A 4WZ4A 1BT5A 5CRFA 4Y0OA 3NECA 5F83A 3ZGAB 5HPFA 1ACFA 2R78A 2L4RA 1EROA 4FOFA 1UWPX 2V1AA 4PM9A 3K3CA 4EWFA 5HARA 1ZHHB 3O5YA 1N9OA 3PHYA 4WM9A 5FEGA 3PBNA 1BSGA 4QHCA 3KSGA 5J8XA 2D02A 1MKMA 3MQ0A 5IU1A 2JKGA 2BASA 5E2FA 3MJQA 4EERA 1IKGA 3A3EA 5MC7A 3T1QB 1MPLA 1BULA 1S1ZA 5HDCA 5CEBA 1MBLA 1Q2PA 5E2HA 2P74A 1KE3A 2Z6DA 3IXBA 1NZUA 3VOLA 1E3UA 3VE4A 3KSHA 2C5WB 4P85A 4ETXA 4R6LA 3BY8A 4ARZA 3IXDA 3UPPA 5HWTA 4Q0HA 2IA2A 2ZMFA 3N8LA 4Q0IA 4QB8A 2ACGA 1MWSA 1PI5A 4CLCD 1VEUB 2PD7A 4KZ4A 2PYRA 4D60A 5DJUA 3E0YA 1K4EA 2JKRI 2WKRA 5KMWA 3HLDA 1G28A 1PRQA 1UGUA 3WWXA 4OPZA 4F3LB 4GCZA 2V0UA 1FR1A 1JWPA 4A5RA 4ID4A 4JF5A 3E4OA 3PR6A 4MLLA 2B95A 5DF7A 3PBSA 3MF0A 4DJ3A 3IHBA 4II7A 2PD8A 1GSWA 4WUJA 3CUEA 3BFDA 1TDGA 5HD5A 4JBFA 1NRFA 4BENA 3SZTA 2DRWA 4UEYA 3H82A 2ZC4B 4MBFA 4DXCA 3UMEA 5GLCA 2L1MA 4RA7A 2KDKA 1TS8A 4X55A 3E2LA 5HDSA 5EM1A 4Q0JA 1MWRA 3QP2A 2O99A 5HX9A 2XH9A 2X02A 4E3IA 2WKHA 5JYOA 1H8ZA 4OQ0A 3LIFA 3T1SA 3EWKA 5HAQA 4B93A 3DTKA 2E8JA 3G32A 5FASA 2VLGA 4KZ9A 1SKFA 3T50A 1I2SA 1ES2A 3BFCA 3HJIA 1OTBA 1S6RA 2K31A 2FZ0A 1DJBA 2WZZA 1EI5A 1PWCA 4EU0A 3R4KA 3O88A 3MFDA 4GHIA 3GECA 1XJ4A 2VA0A 2PU4A 3BY9A 2HP5A 2XF3A 1K0KA 2PR6A 4NG2A 2H28A 4OH0A 3JPUA 3S7PA 3TW8A 1PW8A 3IWQA 3UDXA 4JXSA 4XUZA 3PXPA 1ONHA 5AJGA 1OT9A 2WADA 3LIDA 1K6SA 2WKEA 1ZG4A 2W3EA 2KOIA 2EX8A 4NETA 4EBLA 3BECA 3C5AA 1P9RA 1MXOA 1P0ZA 2Z2MB 5FAPA 3C30A 4E6WA 4BD0A 4YFMA 4P6ZS 3MZEA 4LCMA 2CC1A 1AWIA 1N9BA 2PRFA 3RXWA 1K55A 2PYPA 4I3JA 3BLSA 4E3KA 4S2JA 3BWLA 2UV0E 1TVFA 2W1RA 3P98A 4IVKA 1C3BA 1KE4A 1L0GA 4NK3A 2EX2A 3LIAA 3CJMA 3TRCA 5CGXA 1MC0A 4JXGA 1RCJA 2X01A 3QHYA 3OBFA 1PNEA 1TS6A 1CEGA 3BW6A 3T4LA 3MQOA 3SS5A 3WS2A 1OTEA 3H82B 3UNWA 3EGXC 3IH8A 4GLQA 1FCMA 3IBJA 2QJ5A 3VP4A 1H3QA 1XPBA 4QY5A 2PBDP 4KQDA 1OPXA 3QP1A 5AQ7A 5F6AA 4PM6A 4WEKA 2WGVA 2EWWA 1BLHA 5I94A 2HV1A 2OWJA 3WS1A 3W4OA 3DAVA 3Q7VA 1FSYA 1MKIA 1WYBA 5U47A 2ZC7A 3W4QA 1GCEA 2IWDA 3ISGA 4OPRA 3MFXA 4R23A 4AFIA 1T19A 2OOLA 3DTIA 5GHZA 4YOFA 4GHIB 1YAXA 4Y2FA 5TR7A 1HD8A 4O01A 2R9WA 1P9WA 3T1XA 5GLAA 4R3BA 4GS9A 1I5QA 4CQHA 1DP6A 1PWDA 5FQMA 4HBTA 4P6ZM 2EFUA 4R4RA 1MZUA 3IT9A 3KX0X 2GDNA 3M6BA 3SH9A 3T12B 3G31A 3RXXA 4OOMA 2VGJA 3UE1A 3V50A 2W3HA 5AQ9A 4NEED 4P87A 1VHMA 4C6YA 2CMNA 4M3KA 3NHQA 4GB7A 3HLBA 1IYOA 4X1MA 4UQIS 4HNBA 2XQZA 3IF6A 3OLOA 3DW0A 3D72A 2FH5A 4EEUA 4NXBA 2Y59A 3Q1FA 1CJFA 4WF0A 5EUAA 4ZTKA 1BLSA 5EVEA 5A92A 3DWZA 3KYEA 3M2KA 1S0WA 5DKLA 4DKIA 1DP9A 1S4SA 2HJEA 1SHVA 2GJ3A 1F9IA 2P04A 4MDZA 4RYEA 3FKWA 3WS5A 1VETA 5G18A 1CQAA 4JGPA 4C3QA 5EOEA 2Y55A 2P9VA 4DE0A 3ZYTA 1FILA 3BFEA 1FOFA 3LIBA 4N92A 4EBNA 4I38A 3L7HA 2ZL1A 1W8YA 4Y0UA 3N4IA 4HH3A 5L8MA 4JXVA 2GX5A 4PKYA 1SDEA 4UHUA 4LPZA 1XJ3A 1PWGA 2W0NA 3Q7VB 5DTKA 2VEAA 1YLYA 3HLGA 4BBUA 4O7DA 4S2NA 1OJ5A 1ZC2A 1DY6A 4FH4A 1W8QA 3CHWP 3ZG7B 1NY0A 2ZQCA 4JLFA 3ZHHA 1KDWA 3S7QA 1NYMA 4L9FA 3PAEA 4S2IA 5GHXA 4EUVA 5FAOA 4B9OA 2Y2OA 3O3VA 1S1YA 3FPWA 1RGZA 1G6AA 2ZLYA 1YMXA 3U4LP 1P97A 5A93A 4GS9B 4N1XA 5FQIA 5CECA 5L09A 4OLGA 4UQIM 1VEUA 4N1HA 3LI9A 1N4OA 3NC8A 1XX2A 1IOUA 3OPPA 4HY8A 3C38A 4F3LA 5FDHA 4DE2A 3C4PA 4OQGA 5A8BA 4Y13A 4S2LA 4NXGA 1K56D 4C75A 1LHYA 1RGYA 2HF6A 5TBMA 2YKHA 4G3KA 3W8KA 1K54C 3V5MA 4GDBA 3HUNA 4Y7PA 3MS6A 2PAVP 5BOHA 4U0TA 1G6OA 5HDDA 5AQAA 1NZOA 3AGDA 1K57C 2V8CA 2HGVA 2WGIA 3DTMA 4R1GA 2ZMAA 1SZVA 5DTTA 2XLNA 5FI6A 4DE1A 2B18A 4Q8IA 4BLMA 4QJGA 4S2KA 5F69A 1VETB 3MKEA 5E43A 4IUKA 2P9VB 4I3IA 4KZ3A 2Q9MA 3SOIA 1LL8A 1L3LA 5CGWA 1PW1A 3IS2B 3GV9A 3F1NA 1LI9A 2ZL1B 4I3AA 1V9YA 5FA7A 1F5MA 5GHYA 4QD4A 2W3GA 3G4PA 2NUTC 3PBQA 2VV7A 5KZHA 4Y15A 4DE3A 2WZXA 1L0FA 3V3RA 1TEMA 3HL9A 2ZQ7A 2OLVA 3N8SA 4UA6A 3GTCA 5FL3A 4HESA 2OV5A 5AVFA 4IBRA 3ZVWA 3ITAA 1DP8A 1ERMA 4HEFA 4EQ1A 1Z09A 1FIKA 1K38A 3S7OA 3FYZA 3Q7ZA 3UE3A 5EVIA 3A3FA 4DXBA 3CG5A 1NWZA 4X1LA 2XFSA 5L10A 3CI6A 4GNUA 4EESA 1H8MA 1W63M 3TJZC 3HLEA 5CERA 3FWLA 5E2GA 4JF6A 3EQVA 4DJ2A 3P7NA 4L0LA 1FCNA 3ZG9B 1BLPA 5TBMB 4KZ6A 2O9CA 3S4XA 3EEHA 3ZG8B 1CI9A 4WZ5C 3Q07A 4P6BA 3VOZA 3O86A 2JKRM 3IXGA 4FTXA 4WMCD 2W3DA 3VFHA 1KVMA 1KGEA 4S2MA 4IJGA 2DMWA 4CLCE 2HP6A 2XA7S 3A3DA 4X68A 2VGKA 4OOLA 3C4OA 1K6RA 3TG9A 1CEFA 3B47A 1M6KA 1TD5A 2B5RA 4HJ6A 1HTZA 4R4SA 3BQAA 3PBTA 2QJ7A 3A3IA 1V9ZA 4JF4A 3V3SA 1HVBA 3IXHA 4MMNA 4HHDA 3ITBA 4KZAA 5L2FA 3LY4A 2J8YA 2I9VA 1H5XA 3V39A 3C2WA 1U60A 2WKPA 3F1NB 4JPMA 3VP2A 1YKDA 2QZ6A 3UB5P 1D1JA 3TOIA 1YSQA 4E3MA 3UB8A 3MXSA 1OT6A 3KSIA 3LEZA 4R0QA 3H7WA 3C7VA 4JGOA 1T1AA 3QP5A 4E04A 3WRZA 3WS0A 2W27A 4DRTA 1XGJA 3CWFA 3NCKA 1GSXA 2Z2LB 5CX7A 3S22A 3T4KA 4HJ4A 4Z9QA 3VFFA 3LIEA 3NOPC 3NOUC 3I7JA 2WK0A 3SH8A 3N8RA 4ZAMA 4IHQA 4BBVA 3O87A 2HDRA 3KYZA 2QPNA 1E25A 3GQZA 4X6TA 5EVIB 1LSXA 5F1FA 4M4XA 3A3JA 3HLWA 4KG2A 2XA7M 2XR0A 4JXWA 3B33A 4IUHA 2QHKA 1VQQA 2FFFB 1IEMA 4X56A 1DJCA 4K08A 1W5DA 2XEPA 3OCLA 4MBKA 2ZM2A 1W63Q 3HCYA 1PI4A 4B4ZA 3EOIA 1BLCA 1STZA 3MMHA 1S4RA 1PIOA 4OOYA 1PZOA 2UWXA 1ES5A 4OPYA 4KZ8A 1J3WA 3PTEA 1WYCA 1XJ2A 5CGSA 3DBAA 4CLCA 1ONGA 1OTAA 4ZBEA 2JKFA 3M2JA 3Q82A 2J3WA 4D2OA 1KE0A 2ZC6B 4LRXC 3MR0A 4K91A 3MKFA 3SS4A 3T4OA 2J9OA 3GDIA 5HD3A 2O9BA 4KQQA 1YLPA 4NXFA 5L07A 5K5BA 3A0SA 2JCHA 3LGOA 5GLBA 3TSGA 2OAQ1 1FCOA 5AQBA 4MN6A 4EEPA 2XRNA 2Y2KA 4LFUA 1S67L 2G7UA 3H7WB 2QKPA 1FR6A 3BFFA 5HFOA 2VJWA 5EE8A 4LLOB 3D3OA 1T18A 1H0MA 4L9EA 3MZDA 1J9MA 1IYPA 4ZDXA 3OZHA 3LI8A 5TFQA 3R7WA 3EEAA 1L2SA 4BJPA 4HOIA 1N9NA 4BL2A 2JKTI 4MN5A 4P0MA 2J9PA 2LB9A 3NY4A 2QMIA 1OTIA 3Q81A 4EETB 3BEBA 5IT5A 4RVAA 2PBYA 3IWIA 3CUEC 4XT2B 2Q9NA 2EA9A 4MBHA 4KZ7A 3LCEA 3BLMA 1IKIA 4FSFA 4Y0TA 3UE0A 3UE6A 3HUMA 1JWZA 3LFVA 3MQQA 1SKOA 5DF8A 3SW1A 3UB7A 2HJ9C 2ZBBA 1ES3A 5A90A 1I2WA 2QWSA 5CHUA 2XD1A 4HIAA 3A0VA 2JBFA 4IBXA 1T1BA 2EXBA 1NLZA 1DRMA 2XD5A 2ZM0A 5EV0A 1NRJA 2LB5A 3NDEA 3LUQA 2V0WA 4EW7A 4E3LA 3PBRA 3LR5A 3FC7A 5EM0A 2Y2HA 5DVAA 3CITA 1Y4OA 4GZBA 4CLCB 1L0EA 4HP9A 3IS2A 1E3UD 3IQAA 1CI8A 1FSWA 1PZPA 3GR2A 4X69A 3OPRA 2VGLS 1JNUA 4EBPA 3IX3A 3HJKA 4GN2A 4OKPA 5HWVA 3UO9A 4WYYA 4OLDA 2M1CA 3LR3A 2Y8HA 1ODVA 3UDFA 4DDYA 1IFQA 3VP3A 2Y2JA 4OONA 1BTLA 3E2KA 2G2WA 1F2KA 2A24B 2INWA 3HVFA 1WA9A 1D7EA 5DJTA 2R9XA 2B02A 2O9AA 2WGWB 2ZJ9A 5M19A 1IYQA 4LV3A 1K55C 4RQ9A 2KX6A 3R7WB 3T4JA 3T1RA 1F98A 4R3AA 2VKSA 2V1ZA 5CTMA 2EX9A 5HPIA 2IWCA 3JVUA 3MXQA 5CTNA 5JYPA 1S66L 5TGFA 2J7VA 5FI7A 4OP5A 2HP9A 2ZQ8A 1XJ6A 5HAIA 1MWUA 3D4FA 3AGFA 5EECA 4WLAA 2ZOIA 1BZAA 2ZD8A 1YT4A 4LCLA 3VSLA 2JN7A 4GDNA 4PMAA 4BMWA 1Y28A 4LV1A 2A2LA 3VOYA 5HZHA 2EFXA 3VMAA 1VM1A 1SKOB 4OQIA 4G3WA 5HL1A 2OAP1 2DNSA 2VGLM 2HPBA 3PAGA 2GNXA 5KSCA 4PHTA 3ZNYA 4KQRA 2VV6A 2WKQA 1YM1A 1BUEA 1ESUA 3LYXA 4S2PA 4KG6A 1LLBA 1KDSA 4UAAA 3WRTA 4JGQA 3P09A 1YLJA 4QWOA 4ZJ1A 2JC7A 4E6XA 2K2NA 2Y2PA 2Y2LA 2EWVA 3QP4A 3OC2A 1GHMA 2HDQA 3UN7A 2W1TA 3T4SA 5HL6A 4FUWA 2BG1A 4HH2A 4X53A 2XFTA 2W3FA 2ZOHA 1MWTA 1ZKJA 3IBRA 3S1YA 3VE3A 3G35A 1LT0A 4BBTA 2BLSA 3G2YA 2PR5A 5M1AA 5FQJA 1XGIA 4R3JA 1L0DA 2L0WA 3QP8A 5DKKA 3NI9A 4HQAA 1RP5A 2ZC5B 3IF6C 4QPRA 2K7SA 1HZOA 4GD6A 2XK1A 3VP0A 5EPHA 4LV2A 4DF6A 3S7NA 3CPTA 4PM5A 3MZFA 4DDSA 1SDNA 3G30A 2Y79A 3GRJA 2H0TA 3NOTC 3T4TA 2Q0OA 3GVBA 1NYYA 3KO6A 4GW9A 4DN0A 4E3OA 3M6HA 3OCNA 5LBRA 1XA7A 2XSSA 4N9KA 3NBLA 5G4ZA 1G5UA 1UWNX 2V9AA 3ZVTA 1TF1A 3MXRA 1MY8A 4MN7A 3N7WA 4FH2A 5I5LA 4LRYC 4I5SA 3UPOA 2C6WB 2Y2IA 1KVLA 4H8RA 1AXBA 1LL9A 1O07A 2A49A 5IS1A 1TDLA 2RCXA 2PHYA 1QMEA 2ZQDA 3EGDC 3F1OA 4XUXA 2VX8A 4PPRA 4F94A 4LENA 4S2NC 4U3TA 1YQSA 1WE4A 2H10A 1N9LA 3CLOA 4Y5FA 2WAEA 1K56A 1KGFA 3TE8A 3QP6A 3HLCA 4EV4A 4R38A 3V67A 4B4XA 5FQKA 3CZDA 3NJAA 4KUOA 3EQUA 5EOOA 4Y17A 1Y54A 1JTGA 3LEQA 2HZ5A 4OP8A 2P08A 2JHEA 5CEDA 2EXAA 3RH8B 3FPVA 1YPRA 4G3VA 3MSHA 1KOUA 3QNCA 2O0YA 1JWVA 2W1TB 1D06A 1NXYA 3W2ZA 5FDSA 5GLDA 3ICYA 2OWHA 1IELA 4ESPA 4S2OA 5DF9A 4WEJA 3LO7A 5HSQA 4X25A 4KG5A 3GSGA 3PYPA 3BQ8A 5J3WA 2PDRA 3SS3A 4O8GA 1E4DA 4OPQA 2Y2NA 1NJ4A 5TJJA 2V2FF 4XT2A 3HREA 3ZNTA 2V8FA 3CPTB 2X71A 2ZM8A 2J3TC 4DMZA 4FD8A 4H6JA 5HAPA 4ARZB 1GHPA 4BL3A 4NKPA
chains in the Genus database with same CATH topology
3E0YA 2EA9A 2JKRI 2WKRA 5A8BA 4NXGA 1G28A 1UGUA 4F3LB 4GCZA 4HI4A 1ZTUA 2HF6A 2V0UA 4FSFA 5KIZA 1X0OA 5TBMA 2YKHA 4G3KA 3UE6A 3CAXA 3E4OA 3LFVA 4KUKA 3PR6A 3P01A 1GSVA 3KYQA 3PBSA 3MF0A 3MQQA 5EFWA 4DJ3A 3SW1A 4II7A 3UB7A 2HJ9C 2ZBBA 1G6OA 5HDDA 2QWSA 4R70A 2PD8A 4HIAA 1GSWA 4WUJA 2PT7A 3F1PA 3A0VA 3CUEA 1T1BA 1NLZA 2HGVA 1DRMA 3K3DA 5HD5A 3G6OA 1NRJA 2LB5A 3F1OB 3LUQA 4UEYA 2V0WA 4JGRA 3H82A 4EW7A 1OJGA 3T4QA 4WN5A 3PBRA 3LR5A 3UMEA 5KSHA 3FC7A 2L1MA 3CITA 2KDKA 1TS8A 2QYBA 4CLCB 2B18A 5HDSA 2VV8A 4Q0JA 2P7JA 2O99A 4HP9A 5F69A 3IS2A 4IUKA 3RFBA 4I3IA 2VGLS 1LL8A 1JNUA 3LIFA 3EWKA 4WL9A 5DFYA 3IS2B 3LR0A 4B93A 4HP4A 3HJKA 3F1NA 5HWVA 2VLGA 4I3AA 1V9YA 3T50A 2M7UA 2M1CA 1F5MA 3LR3A 2A24A 2Y8HA 3HJIA 1TS0A 1ODVA 1OTBA 2W3GA 1IFQA 2K31A 2FZ0A 2NUTC 2KLIA 1XFQA 3PBQA 4ETZA 2VV7A 4Y3IA 2M7VA 4EU0A 2A24B 2INWA 3R4KA 1WA9A 3A0RA 4GHIA 3GECA 1D7EA 1XJ4A 5DJTA 2VA0A 2B02A 2O9AA 3BY9A 4YWZA 5FL3A 2PR6A 2H28A 5AVFA 2XROA 2V1BA 4RQ9A 2KX6A 3S7PA 3TW8A 3C8CA 1DP8A 4PAUA 4EQ1A 3PXPA 2J80A 3R7WB 3T4JA 2J3TD 1F98A 5AJGA 4NXEA 4R3AA 3S7OA 2VKSA 1OT9A 4O0PA 4WELA 3UE3A 3E4PA 3LIDA 5HPIA 3JVUA 3MXQA 2W3EA 2KOIA 1OTDA 1S66L 1NWZA 3ULFA 3BJNA 3CI6A 1XJ6A 4EESA 1H8MA 1P9RA 1W63M 3TJZC 3OOVA 4WLAA 1P0ZA 2ZOIA 4H6JB 1LSVA 3UB6A 3C30A 3EQVA 4P6ZS 4DJ2A 2JN7A 2JKTM 5HWWA 4GJ4A 3P7NA 4L0LA 2PYPA 4I3JA 4ME4A 5TBMB 4BMWA 3BWLA 2O9CA 1Y28A 5F5YA 3EEHA 2W1RA 2A2LA 5HZHA 2JKRM 2W3DA 3LIAA 4G3WA 4PKYG 3PBOA 3TRCA 1BYWA 4IJGA 4BWIA 1MC0A 2DMWA 2OAP1 5DFXA 3F1PB 4CLCE 3K2NA 3OBFA 2XA7S 2VGLM 1TS6A 5J4EA 3BW6A 3T4LA 2GNXA 3MQOA 5J7EA 4OOLA 1OTEA 3B47A 3H82B 4PHTA 3EGXC 4GLQA 1TD5A 2VV6A 4HJ6A 3IBJA 2QJ5A 2MJ6A 2WKQA 1H3QA 4I39A 3BQAA 3FG8A 3LYXA 4Z1WA 3PBTA 2QJ7A 4KQDA 1V9ZA 1OPXA 4JGQA 3VV4A 3LR4A 5F6AA 4MMNA 2K2NA 4HHDA 2NUPC 4WEKA 2EWWA 2I9VA 2HV1A 2OWJA 2EWVA 3C2WA 3OC2A 3UMDA 2WKPA 3F1NB 3H9WA 2W1TA 3LICA 1VB6A 3T4SA 1YKDA 1YSQA 3JVVA 5HL6A 3UB8A 1OT6A 4HH2A 3KSIA 2W3FA 3MFXA 2ZOHA 4YNRA 3IBRA 4AFIA 3VE3A 3H7WA 1LT0A 1T19A 2OOLA 1EW0A 4JGOA 1T1AA 4BBTA 4E04A 4YOFA 3UB9A 2PR5A 3B42A 2ZMVA 3E4QA 5AVEA 4GHIB 2W27A 3RTYA 1LSWA 1YAXA 4Y2FA 3CWFA 4KQOA 1GSXA 4O01A 1P9WA 2L0WA 2Z6CA 5DKKA 5CX7A 4HQAA 3T4KA 4HJ4A 4GS9A 4QPRA 4CQHA 1DP6A 2K7SA 3LIEA 4EXOA 4P6ZM 4L9GA 1MZUA 3NOPC 3NOUC 3KX0X 3S7NA 4IHQA 4BBVA 4OOMA 2W3HA 3KYZA 2YKFA 2Y79A 3NOTC 3T4TA 2VZWA 1NLYA 1LSXA 3KO6A 4GW9A 4DN0A 1XFNA 3OCNA 2D01A 4NEED 3ZQ5A 1VHMA 4HJ3A 4M4XA 2XSSA 5LBRA 2CMNA 5G4ZA 1YSPA 3NHQA 4LRZE 1UWNX 2V9AA 1TF1A 2XA7M 4CLCC 3E98A 4MCWA 3B33A 4ZRRA 4UQIS 4HNBA 4IUHA 2QHKA 3OLOA 3D72A 2FH5A 4EEUA 4NXBA 4MN7A 4WF0A 4K08A 5I5LA 4LRYC 1T1CA 4I5SA 2GZAA 3OCLA 1TS7A 1W63Q 3HCYA 3KSFA 5IS1A 3EOIA 5C5KA 2PHYA 1STZA 3MMHA 1S4RA 3EGDC 3F1OA 3U2AA 2VX8A 5DKLA 1DP9A 1S4SA 2HJEA 5F68A 5G4YA 2GJ3A 1F9IA 1XJ2A 2P04A 3DBAA 4MDZA 4CLCA 1N9LA 3CLOA 5HPFA 1OTAA 4Y5FA 2R78A 2L4RA 4JGPA 3TE8A 2J3WA 4FOFA 1UWPX 2V1AA 4LRXC 4R38A 3K3CA 3MR0A 3ZYTA 3V67A 1ZHHB 3LIBA 3O5YA 3NJAA 4I38A 1N9OA 3PHYA 4KUOA 3T4OA 3GDIA 3EQUA 3PBNA 5HD3A 2O9BA 2P08A 4HH3A 5L8MA 2JHEA 2GX5A 4PKYA 3KSGA 4LPZA 4NXFA 1XJ3A 5K5BA 3RH8B 2W0NA 3A0SA 3FPVA 2VEAA 4G3VA 4BBUA 1KOUA 1OJ5A 2O0YA 2D02A 2W1TB 1MKMA 3MQ0A 5IU1A 1D06A 2BASA 2OAQ1 3W2ZA 3MJQA 4MN6A 4EERA 3ICYA 4EEPA 2OWHA 2XRNA 5MC7A 1S1ZA 1S67L 5HDCA 3S7QA 2G7UA 3H7WB 2QKPA 4L9FA 5DF9A 2VJWA 4EUVA 4WEJA 4B9OA 4LLOB 3D3OA 1T18A 5HSQA 2Z6DA 4L9EA 3PYPA 3BQ8A 5J3WA 1S1YA 3FPWA 2PDRA 3VOLA 4O8GA 3VE4A 3KSHA 3R7WA 3LI8A 5TJJA 1P97A 3EEAA 4GS9B 4ETXA 4BJPA 4HOIA 1N9NA 4R6LA 3BY8A 4UQIM 4XT2A 4ARZA 2JKTI 4MN5A 3LI9A 5HWTA 4Q0HA 1IOUA 2IA2A 2ZMFA 2LB9A 4Q0IA 4EETB 1OTIA 5IT5A 4HY8A 3C38A 4F3LA 3CUEC 2J3TC 4DMZA 4CLCD 4XT2B 4H6JA 2PD7A 4ARZB 2PYRA 5DJUA 4NKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA9 A;  2WKR A;  5A8B A;  4NXG A;  1G28 A;  1UGU A;  4F3L B;  4GCZ A;  4HI4 A;  2V0U A;  5KIZ A;  1X0O A;  5TBM A;  2YKH A;  3UE6 A;  3CAX A;  3E4O A;  4KUK A;  1GSV A;  3MQQ A;  5EFW A;  4DJ3 A;  3SW1 A;  3UB7 A;  2ZBB A;  5HDD A;  2QWS A;  4R70 A;  2PD8 A;  4HIA A;  1GSW A;  4WUJ A;  3F1P A;  3A0V A;  1T1B A;  1DRM A;  3K3D A;  5HD5 A;  3G6O A;  3F1O B;  3LUQ A;  2V0W A;  4JGR A;  3H82 A;  4EW7 A;  1OJG A;  4WN5 A;  3UME A;  3FC7 A;  2L1M A;  2KDK A;  1TS8 A;  5HDS A;  2VV8 A;  2P7J A;  4HP9 A;  5F69 A;  3IS2 A;  4I3I A;  1LL8 A;  1JNU A;  3LIF A;  3EWK A;  4WL9 A;  3IS2 B;  4HP4 A;  3HJK A;  3F1N A;  5HWV A;  2VLG A;  4I3A A;  1V9Y A;  3T50 A;  2M1C A;  2A24 A;  3HJI A;  1TS0 A;  1ODV A;  1OTB A;  1XFQ A;  2VV7 A;  2A24 B;  2INW A;  1WA9 A;  3A0R A;  4GHI A;  3GEC A;  1D7E A;  1XJ4 A;  5DJT A;  2B02 A;  3BY9 A;  4YWZ A;  2PR6 A;  2H28 A;  5AVF A;  2V1B A;  4RQ9 A;  2KX6 A;  3C8C A;  1DP8 A;  4EQ1 A;  2J80 A;  1F98 A;  4NXE A;  4R3A A;  1OT9 A;  3E4P A;  3LID A;  3MXQ A;  1OTD A;  1S66 L;  1NWZ A;  3ULF A;  1XJ6 A;  4EES A;  4WLA A;  1P0Z A;  2ZOI A;  4H6J B;  1LSV A;  3UB6 A;  4DJ2 A;  2JN7 A;  5HWW A;  3P7N A;  2PYP A;  4I3J A;  5TBM B;  3BWL A;  1Y28 A;  5F5Y A;  3EEH A;  5HZH A;  3LIA A;  4PKY G;  1BYW A;  3F1P B;  1TS6 A;  5J4E A;  5J7E A;  3MQO A;  1OTE A;  3H82 B;  2VV6 A;  4HJ6 A;  2QJ5 A;  2WKQ A;  4I39 A;  3LYX A;  3FG8 A;  2QJ7 A;  4KQD A;  1V9Z A;  4JGQ A;  5F6A A;  4HHD A;  2I9V A;  2HV1 A;  2OWJ A;  3C2W A;  3UMD A;  2WKP A;  3F1N B;  3H9W A;  3LIC A;  1VB6 A;  3UB8 A;  1OT6 A;  4HH2 A;  3MFX A;  2ZOH A;  3IBR A;  3VE3 A;  3H7W A;  1LT0 A;  1T19 A;  2OOL A;  1EW0 A;  4JGO A;  1T1A A;  4BBT A;  4E04 A;  3UB9 A;  2PR5 A;  3E4Q A;  5AVE A;  3RTY A;  4GHI B;  2W27 A;  1LSW A;  3CWF A;  1GSX A;  2L0W A;  2Z6C A;  5DKK A;  4HQA A;  4HJ4 A;  4GS9 A;  1DP6 A;  2K7S A;  3LIE A;  4EXO A;  4L9G A;  1MZU A;  3NOP C;  3NOU C;  3KX0 X;  4BBV A;  2YKF A;  3NOT C;  1LSX A;  4GW9 A;  1XFN A;  2D01 A;  3ZQ5 A;  4HJ3 A;  4M4X A;  2CMN A;  5G4Z A;  3NHQ A;  4LRZ E;  1UWN X;  2V9A A;  3B33 A;  4HNB A;  2QHK A;  3OLO A;  3D72 A;  4EEU A;  4NXB A;  4WF0 A;  4K08 A;  5I5L A;  4LRY C;  1T1C A;  4I5S A;  1TS7 A;  5IS1 A;  2PHY A;  1S4R A;  3F1O A;  5DKL A;  1DP9 A;  1S4S A;  5F68 A;  5G4Y A;  2GJ3 A;  1F9I A;  1XJ2 A;  1N9L A;  3CLO A;  1OTA A;  2R78 A;  2L4R A;  4JGP A;  1UWP X;  2V1A A;  4LRX C;  4R38 A;  3K3C A;  3MR0 A;  3LIB A;  3NJA A;  4I38 A;  1N9O A;  3PHY A;  4KUO A;  3GDI A;  5HD3 A;  4HH3 A;  2JHE A;  4PKY A;  4LPZ A;  4NXF A;  1XJ3 A;  3RH8 B;  2W0N A;  3A0S A;  2VEA A;  4BBU A;  1KOU A;  1OJ5 A;  2D02 A;  5IU1 A;  1D06 A;  2BAS A;  3MJQ A;  4MN6 A;  4EER A;  3ICY A;  4EEP A;  2OWH A;  1S1Z A;  1S67 L;  5HDC A;  3H7W B;  2QKP A;  4L9F A;  4B9O A;  4LLO B;  1T18 A;  5HSQ A;  2Z6D A;  4L9E A;  3PYP A;  5J3W A;  1S1Y A;  2PDR A;  3VOL A;  3VE4 A;  3LI8 A;  1P97 A;  4GS9 B;  4HOI A;  1N9N A;  4R6L A;  3BY8 A;  4XT2 A;  4MN5 A;  3LI9 A;  5HWT A;  4EET B;  1OTI A;  4HY8 A;  4F3L A;  4XT2 B;  4H6J A;  2PD7 A;  2PYR A;  5DJU A; 
#chains in the Genus database with same CATH topology
 5FQ9 A;  1LI0 A;  4OVD A;  4WBG A;  4HI4 A;  1ZTU A;  5FEF A;  5KIZ A;  4EUZ A;  1X0O A;  2ZC3 B;  3IX8 A;  3CAX A;  4KUK A;  3P01 A;  1GSV A;  3KYQ A;  4RX2 A;  4MNR A;  5EFW A;  4JKT A;  2OLU A;  2WYX A;  3CMZ A;  1O7E A;  4R70 A;  2PT7 A;  4B88 A;  3F1P A;  3C7U A;  3K3D A;  3G6O A;  3BM6 A;  3F1O B;  4JGR A;  1OJG A;  4GKU A;  2EX6 A;  1XP4 A;  3T4Q A;  4WN5 A;  5KSH A;  3HUO A;  3BYD A;  1GHI A;  2QYB A;  1CF0 A;  1K54 A;  1XXM A;  2VV8 A;  5FQQ A;  1EWZ A;  2P7J A;  3LY3 A;  2Y91 A;  1YLT A;  3FKV A;  2RL3 A;  3WS4 A;  3RFB A;  5F82 A;  1K57 A;  4WL9 A;  5DFY A;  2H5S A;  3LR0 A;  3MBZ A;  4HP4 A;  3UY6 A;  1KGG A;  4XXR A;  1ERQ A;  4WMC A;  2M7U A;  2A24 A;  1TS0 A;  1A0K A;  2WGW A;  2KLI A;  1XFQ A;  3B3X A;  5EVI C;  4BD1 A;  4ETZ A;  4MEZ A;  4Y3I A;  2M7V A;  4EQI A;  3ZG5 A;  3A0R A;  5F1G A;  4GOG A;  4U0X A;  4YWZ A;  1JTD A;  1YLZ A;  2IWB A;  3HLF A;  1QMF A;  2XRO A;  2WUQ A;  2V1B A;  2A3U A;  4K0X A;  1K25 A;  3C8C A;  3NIA A;  5FAT A;  4PAU A;  2J80 A;  2J3T D;  5HW3 A;  3RJU A;  4NXE A;  4WEL A;  4O0P A;  5A91 A;  3E4P A;  4QU3 A;  3L9K A;  4KZ5 A;  4E3N A;  1OTD A;  4HBU A;  2Y4A A;  1JVJ A;  3ULF A;  3BJN A;  4K0W A;  3VSK A;  3OOV A;  4H6J B;  1LSV A;  3UB6 A;  1ZG6 A;  3IWO A;  1PFL A;  4RX3 A;  2FFY A;  2JKT M;  5HWW A;  4GJ4 A;  4GD8 A;  4ME4 A;  2BTF P;  3G2Z A;  5FI2 A;  5F5Y A;  1IYS A;  2OSU A;  3IHA A;  3ZDJ A;  2XDM A;  3UPN A;  1Q2Q A;  5FAQ A;  3BFG A;  4PKY G;  3PBO A;  3IX4 A;  1BYW A;  4BWI A;  1ES4 A;  1GA0 A;  5DFX A;  3F1P B;  3K2N A;  5J4E A;  1FQG A;  1XA1 A;  3NUL A;  5J7E A;  1W79 A;  5CXW A;  3JYI A;  4KEN B;  2PU2 A;  1YLW A;  4PM7 A;  2HDS A;  2JE5 A;  5E2E A;  2MJ6 A;  3FV7 A;  4PM8 A;  4I39 A;  2WKI A;  1CK3 A;  3FG8 A;  4Z1W A;  4WZ5 A;  4QY6 A;  4LV0 A;  1H8Y A;  3AGE A;  3VV4 A;  3LR4 A;  5DTS A;  2Y2G A;  2NUP C;  3ZG0 A;  2Y2Q A;  3GMW A;  2ZQ9 A;  1OME A;  4UA7 A;  5EVI D;  3UMD A;  2HDU A;  3FZC A;  3H9W A;  3LIC A;  5GL9 A;  1VB6 A;  2DCF A;  5EVL A;  3JVV A;  2WAF A;  2G2U A;  1PYY A;  4YNR A;  3QNB A;  3OPH A;  1K4F A;  4CPK A;  1ALQ A;  1DJA A;  1EW0 A;  1G68 A;  3IF5 A;  3UB9 A;  3B42 A;  2ZMV A;  3E4Q A;  5AVE A;  1LL5 A;  3RTY A;  1LSW A;  4KZB A;  4BQM A;  3G34 A;  2XGN A;  4FCF A;  4KQO A;  2Z6C A;  3BRM A;  3DWK A;  1Z6F A;  4IED A;  1HLU P;  4OQH A;  4IVI A;  4EXO A;  4L9G A;  3DTE A;  2AVX A;  3W4P A;  2E8I A;  5M18 A;  4E3J A;  5IHV A;  4ZJ2 A;  2ZQA A;  3ZCZ A;  2YKF A;  2VZW A;  1NLY A;  2V20 A;  1XFN A;  3HBR A;  5FSR A;  1XKZ A;  2D01 A;  3ZQ5 A;  4HJ3 A;  1YSP A;  4LRZ E;  3N6I A;  3VP1 A;  2VK3 A;  4CLC C;  3E98 A;  4MCW A;  4ZRR A;  2Y2M A;  4CJN A;  4N9L A;  3UDI A;  2I72 A;  5D3O A;  5CHJ A;  3NDG A;  1T1C A;  3OPL A;  1YMS A;  2GZA A;  1SCW A;  3IF6 B;  1TS7 A;  4UA9 A;  3KSF A;  2H0Y A;  3D9Y A;  5C5K A;  1GA9 A;  3U2A A;  5CHM A;  1W7F A;  1ESI A;  3IH9 A;  3ZFZ A;  4ZJ3 A;  5F68 A;  1M40 A;  4LGW A;  5G4Y A;  4YIN A;  3SH7 A;  4WZ4 A;  1BT5 A;  5CRF A;  4Y0O A;  3NEC A;  5F83 A;  3ZGA B;  5HPF A;  1ACF A;  2R78 A;  2L4R A;  1ERO A;  4FOF A;  1UWP X;  2V1A A;  4PM9 A;  3K3C A;  4EWF A;  5HAR A;  1ZHH B;  3O5Y A;  1N9O A;  3PHY A;  4WM9 A;  5FEG A;  3PBN A;  1BSG A;  4QHC A;  3KSG A;  5J8X A;  2D02 A;  1MKM A;  3MQ0 A;  5IU1 A;  2JKG A;  2BAS A;  5E2F A;  3MJQ A;  4EER A;  1IKG A;  3A3E A;  5MC7 A;  3T1Q B;  1MPL A;  1BUL A;  1S1Z A;  5HDC A;  5CEB A;  1MBL A;  1Q2P A;  5E2H A;  2P74 A;  1KE3 A;  2Z6D A;  3IXB A;  1NZU A;  3VOL A;  1E3U A;  3VE4 A;  3KSH A;  2C5W B;  4P85 A;  4ETX A;  4R6L A;  3BY8 A;  4ARZ A;  3IXD A;  3UPP A;  5HWT A;  4Q0H A;  2IA2 A;  2ZMF A;  3N8L A;  4Q0I A;  4QB8 A;  2ACG A;  1MWS A;  1PI5 A;  4CLC D;  1VEU B;  2PD7 A;  4KZ4 A;  2PYR A;  4D60 A;  5DJU A;  3E0Y A;  1K4E A;  2JKR I;  2WKR A;  5KMW A;  3HLD A;  1G28 A;  1PRQ A;  1UGU A;  3WWX A;  4OPZ A;  4F3L B;  4GCZ A;  2V0U A;  1FR1 A;  1JWP A;  4A5R A;  4ID4 A;  4JF5 A;  3E4O A;  3PR6 A;  4MLL A;  2B95 A;  5DF7 A;  3PBS A;  3MF0 A;  4DJ3 A;  3IHB A;  4II7 A;  2PD8 A;  1GSW A;  4WUJ A;  3CUE A;  3BFD A;  1TDG A;  5HD5 A;  4JBF A;  1NRF A;  4BEN A;  3SZT A;  2DRW A;  4UEY A;  3H82 A;  2ZC4 B;  4MBF A;  4DXC A;  3UME A;  5GLC A;  2L1M A;  4RA7 A;  2KDK A;  1TS8 A;  4X55 A;  3E2L A;  5HDS A;  5EM1 A;  4Q0J A;  1MWR A;  3QP2 A;  2O99 A;  5HX9 A;  2XH9 A;  2X02 A;  4E3I A;  2WKH A;  5JYO A;  1H8Z A;  4OQ0 A;  3LIF A;  3T1S A;  3EWK A;  5HAQ A;  4B93 A;  3DTK A;  2E8J A;  3G32 A;  5FAS A;  2VLG A;  4KZ9 A;  1SKF A;  3T50 A;  1I2S A;  1ES2 A;  3BFC A;  3HJI A;  1OTB A;  1S6R A;  2K31 A;  2FZ0 A;  1DJB A;  2WZZ A;  1EI5 A;  1PWC A;  4EU0 A;  3R4K A;  3O88 A;  3MFD A;  4GHI A;  3GEC A;  1XJ4 A;  2VA0 A;  2PU4 A;  3BY9 A;  2HP5 A;  2XF3 A;  1K0K A;  2PR6 A;  4NG2 A;  2H28 A;  4OH0 A;  3JPU A;  3S7P A;  3TW8 A;  1PW8 A;  3IWQ A;  3UDX A;  4JXS A;  4XUZ A;  3PXP A;  1ONH A;  5AJG A;  1OT9 A;  2WAD A;  3LID A;  1K6S A;  2WKE A;  1ZG4 A;  2W3E A;  2KOI A;  2EX8 A;  4NET A;  4EBL A;  3BEC A;  3C5A A;  1P9R A;  1MXO A;  1P0Z A;  2Z2M B;  5FAP A;  3C30 A;  4E6W A;  4BD0 A;  4YFM A;  4P6Z S;  3MZE A;  4LCM A;  2CC1 A;  1AWI A;  1N9B A;  2PRF A;  3RXW A;  1K55 A;  2PYP A;  4I3J A;  3BLS A;  4E3K A;  4S2J A;  3BWL A;  2UV0 E;  1TVF A;  2W1R A;  3P98 A;  4IVK A;  1C3B A;  1KE4 A;  1L0G A;  4NK3 A;  2EX2 A;  3LIA A;  3CJM A;  3TRC A;  5CGX A;  1MC0 A;  4JXG A;  1RCJ A;  2X01 A;  3QHY A;  3OBF A;  1PNE A;  1TS6 A;  1CEG A;  3BW6 A;  3T4L A;  3MQO A;  3SS5 A;  3WS2 A;  1OTE A;  3H82 B;  3UNW A;  3EGX C;  3IH8 A;  4GLQ A;  1FCM A;  3IBJ A;  2QJ5 A;  3VP4 A;  1H3Q A;  1XPB A;  4QY5 A;  2PBD P;  4KQD A;  1OPX A;  3QP1 A;  5AQ7 A;  5F6A A;  4PM6 A;  4WEK A;  2WGV A;  2EWW A;  1BLH A;  5I94 A;  2HV1 A;  2OWJ A;  3WS1 A;  3W4O A;  3DAV A;  3Q7V A;  1FSY A;  1MKI A;  1WYB A;  5U47 A;  2ZC7 A;  3W4Q A;  1GCE A;  2IWD A;  3ISG A;  4OPR A;  3MFX A;  4R23 A;  4AFI A;  1T19 A;  2OOL A;  3DTI A;  5GHZ A;  4YOF A;  4GHI B;  1YAX A;  4Y2F A;  5TR7 A;  1HD8 A;  4O01 A;  2R9W A;  1P9W A;  3T1X A;  5GLA A;  4R3B A;  4GS9 A;  1I5Q A;  4CQH A;  1DP6 A;  1PWD A;  5FQM A;  4HBT A;  4P6Z M;  2EFU A;  4R4R A;  1MZU A;  3IT9 A;  3KX0 X;  2GDN A;  3M6B A;  3SH9 A;  3T12 B;  3G31 A;  3RXX A;  4OOM A;  2VGJ A;  3UE1 A;  3V50 A;  2W3H A;  5AQ9 A;  4NEE D;  4P87 A;  1VHM A;  4C6Y A;  2CMN A;  4M3K A;  3NHQ A;  4GB7 A;  3HLB A;  1IYO A;  4X1M A;  4UQI S;  4HNB A;  2XQZ A;  3IF6 A;  3OLO A;  3DW0 A;  3D72 A;  2FH5 A;  4EEU A;  4NXB A;  2Y59 A;  3Q1F A;  1CJF A;  4WF0 A;  5EUA A;  4ZTK A;  1BLS A;  5EVE A;  5A92 A;  3DWZ A;  3KYE A;  3M2K A;  1S0W A;  5DKL A;  4DKI A;  1DP9 A;  1S4S A;  2HJE A;  1SHV A;  2GJ3 A;  1F9I A;  2P04 A;  4MDZ A;  4RYE A;  3FKW A;  3WS5 A;  1VET A;  5G18 A;  1CQA A;  4JGP A;  4C3Q A;  5EOE A;  2Y55 A;  2P9V A;  4DE0 A;  3ZYT A;  1FIL A;  3BFE A;  1FOF A;  3LIB A;  4N92 A;  4EBN A;  4I38 A;  3L7H A;  2ZL1 A;  1W8Y A;  4Y0U A;  3N4I A;  4HH3 A;  5L8M A;  4JXV A;  2GX5 A;  4PKY A;  1SDE A;  4UHU A;  4LPZ A;  1XJ3 A;  1PWG A;  2W0N A;  3Q7V B;  5DTK A;  2VEA A;  1YLY A;  3HLG A;  4BBU A;  4O7D A;  4S2N A;  1OJ5 A;  1ZC2 A;  1DY6 A;  4FH4 A;  1W8Q A;  3CHW P;  3ZG7 B;  1NY0 A;  2ZQC A;  4JLF A;  3ZHH A;  1KDW A;  3S7Q A;  1NYM A;  4L9F A;  3PAE A;  4S2I A;  5GHX A;  4EUV A;  5FAO A;  4B9O A;  2Y2O A;  3O3V A;  1S1Y A;  3FPW A;  1RGZ A;  1G6A A;  2ZLY A;  1YMX A;  3U4L P;  1P97 A;  5A93 A;  4GS9 B;  4N1X A;  5FQI A;  5CEC A;  5L09 A;  4OLG A;  4UQI M;  1VEU A;  4N1H A;  3LI9 A;  1N4O A;  3NC8 A;  1XX2 A;  1IOU A;  3OPP A;  4HY8 A;  3C38 A;  4F3L A;  5FDH A;  4DE2 A;  3C4P A;  4OQG A;  5A8B A;  4Y13 A;  4S2L A;  4NXG A;  1K56 D;  4C75 A;  1LHY A;  1RGY A;  2HF6 A;  5TBM A;  2YKH A;  4G3K A;  3W8K A;  1K54 C;  3V5M A;  4GDB A;  3HUN A;  4Y7P A;  3MS6 A;  2PAV P;  5BOH A;  4U0T A;  1G6O A;  5HDD A;  5AQA A;  1NZO A;  3AGD A;  1K57 C;  2V8C A;  2HGV A;  2WGI A;  3DTM A;  4R1G A;  2ZMA A;  1SZV A;  5DTT A;  2XLN A;  5FI6 A;  4DE1 A;  2B18 A;  4Q8I A;  4BLM A;  4QJG A;  4S2K A;  5F69 A;  1VET B;  3MKE A;  5E43 A;  4IUK A;  2P9V B;  4I3I A;  4KZ3 A;  2Q9M A;  3SOI A;  1LL8 A;  1L3L A;  5CGW A;  1PW1 A;  3IS2 B;  3GV9 A;  3F1N A;  1LI9 A;  2ZL1 B;  4I3A A;  1V9Y A;  5FA7 A;  1F5M A;  5GHY A;  4QD4 A;  2W3G A;  3G4P A;  2NUT C;  3PBQ A;  2VV7 A;  5KZH A;  4Y15 A;  4DE3 A;  2WZX A;  1L0F A;  3V3R A;  1TEM A;  3HL9 A;  2ZQ7 A;  2OLV A;  3N8S A;  4UA6 A;  3GTC A;  5FL3 A;  4HES A;  2OV5 A;  5AVF A;  4IBR A;  3ZVW A;  3ITA A;  1DP8 A;  1ERM A;  4HEF A;  4EQ1 A;  1Z09 A;  1FIK A;  1K38 A;  3S7O A;  3FYZ A;  3Q7Z A;  3UE3 A;  5EVI A;  3A3F A;  4DXB A;  3CG5 A;  1NWZ A;  4X1L A;  2XFS A;  5L10 A;  3CI6 A;  4GNU A;  4EES A;  1H8M A;  1W63 M;  3TJZ C;  3HLE A;  5CER A;  3FWL A;  5E2G A;  4JF6 A;  3EQV A;  4DJ2 A;  3P7N A;  4L0L A;  1FCN A;  3ZG9 B;  1BLP A;  5TBM B;  4KZ6 A;  2O9C A;  3S4X A;  3EEH A;  3ZG8 B;  1CI9 A;  4WZ5 C;  3Q07 A;  4P6B A;  3VOZ A;  3O86 A;  2JKR M;  3IXG A;  4FTX A;  4WMC D;  2W3D A;  3VFH A;  1KVM A;  1KGE A;  4S2M A;  4IJG A;  2DMW A;  4CLC E;  2HP6 A;  2XA7 S;  3A3D A;  4X68 A;  2VGK A;  4OOL A;  3C4O A;  1K6R A;  3TG9 A;  1CEF A;  3B47 A;  1M6K A;  1TD5 A;  2B5R A;  4HJ6 A;  1HTZ A;  4R4S A;  3BQA A;  3PBT A;  2QJ7 A;  3A3I A;  1V9Z A;  4JF4 A;  3V3S A;  1HVB A;  3IXH A;  4MMN A;  4HHD A;  3ITB A;  4KZA A;  5L2F A;  3LY4 A;  2J8Y A;  2I9V A;  1H5X A;  3V39 A;  3C2W A;  1U60 A;  2WKP A;  3F1N B;  4JPM A;  3VP2 A;  1YKD A;  2QZ6 A;  3UB5 P;  1D1J A;  3TOI A;  1YSQ A;  4E3M A;  3UB8 A;  3MXS A;  1OT6 A;  3KSI A;  3LEZ A;  4R0Q A;  3H7W A;  3C7V A;  4JGO A;  1T1A A;  3QP5 A;  4E04 A;  3WRZ A;  3WS0 A;  2W27 A;  4DRT A;  1XGJ A;  3CWF A;  3NCK A;  1GSX A;  2Z2L B;  5CX7 A;  3S22 A;  3T4K A;  4HJ4 A;  4Z9Q A;  3VFF A;  3LIE A;  3NOP C;  3NOU C;  3I7J A;  2WK0 A;  3SH8 A;  3N8R A;  4ZAM A;  4IHQ A;  4BBV A;  3O87 A;  2HDR A;  3KYZ A;  2QPN A;  1E25 A;  3GQZ A;  4X6T A;  5EVI B;  1LSX A;  5F1F A;  4M4X A;  3A3J A;  3HLW A;  4KG2 A;  2XA7 M;  2XR0 A;  4JXW A;  3B33 A;  4IUH A;  2QHK A;  1VQQ A;  2FFF B;  1IEM A;  4X56 A;  1DJC A;  4K08 A;  1W5D A;  2XEP A;  3OCL A;  4MBK A;  2ZM2 A;  1W63 Q;  3HCY A;  1PI4 A;  4B4Z A;  3EOI A;  1BLC A;  1STZ A;  3MMH A;  1S4R A;  1PIO A;  4OOY A;  1PZO A;  2UWX A;  1ES5 A;  4OPY A;  4KZ8 A;  1J3W A;  3PTE A;  1WYC A;  1XJ2 A;  5CGS A;  3DBA A;  4CLC A;  1ONG A;  1OTA A;  4ZBE A;  2JKF A;  3M2J A;  3Q82 A;  2J3W A;  4D2O A;  1KE0 A;  2ZC6 B;  4LRX C;  3MR0 A;  4K91 A;  3MKF A;  3SS4 A;  3T4O A;  2J9O A;  3GDI A;  5HD3 A;  2O9B A;  4KQQ A;  1YLP A;  4NXF A;  5L07 A;  5K5B A;  3A0S A;  2JCH A;  3LGO A;  5GLB A;  3TSG A;  2OAQ 1;  1FCO A;  5AQB A;  4MN6 A;  4EEP A;  2XRN A;  2Y2K A;  4LFU A;  1S67 L;  2G7U A;  3H7W B;  2QKP A;  1FR6 A;  3BFF A;  5HFO A;  2VJW A;  5EE8 A;  4LLO B;  3D3O A;  1T18 A;  1H0M A;  4L9E A;  3MZD A;  1J9M A;  1IYP A;  4ZDX A;  3OZH A;  3LI8 A;  5TFQ A;  3R7W A;  3EEA A;  1L2S A;  4BJP A;  4HOI A;  1N9N A;  4BL2 A;  2JKT I;  4MN5 A;  4P0M A;  2J9P A;  2LB9 A;  3NY4 A;  2QMI A;  1OTI A;  3Q81 A;  4EET B;  3BEB A;  5IT5 A;  4RVA A;  2PBY A;  3IWI A;  3CUE C;  4XT2 B;  2Q9N A;  2EA9 A;  4MBH A;  4KZ7 A;  3LCE A;  3BLM A;  1IKI A;  4FSF A;  4Y0T A;  3UE0 A;  3UE6 A;  3HUM A;  1JWZ A;  3LFV A;  3MQQ A;  1SKO A;  5DF8 A;  3SW1 A;  3UB7 A;  2HJ9 C;  2ZBB A;  1ES3 A;  5A90 A;  1I2W A;  2QWS A;  5CHU A;  2XD1 A;  4HIA A;  3A0V A;  2JBF A;  4IBX A;  1T1B A;  2EXB A;  1NLZ A;  1DRM A;  2XD5 A;  2ZM0 A;  5EV0 A;  1NRJ A;  2LB5 A;  3NDE A;  3LUQ A;  2V0W A;  4EW7 A;  4E3L A;  3PBR A;  3LR5 A;  3FC7 A;  5EM0 A;  2Y2H A;  5DVA A;  3CIT A;  1Y4O A;  4GZB A;  4CLC B;  1L0E A;  4HP9 A;  3IS2 A;  1E3U D;  3IQA A;  1CI8 A;  1FSW A;  1PZP A;  3GR2 A;  4X69 A;  3OPR A;  2VGL S;  1JNU A;  4EBP A;  3IX3 A;  3HJK A;  4GN2 A;  4OKP A;  5HWV A;  3UO9 A;  4WYY A;  4OLD A;  2M1C A;  3LR3 A;  2Y8H A;  1ODV A;  3UDF A;  4DDY A;  1IFQ A;  3VP3 A;  2Y2J A;  4OON A;  1BTL A;  3E2K A;  2G2W A;  1F2K A;  2A24 B;  2INW A;  3HVF A;  1WA9 A;  1D7E A;  5DJT A;  2R9X A;  2B02 A;  2O9A A;  2WGW B;  2ZJ9 A;  5M19 A;  1IYQ A;  4LV3 A;  1K55 C;  4RQ9 A;  2KX6 A;  3R7W B;  3T4J A;  3T1R A;  1F98 A;  4R3A A;  2VKS A;  2V1Z A;  5CTM A;  2EX9 A;  5HPI A;  2IWC A;  3JVU A;  3MXQ A;  5CTN A;  5JYP A;  1S66 L;  5TGF A;  2J7V A;  5FI7 A;  4OP5 A;  2HP9 A;  2ZQ8 A;  1XJ6 A;  5HAI A;  1MWU A;  3D4F A;  3AGF A;  5EEC A;  4WLA A;  2ZOI A;  1BZA A;  2ZD8 A;  1YT4 A;  4LCL A;  3VSL A;  2JN7 A;  4GDN A;  4PMA A;  4BMW A;  1Y28 A;  4LV1 A;  2A2L A;  3VOY A;  5HZH A;  2EFX A;  3VMA A;  1VM1 A;  1SKO B;  4OQI A;  4G3W A;  5HL1 A;  2OAP 1;  2DNS A;  2VGL M;  2HPB A;  3PAG A;  2GNX A;  5KSC A;  4PHT A;  3ZNY A;  4KQR A;  2VV6 A;  2WKQ A;  1YM1 A;  1BUE A;  1ESU A;  3LYX A;  4S2P A;  4KG6 A;  1LLB A;  1KDS A;  4UAA A;  3WRT A;  4JGQ A;  3P09 A;  1YLJ A;  4QWO A;  4ZJ1 A;  2JC7 A;  4E6X A;  2K2N A;  2Y2P A;  2Y2L A;  2EWV A;  3QP4 A;  3OC2 A;  1GHM A;  2HDQ A;  3UN7 A;  2W1T A;  3T4S A;  5HL6 A;  4FUW A;  2BG1 A;  4HH2 A;  4X53 A;  2XFT A;  2W3F A;  2ZOH A;  1MWT A;  1ZKJ A;  3IBR A;  3S1Y A;  3VE3 A;  3G35 A;  1LT0 A;  4BBT A;  2BLS A;  3G2Y A;  2PR5 A;  5M1A A;  5FQJ A;  1XGI A;  4R3J A;  1L0D A;  2L0W A;  3QP8 A;  5DKK A;  3NI9 A;  4HQA A;  1RP5 A;  2ZC5 B;  3IF6 C;  4QPR A;  2K7S A;  1HZO A;  4GD6 A;  2XK1 A;  3VP0 A;  5EPH A;  4LV2 A;  4DF6 A;  3S7N A;  3CPT A;  4PM5 A;  3MZF A;  4DDS A;  1SDN A;  3G30 A;  2Y79 A;  3GRJ A;  2H0T A;  3NOT C;  3T4T A;  2Q0O A;  3GVB A;  1NYY A;  3KO6 A;  4GW9 A;  4DN0 A;  4E3O A;  3M6H A;  3OCN A;  5LBR A;  1XA7 A;  2XSS A;  4N9K A;  3NBL A;  5G4Z A;  1G5U A;  1UWN X;  2V9A A;  3ZVT A;  1TF1 A;  3MXR A;  1MY8 A;  4MN7 A;  3N7W A;  4FH2 A;  5I5L A;  4LRY C;  4I5S A;  3UPO A;  2C6W B;  2Y2I A;  1KVL A;  4H8R A;  1AXB A;  1LL9 A;  1O07 A;  2A49 A;  5IS1 A;  1TDL A;  2RCX A;  2PHY A;  1QME A;  2ZQD A;  3EGD C;  3F1O A;  4XUX A;  2VX8 A;  4PPR A;  4F94 A;  4LEN A;  4S2N C;  4U3T A;  1YQS A;  1WE4 A;  2H10 A;  1N9L A;  3CLO A;  4Y5F A;  2WAE A;  1K56 A;  1KGF A;  3TE8 A;  3QP6 A;  3HLC A;  4EV4 A;  4R38 A;  3V67 A;  4B4X A;  5FQK A;  3CZD A;  3NJA A;  4KUO A;  3EQU A;  5EOO A;  4Y17 A;  1Y54 A;  1JTG A;  3LEQ A;  2HZ5 A;  4OP8 A;  2P08 A;  2JHE A;  5CED A;  2EXA A;  3RH8 B;  3FPV A;  1YPR A;  4G3V A;  3MSH A;  1KOU A;  3QNC A;  2O0Y A;  1JWV A;  2W1T B;  1D06 A;  1NXY A;  3W2Z A;  5FDS A;  5GLD A;  3ICY A;  2OWH A;  1IEL A;  4ESP A;  4S2O A;  5DF9 A;  4WEJ A;  3LO7 A;  5HSQ A;  4X25 A;  4KG5 A;  3GSG A;  3PYP A;  3BQ8 A;  5J3W A;  2PDR A;  3SS3 A;  4O8G A;  1E4D A;  4OPQ A;  2Y2N A;  1NJ4 A;  5TJJ A;  2V2F F;  4XT2 A;  3HRE A;  3ZNT A;  2V8F A;  3CPT B;  2X71 A;  2ZM8 A;  2J3T C;  4DMZ A;  4FD8 A;  4H6J A;  5HAP A;  4ARZ B;  1GHP A;  4BL3 A;  4NKP A; 
#chains in the Genus database with same CATH homology
 3E0Y A;  2EA9 A;  2JKR I;  2WKR A;  5A8B A;  4NXG A;  1G28 A;  1UGU A;  4F3L B;  4GCZ A;  4HI4 A;  1ZTU A;  2HF6 A;  2V0U A;  4FSF A;  5KIZ A;  1X0O A;  5TBM A;  2YKH A;  4G3K A;  3UE6 A;  3CAX A;  3E4O A;  3LFV A;  4KUK A;  3PR6 A;  3P01 A;  1GSV A;  3KYQ A;  3PBS A;  3MF0 A;  3MQQ A;  5EFW A;  4DJ3 A;  3SW1 A;  4II7 A;  3UB7 A;  2HJ9 C;  2ZBB A;  1G6O A;  5HDD A;  2QWS A;  4R70 A;  2PD8 A;  4HIA A;  1GSW A;  4WUJ A;  2PT7 A;  3F1P A;  3A0V A;  3CUE A;  1T1B A;  1NLZ A;  2HGV A;  1DRM A;  3K3D A;  5HD5 A;  3G6O A;  1NRJ A;  2LB5 A;  3F1O B;  3LUQ A;  4UEY A;  2V0W A;  4JGR A;  3H82 A;  4EW7 A;  1OJG A;  3T4Q A;  4WN5 A;  3PBR A;  3LR5 A;  3UME A;  5KSH A;  3FC7 A;  2L1M A;  3CIT A;  2KDK A;  1TS8 A;  2QYB A;  4CLC B;  2B18 A;  5HDS A;  2VV8 A;  4Q0J A;  2P7J A;  2O99 A;  4HP9 A;  5F69 A;  3IS2 A;  4IUK A;  3RFB A;  4I3I A;  2VGL S;  1LL8 A;  1JNU A;  3LIF A;  3EWK A;  4WL9 A;  5DFY A;  3IS2 B;  3LR0 A;  4B93 A;  4HP4 A;  3HJK A;  3F1N A;  5HWV A;  2VLG A;  4I3A A;  1V9Y A;  3T50 A;  2M7U A;  2M1C A;  1F5M A;  3LR3 A;  2A24 A;  2Y8H A;  3HJI A;  1TS0 A;  1ODV A;  1OTB A;  2W3G A;  1IFQ A;  2K31 A;  2FZ0 A;  2NUT C;  2KLI A;  1XFQ A;  3PBQ A;  4ETZ A;  2VV7 A;  4Y3I A;  2M7V A;  4EU0 A;  2A24 B;  2INW A;  3R4K A;  1WA9 A;  3A0R A;  4GHI A;  3GEC A;  1D7E A;  1XJ4 A;  5DJT A;  2VA0 A;  2B02 A;  2O9A A;  3BY9 A;  4YWZ A;  5FL3 A;  2PR6 A;  2H28 A;  5AVF A;  2XRO A;  2V1B A;  4RQ9 A;  2KX6 A;  3S7P A;  3TW8 A;  3C8C A;  1DP8 A;  4PAU A;  4EQ1 A;  3PXP A;  2J80 A;  3R7W B;  3T4J A;  2J3T D;  1F98 A;  5AJG A;  4NXE A;  4R3A A;  3S7O A;  2VKS A;  1OT9 A;  4O0P A;  4WEL A;  3UE3 A;  3E4P A;  3LID A;  5HPI A;  3JVU A;  3MXQ A;  2W3E A;  2KOI A;  1OTD A;  1S66 L;  1NWZ A;  3ULF A;  3BJN A;  3CI6 A;  1XJ6 A;  4EES A;  1H8M A;  1P9R A;  1W63 M;  3TJZ C;  3OOV A;  4WLA A;  1P0Z A;  2ZOI A;  4H6J B;  1LSV A;  3UB6 A;  3C30 A;  3EQV A;  4P6Z S;  4DJ2 A;  2JN7 A;  2JKT M;  5HWW A;  4GJ4 A;  3P7N A;  4L0L A;  2PYP A;  4I3J A;  4ME4 A;  5TBM B;  4BMW A;  3BWL A;  2O9C A;  1Y28 A;  5F5Y A;  3EEH A;  2W1R A;  2A2L A;  5HZH A;  2JKR M;  2W3D A;  3LIA A;  4G3W A;  4PKY G;  3PBO A;  3TRC A;  1BYW A;  4IJG A;  4BWI A;  1MC0 A;  2DMW A;  2OAP 1;  5DFX A;  3F1P B;  4CLC E;  3K2N A;  3OBF A;  2XA7 S;  2VGL M;  1TS6 A;  5J4E A;  3BW6 A;  3T4L A;  2GNX A;  3MQO A;  5J7E A;  4OOL A;  1OTE A;  3B47 A;  3H82 B;  4PHT A;  3EGX C;  4GLQ A;  1TD5 A;  2VV6 A;  4HJ6 A;  3IBJ A;  2QJ5 A;  2MJ6 A;  2WKQ A;  1H3Q A;  4I39 A;  3BQA A;  3FG8 A;  3LYX A;  4Z1W A;  3PBT A;  2QJ7 A;  4KQD A;  1V9Z A;  1OPX A;  4JGQ A;  3VV4 A;  3LR4 A;  5F6A A;  4MMN A;  2K2N A;  4HHD A;  2NUP C;  4WEK A;  2EWW A;  2I9V A;  2HV1 A;  2OWJ A;  2EWV A;  3C2W A;  3OC2 A;  3UMD A;  2WKP A;  3F1N B;  3H9W A;  2W1T A;  3LIC A;  1VB6 A;  3T4S A;  1YKD A;  1YSQ A;  3JVV A;  5HL6 A;  3UB8 A;  1OT6 A;  4HH2 A;  3KSI A;  2W3F A;  3MFX A;  2ZOH A;  4YNR A;  3IBR A;  4AFI A;  3VE3 A;  3H7W A;  1LT0 A;  1T19 A;  2OOL A;  1EW0 A;  4JGO A;  1T1A A;  4BBT A;  4E04 A;  4YOF A;  3UB9 A;  2PR5 A;  3B42 A;  2ZMV A;  3E4Q A;  5AVE A;  4GHI B;  2W27 A;  3RTY A;  1LSW A;  1YAX A;  4Y2F A;  3CWF A;  4KQO A;  1GSX A;  4O01 A;  1P9W A;  2L0W A;  2Z6C A;  5DKK A;  5CX7 A;  4HQA A;  3T4K A;  4HJ4 A;  4GS9 A;  4QPR A;  4CQH A;  1DP6 A;  2K7S A;  3LIE A;  4EXO A;  4P6Z M;  4L9G A;  1MZU A;  3NOP C;  3NOU C;  3KX0 X;  3S7N A;  4IHQ A;  4BBV A;  4OOM A;  2W3H A;  3KYZ A;  2YKF A;  2Y79 A;  3NOT C;  3T4T A;  2VZW A;  1NLY A;  1LSX A;  3KO6 A;  4GW9 A;  4DN0 A;  1XFN A;  3OCN A;  2D01 A;  4NEE D;  3ZQ5 A;  1VHM A;  4HJ3 A;  4M4X A;  2XSS A;  5LBR A;  2CMN A;  5G4Z A;  1YSP A;  3NHQ A;  4LRZ E;  1UWN X;  2V9A A;  1TF1 A;  2XA7 M;  4CLC C;  3E98 A;  4MCW A;  3B33 A;  4ZRR A;  4UQI S;  4HNB A;  4IUH A;  2QHK A;  3OLO A;  3D72 A;  2FH5 A;  4EEU A;  4NXB A;  4MN7 A;  4WF0 A;  4K08 A;  5I5L A;  4LRY C;  1T1C A;  4I5S A;  2GZA A;  3OCL A;  1TS7 A;  1W63 Q;  3HCY A;  3KSF A;  5IS1 A;  3EOI A;  5C5K A;  2PHY A;  1STZ A;  3MMH A;  1S4R A;  3EGD C;  3F1O A;  3U2A A;  2VX8 A;  5DKL A;  1DP9 A;  1S4S A;  2HJE A;  5F68 A;  5G4Y A;  2GJ3 A;  1F9I A;  1XJ2 A;  2P04 A;  3DBA A;  4MDZ A;  4CLC A;  1N9L A;  3CLO A;  5HPF A;  1OTA A;  4Y5F A;  2R78 A;  2L4R A;  4JGP A;  3TE8 A;  2J3W A;  4FOF A;  1UWP X;  2V1A A;  4LRX C;  4R38 A;  3K3C A;  3MR0 A;  3ZYT A;  3V67 A;  1ZHH B;  3LIB A;  3O5Y A;  3NJA A;  4I38 A;  1N9O A;  3PHY A;  4KUO A;  3T4O A;  3GDI A;  3EQU A;  3PBN A;  5HD3 A;  2O9B A;  2P08 A;  4HH3 A;  5L8M A;  2JHE A;  2GX5 A;  4PKY A;  3KSG A;  4LPZ A;  4NXF A;  1XJ3 A;  5K5B A;  3RH8 B;  2W0N A;  3A0S A;  3FPV A;  2VEA A;  4G3V A;  4BBU A;  1KOU A;  1OJ5 A;  2O0Y A;  2D02 A;  2W1T B;  1MKM A;  3MQ0 A;  5IU1 A;  1D06 A;  2BAS A;  2OAQ 1;  3W2Z A;  3MJQ A;  4MN6 A;  4EER A;  3ICY A;  4EEP A;  2OWH A;  2XRN A;  5MC7 A;  1S1Z A;  1S67 L;  5HDC A;  3S7Q A;  2G7U A;  3H7W B;  2QKP A;  4L9F A;  5DF9 A;  2VJW A;  4EUV A;  4WEJ A;  4B9O A;  4LLO B;  3D3O A;  1T18 A;  5HSQ A;  2Z6D A;  4L9E A;  3PYP A;  3BQ8 A;  5J3W A;  1S1Y A;  3FPW A;  2PDR A;  3VOL A;  4O8G A;  3VE4 A;  3KSH A;  3R7W A;  3LI8 A;  5TJJ A;  1P97 A;  3EEA A;  4GS9 B;  4ETX A;  4BJP A;  4HOI A;  1N9N A;  4R6L A;  3BY8 A;  4UQI M;  4XT2 A;  4ARZ A;  2JKT I;  4MN5 A;  3LI9 A;  5HWT A;  4Q0H A;  1IOU A;  2IA2 A;  2ZMF A;  2LB9 A;  4Q0I A;  4EET B;  1OTI A;  5IT5 A;  4HY8 A;  3C38 A;  4F3L A;  3CUE C;  2J3T C;  4DMZ A;  4CLC D;  4XT2 B;  4H6J A;  2PD7 A;  4ARZ B;  2PYR A;  5DJU A;  4NKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...