1XJ2A

Co-bound structure of bjfixlh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
molecule keywords Sensor protein fixL
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj2A00
3NOPC 1MZUA 3BY9A 1T18A 5DKLA 3LICA 4HQAA 4M4XA 1T19A 4JGPA 5HD5A 2JN7A 1S1YA 2VEAA 2Z6CA 3F1OB 1S1ZA 3HJIA 3PHYA 4HH2A 4K08A 5HDSA 1D06A 1KOUA 1XFNA 2D01A 4LPZA 2R78A 2V0WA 4F3LB 2HV1A 2JHEA 2QJ7A 1TS6A 2VV7A 4NXBA 2EA9A 2V0UA 2WKPA 1OTBA 1X0OA 5G4ZA 2CMNA 3LIEA 2ZBBA 5J7EA 3UE6A 2L0WA 3F1PA 4HH3A 4XT2A 2PD8A 4HJ4A 5TBMB 1OTEA 4RQ9A 1OJGA 1XJ3A 1Y28A 4HJ3A 1JNUA 3P7NA 4R3AA 4GW9A 5J4EA 3H7WB 4KUKA 4R70A 3T50A 2KX6A 2W27A 3UB8A 2QHKA 2QWSA 3F1NB 4BBVA 1GSWA 5DJTA 5F69A 3VE3A 2OWJA 3F1PB 5A8BA 3CWFA 4L9EA 2VV6A 3H82A 2YKHA 3LI8A 3A0SA 1UWPX 3BY8A 3G6OA 4HJ6A 2OWHA 4NXFA 1S4SA 3RH8B 4EESA 5DJUA 2D02A 2WKRA 3MJQA 4L9FA 5DKKA 5HDDA 5IU1A 4F3LA 3B33A 1P0ZA 3E4PA 3K3CA 3IS2A 1VB6A 1S67L 1WA9A 2INWA 2KDKA 2OOLA 2PR5A 2QKPA 4KQDA 2I9VA 3H9WA 4HOIA 3E4OA 3UMDA 4LRZE 1LSWA 2A24A 5HWVA 4GHIA 4H6JB 3PYPA 1T1AA 4I38A 2B02A 4DJ3A 4EXOA 1DP6A 3A0RA 2V9AA 1P97A 4XT2B 3FG8A 4HP4A 4YWZA 4WF0A 4KUOA 2WKQA 3IBRA 1GSXA 1V9YA 4I3JA 3EWKA 3MFXA 1F9IA 3A0VA 2ZOHA 4B9OA 4MN5A 1OJ5A 4NXEA 3LIAA 3EEHA 1TS7A 1N9LA 2PR6A 3H82B 2V1AA 3HJKA 2GJ3A 3NOUC 4JGOA 1OT9A 3GDIA 1TS8A 3NOTC 5F5YA 5J3WA 1DP8A 1DP9A 3CAXA 3F1NA 4GCZA 4BBUA 3E4QA 2YKFA 3MXQA 1UGUA 3GECA 2VV8A 3H7WA 3C2WA 3LIFA 5HDCA 3RTYA 3BWLA 5HWWA 5KIZA 1N9NA 1LSXA 1ODVA 5IS1A 1OT6A 4JGQA 4HY8A 2J80A 2PHYA 2W0NA 3IS2B 3LUQA 2K7SA 5TBMA 4JGRA 4MN6A 4I5SA 3MQOA 5EFWA 1XJ4A 3ICYA 1T1CA 4EERA 4I39A 1TS0A 2ZOIA 3MQQA 4EEUA 3OLOA 4HNBA 2H28A 4GS9A 4WN5A 1BYWA 2L4RA 3LYXA 3K3DA 4HI4A 5G4YA 4HHDA 2M1CA 4L9GA 3UB6A 5HSQA 1LT0A 3NHQA 4HP9A 4WUJA 5HWTA 4GS9B 3F1OA 5HZHA 1NWZA 2V1BA 1EW0A 3VOLA 2PD7A 1N9OA 2PYPA 1XJ6A 3CLOA 4DJ2A 1DRMA 4EEPA 4R6LA 4H6JA 5AVFA 4BBTA 4EETB 1XFQA 2BASA 3KX0X 1F98A 3FC7A 4HIAA 3LIBA 1OTIA 2PYRA 5HD3A 3MR0A 1LSVA 2Z6DA 2P7JA 4WLAA 4PKYA 4R38A 4WL9A 2VLGA 3UMEA 1G28A 3C8CA 4EQ1A 1S66L 4LLOB 3VE4A 1D7EA 2L1MA 1OTDA 3D72A 4LRXC 3LIDA 3UB9A 5I5LA 1GSVA 1UWNX 4I3IA 4NXGA 1OTAA 2QJ5A 3LI9A 3NJAA 3ULFA 1V9ZA 1LL8A 3ZQ5A 4E04A 4PKYG 1XJ2A 5F6AA 3UB7A 4LRYC 5AVEA 3SW1A 4EW7A 5F68A 1T1BA 1S4RA 4GHIB 2PDRA 2A24B 4I3AA
chains in the Genus database with same CATH superfamily
3QNBA 2R9XA 5M1AA 5FQ9A 3SH9A 3A3JA 1VM1A 2G7UA 4FUWA 2WKEA 3ZG8B 1FOFA 3ZNTA 2XDMA 1IELA 4FTXA 5DVAA 5FDSA 5FQQA 3T4KA 1CF0A 3Q81A 4S2OA 2W3FA 5FEGA 3PAEA 4UEYA 5DKKA 2WK0A 3GSGA 3NULA 3IS2A 3IF6A 2I9VA 2B02A 2K2NA 4YWZA 1PWDA 5CGXA 5FSRA 1BLCA 1YMSA 4OLGA 4ZRRA 2ZM2A 5J3WA 1P9RA 4CPKA 3E98A 3WS1A 3VSKA 5HWWA 3AGFA 2HPBA 3IX3A 3ZG9B 1CK3A 2KOIA 2J3TC 2Y2HA 3DTIA 4QPRA 5A90A 2W3EA 4DDSA 1L0EA 3RXWA 1W63Q 2ZQCA 1N4OA 4O7DA 3F1OA 1ES5A 2V1BA 4ZDXA 3JVUA 1KE0A 2VKSA 3IX8A 1MKMA 5M18A 4IVIA 4EBPA 4KENB 3BFFA 1K56A 4EQ1A 1HD8A 4KZAA 1D7EA 4PPRA 2QJ5A 4MBHA 1LHYA 4EUVA 3HLDA 5DTTA 1D1JA 3HL9A 4X56A 2HDUA 1T19A 4JGPA 2JN7A 3PBQA 4DRTA 1K55C 3SH7A 4IHQA 2R78A 2V0WA 2HV1A 2JHEA 3NY4A 2RCXA 2L0WA 4U0XA 1OTEA 4IBRA 1XJ3A 3P01A 3GR2A 4GW9A 5J4EA 5F82A 4R70A 2H0TA 3DTEA 4Y13A 2QWSA 1MWUA 4E3JA 3RH8B 4ZTKA 1YLWA 4UA9A 1ERMA 3E4OA 2WKIA 4S2PA 1CI8A 3FG8A 2PU4A 3G32A 1F9IA 1XA7A 4GD8A 5EUAA 4GZBA 4MNRA 3HLBA 4PM7A 3E2LA 5D3OA 2EX6A 4OPQA 1EROA 4JKTA 2H10A 4B4XA 1E3UA 3ITBA 5DFYA 4QWOA 4K0WA 1CEGA 1YLZA 1LSVA 1W5DA 1LI0A 3KYQA 4DJ2A 4R4SA 4C3QA 4YINA 3VP1A 5GHYA 1XPBA 2L1MA 1O7EA 3GV9A 1L0GA 4MMNA 3ULFA 2BG1A 4KZ7A 2PAVP 3QP4A 2XF3A 3CITA 1C3BA 3K2NA 2PDRA 3OPLA 1MBLA 5EVID 5GLAA 1L3LA 2ZM8A 3BEBA 4LPZA 5C5KA 1TS6A 3LY4A 2ZC5B 2EA9A 2V0UA 3A3IA 3ZYTA 4KZ9A 1YPRA 2ZBBA 3LIEA 3NCKA 4UQIM 5EVIA 4QY6A 3IH8A 3M6HA 4KZ6A 4PM6A 2VX8A 2P9VB 4RA7A 5FL3A 1LI9A 3U4LP 1AXBA 5IU1A 4R0QA 4E3MA 3MQ0A 1WA9A 3WRZA 1LL5A 2A24A 5DTKA 4I38A 3IXGA 4EXOA 3R4KA 4EBNA 1NRFA 3RJUA 1YSQA 4D2OA 3MFXA 3S1YA 2X01A 2HP9A 3EEHA 1N9LA 2PR6A 3O87A 3FV7A 4IUHA 4BBUA 3MXQA 4PHTA 5HDCA 2NUTC 1CJFA 3LCEA 2XR0A 3IS2B 3O5YA 3EEAA 4EBLA 5EFWA 4EERA 4WN5A 4L9GA 1P9WA 5TFQA 4EUZA 3BFEA 5EOEA 2PD7A 4R3JA 4R6LA 5FA7A 5CTNA 3E2KA 5JYPA 1KGGA 1UWNX 2V1ZA 4DDYA 1SKFA 3UB5P 3SW1A 2W1TA 3T4QA 1S4RA 2DRWA 2Y2MA 1KVMA 3QP1A 2B18A 3HJIA 4CLCC 2Q9NA 4NXBA 3LEZA 2O9AA 1KE4A 1STZA 1E25A 3G2YA 4HH3A 4HJ4A 1MC0A 1HVBA 2FZ0A 4JXWA 3P7NA 4R1GA 3FYZA 4PAUA 5EVIB 3F1NB 3UO9A 3QP2A 3VE3A 1JTGA 2B5RA 3BFGA 5DF7A 4ZAMA 2QKPA 3OPPA 4HOIA 3QHYA 2I72A 3HLFA 4IVKA 3W2ZA 2EX2A 2XFTA 4GLQA 2WAEA 1LLBA 1OJ5A 1IEMA 1NRJA 2IWDA 3IQAA 1G6AA 4GN2A 5FQIA 3Q7VA 5TBMA 2HP5A 3MQQA 1S6RA 4JF4A 1NLZA 4LCMA 1KE3A 3SZTA 3LR0A 2Z2LB 3MZEA 2EFXA 1ERQA 4OP8A 1S66L 2DCFA 5KMWA 2V8FA 3D4FA 3MF0A 1GSVA 1ZTUA 1NJ4A 4PKYG 3UE0A 1W8YA 3IF6C 5CX7A 5HD5A 1SZVA 4GDBA 1JVJA 4WYYA 4FSFA 1PW1A 5HAPA 2J9PA 1W79A 2G2UA 3SS3A 1PNEA 3GVBA 5L09A 3UB8A 2QHKA 4KZ8A 1Z6FA 3KSHA 1UWPX 1S4SA 4OPZA 5GLDA 2WADA 3CI6A 5CERA 4ID4A 5HDDA 4F3LA 4CQHA 3B33A 3E4PA 1W8QA 4WL9A 3T1XA 2AVXA 4Q0JA 4KQDA 4NKPA 1T1AA 2Y8HA 2JKGA 4O01A 1NY0A 2RL3A 5EE8A 4WMCD 3TSGA 3NOTC 4R3BA 4CLCB 4O8GA 3H7WA 5KIZA 1XGIA 1KGFA 4JGQA 4HY8A 2W0NA 4U0TA 4F94A 3M2KA 4HNBA 3KO6A 1BYWA 1SKOB 4DE2A 4OH0A 3UPPA 3NHQA 3SOIA 5HZHA 5CEDA 3OC2A 3V3RA 2J7VA 1AWIA 2JBFA 2BASA 1F98A 2R9WA 2X02A 3DTMA 3LIBA 1K54C 2Y2NA 2EFUA 4QJGA 1A0KA 1E3UD 4LV2A 5GHXA 2XRNA 4DE0A 3I7JA 4L0LA 1Q2PA 4EW7A 5F68A 1CEFA 1TF1A 2QMIA 2ZMFA 3CG5A 4KG5A 5AQAA 3A3FA 2VEAA 5FQKA 4K08A 2VJWA 3CMZA 4DN0A 4ZJ3A 4HBTA 2E8IA 4OVDA 5AQ9A 2VV7A 4FOFA 4S2JA 5HW3A 1FSWA 4KQRA 1W7FA 3IHAA 4HJ3A 3ZCZA 2DNSA 3C38A 1W63M 1JWZA 5HAIA 2KLIA 2EX9A 3GMWA 1ALQA 1BT5A 2JKTI 3MJQA 1RP5A 2E8JA 4LRXC 2O9BA 4UQIS 3IXBA 4N1XA 1P97A 3EQUA 3UNWA 5CTMA 3EWKA 3WS5A 1L0DA 3H82B 1YLTA 3LEQA 5E2FA 1DP8A 3DWKA 1ZKJA 4KZ4A 2PBDP 3VOZA 3ZVWA 2H0YA 1VHMA 3KSFA 4N92A 3HREA 3HBRA 5EV0A 1YKDA 3ZG0A 3VOYA 4BJPA 3UB6A 1EWZA 4AFIA 1OMEA 4NETA 2J3TD 3KSIA 3NECA 2Y4AA 5DF8A 2A49A 1U60A 2HF6A 3V3SA 5FQMA 4OQHA 2O9CA 1L2SA 4GDNA 3D72A 1I2SA 5GHZA 1OTAA 3A3EA 1M6KA 2XA7M 2WZXA 2Y2JA 1MZUA 4WZ5A 4LV3A 1IKIA 4X1LA 1S1YA 2ACGA 3MFDA 4X25A 4QY5A 2Y2IA 2VK3A 1IYQA 2Y2KA 1X0OA 2BLSA 3UE6A 4Z1WA 5TBMB 1Y28A 4X53A 2JKFA 1XP4A 2WYXA 2WZZA 3F1PB 2JE5A 3OPHA 5DJUA 4S2NC 4LV0A 1VB6A 1XA1A 5HL6A 3PTEA 3PYPA 3IWOA 4DJ3A 1PWCA 4DF6A 4WF0A 4Y15A 4OPRA 2OLUA 1GSXA 3BYDA 1SCWA 4B9OA 4MN5A 3RXXA 3LR5A 3CUEA 3LR4A 1OPXA 4E3LA 1H3QA 3F1NA 4GOGA 3G4PA 5F1FA 5HPIA 1XGJA 4HBUA 4JGRA 4E3NA 1TS0A 4EEUA 4BENA 2PT7A 1LT0A 4GS9B 1RCJA 4WZ4A 2PYPA 1XJ6A 3B42A 2A2LA 2WGVA 3SH8A 3Q1FA 3Q82A 4PKYA 1G28A 4UA7A 5CGSA 5KZHA 1DY6A 3T12B 2IWCA 3WRTA 3ZVTA 3T1SA 2Q9MA 3T50A 3NOPC 4EV4A 4KG6A 4HH2A 1D06A 5DTSA 1IYSA 3WWXA 2VGLM 2CC1A 3KYZA 2CMNA 4Y0UA 5J7EA 3QNCA 2PD8A 1FCMA 2UWXA 3UN7A 1PZOA 3IF6B 3PR6A 4DE1A 3H82A 2OSUA 3IF5A 4NXFA 3G35A 4IBXA 2EWWA 4X68A 3K3CA 4O0PA 1S67L 2KDKA 2ZJ9A 3NC8A 5IT5A 2ZQ8A 4PM5A 3G2ZA 3UE1A 4II7A 4GHIA 3WS4A 1NLYA 2V9AA 3NBLA 5FI2A 4ZJ1A 3MZFA 3CHWP 1TS8A 1ACFA 5FI7A 2C6WB 3PXPA 3BWLA 3T1RA 2GZAA 2J80A 4MN6A 4QU3A 5K5BA 3N7WA 1BULA 4Y0OA 3OCLA 2GX5A 2EXAA 4HI4A 5EM0A 4JXSA 2GNXA 2DMWA 4EEPA 5AVFA 1TD5A 1G68A 4PM9A 4YOFA 3MXRA 1L0FA 3QP8A 4WLAA 4WM9A 3TOIA 4B88A 5CEBA 3VE4A 2IWBA 4DXBA 5DFXA 5HFOA 4LRYC 2WGWB 4NEED 5HDSA 4G3WA 2P04A 1KOUA 1O07A 1GHPA 1K57C 3LFVA 4K91A 4YFMA 1MY8A 2XEPA 2A3UA 4XT2A 1YM1A 1OJGA 4OQIA 4JBFA 2H5SA 4KZ5A 3T4OA 4ETXA 5E2EA 4GNUA 4S2MA 3A0SA 3G6OA 3PBSA 2HP6A 2D02A 1PFLA 4FH2A 1SHVA 3NDEA 5FATA 1HTZA 1RGYA 1YLJA 2UV0E 1KDSA 3GQZA 3L7HA 1H0MA 4N1HA 4I3JA 4U3TA 2M7UA 4NXEA 4S2IA 2Y91A 3HJKA 4ME4A 5F5YA 2HDRA 5EECA 5E2HA 4Q8IA 1N9NA 3O86A 4P0MA 4BLMA 4I39A 2W1RA 2JC7A 4BWIA 2LB9A 4XUZA 1DJAA 4OONA 4ESPA 4BL2A 1WE4A 3JYIA 1PW8A 2ZQ9A 2QYBA 1LL9A 3FC7A 1OTIA 5HARA 2P7JA 3KYEA 5E43A 1MWRA 1G5UA 4MBFA 1PYYA 5I5LA 4I3IA 5IHVA 2JCHA 3L9KA 1BTLA 2C5WB 1IKGA 3MSHA 3IWIA 3LICA 4HQAA 4GD6A 1Z09A 5EPHA 1ONHA 5JYOA 2EX8A 3UDXA 3ISGA 4MLLA 1JNUA 2NUPC 3H7WB 4PMAA 1YLYA 2EXBA 1YT4A 1MWTA 3MMHA 2FH5A 3NDGA 3S7OA 2INWA 3HLCA 4M3KA 5M19A 3A0RA 3G34A 1VETA 4HP4A 3TJZC 2Y2GA 1V9YA 3UDIA 1YSPA 3OPRA 1JTDA 1NYMA 3CJMA 1TS7A 3NOUC 1F5MA 4R4RA 4JGOA 1G6OA 3HLWA 4BQMA 3RTYA 4UAAA 1ODVA 5CHMA 1VEUB 2K7SA 3BQ8A 2Y2LA 2H28A 3LYXA 2M1CA 4HP9A 3S22A 2XA7S 2ZC3B 3KX0X 2ZQAA 2X71A 2Z6DA 4R38A 4OOMA 1NZUA 2P74A 2XLNA 5EVLA 3DW0A 1V9ZA 4OKPA 5F6AA 3HLEA 2J3WA 1ONGA 4H6JA 3BY9A 2HZ5A 3BQAA 1PWGA 2G2WA 2GDNA 4RX3A 3LR3A 4F3LB 5LBRA 5E2GA 3W4OA 3LGOA 1OTBA 5G4ZA 1K6RA 3VP2A 1ZC2A 3CUEC 1PRQA 2KX6A 5FI6A 4JLFA 4BBVA 1GSWA 2Y2QA 3MZDA 4X1MA 5KSCA 3LI8A 2V8CA 1TDLA 3FPWA 4L9FA 4NG2A 4OLDA 3VMAA 5HL1A 1J9MA 5AQBA 4R23A 1FR1A 1I2WA 3IT9A 4DKIA 4XXRA 2WKQA 4E6XA 1WYCA 2XQZA 4K0XA 4B93A 3EOIA 5EVIC 1J3WA 1OT9A 2W3HA 3N8SA 5FDHA 2P9VA 2V20A 3C2WA 3A3DA 1GCEA 1H8MA 1LSXA 5IS1A 3U2AA 3LUQA 5F1GA 2M7VA 4WZ5C 2L4RA 4P6BA 1ES4A 2JKRI 1NWZA 4P87A 2LB5A 1EW0A 3V39A 1HLUP 2ZMVA 1JWPA 1K55A 3JVVA 3FKWA 3N6IA 2VGLS 4Y0TA 1BLSA 5L07A 5I94A 3EGDC 2VZWA 1VEUA 4KQOA 1XJ2A 2W3DA 3IXDA 3T4LA 3NIAA 5TR7A 1GHMA 4I3AA 1WYBA 4IEDA 4GB7A 4M4XA 2ZC6B 5F83A 4KG2A 3JPUA 3LY3A 4E3OA 3M2JA 3RFBA 1H8YA 4RQ9A 3V50A 3QP6A 1I5QA 4S2LA 3C5AA 3QP5A 2W27A 4Y7PA 5DJTA 4E3IA 4BD0A 3HLGA 2OWHA 1SKOA 1YQSA 2O99A 4EESA 5EOOA 2W3GA 1FIKA 3FKVA 1BLPA 5CXWA 2ZC4B 1MKIA 4ARZA 3C7UA 4LV1A 1H8ZA 4Q0IA 2PR5A 2VGJA 3H9WA 3C4PA 4H6JB 5GL9A 3BRMA 4UHUA 4CJNA 1DJCA 1IOUA 4RX2A 1TDGA 3FPVA 4S2NA 3VSLA 4OOLA 1FCNA 4XUXA 5KSHA 2GJ3A 4JPMA 1DP9A 3CAXA 1OT6A 1H5XA 3G31A 4ARZB 4Y17A 2ZOIA 4GS9A 3IH9A 3K3DA 1MXOA 3MKEA 5HSQA 3OOVA 1K56D 5FASA 3ZGAB 2PRFA 4JF6A 3CLOA 5FAQA 4BBTA 2ZQ7A 5HX9A 2J8YA 2ZLYA 3ZG7B 2Y2PA 3AGEA 4FCFA 3C8CA 2XH9A 4Q0HA 5FEFA 3DAVA 3DBAA 3UPNA 3UB9A 1ES3A 4CLCD 3NJAA 3DTKA 3DWZA 1K4FA 3UB7A 5EM1A 3PBNA 2PYRA 3IBJA 3PHYA 2Z6CA 3F1OB 5CHJA 5FAOA 3W8KA 3ZG5A 2Y79A 2QJ7A 2Y55A 4QHCA 1ESUA 3GRJA 5GLBA 3F1PA 2Y59A 4C75A 1M40A 4MCWA 1KGEA 2Q0OA 4ZBEA 4WEJA 2VA0A 5AQ7A 2IA2A 4P6ZS 5A8BA 4L9EA 3BY8A 4P85A 3NI9A 4HJ6A 2OLVA 3VV4A 3UE3A 3G30A 2WKRA 4GJ4A 4Y2FA 3BJNA 3HUNA 4MBKA 1BSGA 1K4EA 3MBZA 3M6BA 1LSWA 5HWVA 3PBTA 2OV5A 4XT2B 1ZHHB 4KUOA 2JKRM 1FQGA 3PBRA 2VGKA 1DJBA 4Y3IA 3FZCA 3FWLA 3GDIA 3W4PA 1K0KA 1IYPA 4E6WA 4LFUA 2QPNA 5A93A 2XFSA 2OAP1 3EQVA 4NK3A 1XJ4A 3ICYA 5G4YA 3BLMA 2QZ6A 3MKFA 3P09A 1XKZA 4EETB 3OCNA 2Z2MB 2ZL1B 4CLCA 2VLGA 1BZAA 5FAPA 1OTDA 3LIDA 4CLCE 4WBGA 4NXGA 5U47A 3MS6A 4E04A 5AVEA 1K25A 2ZM0A 1TEMA 1K6SA 3BM6A 1MWSA 3VP4A 2PU2A 1FR6A 3S4XA 4MN7A 3OBFA 2WKPA 4N9KA 3ITAA 4JF5A 1BLHA 1XXMA 4R3AA 3LO7A 3WS0A 4DXCA 5FQJA 5F69A 2XGNA 3CWFA 2VV6A 2YKHA 4IUKA 1IFQA 5L10A 2FFFB 2P08A 4LGWA 4EWFA 2PBYA 3N8LA 1EI5A 1NXYA 3KSGA 4QD4A 2HGVA 4WELA 3C4OA 3HUMA 3ZDJA 2WGWA 3EGXC 3WS2A 1HZOA 5HAQA 2J9OA 1Q2QA 5G18A 3IBRA 4Z9QA 2XSSA 3TE8A 4GCZA 3TG9A 3E4QA 1UGUA 3IHBA 1JWVA 2EWVA 2XD5A 3HCYA 2WUQA 3S7NA 1VQQA 4I5SA 5CHUA 1QMEA 3PAGA 1NYYA 4HHDA 1N9BA 3O3VA 1RGZA 5DF9A 5GLCA 1GHIA 3B3XA 4UA6A 1QMFA 2WAFA 4OP5A 2WGIA 4X69A 1KDWA 1ESIA 3GTCA 3BECA 4G3VA 4HIAA 3W4QA 5MC7A 4IJGA 1GA9A 3CPTA 3BFDA 3LI9A 1LL8A 4MEZA 1PI5A 4GHIB 1TVFA 4FH4A 1CQAA 4DE3A 3V5MA 1XX2A 2HJ9C 1SDEA 2HDQA 1CI9A 1XFNA 3P98A 4KZBA 4BMWA 2O0YA 3ZFZA 5L2FA 1IYOA 3OZHA 2XROA 1K54A 5L8MA 3VP3A 4B4ZA 4KUKA 4DMZA 1KVLA 4KZ3A 1K57A 3C7VA 5J8XA 3UY6A 4E3KA 3T1QB 5HPFA 2V2FF 4BL3A 1P0ZA 4JXGA 3SS4A 4C6YA 2BTFP 2OOLA 2ZD8A 3IX4A 4LRZE 4WEKA 5CRFA 4QB8A 3S7PA 1DP6A 3HUOA 5BOHA 3SS5A 3T4SA 1Y4OA 1E4DA 2ZOHA 3E0YA 3R7WB 4YNRA 1BUEA 3LIAA 2V1AA 3BFCA 1Y54A 1SDNA 2YKFA 3GECA 2VV8A 3LIFA 4H8RA 4HESA 2XK1A 4OQGA 3MQOA 1T1CA 2MJ6A 4MDZA 1MPLA 2Y2OA 3ZHHA 4WUJA 3T4JA 3AGDA 1YLPA 2ZQDA 4RYEA 1DRMA 2HJEA 3VFHA 3VFFA 1XFQA 4G3KA 3UDFA 4ETZA 1YAXA 2FFYA 4LLOB 4X55A 1GA0A 4D60A 3BW6A 3CPTB 3ZNYA 2HDSA 1PIOA 3B47A 2A24B 3C30A 1T18A 4RVAA 1ES2A 5DKLA 4OQ0A 3D3OA 4A5RA 4Y5FA 1S1ZA 4S2KA 3D9YA 4X6TA 3Q07A 2D01A 3BLSA 3IWQA 4HEFA 1ZG6A 4KQQA 3IXHA 1FSYA 1VETB 5AJGA 2B95A 5CGWA 1S0WA 4EU0A 3O88A 4N9LA 2OWJA 5CECA 4FD8A 4EQIA 4ZJ2A 4OOYA 4BD1A 1F2KA 3TRCA 5EVEA 3Q7VB 3HVFA 3UMDA 4WMCA 3MXSA 4LENA 4OPYA 5A91A 2ZC7A 4P6ZM 3Q7ZA 3A0VA 1PZPA 4JXVA 3N4IA 2XD1A 4LCLA 3VP0A 3T4TA 1K38A 2PHYA 5TGFA 1NZOA 3OLOA 1PI4A 3TW8A 5HWTA 5TJJA 1FILA 3VOLA 1N9OA 3UPOA 3CZDA 4PM8A 1YMXA 2JKTM 2K31A 3V67A 5A92A 5HD3A 3MR0A 1FCOA 2OAQ1 3UMEA 3PBOA 3S7QA 4GKUA 3R7WA 2ZMAA 1ZG4A 3N8RA 2ZL1A 3ZQ5A 2WKHA 2W1TB 1T1BA
chains in the Genus database with same CATH topology
3IBJA 4NEED 5CX7A 5HD5A 3PHYA 2Z6CA 3F1OB 5HDSA 4G3WA 2P04A 1KOUA 4FSFA 2Y79A 2G7UA 2QJ7A 3LFVA 3F1PA 4XT2A 1OJGA 4MCWA 4WEJA 2VA0A 3T4KA 2IA2A 2QHKA 4P6ZS 3UB8A 3T4OA 4ETXA 2W3FA 5A8BA 4L9EA 3A0SA 1UWPX 3BY8A 3G6OA 3KSHA 4HJ6A 1S4SA 3PBSA 3VV4A 2D02A 3UE3A 3CI6A 2WKRA 4GJ4A 4UEYA 5DKKA 5HDDA 4F3LA 4CQHA 3B33A 4Y2FA 3E4PA 3IS2A 4WL9A 4Q0JA 3BJNA 4KQDA 2I9VA 4NKPA 1LSWA 5HWVA 3PBTA 1T1AA 2B02A 2Y8HA 4XT2B 2K2NA 4YWZA 1ZHHB 4KUOA 2JKRM 4O01A 4I3JA 3PBRA 2M7UA 4NXEA 4ZRRA 4Y3IA 3HJKA 4ME4A 5J3WA 5F5YA 3GDIA 1P9RA 3NOTC 3E98A 4CLCB 4O8GA 3H7WA 5HWWA 5KIZA 1N9NA 4JGQA 4HY8A 2KOIA 2J3TC 2W0NA 3EQVA 2OAP1 4QPRA 1XJ4A 3ICYA 2W3EA 4I39A 4HNBA 3KO6A 1BYWA 2W1RA 5G4YA 1W63Q 2LB9A 4BWIA 3NHQA 3F1OA 5HZHA 2V1BA 3OC2A 3JVUA 2VKSA 1MKMA 4EETB 2QYBA 2BASA 3OCNA 1F98A 3FC7A 3LIBA 1OTIA 2P7JA 4CLCA 4EQ1A 2VLGA 1D7EA 1OTDA 2XRNA 3LIDA 4CLCE 5I5LA 4I3IA 4NXGA 2QJ5A 4EUVA 4L0LA 4E04A 5AVEA 4EW7A 5F68A 1TF1A 3LICA 4HQAA 1T19A 2ZMFA 4JGPA 2JN7A 2VEAA 3PBQA 4K08A 2VJWA 4DN0A 4IHQA 2R78A 2V0WA 2HV1A 2JHEA 2VV7A 4FOFA 4MN7A 3OBFA 2WKPA 2L0WA 1OTEA 1XJ3A 3P01A 4HJ3A 1JNUA 2NUPC 4R3AA 4GW9A 5J4EA 3H7WB 4R70A 3C38A 1W63M 2QWSA 5F69A 3CWFA 2KLIA 2VV6A 2YKHA 4IUKA 3RH8B 1IFQA 3MMHA 2JKTI 3MJQA 2FH5A 2P08A 3S7OA 4LRXC 3KSGA 2INWA 2O9BA 4UQIS 2HGVA 3E4OA 4WELA 3EGXC 3A0RA 1P97A 3EQUA 3FG8A 4HP4A 3TJZC 3IBRA 1V9YA 1YSPA 3EWKA 1F9IA 2XSSA 3NOUC 1TS7A 3H82B 1F5MA 4JGOA 1G6OA 1DP8A 3TE8A 4GCZA 3E4QA 1UGUA 3RTYA 2EWVA 1ODVA 3HCYA 3S7NA 2K7SA 1VHMA 3BQ8A 4I5SA 3KSFA 1YKDA 2H28A 3LYXA 4BJPA 4HHDA 2M1CA 3UB6A 4HP9A 4AFIA 2J3TD 3KSIA 5DF9A 2XA7S 5DFYA 2HF6A 3KX0X 4G3VA 4HIAA 5MC7A 4IJGA 1LSVA 3KYQA 2Z6DA 4DJ2A 4R38A 4OOMA 2O9CA 2L1MA 3D72A 1OTAA 4MMNA 3LI9A 3ULFA 1V9ZA 1LL8A 5F6AA 2XA7M 3CITA 3K2NA 2J3WA 4GHIB 2PDRA 4H6JA 1MZUA 3BY9A 3BQAA 2HJ9C 1S1YA 3LR3A 1XFNA 4LPZA 5C5KA 4F3LB 5LBRA 1TS6A 2EA9A 2V0UA 1OTBA 1X0OA 5G4ZA 3ZYTA 3LIEA 2ZBBA 4BMWA 3UE6A 2O0YA 4UQIM 4Z1WA 5TBMB 2XROA 3CUEC 1Y28A 5L8MA 4KUKA 2VX8A 2KX6A 4DMZA 4BBVA 1GSWA 3F1PB 3LI8A 5FL3A 5DJUA 3FPWA 4L9FA 5IU1A 5HPFA 1P0ZA 3MQ0A 1VB6A 1WA9A 2OOLA 5HL6A 4LRZE 2A24A 4WEKA 3PYPA 4I38A 4DJ3A 4EXOA 3S7PA 3R4KA 1DP6A 4WF0A 1YSQA 2WKQA 1GSXA 3MFXA 3T4SA 2ZOHA 3E0YA 4MN5A 4YNRA 3R7WB 4B93A 4B9OA 3LR5A 3EEHA 3LIAA 1N9LA 2PR6A 3CUEA 2V1AA 3LR4A 3EOIA 1OT9A 1OPXA 2W3HA 1H3QA 3F1NA 4IUHA 4BBUA 3MXQA 2YKFA 3GECA 2VV8A 4PHTA 3C2WA 3LIFA 5HDCA 5HPIA 1H8MA 1LSXA 2NUTC 3U2AA 5IS1A 3O5YA 3LUQA 3IS2B 3EEAA 4JGRA 3MQOA 5EFWA 4EERA 1T1CA 2M7VA 2MJ6A 1TS0A 4MDZA 4EEUA 2PT7A 4WN5A 2L4RA 4L9GA 1P9WA 1LT0A 2JKRI 4WUJA 3T4JA 4GS9B 1NWZA 2LB5A 1EW0A 2PD7A 2PYPA 1XJ6A 3B42A 1DRMA 2A2LA 4R6LA 2HJEA 2ZMVA 1XFQA 4G3KA 4ETZA 3JVVA 4PKYA 1YAXA 1G28A 4LLOB 2VGLS 3BW6A 1UWNX 3EGDC 2VZWA 4KQOA 1XJ2A 2W3DA 3SW1A 3B47A 2W1TA 3T4LA 3T4QA 1S4RA 2A24B 4I3AA 3C30A 3NOPC 3T50A 1T18A 5DKLA 4M4XA 3D3OA 4Y5FA 1S1ZA 2B18A 3HJIA 4HH2A 1D06A 4CLCC 2D01A 2VGLM 4NXBA 2O9AA 3KYZA 1STZA 2CMNA 3RFBA 5J7EA 4HH3A 2PD8A 1MC0A 4HJ4A 4RQ9A 5AJGA 2FZ0A 4EU0A 3P7NA 4PAUA 2W27A 3F1NB 5DJTA 3PR6A 3VE3A 2OWJA 3H82A 2OWHA 4NXFA 2O99A 4EESA 2W3GA 2EWWA 4ARZA 3K3CA 4O0PA 1S67L 2QKPA 2KDKA 4Q0IA 2PR5A 3H9WA 3TRCA 4HOIA 5IT5A 3UMDA 4II7A 4GHIA 4H6JB 3W2ZA 1NLYA 1IOUA 2V9AA 4GLQA 4P6ZM 3FPVA 4OOLA 3A0VA 1OJ5A 1NRJA 5KSHA 2GJ3A 1TS8A 1DP9A 3CAXA 3PXPA 3BWLA 1OT6A 3T4TA 2GZAA 2J80A 2PHYA 5TBMA 4ARZB 4MN6A 5K5BA 2ZOIA 3MQQA 2GX5A 3OCLA 3OLOA 4GS9A 1NLZA 3K3DA 4HI4A 3TW8A 5HSQA 5HWTA 3OOVA 5TJJA 2GNXA 2DMWA 3VOLA 1N9OA 3CLOA 4EEPA 5AVFA 4BBTA 3LR0A 1TD5A 2JKTM 2K31A 3V67A 4YOFA 5HD3A 3MR0A 2OAQ1 4WLAA 3UMEA 3C8CA 1S66L 3PBOA 4Q0HA 3VE4A 3S7QA 3DBAA 3R7WA 3UB9A 3MF0A 1GSVA 4CLCD 5DFXA 3NJAA 1ZTUA 3ZQ5A 4PKYG 3UB7A 4LRYC 2W1TB 3PBNA 1T1BA 2PYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOP C;  1MZU A;  3BY9 A;  1T18 A;  5DKL A;  3LIC A;  4HQA A;  4M4X A;  1T19 A;  4JGP A;  5HD5 A;  2JN7 A;  1S1Y A;  2VEA A;  2Z6C A;  3F1O B;  1S1Z A;  3HJI A;  3PHY A;  4HH2 A;  4K08 A;  5HDS A;  1D06 A;  1KOU A;  1XFN A;  2D01 A;  4LPZ A;  2R78 A;  2V0W A;  4F3L B;  2HV1 A;  2JHE A;  2QJ7 A;  1TS6 A;  2VV7 A;  4NXB A;  2EA9 A;  2V0U A;  2WKP A;  1OTB A;  1X0O A;  5G4Z A;  2CMN A;  3LIE A;  2ZBB A;  5J7E A;  3UE6 A;  2L0W A;  3F1P A;  4HH3 A;  4XT2 A;  2PD8 A;  4HJ4 A;  5TBM B;  1OTE A;  4RQ9 A;  1OJG A;  1XJ3 A;  1Y28 A;  4HJ3 A;  1JNU A;  3P7N A;  4R3A A;  4GW9 A;  5J4E A;  3H7W B;  4KUK A;  4R70 A;  3T50 A;  2KX6 A;  2W27 A;  3UB8 A;  2QHK A;  2QWS A;  3F1N B;  4BBV A;  1GSW A;  5DJT A;  5F69 A;  3VE3 A;  2OWJ A;  3F1P B;  5A8B A;  3CWF A;  4L9E A;  2VV6 A;  3H82 A;  2YKH A;  3LI8 A;  3A0S A;  1UWP X;  3BY8 A;  3G6O A;  4HJ6 A;  2OWH A;  4NXF A;  1S4S A;  3RH8 B;  4EES A;  5DJU A;  2D02 A;  2WKR A;  3MJQ A;  4L9F A;  5DKK A;  5HDD A;  5IU1 A;  4F3L A;  3B33 A;  1P0Z A;  3E4P A;  3K3C A;  3IS2 A;  1VB6 A;  1S67 L;  1WA9 A;  2INW A;  2KDK A;  2OOL A;  2PR5 A;  2QKP A;  4KQD A;  2I9V A;  3H9W A;  4HOI A;  3E4O A;  3UMD A;  4LRZ E;  1LSW A;  2A24 A;  5HWV A;  4GHI A;  4H6J B;  3PYP A;  1T1A A;  4I38 A;  2B02 A;  4DJ3 A;  4EXO A;  1DP6 A;  3A0R A;  2V9A A;  1P97 A;  4XT2 B;  3FG8 A;  4HP4 A;  4YWZ A;  4WF0 A;  4KUO A;  2WKQ A;  3IBR A;  1GSX A;  1V9Y A;  4I3J A;  3EWK A;  3MFX A;  1F9I A;  3A0V A;  2ZOH A;  4B9O A;  4MN5 A;  1OJ5 A;  4NXE A;  3LIA A;  3EEH A;  1TS7 A;  1N9L A;  2PR6 A;  3H82 B;  2V1A A;  3HJK A;  2GJ3 A;  3NOU C;  4JGO A;  1OT9 A;  3GDI A;  1TS8 A;  3NOT C;  5F5Y A;  5J3W A;  1DP8 A;  1DP9 A;  3CAX A;  3F1N A;  4GCZ A;  4BBU A;  3E4Q A;  2YKF A;  3MXQ A;  1UGU A;  3GEC A;  2VV8 A;  3H7W A;  3C2W A;  3LIF A;  5HDC A;  3RTY A;  3BWL A;  5HWW A;  5KIZ A;  1N9N A;  1LSX A;  1ODV A;  5IS1 A;  1OT6 A;  4JGQ A;  4HY8 A;  2J80 A;  2PHY A;  2W0N A;  3IS2 B;  3LUQ A;  2K7S A;  5TBM A;  4JGR A;  4MN6 A;  4I5S A;  3MQO A;  5EFW A;  1XJ4 A;  3ICY A;  1T1C A;  4EER A;  4I39 A;  1TS0 A;  2ZOI A;  3MQQ A;  4EEU A;  3OLO A;  4HNB A;  2H28 A;  4GS9 A;  4WN5 A;  1BYW A;  2L4R A;  3LYX A;  3K3D A;  4HI4 A;  5G4Y A;  4HHD A;  2M1C A;  4L9G A;  3UB6 A;  5HSQ A;  1LT0 A;  3NHQ A;  4HP9 A;  4WUJ A;  5HWT A;  4GS9 B;  3F1O A;  5HZH A;  1NWZ A;  2V1B A;  1EW0 A;  3VOL A;  2PD7 A;  1N9O A;  2PYP A;  1XJ6 A;  3CLO A;  4DJ2 A;  1DRM A;  4EEP A;  4R6L A;  4H6J A;  5AVF A;  4BBT A;  4EET B;  1XFQ A;  2BAS A;  3KX0 X;  1F98 A;  3FC7 A;  4HIA A;  3LIB A;  1OTI A;  2PYR A;  5HD3 A;  3MR0 A;  1LSV A;  2Z6D A;  2P7J A;  4WLA A;  4PKY A;  4R38 A;  4WL9 A;  2VLG A;  3UME A;  1G28 A;  3C8C A;  4EQ1 A;  1S66 L;  4LLO B;  3VE4 A;  1D7E A;  2L1M A;  1OTD A;  3D72 A;  4LRX C;  3LID A;  3UB9 A;  5I5L A;  1GSV A;  1UWN X;  4I3I A;  4NXG A;  1OTA A;  2QJ5 A;  3LI9 A;  3NJA A;  3ULF A;  1V9Z A;  1LL8 A;  3ZQ5 A;  4E04 A;  4PKY G;  1XJ2 A;  5F6A A;  3UB7 A;  4LRY C;  5AVE A;  3SW1 A;  4EW7 A;  5F68 A;  1T1B A;  1S4R A;  4GHI B;  2PDR A;  2A24 B;  4I3A A; 
#chains in the Genus database with same CATH topology
 3QNB A;  2R9X A;  5M1A A;  5FQ9 A;  3SH9 A;  3A3J A;  1VM1 A;  2G7U A;  4FUW A;  2WKE A;  3ZG8 B;  1FOF A;  3ZNT A;  2XDM A;  1IEL A;  4FTX A;  5DVA A;  5FDS A;  5FQQ A;  3T4K A;  1CF0 A;  3Q81 A;  4S2O A;  2W3F A;  5FEG A;  3PAE A;  4UEY A;  5DKK A;  2WK0 A;  3GSG A;  3NUL A;  3IS2 A;  3IF6 A;  2I9V A;  2B02 A;  2K2N A;  4YWZ A;  1PWD A;  5CGX A;  5FSR A;  1BLC A;  1YMS A;  4OLG A;  4ZRR A;  2ZM2 A;  5J3W A;  1P9R A;  4CPK A;  3E98 A;  3WS1 A;  3VSK A;  5HWW A;  3AGF A;  2HPB A;  3IX3 A;  3ZG9 B;  1CK3 A;  2KOI A;  2J3T C;  2Y2H A;  3DTI A;  4QPR A;  5A90 A;  2W3E A;  4DDS A;  1L0E A;  3RXW A;  1W63 Q;  2ZQC A;  1N4O A;  4O7D A;  3F1O A;  1ES5 A;  2V1B A;  4ZDX A;  3JVU A;  1KE0 A;  2VKS A;  3IX8 A;  1MKM A;  5M18 A;  4IVI A;  4EBP A;  4KEN B;  3BFF A;  1K56 A;  4EQ1 A;  1HD8 A;  4KZA A;  1D7E A;  4PPR A;  2QJ5 A;  4MBH A;  1LHY A;  4EUV A;  3HLD A;  5DTT A;  1D1J A;  3HL9 A;  4X56 A;  2HDU A;  1T19 A;  4JGP A;  2JN7 A;  3PBQ A;  4DRT A;  1K55 C;  3SH7 A;  4IHQ A;  2R78 A;  2V0W A;  2HV1 A;  2JHE A;  3NY4 A;  2RCX A;  2L0W A;  4U0X A;  1OTE A;  4IBR A;  1XJ3 A;  3P01 A;  3GR2 A;  4GW9 A;  5J4E A;  5F82 A;  4R70 A;  2H0T A;  3DTE A;  4Y13 A;  2QWS A;  1MWU A;  4E3J A;  3RH8 B;  4ZTK A;  1YLW A;  4UA9 A;  1ERM A;  3E4O A;  2WKI A;  4S2P A;  1CI8 A;  3FG8 A;  2PU4 A;  3G32 A;  1F9I A;  1XA7 A;  4GD8 A;  5EUA A;  4GZB A;  4MNR A;  3HLB A;  4PM7 A;  3E2L A;  5D3O A;  2EX6 A;  4OPQ A;  1ERO A;  4JKT A;  2H10 A;  4B4X A;  1E3U A;  3ITB A;  5DFY A;  4QWO A;  4K0W A;  1CEG A;  1YLZ A;  1LSV A;  1W5D A;  1LI0 A;  3KYQ A;  4DJ2 A;  4R4S A;  4C3Q A;  4YIN A;  3VP1 A;  5GHY A;  1XPB A;  2L1M A;  1O7E A;  3GV9 A;  1L0G A;  4MMN A;  3ULF A;  2BG1 A;  4KZ7 A;  2PAV P;  3QP4 A;  2XF3 A;  3CIT A;  1C3B A;  3K2N A;  2PDR A;  3OPL A;  1MBL A;  5EVI D;  5GLA A;  1L3L A;  2ZM8 A;  3BEB A;  4LPZ A;  5C5K A;  1TS6 A;  3LY4 A;  2ZC5 B;  2EA9 A;  2V0U A;  3A3I A;  3ZYT A;  4KZ9 A;  1YPR A;  2ZBB A;  3LIE A;  3NCK A;  4UQI M;  5EVI A;  4QY6 A;  3IH8 A;  3M6H A;  4KZ6 A;  4PM6 A;  2VX8 A;  2P9V B;  4RA7 A;  5FL3 A;  1LI9 A;  3U4L P;  1AXB A;  5IU1 A;  4R0Q A;  4E3M A;  3MQ0 A;  1WA9 A;  3WRZ A;  1LL5 A;  2A24 A;  5DTK A;  4I38 A;  3IXG A;  4EXO A;  3R4K A;  4EBN A;  1NRF A;  3RJU A;  1YSQ A;  4D2O A;  3MFX A;  3S1Y A;  2X01 A;  2HP9 A;  3EEH A;  1N9L A;  2PR6 A;  3O87 A;  3FV7 A;  4IUH A;  4BBU A;  3MXQ A;  4PHT A;  5HDC A;  2NUT C;  1CJF A;  3LCE A;  2XR0 A;  3IS2 B;  3O5Y A;  3EEA A;  4EBL A;  5EFW A;  4EER A;  4WN5 A;  4L9G A;  1P9W A;  5TFQ A;  4EUZ A;  3BFE A;  5EOE A;  2PD7 A;  4R3J A;  4R6L A;  5FA7 A;  5CTN A;  3E2K A;  5JYP A;  1KGG A;  1UWN X;  2V1Z A;  4DDY A;  1SKF A;  3UB5 P;  3SW1 A;  2W1T A;  3T4Q A;  1S4R A;  2DRW A;  2Y2M A;  1KVM A;  3QP1 A;  2B18 A;  3HJI A;  4CLC C;  2Q9N A;  4NXB A;  3LEZ A;  2O9A A;  1KE4 A;  1STZ A;  1E25 A;  3G2Y A;  4HH3 A;  4HJ4 A;  1MC0 A;  1HVB A;  2FZ0 A;  4JXW A;  3P7N A;  4R1G A;  3FYZ A;  4PAU A;  5EVI B;  3F1N B;  3UO9 A;  3QP2 A;  3VE3 A;  1JTG A;  2B5R A;  3BFG A;  5DF7 A;  4ZAM A;  2QKP A;  3OPP A;  4HOI A;  3QHY A;  2I72 A;  3HLF A;  4IVK A;  3W2Z A;  2EX2 A;  2XFT A;  4GLQ A;  2WAE A;  1LLB A;  1OJ5 A;  1IEM A;  1NRJ A;  2IWD A;  3IQA A;  1G6A A;  4GN2 A;  5FQI A;  3Q7V A;  5TBM A;  2HP5 A;  3MQQ A;  1S6R A;  4JF4 A;  1NLZ A;  4LCM A;  1KE3 A;  3SZT A;  3LR0 A;  2Z2L B;  3MZE A;  2EFX A;  1ERQ A;  4OP8 A;  1S66 L;  2DCF A;  5KMW A;  2V8F A;  3D4F A;  3MF0 A;  1GSV A;  1ZTU A;  1NJ4 A;  4PKY G;  3UE0 A;  1W8Y A;  3IF6 C;  5CX7 A;  5HD5 A;  1SZV A;  4GDB A;  1JVJ A;  4WYY A;  4FSF A;  1PW1 A;  5HAP A;  2J9P A;  1W79 A;  2G2U A;  3SS3 A;  1PNE A;  3GVB A;  5L09 A;  3UB8 A;  2QHK A;  4KZ8 A;  1Z6F A;  3KSH A;  1UWP X;  1S4S A;  4OPZ A;  5GLD A;  2WAD A;  3CI6 A;  5CER A;  4ID4 A;  5HDD A;  4F3L A;  4CQH A;  3B33 A;  3E4P A;  1W8Q A;  4WL9 A;  3T1X A;  2AVX A;  4Q0J A;  4KQD A;  4NKP A;  1T1A A;  2Y8H A;  2JKG A;  4O01 A;  1NY0 A;  2RL3 A;  5EE8 A;  4WMC D;  3TSG A;  3NOT C;  4R3B A;  4CLC B;  4O8G A;  3H7W A;  5KIZ A;  1XGI A;  1KGF A;  4JGQ A;  4HY8 A;  2W0N A;  4U0T A;  4F94 A;  3M2K A;  4HNB A;  3KO6 A;  1BYW A;  1SKO B;  4DE2 A;  4OH0 A;  3UPP A;  3NHQ A;  3SOI A;  5HZH A;  5CED A;  3OC2 A;  3V3R A;  2J7V A;  1AWI A;  2JBF A;  2BAS A;  1F98 A;  2R9W A;  2X02 A;  3DTM A;  3LIB A;  1K54 C;  2Y2N A;  2EFU A;  4QJG A;  1A0K A;  1E3U D;  4LV2 A;  5GHX A;  2XRN A;  4DE0 A;  3I7J A;  4L0L A;  1Q2P A;  4EW7 A;  5F68 A;  1CEF A;  1TF1 A;  2QMI A;  2ZMF A;  3CG5 A;  4KG5 A;  5AQA A;  3A3F A;  2VEA A;  5FQK A;  4K08 A;  2VJW A;  3CMZ A;  4DN0 A;  4ZJ3 A;  4HBT A;  2E8I A;  4OVD A;  5AQ9 A;  2VV7 A;  4FOF A;  4S2J A;  5HW3 A;  1FSW A;  4KQR A;  1W7F A;  3IHA A;  4HJ3 A;  3ZCZ A;  2DNS A;  3C38 A;  1W63 M;  1JWZ A;  5HAI A;  2KLI A;  2EX9 A;  3GMW A;  1ALQ A;  1BT5 A;  2JKT I;  3MJQ A;  1RP5 A;  2E8J A;  4LRX C;  2O9B A;  4UQI S;  3IXB A;  4N1X A;  1P97 A;  3EQU A;  3UNW A;  5CTM A;  3EWK A;  3WS5 A;  1L0D A;  3H82 B;  1YLT A;  3LEQ A;  5E2F A;  1DP8 A;  3DWK A;  1ZKJ A;  4KZ4 A;  2PBD P;  3VOZ A;  3ZVW A;  2H0Y A;  1VHM A;  3KSF A;  4N92 A;  3HRE A;  3HBR A;  5EV0 A;  1YKD A;  3ZG0 A;  3VOY A;  4BJP A;  3UB6 A;  1EWZ A;  4AFI A;  1OME A;  4NET A;  2J3T D;  3KSI A;  3NEC A;  2Y4A A;  5DF8 A;  2A49 A;  1U60 A;  2HF6 A;  3V3S A;  5FQM A;  4OQH A;  2O9C A;  1L2S A;  4GDN A;  3D72 A;  1I2S A;  5GHZ A;  1OTA A;  3A3E A;  1M6K A;  2XA7 M;  2WZX A;  2Y2J A;  1MZU A;  4WZ5 A;  4LV3 A;  1IKI A;  4X1L A;  1S1Y A;  2ACG A;  3MFD A;  4X25 A;  4QY5 A;  2Y2I A;  2VK3 A;  1IYQ A;  2Y2K A;  1X0O A;  2BLS A;  3UE6 A;  4Z1W A;  5TBM B;  1Y28 A;  4X53 A;  2JKF A;  1XP4 A;  2WYX A;  2WZZ A;  3F1P B;  2JE5 A;  3OPH A;  5DJU A;  4S2N C;  4LV0 A;  1VB6 A;  1XA1 A;  5HL6 A;  3PTE A;  3PYP A;  3IWO A;  4DJ3 A;  1PWC A;  4DF6 A;  4WF0 A;  4Y15 A;  4OPR A;  2OLU A;  1GSX A;  3BYD A;  1SCW A;  4B9O A;  4MN5 A;  3RXX A;  3LR5 A;  3CUE A;  3LR4 A;  1OPX A;  4E3L A;  1H3Q A;  3F1N A;  4GOG A;  3G4P A;  5F1F A;  5HPI A;  1XGJ A;  4HBU A;  4JGR A;  4E3N A;  1TS0 A;  4EEU A;  4BEN A;  2PT7 A;  1LT0 A;  4GS9 B;  1RCJ A;  4WZ4 A;  2PYP A;  1XJ6 A;  3B42 A;  2A2L A;  2WGV A;  3SH8 A;  3Q1F A;  3Q82 A;  4PKY A;  1G28 A;  4UA7 A;  5CGS A;  5KZH A;  1DY6 A;  3T12 B;  2IWC A;  3WRT A;  3ZVT A;  3T1S A;  2Q9M A;  3T50 A;  3NOP C;  4EV4 A;  4KG6 A;  4HH2 A;  1D06 A;  5DTS A;  1IYS A;  3WWX A;  2VGL M;  2CC1 A;  3KYZ A;  2CMN A;  4Y0U A;  5J7E A;  3QNC A;  2PD8 A;  1FCM A;  2UWX A;  3UN7 A;  1PZO A;  3IF6 B;  3PR6 A;  4DE1 A;  3H82 A;  2OSU A;  3IF5 A;  4NXF A;  3G35 A;  4IBX A;  2EWW A;  4X68 A;  3K3C A;  4O0P A;  1S67 L;  2KDK A;  2ZJ9 A;  3NC8 A;  5IT5 A;  2ZQ8 A;  4PM5 A;  3G2Z A;  3UE1 A;  4II7 A;  4GHI A;  3WS4 A;  1NLY A;  2V9A A;  3NBL A;  5FI2 A;  4ZJ1 A;  3MZF A;  3CHW P;  1TS8 A;  1ACF A;  5FI7 A;  2C6W B;  3PXP A;  3BWL A;  3T1R A;  2GZA A;  2J80 A;  4MN6 A;  4QU3 A;  5K5B A;  3N7W A;  1BUL A;  4Y0O A;  3OCL A;  2GX5 A;  2EXA A;  4HI4 A;  5EM0 A;  4JXS A;  2GNX A;  2DMW A;  4EEP A;  5AVF A;  1TD5 A;  1G68 A;  4PM9 A;  4YOF A;  3MXR A;  1L0F A;  3QP8 A;  4WLA A;  4WM9 A;  3TOI A;  4B88 A;  5CEB A;  3VE4 A;  2IWB A;  4DXB A;  5DFX A;  5HFO A;  4LRY C;  2WGW B;  4NEE D;  5HDS A;  4G3W A;  2P04 A;  1KOU A;  1O07 A;  1GHP A;  1K57 C;  3LFV A;  4K91 A;  4YFM A;  1MY8 A;  2XEP A;  2A3U A;  4XT2 A;  1YM1 A;  1OJG A;  4OQI A;  4JBF A;  2H5S A;  4KZ5 A;  3T4O A;  4ETX A;  5E2E A;  4GNU A;  4S2M A;  3A0S A;  3G6O A;  3PBS A;  2HP6 A;  2D02 A;  1PFL A;  4FH2 A;  1SHV A;  3NDE A;  5FAT A;  1HTZ A;  1RGY A;  1YLJ A;  2UV0 E;  1KDS A;  3GQZ A;  3L7H A;  1H0M A;  4N1H A;  4I3J A;  4U3T A;  2M7U A;  4NXE A;  4S2I A;  2Y91 A;  3HJK A;  4ME4 A;  5F5Y A;  2HDR A;  5EEC A;  5E2H A;  4Q8I A;  1N9N A;  3O86 A;  4P0M A;  4BLM A;  4I39 A;  2W1R A;  2JC7 A;  4BWI A;  2LB9 A;  4XUZ A;  1DJA A;  4OON A;  4ESP A;  4BL2 A;  1WE4 A;  3JYI A;  1PW8 A;  2ZQ9 A;  2QYB A;  1LL9 A;  3FC7 A;  1OTI A;  5HAR A;  2P7J A;  3KYE A;  5E43 A;  1MWR A;  1G5U A;  4MBF A;  1PYY A;  5I5L A;  4I3I A;  5IHV A;  2JCH A;  3L9K A;  1BTL A;  2C5W B;  1IKG A;  3MSH A;  3IWI A;  3LIC A;  4HQA A;  4GD6 A;  1Z09 A;  5EPH A;  1ONH A;  5JYO A;  2EX8 A;  3UDX A;  3ISG A;  4MLL A;  1JNU A;  2NUP C;  3H7W B;  4PMA A;  1YLY A;  2EXB A;  1YT4 A;  1MWT A;  3MMH A;  2FH5 A;  3NDG A;  3S7O A;  2INW A;  3HLC A;  4M3K A;  5M19 A;  3A0R A;  3G34 A;  1VET A;  4HP4 A;  3TJZ C;  2Y2G A;  1V9Y A;  3UDI A;  1YSP A;  3OPR A;  1JTD A;  1NYM A;  3CJM A;  1TS7 A;  3NOU C;  1F5M A;  4R4R A;  4JGO A;  1G6O A;  3HLW A;  4BQM A;  3RTY A;  4UAA A;  1ODV A;  5CHM A;  1VEU B;  2K7S A;  3BQ8 A;  2Y2L A;  2H28 A;  3LYX A;  2M1C A;  4HP9 A;  3S22 A;  2XA7 S;  2ZC3 B;  3KX0 X;  2ZQA A;  2X71 A;  2Z6D A;  4R38 A;  4OOM A;  1NZU A;  2P74 A;  2XLN A;  5EVL A;  3DW0 A;  1V9Z A;  4OKP A;  5F6A A;  3HLE A;  2J3W A;  1ONG A;  4H6J A;  3BY9 A;  2HZ5 A;  3BQA A;  1PWG A;  2G2W A;  2GDN A;  4RX3 A;  3LR3 A;  4F3L B;  5LBR A;  5E2G A;  3W4O A;  3LGO A;  1OTB A;  5G4Z A;  1K6R A;  3VP2 A;  1ZC2 A;  3CUE C;  1PRQ A;  2KX6 A;  5FI6 A;  4JLF A;  4BBV A;  1GSW A;  2Y2Q A;  3MZD A;  4X1M A;  5KSC A;  3LI8 A;  2V8C A;  1TDL A;  3FPW A;  4L9F A;  4NG2 A;  4OLD A;  3VMA A;  5HL1 A;  1J9M A;  5AQB A;  4R23 A;  1FR1 A;  1I2W A;  3IT9 A;  4DKI A;  4XXR A;  2WKQ A;  4E6X A;  1WYC A;  2XQZ A;  4K0X A;  4B93 A;  3EOI A;  5EVI C;  1J3W A;  1OT9 A;  2W3H A;  3N8S A;  5FDH A;  2P9V A;  2V20 A;  3C2W A;  3A3D A;  1GCE A;  1H8M A;  1LSX A;  5IS1 A;  3U2A A;  3LUQ A;  5F1G A;  2M7V A;  4WZ5 C;  2L4R A;  4P6B A;  1ES4 A;  2JKR I;  1NWZ A;  4P87 A;  2LB5 A;  1EW0 A;  3V39 A;  1HLU P;  2ZMV A;  1JWP A;  1K55 A;  3JVV A;  3FKW A;  3N6I A;  2VGL S;  4Y0T A;  1BLS A;  5L07 A;  5I94 A;  3EGD C;  2VZW A;  1VEU A;  4KQO A;  1XJ2 A;  2W3D A;  3IXD A;  3T4L A;  3NIA A;  5TR7 A;  1GHM A;  4I3A A;  1WYB A;  4IED A;  4GB7 A;  4M4X A;  2ZC6 B;  5F83 A;  4KG2 A;  3JPU A;  3LY3 A;  4E3O A;  3M2J A;  3RFB A;  1H8Y A;  4RQ9 A;  3V50 A;  3QP6 A;  1I5Q A;  4S2L A;  3C5A A;  3QP5 A;  2W27 A;  4Y7P A;  5DJT A;  4E3I A;  4BD0 A;  3HLG A;  2OWH A;  1SKO A;  1YQS A;  2O99 A;  4EES A;  5EOO A;  2W3G A;  1FIK A;  3FKV A;  1BLP A;  5CXW A;  2ZC4 B;  1MKI A;  4ARZ A;  3C7U A;  4LV1 A;  1H8Z A;  4Q0I A;  2PR5 A;  2VGJ A;  3H9W A;  3C4P A;  4H6J B;  5GL9 A;  3BRM A;  4UHU A;  4CJN A;  1DJC A;  1IOU A;  4RX2 A;  1TDG A;  3FPV A;  4S2N A;  3VSL A;  4OOL A;  1FCN A;  4XUX A;  5KSH A;  2GJ3 A;  4JPM A;  1DP9 A;  3CAX A;  1OT6 A;  1H5X A;  3G31 A;  4ARZ B;  4Y17 A;  2ZOI A;  4GS9 A;  3IH9 A;  3K3D A;  1MXO A;  3MKE A;  5HSQ A;  3OOV A;  1K56 D;  5FAS A;  3ZGA B;  2PRF A;  4JF6 A;  3CLO A;  5FAQ A;  4BBT A;  2ZQ7 A;  5HX9 A;  2J8Y A;  2ZLY A;  3ZG7 B;  2Y2P A;  3AGE A;  4FCF A;  3C8C A;  2XH9 A;  4Q0H A;  5FEF A;  3DAV A;  3DBA A;  3UPN A;  3UB9 A;  1ES3 A;  4CLC D;  3NJA A;  3DTK A;  3DWZ A;  1K4F A;  3UB7 A;  5EM1 A;  3PBN A;  2PYR A;  3IBJ A;  3PHY A;  2Z6C A;  3F1O B;  5CHJ A;  5FAO A;  3W8K A;  3ZG5 A;  2Y79 A;  2QJ7 A;  2Y55 A;  4QHC A;  1ESU A;  3GRJ A;  5GLB A;  3F1P A;  2Y59 A;  4C75 A;  1M40 A;  4MCW A;  1KGE A;  2Q0O A;  4ZBE A;  4WEJ A;  2VA0 A;  5AQ7 A;  2IA2 A;  4P6Z S;  5A8B A;  4L9E A;  3BY8 A;  4P85 A;  3NI9 A;  4HJ6 A;  2OLV A;  3VV4 A;  3UE3 A;  3G30 A;  2WKR A;  4GJ4 A;  4Y2F A;  3BJN A;  3HUN A;  4MBK A;  1BSG A;  1K4E A;  3MBZ A;  3M6B A;  1LSW A;  5HWV A;  3PBT A;  2OV5 A;  4XT2 B;  1ZHH B;  4KUO A;  2JKR M;  1FQG A;  3PBR A;  2VGK A;  1DJB A;  4Y3I A;  3FZC A;  3FWL A;  3GDI A;  3W4P A;  1K0K A;  1IYP A;  4E6W A;  4LFU A;  2QPN A;  5A93 A;  2XFS A;  2OAP 1;  3EQV A;  4NK3 A;  1XJ4 A;  3ICY A;  5G4Y A;  3BLM A;  2QZ6 A;  3MKF A;  3P09 A;  1XKZ A;  4EET B;  3OCN A;  2Z2M B;  2ZL1 B;  4CLC A;  2VLG A;  1BZA A;  5FAP A;  1OTD A;  3LID A;  4CLC E;  4WBG A;  4NXG A;  5U47 A;  3MS6 A;  4E04 A;  5AVE A;  1K25 A;  2ZM0 A;  1TEM A;  1K6S A;  3BM6 A;  1MWS A;  3VP4 A;  2PU2 A;  1FR6 A;  3S4X A;  4MN7 A;  3OBF A;  2WKP A;  4N9K A;  3ITA A;  4JF5 A;  1BLH A;  1XXM A;  4R3A A;  3LO7 A;  3WS0 A;  4DXC A;  5FQJ A;  5F69 A;  2XGN A;  3CWF A;  2VV6 A;  2YKH A;  4IUK A;  1IFQ A;  5L10 A;  2FFF B;  2P08 A;  4LGW A;  4EWF A;  2PBY A;  3N8L A;  1EI5 A;  1NXY A;  3KSG A;  4QD4 A;  2HGV A;  4WEL A;  3C4O A;  3HUM A;  3ZDJ A;  2WGW A;  3EGX C;  3WS2 A;  1HZO A;  5HAQ A;  2J9O A;  1Q2Q A;  5G18 A;  3IBR A;  4Z9Q A;  2XSS A;  3TE8 A;  4GCZ A;  3TG9 A;  3E4Q A;  1UGU A;  3IHB A;  1JWV A;  2EWV A;  2XD5 A;  3HCY A;  2WUQ A;  3S7N A;  1VQQ A;  4I5S A;  5CHU A;  1QME A;  3PAG A;  1NYY A;  4HHD A;  1N9B A;  3O3V A;  1RGZ A;  5DF9 A;  5GLC A;  1GHI A;  3B3X A;  4UA6 A;  1QMF A;  2WAF A;  4OP5 A;  2WGI A;  4X69 A;  1KDW A;  1ESI A;  3GTC A;  3BEC A;  4G3V A;  4HIA A;  3W4Q A;  5MC7 A;  4IJG A;  1GA9 A;  3CPT A;  3BFD A;  3LI9 A;  1LL8 A;  4MEZ A;  1PI5 A;  4GHI B;  1TVF A;  4FH4 A;  1CQA A;  4DE3 A;  3V5M A;  1XX2 A;  2HJ9 C;  1SDE A;  2HDQ A;  1CI9 A;  1XFN A;  3P98 A;  4KZB A;  4BMW A;  2O0Y A;  3ZFZ A;  5L2F A;  1IYO A;  3OZH A;  2XRO A;  1K54 A;  5L8M A;  3VP3 A;  4B4Z A;  4KUK A;  4DMZ A;  1KVL A;  4KZ3 A;  1K57 A;  3C7V A;  5J8X A;  3UY6 A;  4E3K A;  3T1Q B;  5HPF A;  2V2F F;  4BL3 A;  1P0Z A;  4JXG A;  3SS4 A;  4C6Y A;  2BTF P;  2OOL A;  2ZD8 A;  3IX4 A;  4LRZ E;  4WEK A;  5CRF A;  4QB8 A;  3S7P A;  1DP6 A;  3HUO A;  5BOH A;  3SS5 A;  3T4S A;  1Y4O A;  1E4D A;  2ZOH A;  3E0Y A;  3R7W B;  4YNR A;  1BUE A;  3LIA A;  2V1A A;  3BFC A;  1Y54 A;  1SDN A;  2YKF A;  3GEC A;  2VV8 A;  3LIF A;  4H8R A;  4HES A;  2XK1 A;  4OQG A;  3MQO A;  1T1C A;  2MJ6 A;  4MDZ A;  1MPL A;  2Y2O A;  3ZHH A;  4WUJ A;  3T4J A;  3AGD A;  1YLP A;  2ZQD A;  4RYE A;  1DRM A;  2HJE A;  3VFH A;  3VFF A;  1XFQ A;  4G3K A;  3UDF A;  4ETZ A;  1YAX A;  2FFY A;  4LLO B;  4X55 A;  1GA0 A;  4D60 A;  3BW6 A;  3CPT B;  3ZNY A;  2HDS A;  1PIO A;  3B47 A;  2A24 B;  3C30 A;  1T18 A;  4RVA A;  1ES2 A;  5DKL A;  4OQ0 A;  3D3O A;  4A5R A;  4Y5F A;  1S1Z A;  4S2K A;  3D9Y A;  4X6T A;  3Q07 A;  2D01 A;  3BLS A;  3IWQ A;  4HEF A;  1ZG6 A;  4KQQ A;  3IXH A;  1FSY A;  1VET B;  5AJG A;  2B95 A;  5CGW A;  1S0W A;  4EU0 A;  3O88 A;  4N9L A;  2OWJ A;  5CEC A;  4FD8 A;  4EQI A;  4ZJ2 A;  4OOY A;  4BD1 A;  1F2K A;  3TRC A;  5EVE A;  3Q7V B;  3HVF A;  3UMD A;  4WMC A;  3MXS A;  4LEN A;  4OPY A;  5A91 A;  2ZC7 A;  4P6Z M;  3Q7Z A;  3A0V A;  1PZP A;  4JXV A;  3N4I A;  2XD1 A;  4LCL A;  3VP0 A;  3T4T A;  1K38 A;  2PHY A;  5TGF A;  1NZO A;  3OLO A;  1PI4 A;  3TW8 A;  5HWT A;  5TJJ A;  1FIL A;  3VOL A;  1N9O A;  3UPO A;  3CZD A;  4PM8 A;  1YMX A;  2JKT M;  2K31 A;  3V67 A;  5A92 A;  5HD3 A;  3MR0 A;  1FCO A;  2OAQ 1;  3UME A;  3PBO A;  3S7Q A;  4GKU A;  3R7W A;  2ZMA A;  1ZG4 A;  3N8R A;  2ZL1 A;  3ZQ5 A;  2WKH A;  2W1T B;  1T1B A; 
#chains in the Genus database with same CATH homology
 3IBJ A;  4NEE D;  5CX7 A;  5HD5 A;  3PHY A;  2Z6C A;  3F1O B;  5HDS A;  4G3W A;  2P04 A;  1KOU A;  4FSF A;  2Y79 A;  2G7U A;  2QJ7 A;  3LFV A;  3F1P A;  4XT2 A;  1OJG A;  4MCW A;  4WEJ A;  2VA0 A;  3T4K A;  2IA2 A;  2QHK A;  4P6Z S;  3UB8 A;  3T4O A;  4ETX A;  2W3F A;  5A8B A;  4L9E A;  3A0S A;  1UWP X;  3BY8 A;  3G6O A;  3KSH A;  4HJ6 A;  1S4S A;  3PBS A;  3VV4 A;  2D02 A;  3UE3 A;  3CI6 A;  2WKR A;  4GJ4 A;  4UEY A;  5DKK A;  5HDD A;  4F3L A;  4CQH A;  3B33 A;  4Y2F A;  3E4P A;  3IS2 A;  4WL9 A;  4Q0J A;  3BJN A;  4KQD A;  2I9V A;  4NKP A;  1LSW A;  5HWV A;  3PBT A;  1T1A A;  2B02 A;  2Y8H A;  4XT2 B;  2K2N A;  4YWZ A;  1ZHH B;  4KUO A;  2JKR M;  4O01 A;  4I3J A;  3PBR A;  2M7U A;  4NXE A;  4ZRR A;  4Y3I A;  3HJK A;  4ME4 A;  5J3W A;  5F5Y A;  3GDI A;  1P9R A;  3NOT C;  3E98 A;  4CLC B;  4O8G A;  3H7W A;  5HWW A;  5KIZ A;  1N9N A;  4JGQ A;  4HY8 A;  2KOI A;  2J3T C;  2W0N A;  3EQV A;  2OAP 1;  4QPR A;  1XJ4 A;  3ICY A;  2W3E A;  4I39 A;  4HNB A;  3KO6 A;  1BYW A;  2W1R A;  5G4Y A;  1W63 Q;  2LB9 A;  4BWI A;  3NHQ A;  3F1O A;  5HZH A;  2V1B A;  3OC2 A;  3JVU A;  2VKS A;  1MKM A;  4EET B;  2QYB A;  2BAS A;  3OCN A;  1F98 A;  3FC7 A;  3LIB A;  1OTI A;  2P7J A;  4CLC A;  4EQ1 A;  2VLG A;  1D7E A;  1OTD A;  2XRN A;  3LID A;  4CLC E;  5I5L A;  4I3I A;  4NXG A;  2QJ5 A;  4EUV A;  4L0L A;  4E04 A;  5AVE A;  4EW7 A;  5F68 A;  1TF1 A;  3LIC A;  4HQA A;  1T19 A;  2ZMF A;  4JGP A;  2JN7 A;  2VEA A;  3PBQ A;  4K08 A;  2VJW A;  4DN0 A;  4IHQ A;  2R78 A;  2V0W A;  2HV1 A;  2JHE A;  2VV7 A;  4FOF A;  4MN7 A;  3OBF A;  2WKP A;  2L0W A;  1OTE A;  1XJ3 A;  3P01 A;  4HJ3 A;  1JNU A;  2NUP C;  4R3A A;  4GW9 A;  5J4E A;  3H7W B;  4R70 A;  3C38 A;  1W63 M;  2QWS A;  5F69 A;  3CWF A;  2KLI A;  2VV6 A;  2YKH A;  4IUK A;  3RH8 B;  1IFQ A;  3MMH A;  2JKT I;  3MJQ A;  2FH5 A;  2P08 A;  3S7O A;  4LRX C;  3KSG A;  2INW A;  2O9B A;  4UQI S;  2HGV A;  3E4O A;  4WEL A;  3EGX C;  3A0R A;  1P97 A;  3EQU A;  3FG8 A;  4HP4 A;  3TJZ C;  3IBR A;  1V9Y A;  1YSP A;  3EWK A;  1F9I A;  2XSS A;  3NOU C;  1TS7 A;  3H82 B;  1F5M A;  4JGO A;  1G6O A;  1DP8 A;  3TE8 A;  4GCZ A;  3E4Q A;  1UGU A;  3RTY A;  2EWV A;  1ODV A;  3HCY A;  3S7N A;  2K7S A;  1VHM A;  3BQ8 A;  4I5S A;  3KSF A;  1YKD A;  2H28 A;  3LYX A;  4BJP A;  4HHD A;  2M1C A;  3UB6 A;  4HP9 A;  4AFI A;  2J3T D;  3KSI A;  5DF9 A;  2XA7 S;  5DFY A;  2HF6 A;  3KX0 X;  4G3V A;  4HIA A;  5MC7 A;  4IJG A;  1LSV A;  3KYQ A;  2Z6D A;  4DJ2 A;  4R38 A;  4OOM A;  2O9C A;  2L1M A;  3D72 A;  1OTA A;  4MMN A;  3LI9 A;  3ULF A;  1V9Z A;  1LL8 A;  5F6A A;  2XA7 M;  3CIT A;  3K2N A;  2J3W A;  4GHI B;  2PDR A;  4H6J A;  1MZU A;  3BY9 A;  3BQA A;  2HJ9 C;  1S1Y A;  3LR3 A;  1XFN A;  4LPZ A;  5C5K A;  4F3L B;  5LBR A;  1TS6 A;  2EA9 A;  2V0U A;  1OTB A;  1X0O A;  5G4Z A;  3ZYT A;  3LIE A;  2ZBB A;  4BMW A;  3UE6 A;  2O0Y A;  4UQI M;  4Z1W A;  5TBM B;  2XRO A;  3CUE C;  1Y28 A;  5L8M A;  4KUK A;  2VX8 A;  2KX6 A;  4DMZ A;  4BBV A;  1GSW A;  3F1P B;  3LI8 A;  5FL3 A;  5DJU A;  3FPW A;  4L9F A;  5IU1 A;  5HPF A;  1P0Z A;  3MQ0 A;  1VB6 A;  1WA9 A;  2OOL A;  5HL6 A;  4LRZ E;  2A24 A;  4WEK A;  3PYP A;  4I38 A;  4DJ3 A;  4EXO A;  3S7P A;  3R4K A;  1DP6 A;  4WF0 A;  1YSQ A;  2WKQ A;  1GSX A;  3MFX A;  3T4S A;  2ZOH A;  3E0Y A;  4MN5 A;  4YNR A;  3R7W B;  4B93 A;  4B9O A;  3LR5 A;  3EEH A;  3LIA A;  1N9L A;  2PR6 A;  3CUE A;  2V1A A;  3LR4 A;  3EOI A;  1OT9 A;  1OPX A;  2W3H A;  1H3Q A;  3F1N A;  4IUH A;  4BBU A;  3MXQ A;  2YKF A;  3GEC A;  2VV8 A;  4PHT A;  3C2W A;  3LIF A;  5HDC A;  5HPI A;  1H8M A;  1LSX A;  2NUT C;  3U2A A;  5IS1 A;  3O5Y A;  3LUQ A;  3IS2 B;  3EEA A;  4JGR A;  3MQO A;  5EFW A;  4EER A;  1T1C A;  2M7V A;  2MJ6 A;  1TS0 A;  4MDZ A;  4EEU A;  2PT7 A;  4WN5 A;  2L4R A;  4L9G A;  1P9W A;  1LT0 A;  2JKR I;  4WUJ A;  3T4J A;  4GS9 B;  1NWZ A;  2LB5 A;  1EW0 A;  2PD7 A;  2PYP A;  1XJ6 A;  3B42 A;  1DRM A;  2A2L A;  4R6L A;  2HJE A;  2ZMV A;  1XFQ A;  4G3K A;  4ETZ A;  3JVV A;  4PKY A;  1YAX A;  1G28 A;  4LLO B;  2VGL S;  3BW6 A;  1UWN X;  3EGD C;  2VZW A;  4KQO A;  1XJ2 A;  2W3D A;  3SW1 A;  3B47 A;  2W1T A;  3T4L A;  3T4Q A;  1S4R A;  2A24 B;  4I3A A;  3C30 A;  3NOP C;  3T50 A;  1T18 A;  5DKL A;  4M4X A;  3D3O A;  4Y5F A;  1S1Z A;  2B18 A;  3HJI A;  4HH2 A;  1D06 A;  4CLC C;  2D01 A;  2VGL M;  4NXB A;  2O9A A;  3KYZ A;  1STZ A;  2CMN A;  3RFB A;  5J7E A;  4HH3 A;  2PD8 A;  1MC0 A;  4HJ4 A;  4RQ9 A;  5AJG A;  2FZ0 A;  4EU0 A;  3P7N A;  4PAU A;  2W27 A;  3F1N B;  5DJT A;  3PR6 A;  3VE3 A;  2OWJ A;  3H82 A;  2OWH A;  4NXF A;  2O99 A;  4EES A;  2W3G A;  2EWW A;  4ARZ A;  3K3C A;  4O0P A;  1S67 L;  2QKP A;  2KDK A;  4Q0I A;  2PR5 A;  3H9W A;  3TRC A;  4HOI A;  5IT5 A;  3UMD A;  4II7 A;  4GHI A;  4H6J B;  3W2Z A;  1NLY A;  1IOU A;  2V9A A;  4GLQ A;  4P6Z M;  3FPV A;  4OOL A;  3A0V A;  1OJ5 A;  1NRJ A;  5KSH A;  2GJ3 A;  1TS8 A;  1DP9 A;  3CAX A;  3PXP A;  3BWL A;  1OT6 A;  3T4T A;  2GZA A;  2J80 A;  2PHY A;  5TBM A;  4ARZ B;  4MN6 A;  5K5B A;  2ZOI A;  3MQQ A;  2GX5 A;  3OCL A;  3OLO A;  4GS9 A;  1NLZ A;  3K3D A;  4HI4 A;  3TW8 A;  5HSQ A;  5HWT A;  3OOV A;  5TJJ A;  2GNX A;  2DMW A;  3VOL A;  1N9O A;  3CLO A;  4EEP A;  5AVF A;  4BBT A;  3LR0 A;  1TD5 A;  2JKT M;  2K31 A;  3V67 A;  4YOF A;  5HD3 A;  3MR0 A;  2OAQ 1;  4WLA A;  3UME A;  3C8C A;  1S66 L;  3PBO A;  4Q0H A;  3VE4 A;  3S7Q A;  3DBA A;  3R7W A;  3UB9 A;  3MF0 A;  1GSV A;  4CLC D;  5DFX A;  3NJA A;  1ZTU A;  3ZQ5 A;  4PKY G;  3UB7 A;  4LRY C;  2W1T B;  3PBN A;  1T1B A;  2PYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...