1XJ2A

Co-bound structure of bjfixlh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 32
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj2A00
2PHYA 4K08A 4R70A 4EEPA 3NJAA 3F1PB 3C2WA 3B33A 4I3IA 1ODVA 4WL9A 4R38A 2D01A 4DJ2A 2V0WA 4LPZA 3BY8A 1P97A 4EERA 2YKHA 5IU1A 2VV7A 4L9GA 1DP9A 2VV8A 4MN5A 4HY8A 1T1BA 2VLGA 3NHQA 1T1AA 2GJ3A 3ZQ5A 3UE6A 1MZUA 4GW9A 5HWTA 1T18A 4XT2A 4EESA 1OJGA 3CWFA 1LT0A 1LSXA 2EA9A 3K3DA 3C8CA 5F5YA 5J3WA 1LSVA 3RH8B 1OJ5A 5HDSA 4I5SA 3E4OA 1TS8A 1TS0A 2R78A 4JGPA 3E4QA 1EW0A 4I3JA 2V1BA 4HHDA 4YWZA 3PYPA 1S67L 2I9VA 2K7SA 4I39A 4I3AA 2JHEA 3UB6A 3KX0X 4JGRA 3IS2B 4GS9A 1BYWA 2L0WA 3H7WB 2QKPA 3F1NA 5TBMA 2JN7A 3H82B 3NOPC 5HSQA 2OOLA 5IS1A 4GHIA 3LI8A 2A24A 1F98A 1XJ6A 3LYXA 1D7EA 4GCZA 4JGOA 4F3LB 2OWHA 3LI9A 3LUQA 4JGQA 3VE3A 3HJKA 3K3CA 4EQ1A 4NXEA 1S1ZA 2QWSA 4LRXC 1DRMA 5EFWA 2WKQA 1DP6A 3ICYA 3H9WA 3NOUC 3GECA 2PDRA 3LIBA 4BBVA 4WUJA 5DJUA 3F1NB 3LIDA 1V9YA 3UMEA 5TBMB 3VOLA 1F9IA 2QJ7A 4WLAA 2INWA 2A24B 5I5LA 4NXBA 3P7NA 2V9AA 1XFQA 5J7EA 1N9OA 4LRYC 5F6AA 5HDDA 4L9EA 5KIZA 5AVFA 1D06A 1N9NA 2Z6CA 4PKYG 1VB6A 1Y28A 2ZBBA 2QHKA 1S4RA 2HV1A 5DKLA 2QJ5A 3CAXA 1UWNX 5HDCA 4HI4A 4HJ6A 2WKRA 4HJ3A 4NXFA 4B9OA 3MR0A 5F69A 1OT6A 3MJQA 2M1CA 3T50A 2B02A 3MQQA 3FC7A 2J80A 1OT9A 2H28A 3BY9A 1OTEA 4XT2B 1XJ2A 4HNBA 3F1PA 1P0ZA 3OLOA 3UMDA 2VEAA 1LSWA 4KQDA 2KX6A 3VE4A 5HWWA 4M4XA 5HD3A 1G28A 5G4ZA 4WN5A 1X0OA 2V1AA 1OTBA 3CLOA 5HWVA 2L4RA 5F68A 3LICA 4EEUA 4HH3A 1UGUA 3SW1A 2L1MA 3E4PA 4I38A 1KOUA 4WF0A 1GSWA 1T19A 1OTAA 1UWPX 4GS9B 1TS6A 2ZOIA 3IBRA 5HD5A 5DKKA 4HH2A 4LLOB 3RTYA 2P7JA 2PD7A 3HJIA 4HJ4A 3FG8A 1LL8A 2Z6DA 4R3AA 4HOIA 1GSXA 4KUKA 5A8BA 4EW7A 2VV6A 2WKPA 4GHIB 3A0SA 3UB8A 3MXQA 3PHYA 3EWKA 3D72A 4LRZE 2W27A 3IS2A 2PR6A 1S66L 4H6JA 2PYRA 4HIAA 1T1CA 4KUOA 3H7WA 4E04A 3LIFA 2W0NA 3F1OA 3ULFA 3H82A 3BWLA 4MN6A 1OTDA 4BBTA 3LIEA 2V0UA 3GDIA 4EXOA 4DJ3A 1GSVA 1XFNA 4HP9A 4BBUA 2CMNA 5DJTA 4HP4A 1N9LA 5AVEA 4F3LA 4L9FA 1JNUA 3UB9A 3G6OA 5G4YA 1S1YA 1DP8A 3EEHA 2BASA 3UB7A 3A0VA 3NOTC 2ZOHA 2PR5A 4PKYA 4H6JB 4HQAA 2YKFA 2D02A 1XJ4A 3MQOA 4RQ9A 1V9ZA 4R6LA 1TS7A 4EETB 2PYPA 2PD8A 3F1OB 1S4SA 2OWJA 3MFXA 5HZHA 1XJ3A 4NXGA 1OTIA 2KDKA 1WA9A 1NWZA 5J4EA 3A0RA 3LIAA
chains in the Genus database with same CATH superfamily
4PM6A 2NUTC 3WS2A 1F5MA 4X53A 1G6AA 4R70A 5DTSA 5L10A 2Y2LA 4DDSA 1TD5A 4H8RA 4IBXA 5GLDA 3B33A 2WGIA 4I3IA 4ZDXA 1ODVA 4R38A 1N9BA 1H0MA 4OKPA 3BY8A 4X25A 4EERA 4Q0HA 1FQGA 1ES4A 3HBRA 1ZTUA 3BFFA 4MN5A 5HARA 5EM1A 1T1BA 4FD8A 2VLGA 3C4PA 4ZJ3A 3A3EA 3UE6A 4IUHA 3ZQ5A 5FATA 3W2ZA 3LR3A 2P9VA 1KGGA 1OJGA 3N6IA 2GDNA 1VEUA 1W63M 3CWFA 4WZ4A 3CZDA 5FEFA 1LSXA 5AQ7A 5TGFA 3VP4A 3C8CA 1FSWA 3DAVA 4DE0A 1Z09A 4XUZA 4OQHA 1I5QA 3LFVA 1ERMA 1MXOA 1TS8A 1TS0A 1GHPA 3E4QA 4I3JA 5F83A 2V1BA 5D3OA 2RL3A 3IXGA 1S67L 2I9VA 2AVXA 2K7SA 4Y15A 3OPRA 2JHEA 5E2GA 2Z2LB 2J3TD 3FZCA 3QP6A 5A90A 1MKIA 1ESUA 1BYWA 3HUOA 2EWVA 3F1NA 1F2KA 3MS6A 3DTIA 1BTLA 3BQ8A 2JN7A 2P74A 3O88A 1AXBA 2XEPA 4LV0A 4R23A 1CQAA 1PIOA 1W8QA 3IHAA 1N4OA 4XUXA 1YT4A 3UY6A 2VZWA 3S22A 3ZG9B 4HEFA 2A24A 1XJ6A 4R3JA 5HPIA 2KLIA 4JGOA 4KENB 1RCJA 4ESPA 1EI5A 2O9CA 4JGQA 1ES3A 3CMZA 3IXHA 3T1QB 1S1ZA 4AFIA 3D9YA 4OQ0A 2JKTI 3BFGA 4Y0TA 4Y0UA 3NOUC 1ZG4A 3C30A 3ZCZA 5M1AA 3OPLA 3F1NB 4E3LA 1V9YA 3JYIA 3MKFA 3VOLA 3BW6A 1PI4A 1MWRA 2ZC6B 1ALQA 5DF9A 4WLAA 2BG1A 2A24B 4FH2A 3HL9A 3K2NA 2JKFA 5CX7A 3E2KA 3M6HA 4E6WA 3PAEA 4JF5A 4LENA 3FYZA 2XQZA 5EVLA 4L9EA 5HDDA 5KIZA 3NDGA 2QMIA 1W7FA 2Z6CA 1KGEA 1VB6A 3U2AA 2HV1A 1YM1A 4MBKA 4CLCE 4K0XA 3LY4A 3DTMA 3BM6A 4P6ZM 4IVIA 4JLFA 3QNBA 4QY5A 5CTNA 1YLJA 4N9KA 3T50A 5FQ9A 3ITAA 2B02A 1YMXA 3MQQA 4DMZA 2J80A 1OT9A 1OTEA 1CI8A 3OLOA 5F82A 2G7UA 4X1MA 1PZOA 4LGWA 2KX6A 1YPRA 3VFFA 4IHQA 3GR2A 5HWWA 5DFYA 1M6KA 1IOUA 1PI5A 2EX9A 4P87A 2V1AA 3CLOA 3UPPA 5E2HA 4EEUA 1DY6A 2XH9A 3UDIA 3MF0A 4QU3A 4UA6A 4KZ9A 5EV0A 1HTZA 3E4PA 4I38A 4WF0A 3IBJA 5E2FA 4R4RA 2ZL1A 2Y2GA 3S7OA 2J9OA 4KZBA 3VSLA 4PM5A 5HD5A 3ZDJA 3Q82A 2WKEA 2EFUA 2WAEA 5DVAA 1KVLA 4HJ4A 3BRMA 2Z6DA 4R3AA 4HOIA 1GSXA 1MWTA 2W3GA 1PRQA 4C6YA 1STZA 3PBSA 5CEDA 5CHUA 5A8BA 5EVIC 4P6BA 2VV6A 4P85A 4DF6A 4QB8A 4BQMA 2VGKA 5HAQA 4WYYA 3PHYA 3O86A 3EWKA 3N8SA 4LRZE 1W5DA 2EXBA 3PAGA 3QP1A 2WKIA 1CEGA 3SS5A 4NETA 1EWZA 1KE3A 2A2LA 4HIAA 3H7WA 2HGVA 2W1RA 4B88A 5E2EA 2K31A 2ZD8A 4Y7PA 3IH9A 4FSFA 2OV5A 2ZC3B 5A91A 3BWLA 1P9WA 2ZJ9A 4MCWA 4MN6A 3VP3A 3LIEA 2VJWA 2V0UA 2Z2MB 3VV4A 3HVFA 3E2LA 4DXCA 1KE0A 5DJTA 1N9LA 5CERA 4F3LA 1LLBA 1BLSA 3HCYA 4UEYA 5AQAA 3G6OA 4WBGA 4UA7A 3IHBA 3SS3A 1BLPA 1S1YA 3BFCA 3EEHA 1GA9A 1FCOA 3T12B 2BASA 3AGFA 2HDSA 2XGNA 3UB5P 4GOGA 1GA0A 4KZ4A 4E3JA 2PR5A 4PKYA 4X1LA 1K54C 1XJ4A 1I2SA 3BYDA 1RGYA 3KSGA 2PD8A 1NYYA 1BT5A 3CPTB 3IWIA 4NXGA 5GLBA 3ZYTA 2KDKA 4QHCA 2XROA 1L0FA 3QP2A 2Y2IA 3MBZA 4JXSA 3AGEA 1CI9A 2XDMA 1MWSA 1XA1A 2W3EA 2PRFA 2R9WA 4UAAA 2ZMFA 3NJAA 3F1PB 3PXPA 4KZ8A 4Q0IA 5U47A 4CLCC 4JXVA 1WYBA 1PWCA 3BECA 2P08A 2YKHA 5A93A 2VV8A 3MSHA 4HY8A 4OOMA 2WADA 1KGFA 5EVIA 3NHQA 2GJ3A 4B4XA 4Z9QA 1MZUA 3D3OA 2Q0OA 4X56A 1T18A 4EESA 2Y2QA 3G4PA 3T4JA 5DF7A 3C4OA 3K3DA 3IF6A 5FL3A 1MY8A 5F5YA 5J3WA 3RH8B 5KSHA 1Y54A 3IX8A 3O87A 1VETA 1G6OA 5FAQA 4UA9A 2JKTM 1XPBA 1BZAA 4YWZA 1G5UA 3RXWA 4ARZB 2JC7A 3QHYA 2FH5A 2Y2PA 3BEBA 3MZFA 4CQHA 3T1XA 5EVIB 2JKRI 3IS2B 4U0TA 3LR4A 1NLZA 3A3DA 3Q81A 4E6XA 3IX4A 4EBNA 3T4OA 4JKTA 2IA2A 5L2FA 2E8IA 5TBMA 4HESA 2VKSA 1NJ4A 3H82B 3LEQA 3V67A 3UNWA 2W1TA 4EU0A 4KZAA 1K54A 3KYQA 3E98A 3ZG7B 2DNSA 1TDGA 4OLDA 2R9XA 2Y8HA 5DTKA 1VETB 4GHIA 3P01A 4R1GA 3LYXA 4FCFA 5LBRA 1D7EA 4GCZA 2VK3A 2I72A 3LUQA 2ZM8A 3HJKA 3WRZA 2XK1A 3K3CA 4E3MA 2OLUA 4MN7A 3GV9A 1XXMA 4BL2A 4JF6A 1L0GA 3H9WA 2WK0A 3T4SA 4WUJA 3FPWA 5DJUA 5F1GA 5J8XA 1VQQA 4CLCA 5F1FA 5TBMB 2O99A 4GB7A 3R7WB 2W1TB 2PT7A 5CGWA 2HJEA 3C38A 4BMWA 5DFXA 1MKMA 3HLEA 3DTEA 1MBLA 4MEZA 3GVBA 5FAPA 2Y4AA 4NK3A 5I5LA 2ZMAA 5GHXA 1N9OA 4FTXA 5F6AA 1PFLA 3WWXA 2HPBA 5AVFA 1S4RA 2G2UA 2V20A 1UWNX 3CAXA 4PMAA 5HDCA 4B93A 2FZ0A 4HI4A 3JPUA 3NY4A 4NXFA 3VP2A 3MR0A 5EVID 3MJQA 2M1CA 3FC7A 3WRTA 4S2MA 3OPPA 2P9VB 2Y2JA 1XJ2A 4HNBA 5EPHA 1VEUB 1P0ZA 4G3VA 5CGXA 4GKUA 3UMDA 2ZQ7A 1RGZA 2O9BA 2EX6A 4KQDA 3I7JA 3OBFA 3VE4A 4M4XA 5FSRA 2IWDA 4BL3A 5HD3A 1E4DA 3AGDA 1DJCA 4R4SA 2X02A 1G28A 5G4ZA 1TDLA 4WN5A 1X0OA 1OTBA 3MQ0A 2M7VA 1FSYA 2L4RA 4RX2A 4OONA 1ZHHB 4HH3A 5GHZA 4E3KA 1L0DA 2O0YA 4GNUA 2L1MA 3O5YA 1IKGA 5L8MA 2HF6A 3ZGAB 1GSWA 5HL6A 4OPYA 2HDQA 3JVVA 1UWPX 1TS6A 4RA7A 2ZOIA 5L07A 4OP8A 5DKKA 4HH2A 4OP5A 1SCWA 4X69A 4F94A 4U0XA 4D60A 4Y5FA 1O07A 2Y2KA 5HAPA 3G2ZA 5A92A 2EWWA 3CI6A 5EE8A 4WELA 4EW7A 5IT5A 3KYEA 2WKPA 2W3FA 1K55C 3CHWP 1SKOA 3KYZA 3MXQA 2WUQA 2GX5A 3D72A 4BD1A 4WZ5C 1PYYA 1ZKJA 3DWKA 4ZAMA 3VSKA 1T1CA 3LGOA 3PTEA 4E04A 2W3HA 2GNXA 3KSHA 1YKDA 1LI0A 1BUEA 3LR5A 4GDBA 4S2PA 3A3IA 3A3FA 4CLCD 2J3WA 4Q8IA 2GZAA 4BBUA 3SH8A 2K2NA 1BLHA 3ZG0A 3OOVA 3ZVTA 1JNUA 1PW1A 1HZOA 4WEKA 5G18A 1SKOB 3MFDA 4EBLA 4KQRA 1L3LA 2Q9MA 3A0VA 4GJ4A 3Q7VA 3FKWA 4O01A 3TG9A 4HQAA 1SHVA 2D02A 1VHMA 4IEDA 1FR1A 1I2WA 3MQOA 1TS7A 4EETB 2BLSA 3S7NA 4DRTA 1PWGA 2OLVA 4MNRA 4KQQA 4NEED 1KE4A 4E3OA 4KZ3A 1YLWA 4A5RA 1QMFA 4JBFA 2HP5A 3LIAA 1LL5A 4K08A 1PW8A 3HLBA 3HLDA 2ZQ8A 2NUPC 1XA7A 1SKFA 4DJ2A 5AJGA 4ZTKA 4N1HA 3CG5A 1A0KA 2JKRM 2WYXA 4LPZA 2J7VA 3O3VA 3DW0A 5IU1A 1JTDA 4L9GA 1Q2QA 2OAQ1 1H8ZA 3KO6A 1MC0A 3FPVA 1T1AA 3OPHA 1IELA 2J8YA 3VOZA 3IF6C 2XA7S 1K55A 2H0YA 4GW9A 2Y2NA 5HWTA 3U4LP 4XT2A 3RXXA 3NECA 4EUVA 4WZ5A 3T4LA 2ZL1B 5CGSA 4L0LA 2EA9A 3IT9A 2Y59A 4Q0JA 2O9AA 1OJ5A 1IYQA 4MMNA 1LI9A 4Y0OA 4ME4A 1SZVA 4RX3A 2V2FF 3B42A 4BJPA 4JGPA 3MMHA 2PU4A 1EW0A 4RYEA 3V50A 3T4QA 3SH7A 1K56A 4YOFA 2JCHA 2WGWA 1K4FA 3N8RA 4S2LA 4I39A 3WS0A 1XX2A 3W8KA 3L9KA 3KX0X 4ZRRA 4Y3IA 4FOFA 3IQAA 3HUNA 2DMWA 4GS9A 1H5XA 4OPRA 5KMWA 4KG6A 3PBOA 1KVMA 2L0WA 3H7WB 2H10A 1IKIA 5DTTA 4IUKA 2XF3A 3QP8A 1ZG6A 3EQVA 4OOYA 3NOPC 5HAIA 5JYPA 4Y17A 3HUMA 3OCLA 4D2OA 2FFFB 2PBYA 3EGXC 3FWLA 4EV4A 1K57C 4IVKA 2WGWB 3SS4A 2DRWA 2OWHA 4F3LB 3UPOA 2RCXA 3VE3A 3TSGA 4E3IA 3EGDC 3SH9A 1YMSA 2Y91A 4NXEA 4LRXC 4OVDA 1NZUA 4X55A 1DP6A 2VX8A 3MKEA 3JVUA 3ICYA 3LY3A 1WYCA 2KOIA 2BTFP 2PDRA 3LIBA 3VFHA 4BBVA 4Z1WA 1ESIA 3NDEA 2M7UA 3UE0A 3QP4A 3LIDA 3UMEA 4EQIA 1SDNA 2H5SA 5FQJA 1J3WA 1JTGA 4S2IA 2V8FA 1F9IA 1IFQA 1GCEA 1RP5A 4PM9A 1P9RA 3C5AA 3IF5A 5CHJA 1H8YA 1LHYA 4NXBA 1U60A 5GLCA 3ZVWA 3C7VA 4BD0A 3N7WA 2V8CA 2WAFA 1YSQA 4PKYG 5CHMA 2JKGA 2QHKA 3CITA 2E8JA 2VGJA 2QPNA 5DKLA 3EOIA 4KQOA 4C3QA 4Y13A 2XSSA 2QJ5A 4Y2FA 3TW8A 2C6WB 1PZPA 4HJ6A 2WKRA 4HJ3A 2WGVA 4OPQA 5FQQA 2Q9NA 4QJGA 1K0KA 4JPMA 4U3TA 5F69A 4CPKA 4M3KA 3CUEC 1NRFA 2H28A 1TEMA 5GHYA 3S7QA 5CXWA 4UQIS 4OOLA 3UDXA 1ONHA 2P04A 3MZDA 3IF6B 3HREA 1LSWA 4ETZA 1E25A 4OH0A 3B47A 2ZMVA 5TFQA 3EQUA 3UE1A 3IXBA 1KDWA 5HPFA 1K56D 4WM9A 2XD1A 3KSIA 5HWVA 1DJBA 1LL9A 5F68A 3LICA 3LEZA 5EOEA 3OCNA 1UGUA 3SW1A 3BQAA 4KZ5A 1HLUP 1K57A 1KOUA 4DXBA 4QY6A 1XGJA 2Y79A 5CTMA 3IBRA 4IBRA 4LLOB 3RTYA 2WKHA 3HJIA 2C5WB 3FG8A 1LL8A 1NXYA 3NBLA 2VGLS 4EWFA 4X68A 3IWOA 3DBAA 4O8GA 4KUKA 4MBHA 4LV1A 4LCMA 3G31A 3MXRA 4FH4A 2XR0A 3IWQA 4GHIB 2HP6A 3UB8A 4N1XA 1HVBA 3V5MA 3Q1FA 5M18A 2W27A 3N4IA 2PR6A 3UO9A 1S66L 3ZFZA 4PM8A 4H6JA 5GL9A 4KUOA 3T1RA 2HJ9C 2Y2OA 2Y2HA 5TJJA 1WE4A 3FKVA 3ULFA 4G3WA 2PU2A 4WMCA 1NYMA 3PBNA 4BBTA 3BFEA 4EXOA 4DJ3A 4QPRA 1GSVA 2B5RA 5FAOA 4CLCB 2IWBA 2J9PA 4HP9A 3PBQA 1XKZA 4X6TA 3V3RA 1OMEA 5KZHA 5AVEA 3E0YA 5FI7A 3T4KA 5JYOA 4KG5A 3LO7A 3UB9A 5FI2A 5G4YA 3GQZA 2HZ5A 1DP8A 3WS5A 5E43A 3T4TA 4GN2A 1CF0A 3UB7A 3NOTC 3CUEA 2HDRA 2B95A 2ZQ9A 3QP5A 3P98A 3UN7A 3NIAA 4H6JB 2YKFA 1K6RA 4RQ9A 1V9ZA 1S4SA 3RFBA 2WZXA 1NRJA 2ZC4B 1EROA 4S2OA 1Z6FA 1JVJA 2XD5A 4OQGA 1G68A 1OTIA 3M2JA 2H0TA 1IYOA 1PNEA 1NWZA 3SZTA 4EUZA 1BULA 3MZEA 2PHYA 3LCEA 2EXAA 5FDHA 1ES5A 3HLGA 4EEPA 5M19A 2FFYA 3C2WA 4WL9A 2D01A 2V0WA 3VP1A 3B3XA 1IYPA 3CJMA 1P97A 5FQIA 2VV7A 5FDSA 1DP9A 3GSGA 1MPLA 1YLPA 3ZNTA 4ETXA 1NY0A 4KZ6A 4GZBA 4MDZA 5BOHA 5GLAA 1DJAA 2B18A 5DF8A 1FCNA 1OPXA 4DKIA 5KSCA 3A3JA 1HD8A 1LT0A 1YAXA 5EECA 1Y4OA 1LSVA 1XP4A 5HDSA 1ONGA 4I5SA 5C5KA 1YLTA 3E4OA 1FILA 4P0MA 1QMEA 1YLYA 1TVFA 2PBDP 1XGIA 2R78A 3G34A 3D4FA 2W3DA 4HHDA 3NULA 3S1YA 4C75A 5K5BA 1FOFA 1FIKA 3PYPA 4G3KA 3M6BA 1JWPA 1KDSA 4I3AA 2VA0A 3UB6A 4WEJA 2EFXA 3TE8A 1NLYA 4PM7A 4ZJ2A 4JGRA 4O0PA 2JBFA 2LB9A 3PBTA 4XXRA 4KG2A 5EOOA 3DWZA 2QKPA 1IEMA 3WS1A 4WMCD 2A49A 5EUAA 4E3NA 4YINA 4P6ZS 5HSQA 4MBFA 4OQIA 2OOLA 3VMAA 1M40A 1L0EA 5IS1A 3LI8A 1ERQA 1F98A 4HBUA 4R3BA 1YQSA 3GRJA 4B4ZA 3BLSA 3G30A 4HBTA 2QYBA 2XA7M 3LI9A 2ZM0A 3BFDA 4EQ1A 4NKPA 3IXDA 2QWSA 2EX2A 1DRMA 5EFWA 2LB5A 3UPNA 5CEBA 2XFSA 1J9MA 2WKQA 5AQ9A 5EVEA 4DN0A 3HLCA 3GECA 4UHUA 3Q7VB 4CJNA 3TOIA 3ISGA 4GDNA 4QWOA 3ZHHA 4NG2A 4KZ7A 3PR6A 5I94A 3M2KA 4ZBEA 3S7PA 2QJ7A 2EX8A 2J3TC 1JWZA 5CRFA 3MXSA 4IJGA 2INWA 4RVAA 2IWCA 3S4XA 1YLZA 1BSGA 3P7NA 3GTCA 2PAVP 2V9AA 2ZQDA 1XFQA 5IHVA 5J7EA 4LRYC 3TJZC 2ZLYA 3C7UA 3G32A 5HW3A 4S2NC 4BLMA 1D06A 1N9NA 2V1ZA 1Y28A 2ZBBA 3HLWA 2DCFA 1CJFA 1L2SA 1K6SA 4O7DA 3G35A 3PBRA 2ZM2A 3CPTA 4LCLA 3P09A 4OPZA 1E3UA 1AWIA 4B9OA 1ZC2A 1OT6A 2ZQCA 1W8YA 3BY9A 4LV2A 3RJUA 3NCKA 4XT2B 3F1PA 5EM0A 5FEGA 1NZOA 4LFUA 2VEAA 3N8LA 3IH8A 3ZNYA 2UV0E 3W4QA 2HP9A 4ZJ1A 4BENA 5MC7A 3BJNA 4YNRA 3R4KA 4MLLA 3OZHA 3QNCA 1TF1A 3BLMA 4S2JA 4R0QA 4YFMA 4PPRA 1S6RA 4JXWA 1T19A 2A3UA 1OTAA 3T1SA 4GS9B 4DE2A 4LV3A 1K25A 2P7JA 2PD7A 1D1JA 3EEAA 1MWUA 1Q2PA 2Y2MA 3NC8A 3VOYA 2JE5A 4ARZA 1VM1A 2ZC5B 4GD6A 4JXGA 3A0SA 1JWVA 4K0WA 1H8MA 3L7HA 2MJ6A 1CK3A 2XLNA 5FA7A 1CEFA 1ACFA 5HL1A 3G2YA 3V3SA 3Q07A 1FR6A 3IS2A 5FI6A 1YSPA 1C3BA 5L09A 2CC1A 2PYRA 4UQIM 2Y55A 4EBPA 4S2KA 2OSUA 5FASA 3LIFA 2W0NA 3Q7ZA 3F1OA 2UWXA 1PWDA 2ZC7A 1H3QA 2ZQAA 3H82A 4II7A 3W4PA 3LR0A 3HLFA 4S2NA 2G2WA 4DE3A 4N92A 1OTDA 4QD4A 1SDEA 1O7EA 2XFTA 2X01A 3GDIA 5HX9A 3DTKA 2ACGA 5FQKA 4GD8A 1XFNA 3SOIA 2CMNA 3W4OA 1K38A 4HP4A 4K91A 5AQBA 3VP0A 4L9FA 3NI9A 3ZG8B 4OLGA 4DE1A 1K4EA 2ZOHA 2WZZA 4DDYA 1ES2A 2X71A 5FQMA 1IYSA 3UDFA 1BLCA 3ITBA 1FCMA 4BWIA 2VGLM 4R6LA 2PYPA 3F1OB 2QZ6A 2OWJA 4PAUA 3IX3A 3MFXA 3ZG5A 4ID4A 3V39A 2XRNA 5HZHA 3R7WA 1XJ3A 3TRCA 2HDUA 1S0WA 3OC2A 3KSFA 1E3UD 4PHTA 5CECA 1GHIA 4FUWA 2OAP1 3WS4A 4GLQA 1WA9A 5J4EA 1W63Q 4N9LA 5TR7A 3GMWA 4JF4A 3A0RA 1W79A 3UE3A 3FV7A 5HFOA 1GHMA
chains in the Genus database with same CATH topology
2PHYA 4K08A 2NUTC 2W3EA 1F5MA 2NUPC 4R70A 2ZMFA 4EEPA 3NJAA 1TD5A 3F1PB 3C2WA 3PXPA 3B33A 4I3IA 1ODVA 4WL9A 4R38A 2D01A 4Q0IA 4DJ2A 4CLCC 5AJGA 2V0WA 2JKRM 4LPZA 3BY8A 1P97A 4EERA 2P08A 2YKHA 5IU1A 2VV7A 4L9GA 4Q0HA 2OAQ1 1DP9A 1ZTUA 2VV8A 4MN5A 4HY8A 1T1BA 2VLGA 4OOMA 3KO6A 4ETXA 4MDZA 3NHQA 1MC0A 3FPVA 1T1AA 2GJ3A 4IUHA 3UE6A 3ZQ5A 3W2ZA 1MZUA 3D3OA 2XA7S 3LR3A 2B18A 4GW9A 5HWTA 1T18A 4XT2A 4EESA 1OJGA 3T4JA 1OPXA 4EUVA 1W63M 3T4LA 3CWFA 1LT0A 1YAXA 1LSXA 4L0LA 2EA9A 3K3DA 3C8CA 5FL3A 5F5YA 4Q0JA 5J3WA 1LSVA 3RH8B 2O9AA 1OJ5A 5HDSA 5KSHA 4I5SA 5C5KA 4MMNA 3E4OA 1G6OA 4ME4A 3LFVA 4BJPA 3B42A 1TS8A 1TS0A 2R78A 4JGPA 3MMHA 3E4QA 1EW0A 4I3JA 2V1BA 2JKTM 3T4QA 4YOFA 2W3DA 4HHDA 5K5BA 4YWZA 3PYPA 4G3KA 4ARZB 1S67L 2I9VA 2K7SA 4I39A 4I3AA 2JHEA 2VA0A 3UB6A 2FH5A 4WEJA 3TE8A 3KX0X 4CQHA 4ZRRA 2J3TD 1NLYA 4JGRA 4Y3IA 2JKRI 4O0PA 4FOFA 3IS2B 2LB9A 3PBTA 2DMWA 3LR4A 1NLZA 4GS9A 1BYWA 3T4OA 3PBOA 2L0WA 2EWVA 2IA2A 3H7WB 2QKPA 3F1NA 5TBMA 2VKSA 3BQ8A 2JN7A 4IUKA 3H82B 3V67A 3EQVA 2W1TA 4EU0A 3NOPC 3KYQA 3E98A 4P6ZS 5HSQA 2OOLA 2VZWA 2Y8HA 5IS1A 4GHIA 3P01A 3LI8A 2A24A 1F98A 1XJ6A 3LYXA 3OCLA 5HPIA 5LBRA 1D7EA 3EGXC 4GCZA 2KLIA 4JGOA 4F3LB 2OWHA 2QYBA 2XA7M 3LI9A 3LUQA 2O9CA 4JGQA 3VE3A 3HJKA 3EGDC 3K3CA 4EQ1A 4NKPA 1S1ZA 4NXEA 2QWSA 4LRXC 4AFIA 1DRMA 5EFWA 2LB5A 4MN7A 2WKQA 2JKTI 1DP6A 2VX8A 3JVUA 3ICYA 3H9WA 4DN0A 3NOUC 3C30A 2KOIA 3GECA 3T4SA 2PDRA 3LIBA 4BBVA 4Z1WA 4WUJA 2M7UA 3FPWA 5DJUA 3F1NB 3LIDA 1V9YA 3UMEA 4CLCA 5TBMB 3PR6A 2O99A 3S7PA 3R7WB 3VOLA 3BW6A 2W1TB 2PT7A 1F9IA 2HJEA 2QJ7A 3C38A 4BMWA 2J3TC 5DFXA 1IFQA 5DF9A 4WLAA 1MKMA 4IJGA 1P9RA 2INWA 2A24B 3K2NA 4NXBA 5I5LA 3P7NA 5CX7A 2V9AA 1XFQA 5J7EA 1N9OA 4LRYC 3TJZC 5F6AA 5HDDA 4L9EA 5KIZA 1YSQA 5AVFA 1D06A 1N9NA 2Z6CA 4PKYG 1VB6A 1Y28A 2ZBBA 3CITA 2QHKA 1S4RA 3U2AA 2HV1A 5DKLA 3EOIA 4KQOA 3PBRA 4CLCE 2XSSA 2QJ5A 4Y2FA 3TW8A 3CAXA 1UWNX 4P6ZM 5HDCA 4B93A 2FZ0A 4HI4A 4HJ6A 2WKRA 4HJ3A 4NXFA 4B9OA 3MR0A 5F69A 1OT6A 3MJQA 2M1CA 3T50A 2B02A 3MQQA 4DMZA 3FC7A 3CUEC 2J80A 1OT9A 2H28A 3BY9A 1OTEA 4XT2B 3S7QA 1XJ2A 4UQIS 4HNBA 4OOLA 3F1PA 1P0ZA 3OLOA 4G3VA 2P04A 2G7UA 3UMDA 2VEAA 1LSWA 4ETZA 2O9BA 4KQDA 2KX6A 3OBFA 4IHQA 3VE4A 5HWWA 4M4XA 3B47A 2ZMVA 3EQUA 5DFYA 5HD3A 1IOUA 5MC7A 5HPFA 3BJNA 4YNRA 1G28A 3R4KA 5G4ZA 4WN5A 1X0OA 2V1AA 1OTBA 3CLOA 3MQ0A 2M7VA 3KSIA 5HWVA 2L4RA 5F68A 3LICA 4EEUA 1ZHHB 4HH3A 3OCNA 1UGUA 3MF0A 3SW1A 2O0YA 1TF1A 3BQAA 2L1MA 3O5YA 3E4PA 5L8MA 2HF6A 4I38A 1KOUA 4WF0A 3IBJA 1GSWA 1T19A 5HL6A 3JVVA 2Y79A 1OTAA 3S7OA 1UWPX 4GS9B 1TS6A 2ZOIA 3IBRA 5HD5A 5DKKA 4HH2A 4LLOB 3RTYA 2P7JA 2PD7A 3HJIA 4HJ4A 3FG8A 1LL8A 2Z6DA 2VGLS 4Y5FA 3EEAA 4R3AA 4HOIA 3DBAA 1GSXA 4O8GA 4KUKA 2EWWA 3CI6A 2W3GA 1STZA 3PBSA 5A8BA 4ARZA 4WELA 4EW7A 5IT5A 2VV6A 2WKPA 4GHIB 2W3FA 3A0SA 3KYZA 1H8MA 3UB8A 3MXQA 2MJ6A 3PHYA 3EWKA 2GX5A 3D72A 4LRZE 2W27A 3IS2A 2PR6A 1YSPA 1S66L 4H6JA 2PYRA 2A2LA 4UQIM 4HIAA 1T1CA 4KUOA 3H7WA 2HGVA 2HJ9C 2W1RA 2W3HA 4E04A 2K31A 2GNXA 3LIFA 5TJJA 2W0NA 3KSHA 4FSFA 3F1OA 1H3QA 3ULFA 1YKDA 3H82A 4G3WA 4II7A 3BWLA 3LR0A 1P9WA 4MCWA 4MN6A 3LR5A 3PBNA 1OTDA 4BBTA 3LIEA 2VJWA 2V0UA 3GDIA 3VV4A 4CLCD 2J3WA 4EXOA 4DJ3A 4QPRA 1GSVA 4CLCB 1XFNA 2GZAA 4HP9A 4BBUA 3PBQA 2CMNA 5DJTA 2K2NA 4HP4A 1N9LA 5AVEA 3OOVA 3E0YA 4F3LA 3T4KA 4L9FA 1JNUA 3HCYA 4UEYA 3UB9A 3G6OA 4WEKA 5G4YA 1S1YA 1DP8A 3EEHA 2BASA 3T4TA 3UB7A 3A0VA 3NOTC 3CUEA 2ZOHA 2PR5A 4PKYA 4GJ4A 4H6JB 4O01A 4HQAA 2YKFA 2D02A 1VHMA 1XJ4A 4BWIA 2VGLM 3MQOA 4RQ9A 1V9ZA 4R6LA 1TS7A 4EETB 3KSGA 2PYPA 2PD8A 3F1OB 1S4SA 2OWJA 4PAUA 3S7NA 3MFXA 3RFBA 1NRJA 2XRNA 5HZHA 3R7WA 1XJ3A 3TRCA 4NXGA 3ZYTA 1OTIA 2KDKA 3OC2A 3KSFA 2XROA 4PHTA 4NEED 2OAP1 4GLQA 1WA9A 1NWZA 5J4EA 1W63Q 3A0RA 3UE3A 3LIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHY A;  4K08 A;  4R70 A;  4EEP A;  3NJA A;  3F1P B;  3C2W A;  3B33 A;  4I3I A;  1ODV A;  4WL9 A;  4R38 A;  2D01 A;  4DJ2 A;  2V0W A;  4LPZ A;  3BY8 A;  1P97 A;  4EER A;  2YKH A;  5IU1 A;  2VV7 A;  4L9G A;  1DP9 A;  2VV8 A;  4MN5 A;  4HY8 A;  1T1B A;  2VLG A;  3NHQ A;  1T1A A;  2GJ3 A;  3ZQ5 A;  3UE6 A;  1MZU A;  4GW9 A;  5HWT A;  1T18 A;  4XT2 A;  4EES A;  1OJG A;  3CWF A;  1LT0 A;  1LSX A;  2EA9 A;  3K3D A;  3C8C A;  5F5Y A;  5J3W A;  1LSV A;  3RH8 B;  1OJ5 A;  5HDS A;  4I5S A;  3E4O A;  1TS8 A;  1TS0 A;  2R78 A;  4JGP A;  3E4Q A;  1EW0 A;  4I3J A;  2V1B A;  4HHD A;  4YWZ A;  3PYP A;  1S67 L;  2I9V A;  2K7S A;  4I39 A;  4I3A A;  2JHE A;  3UB6 A;  3KX0 X;  4JGR A;  3IS2 B;  4GS9 A;  1BYW A;  2L0W A;  3H7W B;  2QKP A;  3F1N A;  5TBM A;  2JN7 A;  3H82 B;  3NOP C;  5HSQ A;  2OOL A;  5IS1 A;  4GHI A;  3LI8 A;  2A24 A;  1F98 A;  1XJ6 A;  3LYX A;  1D7E A;  4GCZ A;  4JGO A;  4F3L B;  2OWH A;  3LI9 A;  3LUQ A;  4JGQ A;  3VE3 A;  3HJK A;  3K3C A;  4EQ1 A;  4NXE A;  1S1Z A;  2QWS A;  4LRX C;  1DRM A;  5EFW A;  2WKQ A;  1DP6 A;  3ICY A;  3H9W A;  3NOU C;  3GEC A;  2PDR A;  3LIB A;  4BBV A;  4WUJ A;  5DJU A;  3F1N B;  3LID A;  1V9Y A;  3UME A;  5TBM B;  3VOL A;  1F9I A;  2QJ7 A;  4WLA A;  2INW A;  2A24 B;  5I5L A;  4NXB A;  3P7N A;  2V9A A;  1XFQ A;  5J7E A;  1N9O A;  4LRY C;  5F6A A;  5HDD A;  4L9E A;  5KIZ A;  5AVF A;  1D06 A;  1N9N A;  2Z6C A;  4PKY G;  1VB6 A;  1Y28 A;  2ZBB A;  2QHK A;  1S4R A;  2HV1 A;  5DKL A;  2QJ5 A;  3CAX A;  1UWN X;  5HDC A;  4HI4 A;  4HJ6 A;  2WKR A;  4HJ3 A;  4NXF A;  4B9O A;  3MR0 A;  5F69 A;  1OT6 A;  3MJQ A;  2M1C A;  3T50 A;  2B02 A;  3MQQ A;  3FC7 A;  2J80 A;  1OT9 A;  2H28 A;  3BY9 A;  1OTE A;  4XT2 B;  1XJ2 A;  4HNB A;  3F1P A;  1P0Z A;  3OLO A;  3UMD A;  2VEA A;  1LSW A;  4KQD A;  2KX6 A;  3VE4 A;  5HWW A;  4M4X A;  5HD3 A;  1G28 A;  5G4Z A;  4WN5 A;  1X0O A;  2V1A A;  1OTB A;  3CLO A;  5HWV A;  2L4R A;  5F68 A;  3LIC A;  4EEU A;  4HH3 A;  1UGU A;  3SW1 A;  2L1M A;  3E4P A;  4I38 A;  1KOU A;  4WF0 A;  1GSW A;  1T19 A;  1OTA A;  1UWP X;  4GS9 B;  1TS6 A;  2ZOI A;  3IBR A;  5HD5 A;  5DKK A;  4HH2 A;  4LLO B;  3RTY A;  2P7J A;  2PD7 A;  3HJI A;  4HJ4 A;  3FG8 A;  1LL8 A;  2Z6D A;  4R3A A;  4HOI A;  1GSX A;  4KUK A;  5A8B A;  4EW7 A;  2VV6 A;  2WKP A;  4GHI B;  3A0S A;  3UB8 A;  3MXQ A;  3PHY A;  3EWK A;  3D72 A;  4LRZ E;  2W27 A;  3IS2 A;  2PR6 A;  1S66 L;  4H6J A;  2PYR A;  4HIA A;  1T1C A;  4KUO A;  3H7W A;  4E04 A;  3LIF A;  2W0N A;  3F1O A;  3ULF A;  3H82 A;  3BWL A;  4MN6 A;  1OTD A;  4BBT A;  3LIE A;  2V0U A;  3GDI A;  4EXO A;  4DJ3 A;  1GSV A;  1XFN A;  4HP9 A;  4BBU A;  2CMN A;  5DJT A;  4HP4 A;  1N9L A;  5AVE A;  4F3L A;  4L9F A;  1JNU A;  3UB9 A;  3G6O A;  5G4Y A;  1S1Y A;  1DP8 A;  3EEH A;  2BAS A;  3UB7 A;  3A0V A;  3NOT C;  2ZOH A;  2PR5 A;  4PKY A;  4H6J B;  4HQA A;  2YKF A;  2D02 A;  1XJ4 A;  3MQO A;  4RQ9 A;  1V9Z A;  4R6L A;  1TS7 A;  4EET B;  2PYP A;  2PD8 A;  3F1O B;  1S4S A;  2OWJ A;  3MFX A;  5HZH A;  1XJ3 A;  4NXG A;  1OTI A;  2KDK A;  1WA9 A;  1NWZ A;  5J4E A;  3A0R A;  3LIA A; 
#chains in the Genus database with same CATH topology
 4PM6 A;  2NUT C;  3WS2 A;  1F5M A;  4X53 A;  1G6A A;  4R70 A;  5DTS A;  5L10 A;  2Y2L A;  4DDS A;  1TD5 A;  4H8R A;  4IBX A;  5GLD A;  3B33 A;  2WGI A;  4I3I A;  4ZDX A;  1ODV A;  4R38 A;  1N9B A;  1H0M A;  4OKP A;  3BY8 A;  4X25 A;  4EER A;  4Q0H A;  1FQG A;  1ES4 A;  3HBR A;  1ZTU A;  3BFF A;  4MN5 A;  5HAR A;  5EM1 A;  1T1B A;  4FD8 A;  2VLG A;  3C4P A;  4ZJ3 A;  3A3E A;  3UE6 A;  4IUH A;  3ZQ5 A;  5FAT A;  3W2Z A;  3LR3 A;  2P9V A;  1KGG A;  1OJG A;  3N6I A;  2GDN A;  1VEU A;  1W63 M;  3CWF A;  4WZ4 A;  3CZD A;  5FEF A;  1LSX A;  5AQ7 A;  5TGF A;  3VP4 A;  3C8C A;  1FSW A;  3DAV A;  4DE0 A;  1Z09 A;  4XUZ A;  4OQH A;  1I5Q A;  3LFV A;  1ERM A;  1MXO A;  1TS8 A;  1TS0 A;  1GHP A;  3E4Q A;  4I3J A;  5F83 A;  2V1B A;  5D3O A;  2RL3 A;  3IXG A;  1S67 L;  2I9V A;  2AVX A;  2K7S A;  4Y15 A;  3OPR A;  2JHE A;  5E2G A;  2Z2L B;  2J3T D;  3FZC A;  3QP6 A;  5A90 A;  1MKI A;  1ESU A;  1BYW A;  3HUO A;  2EWV A;  3F1N A;  1F2K A;  3MS6 A;  3DTI A;  1BTL A;  3BQ8 A;  2JN7 A;  2P74 A;  3O88 A;  1AXB A;  2XEP A;  4LV0 A;  4R23 A;  1CQA A;  1PIO A;  1W8Q A;  3IHA A;  1N4O A;  4XUX A;  1YT4 A;  3UY6 A;  2VZW A;  3S22 A;  3ZG9 B;  4HEF A;  2A24 A;  1XJ6 A;  4R3J A;  5HPI A;  2KLI A;  4JGO A;  4KEN B;  1RCJ A;  4ESP A;  1EI5 A;  2O9C A;  4JGQ A;  1ES3 A;  3CMZ A;  3IXH A;  3T1Q B;  1S1Z A;  4AFI A;  3D9Y A;  4OQ0 A;  2JKT I;  3BFG A;  4Y0T A;  4Y0U A;  3NOU C;  1ZG4 A;  3C30 A;  3ZCZ A;  5M1A A;  3OPL A;  3F1N B;  4E3L A;  1V9Y A;  3JYI A;  3MKF A;  3VOL A;  3BW6 A;  1PI4 A;  1MWR A;  2ZC6 B;  1ALQ A;  5DF9 A;  4WLA A;  2BG1 A;  2A24 B;  4FH2 A;  3HL9 A;  3K2N A;  2JKF A;  5CX7 A;  3E2K A;  3M6H A;  4E6W A;  3PAE A;  4JF5 A;  4LEN A;  3FYZ A;  2XQZ A;  5EVL A;  4L9E A;  5HDD A;  5KIZ A;  3NDG A;  2QMI A;  1W7F A;  2Z6C A;  1KGE A;  1VB6 A;  3U2A A;  2HV1 A;  1YM1 A;  4MBK A;  4CLC E;  4K0X A;  3LY4 A;  3DTM A;  3BM6 A;  4P6Z M;  4IVI A;  4JLF A;  3QNB A;  4QY5 A;  5CTN A;  1YLJ A;  4N9K A;  3T50 A;  5FQ9 A;  3ITA A;  2B02 A;  1YMX A;  3MQQ A;  4DMZ A;  2J80 A;  1OT9 A;  1OTE A;  1CI8 A;  3OLO A;  5F82 A;  2G7U A;  4X1M A;  1PZO A;  4LGW A;  2KX6 A;  1YPR A;  3VFF A;  4IHQ A;  3GR2 A;  5HWW A;  5DFY A;  1M6K A;  1IOU A;  1PI5 A;  2EX9 A;  4P87 A;  2V1A A;  3CLO A;  3UPP A;  5E2H A;  4EEU A;  1DY6 A;  2XH9 A;  3UDI A;  3MF0 A;  4QU3 A;  4UA6 A;  4KZ9 A;  5EV0 A;  1HTZ A;  3E4P A;  4I38 A;  4WF0 A;  3IBJ A;  5E2F A;  4R4R A;  2ZL1 A;  2Y2G A;  3S7O A;  2J9O A;  4KZB A;  3VSL A;  4PM5 A;  5HD5 A;  3ZDJ A;  3Q82 A;  2WKE A;  2EFU A;  2WAE A;  5DVA A;  1KVL A;  4HJ4 A;  3BRM A;  2Z6D A;  4R3A A;  4HOI A;  1GSX A;  1MWT A;  2W3G A;  1PRQ A;  4C6Y A;  1STZ A;  3PBS A;  5CED A;  5CHU A;  5A8B A;  5EVI C;  4P6B A;  2VV6 A;  4P85 A;  4DF6 A;  4QB8 A;  4BQM A;  2VGK A;  5HAQ A;  4WYY A;  3PHY A;  3O86 A;  3EWK A;  3N8S A;  4LRZ E;  1W5D A;  2EXB A;  3PAG A;  3QP1 A;  2WKI A;  1CEG A;  3SS5 A;  4NET A;  1EWZ A;  1KE3 A;  2A2L A;  4HIA A;  3H7W A;  2HGV A;  2W1R A;  4B88 A;  5E2E A;  2K31 A;  2ZD8 A;  4Y7P A;  3IH9 A;  4FSF A;  2OV5 A;  2ZC3 B;  5A91 A;  3BWL A;  1P9W A;  2ZJ9 A;  4MCW A;  4MN6 A;  3VP3 A;  3LIE A;  2VJW A;  2V0U A;  2Z2M B;  3VV4 A;  3HVF A;  3E2L A;  4DXC A;  1KE0 A;  5DJT A;  1N9L A;  5CER A;  4F3L A;  1LLB A;  1BLS A;  3HCY A;  4UEY A;  5AQA A;  3G6O A;  4WBG A;  4UA7 A;  3IHB A;  3SS3 A;  1BLP A;  1S1Y A;  3BFC A;  3EEH A;  1GA9 A;  1FCO A;  3T12 B;  2BAS A;  3AGF A;  2HDS A;  2XGN A;  3UB5 P;  4GOG A;  1GA0 A;  4KZ4 A;  4E3J A;  2PR5 A;  4PKY A;  4X1L A;  1K54 C;  1XJ4 A;  1I2S A;  3BYD A;  1RGY A;  3KSG A;  2PD8 A;  1NYY A;  1BT5 A;  3CPT B;  3IWI A;  4NXG A;  5GLB A;  3ZYT A;  2KDK A;  4QHC A;  2XRO A;  1L0F A;  3QP2 A;  2Y2I A;  3MBZ A;  4JXS A;  3AGE A;  1CI9 A;  2XDM A;  1MWS A;  1XA1 A;  2W3E A;  2PRF A;  2R9W A;  4UAA A;  2ZMF A;  3NJA A;  3F1P B;  3PXP A;  4KZ8 A;  4Q0I A;  5U47 A;  4CLC C;  4JXV A;  1WYB A;  1PWC A;  3BEC A;  2P08 A;  2YKH A;  5A93 A;  2VV8 A;  3MSH A;  4HY8 A;  4OOM A;  2WAD A;  1KGF A;  5EVI A;  3NHQ A;  2GJ3 A;  4B4X A;  4Z9Q A;  1MZU A;  3D3O A;  2Q0O A;  4X56 A;  1T18 A;  4EES A;  2Y2Q A;  3G4P A;  3T4J A;  5DF7 A;  3C4O A;  3K3D A;  3IF6 A;  5FL3 A;  1MY8 A;  5F5Y A;  5J3W A;  3RH8 B;  5KSH A;  1Y54 A;  3IX8 A;  3O87 A;  1VET A;  1G6O A;  5FAQ A;  4UA9 A;  2JKT M;  1XPB A;  1BZA A;  4YWZ A;  1G5U A;  3RXW A;  4ARZ B;  2JC7 A;  3QHY A;  2FH5 A;  2Y2P A;  3BEB A;  3MZF A;  4CQH A;  3T1X A;  5EVI B;  2JKR I;  3IS2 B;  4U0T A;  3LR4 A;  1NLZ A;  3A3D A;  3Q81 A;  4E6X A;  3IX4 A;  4EBN A;  3T4O A;  4JKT A;  2IA2 A;  5L2F A;  2E8I A;  5TBM A;  4HES A;  2VKS A;  1NJ4 A;  3H82 B;  3LEQ A;  3V67 A;  3UNW A;  2W1T A;  4EU0 A;  4KZA A;  1K54 A;  3KYQ A;  3E98 A;  3ZG7 B;  2DNS A;  1TDG A;  4OLD A;  2R9X A;  2Y8H A;  5DTK A;  1VET B;  4GHI A;  3P01 A;  4R1G A;  3LYX A;  4FCF A;  5LBR A;  1D7E A;  4GCZ A;  2VK3 A;  2I72 A;  3LUQ A;  2ZM8 A;  3HJK A;  3WRZ A;  2XK1 A;  3K3C A;  4E3M A;  2OLU A;  4MN7 A;  3GV9 A;  1XXM A;  4BL2 A;  4JF6 A;  1L0G A;  3H9W A;  2WK0 A;  3T4S A;  4WUJ A;  3FPW A;  5DJU A;  5F1G A;  5J8X A;  1VQQ A;  4CLC A;  5F1F A;  5TBM B;  2O99 A;  4GB7 A;  3R7W B;  2W1T B;  2PT7 A;  5CGW A;  2HJE A;  3C38 A;  4BMW A;  5DFX A;  1MKM A;  3HLE A;  3DTE A;  1MBL A;  4MEZ A;  3GVB A;  5FAP A;  2Y4A A;  4NK3 A;  5I5L A;  2ZMA A;  5GHX A;  1N9O A;  4FTX A;  5F6A A;  1PFL A;  3WWX A;  2HPB A;  5AVF A;  1S4R A;  2G2U A;  2V20 A;  1UWN X;  3CAX A;  4PMA A;  5HDC A;  4B93 A;  2FZ0 A;  4HI4 A;  3JPU A;  3NY4 A;  4NXF A;  3VP2 A;  3MR0 A;  5EVI D;  3MJQ A;  2M1C A;  3FC7 A;  3WRT A;  4S2M A;  3OPP A;  2P9V B;  2Y2J A;  1XJ2 A;  4HNB A;  5EPH A;  1VEU B;  1P0Z A;  4G3V A;  5CGX A;  4GKU A;  3UMD A;  2ZQ7 A;  1RGZ A;  2O9B A;  2EX6 A;  4KQD A;  3I7J A;  3OBF A;  3VE4 A;  4M4X A;  5FSR A;  2IWD A;  4BL3 A;  5HD3 A;  1E4D A;  3AGD A;  1DJC A;  4R4S A;  2X02 A;  1G28 A;  5G4Z A;  1TDL A;  4WN5 A;  1X0O A;  1OTB A;  3MQ0 A;  2M7V A;  1FSY A;  2L4R A;  4RX2 A;  4OON A;  1ZHH B;  4HH3 A;  5GHZ A;  4E3K A;  1L0D A;  2O0Y A;  4GNU A;  2L1M A;  3O5Y A;  1IKG A;  5L8M A;  2HF6 A;  3ZGA B;  1GSW A;  5HL6 A;  4OPY A;  2HDQ A;  3JVV A;  1UWP X;  1TS6 A;  4RA7 A;  2ZOI A;  5L07 A;  4OP8 A;  5DKK A;  4HH2 A;  4OP5 A;  1SCW A;  4X69 A;  4F94 A;  4U0X A;  4D60 A;  4Y5F A;  1O07 A;  2Y2K A;  5HAP A;  3G2Z A;  5A92 A;  2EWW A;  3CI6 A;  5EE8 A;  4WEL A;  4EW7 A;  5IT5 A;  3KYE A;  2WKP A;  2W3F A;  1K55 C;  3CHW P;  1SKO A;  3KYZ A;  3MXQ A;  2WUQ A;  2GX5 A;  3D72 A;  4BD1 A;  4WZ5 C;  1PYY A;  1ZKJ A;  3DWK A;  4ZAM A;  3VSK A;  1T1C A;  3LGO A;  3PTE A;  4E04 A;  2W3H A;  2GNX A;  3KSH A;  1YKD A;  1LI0 A;  1BUE A;  3LR5 A;  4GDB A;  4S2P A;  3A3I A;  3A3F A;  4CLC D;  2J3W A;  4Q8I A;  2GZA A;  4BBU A;  3SH8 A;  2K2N A;  1BLH A;  3ZG0 A;  3OOV A;  3ZVT A;  1JNU A;  1PW1 A;  1HZO A;  4WEK A;  5G18 A;  1SKO B;  3MFD A;  4EBL A;  4KQR A;  1L3L A;  2Q9M A;  3A0V A;  4GJ4 A;  3Q7V A;  3FKW A;  4O01 A;  3TG9 A;  4HQA A;  1SHV A;  2D02 A;  1VHM A;  4IED A;  1FR1 A;  1I2W A;  3MQO A;  1TS7 A;  4EET B;  2BLS A;  3S7N A;  4DRT A;  1PWG A;  2OLV A;  4MNR A;  4KQQ A;  4NEE D;  1KE4 A;  4E3O A;  4KZ3 A;  1YLW A;  4A5R A;  1QMF A;  4JBF A;  2HP5 A;  3LIA A;  1LL5 A;  4K08 A;  1PW8 A;  3HLB A;  3HLD A;  2ZQ8 A;  2NUP C;  1XA7 A;  1SKF A;  4DJ2 A;  5AJG A;  4ZTK A;  4N1H A;  3CG5 A;  1A0K A;  2JKR M;  2WYX A;  4LPZ A;  2J7V A;  3O3V A;  3DW0 A;  5IU1 A;  1JTD A;  4L9G A;  1Q2Q A;  2OAQ 1;  1H8Z A;  3KO6 A;  1MC0 A;  3FPV A;  1T1A A;  3OPH A;  1IEL A;  2J8Y A;  3VOZ A;  3IF6 C;  2XA7 S;  1K55 A;  2H0Y A;  4GW9 A;  2Y2N A;  5HWT A;  3U4L P;  4XT2 A;  3RXX A;  3NEC A;  4EUV A;  4WZ5 A;  3T4L A;  2ZL1 B;  5CGS A;  4L0L A;  2EA9 A;  3IT9 A;  2Y59 A;  4Q0J A;  2O9A A;  1OJ5 A;  1IYQ A;  4MMN A;  1LI9 A;  4Y0O A;  4ME4 A;  1SZV A;  4RX3 A;  2V2F F;  3B42 A;  4BJP A;  4JGP A;  3MMH A;  2PU4 A;  1EW0 A;  4RYE A;  3V50 A;  3T4Q A;  3SH7 A;  1K56 A;  4YOF A;  2JCH A;  2WGW A;  1K4F A;  3N8R A;  4S2L A;  4I39 A;  3WS0 A;  1XX2 A;  3W8K A;  3L9K A;  3KX0 X;  4ZRR A;  4Y3I A;  4FOF A;  3IQA A;  3HUN A;  2DMW A;  4GS9 A;  1H5X A;  4OPR A;  5KMW A;  4KG6 A;  3PBO A;  1KVM A;  2L0W A;  3H7W B;  2H10 A;  1IKI A;  5DTT A;  4IUK A;  2XF3 A;  3QP8 A;  1ZG6 A;  3EQV A;  4OOY A;  3NOP C;  5HAI A;  5JYP A;  4Y17 A;  3HUM A;  3OCL A;  4D2O A;  2FFF B;  2PBY A;  3EGX C;  3FWL A;  4EV4 A;  1K57 C;  4IVK A;  2WGW B;  3SS4 A;  2DRW A;  2OWH A;  4F3L B;  3UPO A;  2RCX A;  3VE3 A;  3TSG A;  4E3I A;  3EGD C;  3SH9 A;  1YMS A;  2Y91 A;  4NXE A;  4LRX C;  4OVD A;  1NZU A;  4X55 A;  1DP6 A;  2VX8 A;  3MKE A;  3JVU A;  3ICY A;  3LY3 A;  1WYC A;  2KOI A;  2BTF P;  2PDR A;  3LIB A;  3VFH A;  4BBV A;  4Z1W A;  1ESI A;  3NDE A;  2M7U A;  3UE0 A;  3QP4 A;  3LID A;  3UME A;  4EQI A;  1SDN A;  2H5S A;  5FQJ A;  1J3W A;  1JTG A;  4S2I A;  2V8F A;  1F9I A;  1IFQ A;  1GCE A;  1RP5 A;  4PM9 A;  1P9R A;  3C5A A;  3IF5 A;  5CHJ A;  1H8Y A;  1LHY A;  4NXB A;  1U60 A;  5GLC A;  3ZVW A;  3C7V A;  4BD0 A;  3N7W A;  2V8C A;  2WAF A;  1YSQ A;  4PKY G;  5CHM A;  2JKG A;  2QHK A;  3CIT A;  2E8J A;  2VGJ A;  2QPN A;  5DKL A;  3EOI A;  4KQO A;  4C3Q A;  4Y13 A;  2XSS A;  2QJ5 A;  4Y2F A;  3TW8 A;  2C6W B;  1PZP A;  4HJ6 A;  2WKR A;  4HJ3 A;  2WGV A;  4OPQ A;  5FQQ A;  2Q9N A;  4QJG A;  1K0K A;  4JPM A;  4U3T A;  5F69 A;  4CPK A;  4M3K A;  3CUE C;  1NRF A;  2H28 A;  1TEM A;  5GHY A;  3S7Q A;  5CXW A;  4UQI S;  4OOL A;  3UDX A;  1ONH A;  2P04 A;  3MZD A;  3IF6 B;  3HRE A;  1LSW A;  4ETZ A;  1E25 A;  4OH0 A;  3B47 A;  2ZMV A;  5TFQ A;  3EQU A;  3UE1 A;  3IXB A;  1KDW A;  5HPF A;  1K56 D;  4WM9 A;  2XD1 A;  3KSI A;  5HWV A;  1DJB A;  1LL9 A;  5F68 A;  3LIC A;  3LEZ A;  5EOE A;  3OCN A;  1UGU A;  3SW1 A;  3BQA A;  4KZ5 A;  1HLU P;  1K57 A;  1KOU A;  4DXB A;  4QY6 A;  1XGJ A;  2Y79 A;  5CTM A;  3IBR A;  4IBR A;  4LLO B;  3RTY A;  2WKH A;  3HJI A;  2C5W B;  3FG8 A;  1LL8 A;  1NXY A;  3NBL A;  2VGL S;  4EWF A;  4X68 A;  3IWO A;  3DBA A;  4O8G A;  4KUK A;  4MBH A;  4LV1 A;  4LCM A;  3G31 A;  3MXR A;  4FH4 A;  2XR0 A;  3IWQ A;  4GHI B;  2HP6 A;  3UB8 A;  4N1X A;  1HVB A;  3V5M A;  3Q1F A;  5M18 A;  2W27 A;  3N4I A;  2PR6 A;  3UO9 A;  1S66 L;  3ZFZ A;  4PM8 A;  4H6J A;  5GL9 A;  4KUO A;  3T1R A;  2HJ9 C;  2Y2O A;  2Y2H A;  5TJJ A;  1WE4 A;  3FKV A;  3ULF A;  4G3W A;  2PU2 A;  4WMC A;  1NYM A;  3PBN A;  4BBT A;  3BFE A;  4EXO A;  4DJ3 A;  4QPR A;  1GSV A;  2B5R A;  5FAO A;  4CLC B;  2IWB A;  2J9P A;  4HP9 A;  3PBQ A;  1XKZ A;  4X6T A;  3V3R A;  1OME A;  5KZH A;  5AVE A;  3E0Y A;  5FI7 A;  3T4K A;  5JYO A;  4KG5 A;  3LO7 A;  3UB9 A;  5FI2 A;  5G4Y A;  3GQZ A;  2HZ5 A;  1DP8 A;  3WS5 A;  5E43 A;  3T4T A;  4GN2 A;  1CF0 A;  3UB7 A;  3NOT C;  3CUE A;  2HDR A;  2B95 A;  2ZQ9 A;  3QP5 A;  3P98 A;  3UN7 A;  3NIA A;  4H6J B;  2YKF A;  1K6R A;  4RQ9 A;  1V9Z A;  1S4S A;  3RFB A;  2WZX A;  1NRJ A;  2ZC4 B;  1ERO A;  4S2O A;  1Z6F A;  1JVJ A;  2XD5 A;  4OQG A;  1G68 A;  1OTI A;  3M2J A;  2H0T A;  1IYO A;  1PNE A;  1NWZ A;  3SZT A;  4EUZ A;  1BUL A;  3MZE A;  2PHY A;  3LCE A;  2EXA A;  5FDH A;  1ES5 A;  3HLG A;  4EEP A;  5M19 A;  2FFY A;  3C2W A;  4WL9 A;  2D01 A;  2V0W A;  3VP1 A;  3B3X A;  1IYP A;  3CJM A;  1P97 A;  5FQI A;  2VV7 A;  5FDS A;  1DP9 A;  3GSG A;  1MPL A;  1YLP A;  3ZNT A;  4ETX A;  1NY0 A;  4KZ6 A;  4GZB A;  4MDZ A;  5BOH A;  5GLA A;  1DJA A;  2B18 A;  5DF8 A;  1FCN A;  1OPX A;  4DKI A;  5KSC A;  3A3J A;  1HD8 A;  1LT0 A;  1YAX A;  5EEC A;  1Y4O A;  1LSV A;  1XP4 A;  5HDS A;  1ONG A;  4I5S A;  5C5K A;  1YLT A;  3E4O A;  1FIL A;  4P0M A;  1QME A;  1YLY A;  1TVF A;  2PBD P;  1XGI A;  2R78 A;  3G34 A;  3D4F A;  2W3D A;  4HHD A;  3NUL A;  3S1Y A;  4C75 A;  5K5B A;  1FOF A;  1FIK A;  3PYP A;  4G3K A;  3M6B A;  1JWP A;  1KDS A;  4I3A A;  2VA0 A;  3UB6 A;  4WEJ A;  2EFX A;  3TE8 A;  1NLY A;  4PM7 A;  4ZJ2 A;  4JGR A;  4O0P A;  2JBF A;  2LB9 A;  3PBT A;  4XXR A;  4KG2 A;  5EOO A;  3DWZ A;  2QKP A;  1IEM A;  3WS1 A;  4WMC D;  2A49 A;  5EUA A;  4E3N A;  4YIN A;  4P6Z S;  5HSQ A;  4MBF A;  4OQI A;  2OOL A;  3VMA A;  1M40 A;  1L0E A;  5IS1 A;  3LI8 A;  1ERQ A;  1F98 A;  4HBU A;  4R3B A;  1YQS A;  3GRJ A;  4B4Z A;  3BLS A;  3G30 A;  4HBT A;  2QYB A;  2XA7 M;  3LI9 A;  2ZM0 A;  3BFD A;  4EQ1 A;  4NKP A;  3IXD A;  2QWS A;  2EX2 A;  1DRM A;  5EFW A;  2LB5 A;  3UPN A;  5CEB A;  2XFS A;  1J9M A;  2WKQ A;  5AQ9 A;  5EVE A;  4DN0 A;  3HLC A;  3GEC A;  4UHU A;  3Q7V B;  4CJN A;  3TOI A;  3ISG A;  4GDN A;  4QWO A;  3ZHH A;  4NG2 A;  4KZ7 A;  3PR6 A;  5I94 A;  3M2K A;  4ZBE A;  3S7P A;  2QJ7 A;  2EX8 A;  2J3T C;  1JWZ A;  5CRF A;  3MXS A;  4IJG A;  2INW A;  4RVA A;  2IWC A;  3S4X A;  1YLZ A;  1BSG A;  3P7N A;  3GTC A;  2PAV P;  2V9A A;  2ZQD A;  1XFQ A;  5IHV A;  5J7E A;  4LRY C;  3TJZ C;  2ZLY A;  3C7U A;  3G32 A;  5HW3 A;  4S2N C;  4BLM A;  1D06 A;  1N9N A;  2V1Z A;  1Y28 A;  2ZBB A;  3HLW A;  2DCF A;  1CJF A;  1L2S A;  1K6S A;  4O7D A;  3G35 A;  3PBR A;  2ZM2 A;  3CPT A;  4LCL A;  3P09 A;  4OPZ A;  1E3U A;  1AWI A;  4B9O A;  1ZC2 A;  1OT6 A;  2ZQC A;  1W8Y A;  3BY9 A;  4LV2 A;  3RJU A;  3NCK A;  4XT2 B;  3F1P A;  5EM0 A;  5FEG A;  1NZO A;  4LFU A;  2VEA A;  3N8L A;  3IH8 A;  3ZNY A;  2UV0 E;  3W4Q A;  2HP9 A;  4ZJ1 A;  4BEN A;  5MC7 A;  3BJN A;  4YNR A;  3R4K A;  4MLL A;  3OZH A;  3QNC A;  1TF1 A;  3BLM A;  4S2J A;  4R0Q A;  4YFM A;  4PPR A;  1S6R A;  4JXW A;  1T19 A;  2A3U A;  1OTA A;  3T1S A;  4GS9 B;  4DE2 A;  4LV3 A;  1K25 A;  2P7J A;  2PD7 A;  1D1J A;  3EEA A;  1MWU A;  1Q2P A;  2Y2M A;  3NC8 A;  3VOY A;  2JE5 A;  4ARZ A;  1VM1 A;  2ZC5 B;  4GD6 A;  4JXG A;  3A0S A;  1JWV A;  4K0W A;  1H8M A;  3L7H A;  2MJ6 A;  1CK3 A;  2XLN A;  5FA7 A;  1CEF A;  1ACF A;  5HL1 A;  3G2Y A;  3V3S A;  3Q07 A;  1FR6 A;  3IS2 A;  5FI6 A;  1YSP A;  1C3B A;  5L09 A;  2CC1 A;  2PYR A;  4UQI M;  2Y55 A;  4EBP A;  4S2K A;  2OSU A;  5FAS A;  3LIF A;  2W0N A;  3Q7Z A;  3F1O A;  2UWX A;  1PWD A;  2ZC7 A;  1H3Q A;  2ZQA A;  3H82 A;  4II7 A;  3W4P A;  3LR0 A;  3HLF A;  4S2N A;  2G2W A;  4DE3 A;  4N92 A;  1OTD A;  4QD4 A;  1SDE A;  1O7E A;  2XFT A;  2X01 A;  3GDI A;  5HX9 A;  3DTK A;  2ACG A;  5FQK A;  4GD8 A;  1XFN A;  3SOI A;  2CMN A;  3W4O A;  1K38 A;  4HP4 A;  4K91 A;  5AQB A;  3VP0 A;  4L9F A;  3NI9 A;  3ZG8 B;  4OLG A;  4DE1 A;  1K4E A;  2ZOH A;  2WZZ A;  4DDY A;  1ES2 A;  2X71 A;  5FQM A;  1IYS A;  3UDF A;  1BLC A;  3ITB A;  1FCM A;  4BWI A;  2VGL M;  4R6L A;  2PYP A;  3F1O B;  2QZ6 A;  2OWJ A;  4PAU A;  3IX3 A;  3MFX A;  3ZG5 A;  4ID4 A;  3V39 A;  2XRN A;  5HZH A;  3R7W A;  1XJ3 A;  3TRC A;  2HDU A;  1S0W A;  3OC2 A;  3KSF A;  1E3U D;  4PHT A;  5CEC A;  1GHI A;  4FUW A;  2OAP 1;  3WS4 A;  4GLQ A;  1WA9 A;  5J4E A;  1W63 Q;  4N9L A;  5TR7 A;  3GMW A;  4JF4 A;  3A0R A;  1W79 A;  3UE3 A;  3FV7 A;  5HFO A;  1GHM A; 
#chains in the Genus database with same CATH homology
 2PHY A;  4K08 A;  2NUT C;  2W3E A;  1F5M A;  2NUP C;  4R70 A;  2ZMF A;  4EEP A;  3NJA A;  1TD5 A;  3F1P B;  3C2W A;  3PXP A;  3B33 A;  4I3I A;  1ODV A;  4WL9 A;  4R38 A;  2D01 A;  4Q0I A;  4DJ2 A;  4CLC C;  5AJG A;  2V0W A;  2JKR M;  4LPZ A;  3BY8 A;  1P97 A;  4EER A;  2P08 A;  2YKH A;  5IU1 A;  2VV7 A;  4L9G A;  4Q0H A;  2OAQ 1;  1DP9 A;  1ZTU A;  2VV8 A;  4MN5 A;  4HY8 A;  1T1B A;  2VLG A;  4OOM A;  3KO6 A;  4ETX A;  4MDZ A;  3NHQ A;  1MC0 A;  3FPV A;  1T1A A;  2GJ3 A;  4IUH A;  3UE6 A;  3ZQ5 A;  3W2Z A;  1MZU A;  3D3O A;  2XA7 S;  3LR3 A;  2B18 A;  4GW9 A;  5HWT A;  1T18 A;  4XT2 A;  4EES A;  1OJG A;  3T4J A;  1OPX A;  4EUV A;  1W63 M;  3T4L A;  3CWF A;  1LT0 A;  1YAX A;  1LSX A;  4L0L A;  2EA9 A;  3K3D A;  3C8C A;  5FL3 A;  5F5Y A;  4Q0J A;  5J3W A;  1LSV A;  3RH8 B;  2O9A A;  1OJ5 A;  5HDS A;  5KSH A;  4I5S A;  5C5K A;  4MMN A;  3E4O A;  1G6O A;  4ME4 A;  3LFV A;  4BJP A;  3B42 A;  1TS8 A;  1TS0 A;  2R78 A;  4JGP A;  3MMH A;  3E4Q A;  1EW0 A;  4I3J A;  2V1B A;  2JKT M;  3T4Q A;  4YOF A;  2W3D A;  4HHD A;  5K5B A;  4YWZ A;  3PYP A;  4G3K A;  4ARZ B;  1S67 L;  2I9V A;  2K7S A;  4I39 A;  4I3A A;  2JHE A;  2VA0 A;  3UB6 A;  2FH5 A;  4WEJ A;  3TE8 A;  3KX0 X;  4CQH A;  4ZRR A;  2J3T D;  1NLY A;  4JGR A;  4Y3I A;  2JKR I;  4O0P A;  4FOF A;  3IS2 B;  2LB9 A;  3PBT A;  2DMW A;  3LR4 A;  1NLZ A;  4GS9 A;  1BYW A;  3T4O A;  3PBO A;  2L0W A;  2EWV A;  2IA2 A;  3H7W B;  2QKP A;  3F1N A;  5TBM A;  2VKS A;  3BQ8 A;  2JN7 A;  4IUK A;  3H82 B;  3V67 A;  3EQV A;  2W1T A;  4EU0 A;  3NOP C;  3KYQ A;  3E98 A;  4P6Z S;  5HSQ A;  2OOL A;  2VZW A;  2Y8H A;  5IS1 A;  4GHI A;  3P01 A;  3LI8 A;  2A24 A;  1F98 A;  1XJ6 A;  3LYX A;  3OCL A;  5HPI A;  5LBR A;  1D7E A;  3EGX C;  4GCZ A;  2KLI A;  4JGO A;  4F3L B;  2OWH A;  2QYB A;  2XA7 M;  3LI9 A;  3LUQ A;  2O9C A;  4JGQ A;  3VE3 A;  3HJK A;  3EGD C;  3K3C A;  4EQ1 A;  4NKP A;  1S1Z A;  4NXE A;  2QWS A;  4LRX C;  4AFI A;  1DRM A;  5EFW A;  2LB5 A;  4MN7 A;  2WKQ A;  2JKT I;  1DP6 A;  2VX8 A;  3JVU A;  3ICY A;  3H9W A;  4DN0 A;  3NOU C;  3C30 A;  2KOI A;  3GEC A;  3T4S A;  2PDR A;  3LIB A;  4BBV A;  4Z1W A;  4WUJ A;  2M7U A;  3FPW A;  5DJU A;  3F1N B;  3LID A;  1V9Y A;  3UME A;  4CLC A;  5TBM B;  3PR6 A;  2O99 A;  3S7P A;  3R7W B;  3VOL A;  3BW6 A;  2W1T B;  2PT7 A;  1F9I A;  2HJE A;  2QJ7 A;  3C38 A;  4BMW A;  2J3T C;  5DFX A;  1IFQ A;  5DF9 A;  4WLA A;  1MKM A;  4IJG A;  1P9R A;  2INW A;  2A24 B;  3K2N A;  4NXB A;  5I5L A;  3P7N A;  5CX7 A;  2V9A A;  1XFQ A;  5J7E A;  1N9O A;  4LRY C;  3TJZ C;  5F6A A;  5HDD A;  4L9E A;  5KIZ A;  1YSQ A;  5AVF A;  1D06 A;  1N9N A;  2Z6C A;  4PKY G;  1VB6 A;  1Y28 A;  2ZBB A;  3CIT A;  2QHK A;  1S4R A;  3U2A A;  2HV1 A;  5DKL A;  3EOI A;  4KQO A;  3PBR A;  4CLC E;  2XSS A;  2QJ5 A;  4Y2F A;  3TW8 A;  3CAX A;  1UWN X;  4P6Z M;  5HDC A;  4B93 A;  2FZ0 A;  4HI4 A;  4HJ6 A;  2WKR A;  4HJ3 A;  4NXF A;  4B9O A;  3MR0 A;  5F69 A;  1OT6 A;  3MJQ A;  2M1C A;  3T50 A;  2B02 A;  3MQQ A;  4DMZ A;  3FC7 A;  3CUE C;  2J80 A;  1OT9 A;  2H28 A;  3BY9 A;  1OTE A;  4XT2 B;  3S7Q A;  1XJ2 A;  4UQI S;  4HNB A;  4OOL A;  3F1P A;  1P0Z A;  3OLO A;  4G3V A;  2P04 A;  2G7U A;  3UMD A;  2VEA A;  1LSW A;  4ETZ A;  2O9B A;  4KQD A;  2KX6 A;  3OBF A;  4IHQ A;  3VE4 A;  5HWW A;  4M4X A;  3B47 A;  2ZMV A;  3EQU A;  5DFY A;  5HD3 A;  1IOU A;  5MC7 A;  5HPF A;  3BJN A;  4YNR A;  1G28 A;  3R4K A;  5G4Z A;  4WN5 A;  1X0O A;  2V1A A;  1OTB A;  3CLO A;  3MQ0 A;  2M7V A;  3KSI A;  5HWV A;  2L4R A;  5F68 A;  3LIC A;  4EEU A;  1ZHH B;  4HH3 A;  3OCN A;  1UGU A;  3MF0 A;  3SW1 A;  2O0Y A;  1TF1 A;  3BQA A;  2L1M A;  3O5Y A;  3E4P A;  5L8M A;  2HF6 A;  4I38 A;  1KOU A;  4WF0 A;  3IBJ A;  1GSW A;  1T19 A;  5HL6 A;  3JVV A;  2Y79 A;  1OTA A;  3S7O A;  1UWP X;  4GS9 B;  1TS6 A;  2ZOI A;  3IBR A;  5HD5 A;  5DKK A;  4HH2 A;  4LLO B;  3RTY A;  2P7J A;  2PD7 A;  3HJI A;  4HJ4 A;  3FG8 A;  1LL8 A;  2Z6D A;  2VGL S;  4Y5F A;  3EEA A;  4R3A A;  4HOI A;  3DBA A;  1GSX A;  4O8G A;  4KUK A;  2EWW A;  3CI6 A;  2W3G A;  1STZ A;  3PBS A;  5A8B A;  4ARZ A;  4WEL A;  4EW7 A;  5IT5 A;  2VV6 A;  2WKP A;  4GHI B;  2W3F A;  3A0S A;  3KYZ A;  1H8M A;  3UB8 A;  3MXQ A;  2MJ6 A;  3PHY A;  3EWK A;  2GX5 A;  3D72 A;  4LRZ E;  2W27 A;  3IS2 A;  2PR6 A;  1YSP A;  1S66 L;  4H6J A;  2PYR A;  2A2L A;  4UQI M;  4HIA A;  1T1C A;  4KUO A;  3H7W A;  2HGV A;  2HJ9 C;  2W1R A;  2W3H A;  4E04 A;  2K31 A;  2GNX A;  3LIF A;  5TJJ A;  2W0N A;  3KSH A;  4FSF A;  3F1O A;  1H3Q A;  3ULF A;  1YKD A;  3H82 A;  4G3W A;  4II7 A;  3BWL A;  3LR0 A;  1P9W A;  4MCW A;  4MN6 A;  3LR5 A;  3PBN A;  1OTD A;  4BBT A;  3LIE A;  2VJW A;  2V0U A;  3GDI A;  3VV4 A;  4CLC D;  2J3W A;  4EXO A;  4DJ3 A;  4QPR A;  1GSV A;  4CLC B;  1XFN A;  2GZA A;  4HP9 A;  4BBU A;  3PBQ A;  2CMN A;  5DJT A;  2K2N A;  4HP4 A;  1N9L A;  5AVE A;  3OOV A;  3E0Y A;  4F3L A;  3T4K A;  4L9F A;  1JNU A;  3HCY A;  4UEY A;  3UB9 A;  3G6O A;  4WEK A;  5G4Y A;  1S1Y A;  1DP8 A;  3EEH A;  2BAS A;  3T4T A;  3UB7 A;  3A0V A;  3NOT C;  3CUE A;  2ZOH A;  2PR5 A;  4PKY A;  4GJ4 A;  4H6J B;  4O01 A;  4HQA A;  2YKF A;  2D02 A;  1VHM A;  1XJ4 A;  4BWI A;  2VGL M;  3MQO A;  4RQ9 A;  1V9Z A;  4R6L A;  1TS7 A;  4EET B;  3KSG A;  2PYP A;  2PD8 A;  3F1O B;  1S4S A;  2OWJ A;  4PAU A;  3S7N A;  3MFX A;  3RFB A;  1NRJ A;  2XRN A;  5HZH A;  3R7W A;  1XJ3 A;  3TRC A;  4NXG A;  3ZYT A;  1OTI A;  2KDK A;  3OC2 A;  3KSF A;  2XRO A;  4PHT A;  4NEE D;  2OAP 1;  4GLQ A;  1WA9 A;  1NWZ A;  5J4E A;  1W63 Q;  3A0R A;  3UE3 A;  3LIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...