1XJ3A

Bjfixlh in unliganded ferrous form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 29
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj3A00
3HJIA 4R3AA 4GS9B 2L1MA 1XJ2A 2OOLA 3B33A 4H6JA 3LIAA 4LLOB 4LRZE 5DJUA 4BBUA 2H28A 3EEHA 3LI8A 3LIFA 1S4RA 4EESA 2GJ3A 1DRMA 3LUQA 3E4QA 5AVEA 2ZBBA 3C2WA 3F1PA 2VLGA 2V0UA 4R38A 5HD5A 4EXOA 1OJ5A 3T50A 1EW0A 4LRYC 1OT9A 1S66L 4WF0A 4F3LB 3C8CA 4HH3A 4NXFA 4MN5A 1ODVA 5HWTA 4WUJA 2VV6A 2R78A 1LSWA 3CWFA 1S1YA 2QJ7A 4WN5A 2M1CA 4GHIB 4KQDA 4HQAA 4E04A 3F1OB 1X0OA 2KDKA 5DKKA 4XT2A 3UMEA 2D01A 5HD3A 1N9OA 5J3WA 3KX0X 1T1BA 1OTDA 4B9OA 3IS2B 1S4SA 3LICA 4EETB 3NOTC 1WA9A 4HH2A 1LSXA 1V9ZA 3FG8A 3D72A 1UGUA 3MXQA 2J80A 4I3AA 5HWWA 3BWLA 5KIZA 2A24A 1XJ4A 5EFWA 3NOUC 1XJ3A 2VV8A 3ZQ5A 3K3DA 1P0ZA 3LIDA 4BBTA 1GSWA 2Z6CA 3LIBA 1TS6A 3A0SA 3UE6A 1BYWA 3PHYA 3MJQA 1GSVA 3H82B 3OLOA 3CLOA 3F1NB 4MN6A 4HHDA 4I5SA 4HNBA 1T1AA 2I9VA 3RH8B 4L9FA 3UB7A 3UB6A 5F68A 1V9YA 2BASA 3PYPA 4K08A 5G4ZA 2VEAA 2PDRA 3GDIA 2VV7A 2JN7A 1T1CA 2INWA 4NXBA 4DJ3A 4EQ1A 1XFQA 3H7WB 4LRXC 1OTAA 2D02A 2OWJA 1P97A 4H6JB 2P7JA 4EEUA 4HP9A 1OJGA 2PD8A 2QWSA 1Y28A 1OT6A 1VB6A 2V1AA 2V9AA 5F69A 4I39A 1XFNA 2QJ5A 5A8BA 2KX6A 5IU1A 2PR6A 3IS2A 4GW9A 4KUKA 1MZUA 5DKLA 1F98A 2K7SA 3K3CA 1DP9A 1S67L 2YKHA 2PR5A 1D7EA 4XT2B 1OTEA 1T19A 3ULFA 4HOIA 3SW1A 1GSXA 1XJ6A 4I3IA 1TS0A 5F6AA 4NXEA 3E4PA 1TS7A 2PD7A 4HY8A 3G6OA 4JGOA 4L9EA 3UB8A 3LYXA 1NWZA 5TBMA 4R6LA 4GS9A 5HDSA 2Z6DA 3LI9A 2A24B 1N9LA 5F5YA 2YKFA 5I5LA 3H9WA 4EEPA 1DP8A 3NHQA 4HI4A 3NJAA 4JGPA 3LIEA 4RQ9A 1N9NA 4R70A 3VOLA 1G28A 5HSQA 1JNUA 4BBVA 2B02A 4F3LA 2WKRA 4HJ4A 4EW7A 5G4YA 4DJ2A 2WKQA 1LSVA 4GHIA 2V0WA 4PKYA 4PKYG 3MFXA 3VE3A 2W27A 3F1OA 1KOUA 1UWPX 3F1PB 5DJTA 1D06A 1LL8A 4I38A 4HIAA 5HZHA 2JHEA 3RTYA 3HJKA 2QKPA 3A0RA 2PYRA 3P7NA 5HDDA 4EERA 2ZOHA 1OTBA 5HWVA 4HJ6A 2EA9A 1UWNX 2QHKA 4L9GA 4HP4A 1TS8A 5J7EA 2PHYA 3CAXA 4M4XA 2L0WA 4YWZA 3UB9A 3EWKA 3A0VA 5IS1A 4KUOA 4JGQA 2HV1A 1DP6A 1S1ZA 5AVFA 4JGRA 1OTIA 3FC7A 1LT0A 4GCZA 2WKPA 2ZOIA 2PYPA 2V1BA 1T18A 3VE4A 4WL9A 4NXGA 3E4OA 3ICYA 2CMNA 3H82A 4I3JA 3F1NA 1F9IA 3BY8A 4WLAA 2W0NA 5J4EA 5HDCA 3UMDA 2L4RA 3MQQA 4HJ3A 3NOPC 3BY9A 3GECA 3MR0A 2OWHA 3MQOA 4LPZA 3IBRA 3H7WA 5TBMB
chains in the Genus database with same CATH superfamily
3HJIA 5DTKA 1L2SA 3IH9A 3AGDA 2L1MA 5FQIA 3PBOA 2JKFA 1YM1A 3ZG8B 5CGWA 3ZVTA 4H6JA 4EV4A 1MKIA 3CI6A 5DJUA 1MY8A 3ITAA 1ALQA 2H28A 2HJ9C 1QMFA 4OOLA 4BJPA 3LIFA 5E43A 2W3DA 1IFQA 4EESA 4IBXA 2GJ3A 3R7WB 4JBFA 3E4QA 4BLMA 1KE3A 2W3GA 3F1PA 2VGKA 1KVMA 2G7UA 3LEZA 2FH5A 2HF6A 2Y2HA 5FL3A 1HZOA 1K25A 3I7JA 3PBNA 1OT9A 1F5MA 5DF7A 4F3LB 5U47A 1IKGA 4KENB 5DTTA 4EBLA 4MN5A 5HWTA 4WUJA 2VV6A 2R78A 1PWDA 1S1YA 2QJ7A 5AQAA 2V8CA 4KQDA 3RFBA 3TW8A 4IJGA 4GDBA 5L8MA 3DW0A 4XT2A 5DF9A 4NKPA 4FTXA 2Y2LA 2XFTA 1T1BA 1OTDA 2G2WA 4S2OA 5DTSA 5EECA 1FILA 2GNXA 1S4SA 1XA1A 3QHYA 1WA9A 2K31A 5KSHA 1BSGA 5HAIA 4D60A 2PT7A 3DBAA 4R1GA 1YQSA 2OLUA 4OLDA 4UEYA 3WS1A 5FA7A 3CPTA 3U4LP 5KIZA 3MZFA 1W63M 1HLUP 4KZ7A 1XJ3A 3R4KA 4DMZA 4KG2A 1P0ZA 4WBGA 2ZM2A 2OV5A 4S2PA 2K2NA 2Z6CA 3HL9A 4C3QA 1J9MA 4S2IA 3S1YA 3LIBA 3MKEA 1I2WA 3PHYA 3MJQA 3MKFA 3IF5A 3IX3A 4MN6A 4JXVA 1MKMA 4NETA 4I5SA 4HNBA 3RH8B 4CLCD 3UB7A 5LBRA 3UB6A 1BLPA 1V9YA 1KGFA 3HLEA 2ZC7A 5G4ZA 2JKTM 2Y2QA 2VEAA 3A3DA 1XKZA 5EVIB 1T1CA 1PNEA 2XQZA 3MMHA 2PBYA 5IHVA 1HVBA 1IYQA 3IF6C 3ZVWA 1HTZA 3IF6A 4JF4A 1EROA 4X6TA 2OWJA 1P97A 4H6JB 4X53A 2OAP1 4EEUA 5GLDA 4C6YA 1FCOA 4KZ4A 3Q81A 4OVDA 2ZC3B 4PMAA 2O9AA 3N8RA 3ZFZA 1OJGA 3KYZA 3OPLA 3GVBA 4IVIA 2B18A 3SS5A 3BYDA 2HP5A 2V1AA 3N6IA 5JYOA 1S6RA 4I39A 3MQ0A 2VGLS 3UPNA 3P09A 2KX6A 5IU1A 1Z6FA 1YLJA 3NI9A 3S22A 4KUKA 3D4FA 1LL5A 3UB5P 4OPZA 1D1JA 4OP5A 2ZM0A 4Y5FA 5HX9A 4FCFA 1W63Q 3FWLA 4Y0UA 2YKHA 4BL2A 2VK3A 3VP4A 1D7EA 4XT2B 2BG1A 3P98A 1C3BA 2XEPA 3SW1A 3FKWA 1P9WA 3T4JA 1TS0A 4MCWA 3ZYTA 2HZ5A 1XP4A 3B42A 4O01A 2ZMFA 4PAUA 5J8XA 4KZAA 4YNRA 2XRNA 3C5AA 3ITBA 4GS9A 2Y2JA 2Z6DA 3CPTB 5E2EA 4P6ZS 1N9LA 4JPMA 1JWPA 5FQJA 2ZD8A 3GR2A 4RA7A 1DP8A 3WRTA 4HI4A 2EWVA 3NJAA 3AGFA 1K6RA 1RP5A 3DWZA 3UDXA 4FH2A 1KDSA 4QY5A 3VV4A 3FZCA 2RCXA 1N4OA 2ACGA 2IWCA 2JE5A 2H5SA 4KZBA 2Y8HA 4OP8A 2ZM8A 3MZDA 4Y13A 2XSSA 4LV2A 4WELA 1IOUA 5GLAA 2PRFA 1PRQA 1L0FA 2O0YA 3CZDA 4E3NA 2WK0A 4PKYG 4DN0A 2V20A 4MDZA 2J3TD 3S7PA 4E3MA 2QPNA 1KGGA 5HZHA 2B5RA 3HJKA 1LI9A 1TD5A 5CRFA 2EX8A 3EOIA 4DE0A 2QHKA 1NYYA 4L9GA 1TS8A 4KQOA 3IWIA 4ZJ1A 3KO6A 4LENA 1NZOA 4EU0A 2L0WA 4MMNA 3RXWA 5CECA 3KYQA 5IT5A 3UB9A 2PAVP 5EM1A 4P0MA 4IUHA 3A0VA 4R4SA 5IS1A 4DF6A 1DP6A 4E3IA 1S1ZA 4NK3A 3HUMA 4JGRA 5GHXA 1OTIA 3SH9A 4IBRA 4FD8A 3EEAA 4GCZA 3MSHA 2ZOIA 3N8LA 2O9CA 1XA7A 3HLGA 3DTMA 2CMNA 4QY6A 3BLMA 2V2FF 4G3WA 3BY8A 3NULA 4KQRA 2W0NA 4PM6A 5HDCA 3UMDA 2L4RA 3MQQA 1AXBA 1CEFA 3NOPC 4FOFA 3C7UA 5C5KA 4ME4A 4LCMA 3NDEA 4WM9A 2HDSA 3W4OA 4P6BA 1ZG6A 4R3AA 4GS9B 1NY0A 5HL6A 4OONA 1CI9A 4N9LA 1XJ2A 4R0QA 2Y2NA 4LRZE 4DDYA 5E2HA 2UWXA 3LI8A 1SDNA 1FR6A 4QPRA 3FKVA 2W3FA 3KSIA 5A92A 1WYBA 4QB8A 3IHAA 3BW6A 2ZBBA 3A3FA 2XGNA 2EX6A 3A3EA 3EQVA 3LR4A 1YLYA 5A91A 3T4TA 2JC7A 5HD5A 4ARZB 1YAXA 1MWTA 3UDFA 4HBUA 1EW0A 3PAGA 1S66L 1VQQA 4MNRA 4PM5A 4CLCC 3C8CA 4CLCA 1RGYA 5KSCA 3QP6A 1YMXA 4FH4A 1PYYA 2WAEA 3NC8A 1YLPA 2JKTI 3CWFA 5K5BA 2ZQCA 3VP2A 2ZQDA 3WRZA 3ZGAB 2DCFA 5EV0A 5EOOA 2A2LA 2HPBA 4E3KA 2W1TA 2EXAA 5DKKA 3BFEA 1STZA 1L0GA 3DTIA 2VZWA 3CMZA 1IYOA 4C75A 3C4PA 3IS2B 4OKPA 3LICA 4R3JA 5M18A 2EWWA 4N1HA 3MXQA 2ZC6B 2H0YA 3QP8A 2ZC5B 1JVJA 3O3VA 2E8JA 4KZ8A 4DXCA 1TF1A 3VOZA 4X69A 4KZ6A 3VMAA 2P74A 2VV8A 1RCJA 3IHBA 2P9VA 5AQ7A 2UV0E 2XH9A 3GSGA 5BOHA 5EVEA 2M7VA 4DE1A 1YSPA 3T4KA 3C4OA 5M1AA 1KDWA 5GLCA 3U2AA 1O07A 1FCNA 4JXGA 3M2JA 4MBHA 1OMEA 3VP0A 1T1AA 1YKDA 4Y0TA 3UNWA 5F68A 2BASA 3T1SA 2J8YA 3GQZA 3PYPA 3W2ZA 4K08A 4KG5A 2PBDP 3E98A 5A90A 5FI7A 2PDRA 3GDIA 2VV7A 4IHQA 2BLSA 4QD4A 3VOYA 2O99A 3VFFA 3T4OA 3KSHA 1BZAA 1FSYA 4JF5A 3ZNTA 3TRCA 4UHUA 4Y3IA 1BT5A 1PZPA 2ZL1A 1XPBA 3T4SA 4OPRA 2VKSA 2JKRM 3SOIA 2PD8A 4XUXA 1E25A 1MC0A 2XF3A 1VB6A 5F69A 1ES4A 4LV3A 2QJ5A 3LY3A 1VHMA 2XD5A 4X68A 1QMEA 4EWFA 4WEKA 3PTEA 1I5QA 3E2LA 4QHCA 1YMSA 5DKLA 1FIKA 4PM8A 2C6WB 1F98A 3KYEA 3K3CA 4K91A 5TR7A 2J3TC 1M40A 3LGOA 1MWSA 2W1TB 2XA7M 3LR0A 3ULFA 1GSXA 2Y4AA 2MJ6A 4NXEA 1A0KA 2GZAA 5FAPA 3E4PA 1TS7A 3AGEA 2PD7A 4R3BA 2WYXA 4B4XA 4E6WA 4JGOA 3ZG7B 3K2NA 3LYXA 3MXSA 2PU4A 2WADA 2JKGA 4RVAA 4OOMA 4LFUA 4JKTA 1DJCA 4OLGA 3SZTA 3ZG5A 3HLCA 3LI9A 1AWIA 1TVFA 5DF8A 2Z2MB 1CEGA 2YKFA 1ES2A 2Y2MA 4EEPA 5CERA 1NJ4A 1G6AA 5CGSA 2P9VB 1U60A 1ESUA 3OC2A 4R70A 5CTNA 1GHMA 3D3OA 5EVLA 1K56D 3JYIA 3LY4A 3OZHA 3V3SA 3IX4A 4Y15A 2AVXA 1ONHA 2WKRA 1E3UA 4DDSA 5G4YA 3O87A 2G2UA 1PFLA 4U0XA 1WYCA 4PKYA 3ZHHA 3MFXA 4WMCD 1BTLA 1VETA 3V3RA 3B3XA 3ZNYA 1K4FA 3F1PB 2A49A 2Y2GA 1LL8A 1L3LA 3IBJA 4P87A 2JHEA 3RTYA 3BFFA 4R23A 2QKPA 2VJWA 1ZKJA 4D2OA 3QP2A 1YPRA 1OTBA 2ZL1B 3QP5A 5E2GA 3ISGA 1E4DA 4GZBA 1YT4A 3V39A 5J7EA 1N9BA 3GMWA 2WUQA 1BLCA 5FATA 4ZJ3A 3V5MA 3PAEA 4LCLA 5G18A 2ZC4B 2VX8A 2X71A 3ZCZA 4DE2A 2Y79A 4QU3A 4UQIM 1JWVA 1GHIA 4K0WA 3T1QB 3WWXA 3QP4A 4KZ5A 2DMWA 4E6XA 5M19A 4MEZA 5HAPA 1HD8A 3TG9A 1G68A 4E3OA 4WL9A 2HJEA 3SH7A 3E4OA 2IWBA 3HUOA 3NECA 4FUWA 4CPKA 1LL9A 3S4XA 2E8IA 2VGJA 4G3VA 4OH0A 2WAFA 5J4EA 1PIOA 1ES3A 4JXWA 1S0WA 4Y0OA 4HJ3A 4BENA 2OSUA 4CQHA 3NDGA 3M6BA 3GECA 4GB7A 5DVAA 4QJGA 2RL3A 3MQOA 2XD1A 2ZMVA 4B88A 2WZXA 3BLSA 4BQMA 3Q7ZA 3IBRA 5EOEA 1XXMA 4S2MA 4Q0HA 3T4LA 5FQ9A 3HUNA 4ID4A 4GKUA 2VGLM 5FAQA 4LLOB 3LIAA 3G2YA 4BBUA 1CQAA 3EGXC 5FQKA 1S4RA 3O5YA 1MPLA 3WS5A 5HPIA 3OPRA 1MBLA 4S2NC 4DKIA 2Q9NA 5KZHA 2KLIA 3M2KA 2H0TA 3O88A 5CHJA 1OJ5A 3T50A 1ERQA 3IF6B 4WF0A 1KGEA 2Y59A 3UPOA 4NEED 1FR1A 2XROA 3N4IA 5GHYA 5E2FA 2X02A 5FI6A 2M1CA 3SH8A 1G5UA 5F82A 3IWOA 4E04A 1VETB 5TGFA 4ZJ2A 1DJAA 3OBFA 5FEFA 2J9OA 2D01A 3ZG9B 1N9OA 3IXGA 2ZQ8A 5J3WA 3BJNA 4UAAA 5FDSA 2Y2PA 4B9OA 2JKRI 4HEFA 2HDUA 3MF0A 4HH2A 3LR5A 1LSXA 3FG8A 3FPVA 5HARA 1UGUA 1CF0A 4BWIA 2XR0A 2DNSA 3UY6A 4GDNA 3GV9A 4Z9QA 4BD0A 3SS3A 3BWLA 2A24A 1XJ4A 4E3LA 2NUPC 3K3DA 2Y91A 3OOVA 5DFXA 4Q8IA 4BBTA 4HESA 4X25A 4X55A 1GSWA 1XGJA 3BQ8A 1SKOA 3G2ZA 5EUAA 1TDGA 4JLFA 4IVKA 3A0SA 1RGZA 1K0KA 4YOFA 2W3EA 4GD8A 3OLOA 3CLOA 2I9VA 3CG5A 4BD1A 4L9FA 4E3JA 1FSWA 5TFQA 1H5XA 4ETXA 1XX2A 2Q0OA 3A3JA 4WEJA 4GLQA 1K55C 2R9WA 4S2JA 3NCKA 1K55A 2JN7A 3KSGA 4EQ1A 1XFQA 4OPYA 4GOGA 1Y4OA 4X56A 2D02A 1YLWA 1J3WA 3HBRA 1IEMA 2J7VA 4HP9A 4S2KA 4CJNA 2BTFP 4R4RA 1L0DA 3TSGA 4YINA 4OQIA 5CX7A 5HPFA 2QWSA 1Y28A 2XDMA 1ONGA 2V9AA 3JVUA 3ZDJA 3EQUA 3N7WA 1W7FA 4Q0JA 3G34A 4PPRA 2JCHA 3PBSA 4N92A 3RXXA 1H3QA 3TJZC 1MZUA 2X01A 3IXBA 1K4EA 3ZG0A 2EX9A 2K7SA 4WMCA 4RYEA 1S67L 5GHZA 2KOIA 2WKHA 5CHUA 3CUEC 3CUEA 4XUZA 1BLSA 1Y54A 4X1MA 1T19A 2JBFA 1XJ6A 4I3IA 5F6AA 3W4QA 3RJUA 1SDEA 1IYSA 4EUZA 1JTGA 3G6OA 4L9EA 2FFYA 3UB8A 3G30A 2WGIA 4R6LA 5TBMA 1SCWA 4WZ4A 2J3WA 4Q0IA 2B95A 2HP6A 2WGWA 2WKIA 4BL3A 2A24B 2M7UA 2EX2A 4JF6A 5I5LA 1SHVA 3H9WA 4ZBEA 3G4PA 5EM0A 1M6KA 5AJGA 3WS2A 1PW1A 2XA7S 1SKOB 3HLBA 2LB9A 3UPPA 1BLHA 3PXPA 2H10A 3VOLA 1NZUA 3KSFA 2VA0A 1G28A 1SKFA 3S7OA 2W3HA 4BMWA 5FQMA 3UDIA 5HL1A 4BBVA 3OCLA 2B02A 4HJ4A 3N8SA 1GA9A 4MBKA 4EW7A 4LV1A 4DJ2A 4EUVA 1H8MA 3Q82A 3SS4A 3VSKA 2Z2LB 1FQGA 4GHIA 2FZ0A 3VE3A 2XK1A 3F1OA 1KOUA 1UWPX 5A93A 4QWOA 1PI4A 2J9PA 3CITA 3VFHA 4CLCE 4EQIA 3A0RA 3P7NA 4EERA 1VEUA 2ZOHA 5HWVA 4CLCB 4HJ6A 3QP1A 5HW3A 1KVLA 2ZQ7A 5HAQA 1PW8A 3HLFA 1W79A 3CAXA 1ERMA 2DRWA 3IXDA 3FV7A 1ZTUA 5AQBA 5FQQA 4FSFA 3EWKA 5L09A 2W1RA 2HV1A 3UE0A 4DRTA 2QYBA 5AVFA 1L0EA 3FC7A 1LT0A 4NG2A 1NLZA 1MXOA 3C7VA 2PYPA 1OPXA 3L9KA 3P01A 1ES5A 1K57C 3BECA 1T18A 1K57A 3VE4A 1ZG4A 3OPPA 3V67A 3H82A 2C5WB 4I3JA 4A5RA 3F1NA 1F9IA 4DXBA 5FSRA 5L07A 2R9XA 3GTCA 1NYMA 4Z1WA 3T1RA 2QZ6A 4WLAA 4Y2FA 4G3KA 3LEQA 2GX5A 2LB5A 5CGXA 3MR0A 1BUEA 4KG6A 4UQIS 3H7WA 4O0PA 5TBMB 3IX8A 3BFGA 3MXRA 1VM1A 2OOLA 1CI8A 2WGWB 2ZLYA 3B33A 3DTKA 3EEHA 3DWKA 1ESIA 1SZVA 3T4QA 4HBTA 4X1LA 5FAOA 4OQHA 4EBNA 1IYPA 4GD6A 1DRMA 3LUQA 1K38A 5AVEA 1H0MA 3C30A 3C2WA 2CC1A 3BRMA 2Q9MA 1K6SA 2VLGA 2V0UA 4R38A 1IELA 4UA9A 4GJ4A 2GDNA 4EXOA 2WGVA 4GN2A 4LRYC 3V50A 3D9YA 1G6OA 2OLVA 4O7DA 2ZMAA 4HH3A 3LR3A 3CJMA 2V1ZA 4NXFA 1ODVA 4B93A 3BQAA 1GHPA 4N9KA 2WKEA 1LSWA 1KE0A 3GRJA 4OQGA 4WN5A 2ZQAA 3HREA 1GCEA 4GHIB 4PM9A 4K0XA 2WZZA 4HQAA 1ZC2A 3F1OB 5EPHA 1X0OA 1MWRA 2KDKA 2IA2A 3NIAA 3UN7A 1ZHHB 4F94A 1YSQA 1DJBA 3OPHA 3UMEA 5HD3A 3KX0X 1VEUB 3E2KA 4EETB 3NOTC 1V9ZA 1P9RA 3D72A 3FPWA 5L2FA 3PBQA 2OAQ1 2J80A 2HDRA 1PI5A 4I3AA 5EVID 5HWWA 5FASA 5GLBA 3BFCA 4ETZA 5F1GA 1NRJA 1I2SA 3C38A 3S7QA 1MWUA 5EFWA 4WYYA 3NOUC 3VP3A 3ZQ5A 2Y2IA 3LIDA 5FDHA 4RX3A 2NUTC 2XLNA 2EXBA 1TS6A 1TEMA 1BYWA 2ZJ9A 3UE6A 4YFMA 1GSVA 3H82B 3F1NB 4HHDA 3JPUA 2IWDA 5FI2A 3BEBA 4MLLA 3IT9A 3Q7VA 1PWCA 1LHYA 1PWGA 5HFOA 3E0YA 4KZ9A 1BULA 1NLYA 4S2LA 3A3IA 2INWA 3PBTA 4NXBA 4DJ3A 4ARZA 3H7WB 4S2NA 4LRXC 1OTAA 5I94A 3QNBA 1W8QA 2P7JA 1ACFA 1F2KA 4U3TA 4GNUA 3HLWA 1DY6A 4OOYA 1NXYA 3UO9A 1OT6A 5TJJA 2A3UA 1XFNA 4Y17A 5A8BA 5CTMA 2Y2KA 3NBLA 3UE1A 2PR6A 3IS2A 3HLDA 4GW9A 4PHTA 2FFFB 4P6ZM 4AFIA 2PU2A 1CK3A 3T1XA 1JWZA 3JVVA 3PR6A 4UA6A 4ZTKA 1DP9A 4ZRRA 3T12B 3Q07A 2PR5A 3DAVA 2V8FA 5CHMA 1OTEA 3WS0A 1FOFA 4XXRA 1K54C 4HOIA 1K54A 4KZ3A 4RX2A 5CXWA 5CEDA 3BFDA 3IH8A 1JTDA 4IUKA 5CEBA 3FYZA 3IWQA 4HY8A 2P04A 4LV0A 4LGWA 1EI5A 3TOIA 4O8GA 1NWZA 3O86A 2EFXA 2ZQ9A 5L10A 4ESPA 5HDSA 3HVFA 1W5DA 3Q1FA 5F5YA 1E3UD 2QMIA 4N1XA 1O7EA 3NHQA 4L0LA 5JYPA 4JGPA 3S7NA 3LIEA 3CHWP 3R7WA 4RQ9A 1N9NA 1H8ZA 3DTEA 1GA0A 2Y55A 1Q2QA 3WS4A 5HSQA 3PBRA 1YLZA 1JNUA 2O9BA 5FEGA 4WZ5C 3QNCA 2HP9A 4WZ5A 2XFSA 3W8KA 3MS6A 4F3LA 5EE8A 1XGIA 4ZDXA 3MBZA 1PZOA 2WKQA 1IKIA 3Q7VB 4KQQA 5MC7A 1LSVA 2V0WA 1KE4A 5AQ9A 3VSLA 1LLBA 2W27A 4OPQA 1LI0A 1CJFA 5DJTA 1K56A 1D06A 4I38A 4HIAA 4MBFA 2PYRA 5HDDA 4JXSA 5F1FA 4M3KA 3IQAA 4EBPA 3W4PA 2EA9A 4UA7A 3M6HA 4ZAMA 1UWNX 1WE4A 4OQ0A 3HCYA 4HP4A 1EWZA 2HGVA 3MFDA 2PHYA 1Q2PA 3MZEA 4M4XA 3LCEA 5DFYA 4YWZA 3VP1A 4Y7PA 4PM7A 2EFUA 4KUOA 4H8RA 4JGQA 3G31A 2I72A 1NRFA 3EGDC 3BM6A 3NY4A 1TDLA 5GL9A 2WKPA 3UE3A 2P08A 2V1BA 4IEDA 1YLTA 4DE3A 4II7A 2HDQA 3OCNA 5KMWA 4NXGA 3B47A 1FCMA 3ICYA 5F83A 1Z09A 3TE8A 4U0TA 3LO7A 3G32A 3IXHA 4B4ZA 3G35A 3L7HA 5D3OA 3BY9A 1W8YA 2OWHA 5EVIC 4LPZA 5EVIA 4P85A 3LFVA 4MN7A 2Y2OA 1H8YA
chains in the Genus database with same CATH topology
3HJIA 4R3AA 4Q0HA 4GS9B 3T4LA 5HL6A 2L1MA 1XJ2A 2OOLA 3PBOA 2VGLM 3B33A 4H6JA 3LIAA 3CI6A 4LLOB 4LRZE 5DJUA 4BBUA 3EEHA 2H28A 2HJ9C 3T4QA 4OOLA 3EGXC 3LI8A 4BJPA 3LIFA 4QPRA 2W3DA 1S4RA 1IFQA 2W3FA 3KSIA 3O5YA 4EESA 2GJ3A 1DRMA 3LUQA 3E4QA 3R7WB 5AVEA 5HPIA 3BW6A 3C30A 2W3GA 2ZBBA 3C2WA 3F1PA 2G7UA 2VLGA 2V0UA 2KLIA 3EQVA 2FH5A 3LR4A 2HF6A 4R38A 3T4TA 5HD5A 4GJ4A 4ARZB 4EXOA 1YAXA 5FL3A 1OJ5A 3PBNA 3T50A 1EW0A 4LRYC 1OT9A 1S66L 1F5MA 1G6OA 4WF0A 4CLCC 4F3LB 3C8CA 4CLCA 4HH3A 4NEED 3LR3A 4NXFA 4MN5A 1ODVA 5HWTA 4WUJA 2VV6A 4B93A 2R78A 2XROA 3BQAA 2JKTI 1LSWA 3CWFA 1S1YA 5K5BA 2QJ7A 4WN5A 2M1CA 4GHIB 4KQDA 4HQAA 4E04A 3RFBA 2A2LA 3F1OB 1X0OA 2KDKA 3TW8A 2W1TA 4IJGA 5DKKA 3OBFA 2IA2A 5L8MA 4XT2A 1ZHHB 5DF9A 1YSQA 4NKPA 1STZA 3UMEA 2D01A 2VZWA 5HD3A 1N9OA 5J3WA 3BJNA 1T1BA 3KX0X 1OTDA 4B9OA 2GNXA 2JKRI 3IS2B 1S4SA 3LICA 4EETB 3NOTC 1WA9A 2K31A 3MF0A 4HH2A 2EWWA 3LR5A 1LSXA 5KSHA 1V9ZA 3FPVA 3FG8A 1P9RA 3D72A 3FPWA 3PBQA 1UGUA 3MXQA 2OAQ1 2PT7A 3DBAA 2J80A 4I3AA 5HWWA 4BWIA 1TF1A 4UEYA 4ETZA 1NRJA 3C38A 3S7QA 3BWLA 5KIZA 2A24A 1W63M 1XJ4A 5EFWA 3NOUC 1XJ3A 3R4KA 4DMZA 2VV8A 3ZQ5A 2NUPC 3K3DA 1P0ZA 3OOVA 5DFXA 3LIDA 4BBTA 1GSWA 2K2NA 3BQ8A 2Z6CA 2NUTC 3LIBA 2M7VA 1TS6A 1YSPA 3A0SA 1BYWA 3UE6A 3T4KA 3PHYA 3MJQA 3U2AA 1GSVA 4YOFA 3H82B 2W3EA 3OLOA 3CLOA 3F1NB 4MN6A 4HHDA 1MKMA 4I5SA 4HNBA 1T1AA 2I9VA 3RH8B 4L9FA 4CLCD 3UB7A 1YKDA 5LBRA 3UB6A 5F68A 1V9YA 2BASA 3PYPA 3W2ZA 4K08A 5G4ZA 2JKTM 4ETXA 3E0YA 2VEAA 3E98A 4WEJA 4GLQA 2PDRA 3GDIA 2VV7A 1NLYA 4IHQA 2JN7A 1T1CA 2INWA 3KSGA 3PBTA 4NXBA 4DJ3A 3MMHA 4EQ1A 4ARZA 2O99A 1XFQA 3T4OA 3H7WB 3KSHA 4LRXC 1OTAA 2D02A 3TRCA 4Y3IA 2OWJA 1P97A 4H6JB 2P7JA 2OAP1 4EEUA 3T4SA 4HP9A 2VKSA 2JKRM 2O9AA 1OJGA 3KYZA 2PD8A 5CX7A 2B18A 5HPFA 2QWSA 1Y28A 1MC0A 1OT6A 1VB6A 2V1AA 2V9AA 5F69A 5TJJA 3JVUA 4I39A 1XFNA 2QJ5A 3MQ0A 3EQUA 2VGLS 5A8BA 4Q0JA 1VHMA 2KX6A 3PBSA 5IU1A 2PR6A 3IS2A 4GW9A 1H3QA 4KUKA 4PHTA 4WEKA 3TJZC 1MZUA 5DKLA 4P6ZM 4AFIA 1F98A 4Y5FA 2K7SA 3K3CA 3JVVA 2J3TC 3PR6A 1DP9A 4ZRRA 1W63Q 1S67L 2YKHA 2PR5A 2W1TB 2KOIA 2XA7M 1D7EA 4XT2B 3CUEC 1OTEA 3LR0A 3CUEA 1T19A 3ULFA 4HOIA 3SW1A 1GSXA 1XJ6A 1P9WA 4I3IA 2MJ6A 3T4JA 1TS0A 4MCWA 5F6AA 4NXEA 2GZAA 3ZYTA 3E4PA 1TS7A 4IUKA 2PD7A 4HY8A 3G6OA 3B42A 2P04A 4JGOA 4L9EA 2ZMFA 4O01A 3UB8A 4PAUA 3K2NA 3LYXA 4O8GA 1NWZA 5TBMA 4R6LA 4YNRA 2XRNA 4OOMA 4GS9A 2J3WA 4Q0IA 5HDSA 2Z6DA 3LI9A 2A24B 4P6ZS 1N9LA 2M7UA 5F5YA 2YKFA 5I5LA 3H9WA 4EEPA 1DP8A 3NHQA 4L0LA 4HI4A 2EWVA 5AJGA 3NJAA 4JGPA 3S7NA 3LIEA 3OC2A 3R7WA 4RQ9A 1N9NA 2XA7S 2LB9A 4R70A 3PXPA 3D3OA 3VOLA 3KSFA 2VA0A 1G28A 5HSQA 3PBRA 3S7OA 3VV4A 1JNUA 2O9BA 2W3HA 4BMWA 4BBVA 3OCLA 2B02A 4F3LA 2Y8HA 2WKRA 4HJ4A 4EW7A 5G4YA 4DJ2A 2XSSA 4EUVA 2WKQA 4WELA 1IOUA 1H8MA 5MC7A 2O0YA 1LSVA 4GHIA 2V0WA 2FZ0A 4PKYA 4PKYG 3MFXA 3VE3A 2W27A 3F1OA 4DN0A 1KOUA 1UWPX 4MDZA 3F1PB 2J3TD 3S7PA 5DJTA 1D06A 1LL8A 4I38A 3CITA 4HIAA 3IBJA 5HZHA 2JHEA 4CLCE 3RTYA 3HJKA 2QKPA 2VJWA 1TD5A 3A0RA 2PYRA 3P7NA 5HDDA 4EERA 2ZOHA 1OTBA 5HWVA 4CLCB 4HJ6A 2EA9A 3EOIA 1UWNX 2QHKA 4L9GA 3HCYA 4HP4A 1TS8A 5J7EA 4KQOA 2HGVA 3KO6A 2PHYA 3CAXA 4EU0A 4M4XA 2L0WA 4MMNA 5DFYA 4YWZA 5TBMB 3KYQA 5IT5A 3UB9A 1ZTUA 4FSFA 3EWKA 4IUHA 3A0VA 2VX8A 5IS1A 4KUOA 4JGQA 2Y79A 2W1RA 2HV1A 1DP6A 4UQIM 1S1ZA 2QYBA 5AVFA 4JGRA 1OTIA 2DMWA 3FC7A 3EGDC 1LT0A 3EEAA 4GCZA 1NLZA 2WKPA 2ZOIA 2PYPA 3UE3A 2P08A 2V1BA 1OPXA 3P01A 2O9CA 1T18A 3VE4A 4WL9A 4II7A 2HJEA 3OCNA 4NXGA 3B47A 3E4OA 3ICYA 3V67A 2CMNA 3H82A 4I3JA 3F1NA 1F9IA 4G3WA 3BY8A 4Z1WA 3TE8A 4G3VA 4WLAA 4Y2FA 2W0NA 5J4EA 4G3KA 5HDCA 3UMDA 2L4RA 3MQQA 4HJ3A 3NOPC 2GX5A 4FOFA 4CQHA 3BY9A 3GECA 2LB5A 5C5KA 3MR0A 2OWHA 4ME4A 3MQOA 2ZMVA 4LPZA 3LFVA 4UQIS 3IBRA 4MN7A 3H7WA 4O0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJI A;  4R3A A;  4GS9 B;  2L1M A;  1XJ2 A;  2OOL A;  3B33 A;  4H6J A;  3LIA A;  4LLO B;  4LRZ E;  5DJU A;  4BBU A;  2H28 A;  3EEH A;  3LI8 A;  3LIF A;  1S4R A;  4EES A;  2GJ3 A;  1DRM A;  3LUQ A;  3E4Q A;  5AVE A;  2ZBB A;  3C2W A;  3F1P A;  2VLG A;  2V0U A;  4R38 A;  5HD5 A;  4EXO A;  1OJ5 A;  3T50 A;  1EW0 A;  4LRY C;  1OT9 A;  1S66 L;  4WF0 A;  4F3L B;  3C8C A;  4HH3 A;  4NXF A;  4MN5 A;  1ODV A;  5HWT A;  4WUJ A;  2VV6 A;  2R78 A;  1LSW A;  3CWF A;  1S1Y A;  2QJ7 A;  4WN5 A;  2M1C A;  4GHI B;  4KQD A;  4HQA A;  4E04 A;  3F1O B;  1X0O A;  2KDK A;  5DKK A;  4XT2 A;  3UME A;  2D01 A;  5HD3 A;  1N9O A;  5J3W A;  3KX0 X;  1T1B A;  1OTD A;  4B9O A;  3IS2 B;  1S4S A;  3LIC A;  4EET B;  3NOT C;  1WA9 A;  4HH2 A;  1LSX A;  1V9Z A;  3FG8 A;  3D72 A;  1UGU A;  3MXQ A;  2J80 A;  4I3A A;  5HWW A;  3BWL A;  5KIZ A;  2A24 A;  1XJ4 A;  5EFW A;  3NOU C;  1XJ3 A;  2VV8 A;  3ZQ5 A;  3K3D A;  1P0Z A;  3LID A;  4BBT A;  1GSW A;  2Z6C A;  3LIB A;  1TS6 A;  3A0S A;  3UE6 A;  1BYW A;  3PHY A;  3MJQ A;  1GSV A;  3H82 B;  3OLO A;  3CLO A;  3F1N B;  4MN6 A;  4HHD A;  4I5S A;  4HNB A;  1T1A A;  2I9V A;  3RH8 B;  4L9F A;  3UB7 A;  3UB6 A;  5F68 A;  1V9Y A;  2BAS A;  3PYP A;  4K08 A;  5G4Z A;  2VEA A;  2PDR A;  3GDI A;  2VV7 A;  2JN7 A;  1T1C A;  2INW A;  4NXB A;  4DJ3 A;  4EQ1 A;  1XFQ A;  3H7W B;  4LRX C;  1OTA A;  2D02 A;  2OWJ A;  1P97 A;  4H6J B;  2P7J A;  4EEU A;  4HP9 A;  1OJG A;  2PD8 A;  2QWS A;  1Y28 A;  1OT6 A;  1VB6 A;  2V1A A;  2V9A A;  5F69 A;  4I39 A;  1XFN A;  2QJ5 A;  5A8B A;  2KX6 A;  5IU1 A;  2PR6 A;  3IS2 A;  4GW9 A;  4KUK A;  1MZU A;  5DKL A;  1F98 A;  2K7S A;  3K3C A;  1DP9 A;  1S67 L;  2YKH A;  2PR5 A;  1D7E A;  4XT2 B;  1OTE A;  1T19 A;  3ULF A;  4HOI A;  3SW1 A;  1GSX A;  1XJ6 A;  4I3I A;  1TS0 A;  5F6A A;  4NXE A;  3E4P A;  1TS7 A;  2PD7 A;  4HY8 A;  3G6O A;  4JGO A;  4L9E A;  3UB8 A;  3LYX A;  1NWZ A;  5TBM A;  4R6L A;  4GS9 A;  5HDS A;  2Z6D A;  3LI9 A;  2A24 B;  1N9L A;  5F5Y A;  2YKF A;  5I5L A;  3H9W A;  4EEP A;  1DP8 A;  3NHQ A;  4HI4 A;  3NJA A;  4JGP A;  3LIE A;  4RQ9 A;  1N9N A;  4R70 A;  3VOL A;  1G28 A;  5HSQ A;  1JNU A;  4BBV A;  2B02 A;  4F3L A;  2WKR A;  4HJ4 A;  4EW7 A;  5G4Y A;  4DJ2 A;  2WKQ A;  1LSV A;  4GHI A;  2V0W A;  4PKY A;  4PKY G;  3MFX A;  3VE3 A;  2W27 A;  3F1O A;  1KOU A;  1UWP X;  3F1P B;  5DJT A;  1D06 A;  1LL8 A;  4I38 A;  4HIA A;  5HZH A;  2JHE A;  3RTY A;  3HJK A;  2QKP A;  3A0R A;  2PYR A;  3P7N A;  5HDD A;  4EER A;  2ZOH A;  1OTB A;  5HWV A;  4HJ6 A;  2EA9 A;  1UWN X;  2QHK A;  4L9G A;  4HP4 A;  1TS8 A;  5J7E A;  2PHY A;  3CAX A;  4M4X A;  2L0W A;  4YWZ A;  3UB9 A;  3EWK A;  3A0V A;  5IS1 A;  4KUO A;  4JGQ A;  2HV1 A;  1DP6 A;  1S1Z A;  5AVF A;  4JGR A;  1OTI A;  3FC7 A;  1LT0 A;  4GCZ A;  2WKP A;  2ZOI A;  2PYP A;  2V1B A;  1T18 A;  3VE4 A;  4WL9 A;  4NXG A;  3E4O A;  3ICY A;  2CMN A;  3H82 A;  4I3J A;  3F1N A;  1F9I A;  3BY8 A;  4WLA A;  2W0N A;  5J4E A;  5HDC A;  3UMD A;  2L4R A;  3MQQ A;  4HJ3 A;  3NOP C;  3BY9 A;  3GEC A;  3MR0 A;  2OWH A;  3MQO A;  4LPZ A;  3IBR A;  3H7W A;  5TBM B; 
#chains in the Genus database with same CATH topology
 3HJI A;  5DTK A;  1L2S A;  3IH9 A;  3AGD A;  2L1M A;  5FQI A;  3PBO A;  2JKF A;  1YM1 A;  3ZG8 B;  5CGW A;  3ZVT A;  4H6J A;  4EV4 A;  1MKI A;  3CI6 A;  5DJU A;  1MY8 A;  3ITA A;  1ALQ A;  2H28 A;  2HJ9 C;  1QMF A;  4OOL A;  4BJP A;  3LIF A;  5E43 A;  2W3D A;  1IFQ A;  4EES A;  4IBX A;  2GJ3 A;  3R7W B;  4JBF A;  3E4Q A;  4BLM A;  1KE3 A;  2W3G A;  3F1P A;  2VGK A;  1KVM A;  2G7U A;  3LEZ A;  2FH5 A;  2HF6 A;  2Y2H A;  5FL3 A;  1HZO A;  1K25 A;  3I7J A;  3PBN A;  1OT9 A;  1F5M A;  5DF7 A;  4F3L B;  5U47 A;  1IKG A;  4KEN B;  5DTT A;  4EBL A;  4MN5 A;  5HWT A;  4WUJ A;  2VV6 A;  2R78 A;  1PWD A;  1S1Y A;  2QJ7 A;  5AQA A;  2V8C A;  4KQD A;  3RFB A;  3TW8 A;  4IJG A;  4GDB A;  5L8M A;  3DW0 A;  4XT2 A;  5DF9 A;  4NKP A;  4FTX A;  2Y2L A;  2XFT A;  1T1B A;  1OTD A;  2G2W A;  4S2O A;  5DTS A;  5EEC A;  1FIL A;  2GNX A;  1S4S A;  1XA1 A;  3QHY A;  1WA9 A;  2K31 A;  5KSH A;  1BSG A;  5HAI A;  4D60 A;  2PT7 A;  3DBA A;  4R1G A;  1YQS A;  2OLU A;  4OLD A;  4UEY A;  3WS1 A;  5FA7 A;  3CPT A;  3U4L P;  5KIZ A;  3MZF A;  1W63 M;  1HLU P;  4KZ7 A;  1XJ3 A;  3R4K A;  4DMZ A;  4KG2 A;  1P0Z A;  4WBG A;  2ZM2 A;  2OV5 A;  4S2P A;  2K2N A;  2Z6C A;  3HL9 A;  4C3Q A;  1J9M A;  4S2I A;  3S1Y A;  3LIB A;  3MKE A;  1I2W A;  3PHY A;  3MJQ A;  3MKF A;  3IF5 A;  3IX3 A;  4MN6 A;  4JXV A;  1MKM A;  4NET A;  4I5S A;  4HNB A;  3RH8 B;  4CLC D;  3UB7 A;  5LBR A;  3UB6 A;  1BLP A;  1V9Y A;  1KGF A;  3HLE A;  2ZC7 A;  5G4Z A;  2JKT M;  2Y2Q A;  2VEA A;  3A3D A;  1XKZ A;  5EVI B;  1T1C A;  1PNE A;  2XQZ A;  3MMH A;  2PBY A;  5IHV A;  1HVB A;  1IYQ A;  3IF6 C;  3ZVW A;  1HTZ A;  3IF6 A;  4JF4 A;  1ERO A;  4X6T A;  2OWJ A;  1P97 A;  4H6J B;  4X53 A;  2OAP 1;  4EEU A;  5GLD A;  4C6Y A;  1FCO A;  4KZ4 A;  3Q81 A;  4OVD A;  2ZC3 B;  4PMA A;  2O9A A;  3N8R A;  3ZFZ A;  1OJG A;  3KYZ A;  3OPL A;  3GVB A;  4IVI A;  2B18 A;  3SS5 A;  3BYD A;  2HP5 A;  2V1A A;  3N6I A;  5JYO A;  1S6R A;  4I39 A;  3MQ0 A;  2VGL S;  3UPN A;  3P09 A;  2KX6 A;  5IU1 A;  1Z6F A;  1YLJ A;  3NI9 A;  3S22 A;  4KUK A;  3D4F A;  1LL5 A;  3UB5 P;  4OPZ A;  1D1J A;  4OP5 A;  2ZM0 A;  4Y5F A;  5HX9 A;  4FCF A;  1W63 Q;  3FWL A;  4Y0U A;  2YKH A;  4BL2 A;  2VK3 A;  3VP4 A;  1D7E A;  4XT2 B;  2BG1 A;  3P98 A;  1C3B A;  2XEP A;  3SW1 A;  3FKW A;  1P9W A;  3T4J A;  1TS0 A;  4MCW A;  3ZYT A;  2HZ5 A;  1XP4 A;  3B42 A;  4O01 A;  2ZMF A;  4PAU A;  5J8X A;  4KZA A;  4YNR A;  2XRN A;  3C5A A;  3ITB A;  4GS9 A;  2Y2J A;  2Z6D A;  3CPT B;  5E2E A;  4P6Z S;  1N9L A;  4JPM A;  1JWP A;  5FQJ A;  2ZD8 A;  3GR2 A;  4RA7 A;  1DP8 A;  3WRT A;  4HI4 A;  2EWV A;  3NJA A;  3AGF A;  1K6R A;  1RP5 A;  3DWZ A;  3UDX A;  4FH2 A;  1KDS A;  4QY5 A;  3VV4 A;  3FZC A;  2RCX A;  1N4O A;  2ACG A;  2IWC A;  2JE5 A;  2H5S A;  4KZB A;  2Y8H A;  4OP8 A;  2ZM8 A;  3MZD A;  4Y13 A;  2XSS A;  4LV2 A;  4WEL A;  1IOU A;  5GLA A;  2PRF A;  1PRQ A;  1L0F A;  2O0Y A;  3CZD A;  4E3N A;  2WK0 A;  4PKY G;  4DN0 A;  2V20 A;  4MDZ A;  2J3T D;  3S7P A;  4E3M A;  2QPN A;  1KGG A;  5HZH A;  2B5R A;  3HJK A;  1LI9 A;  1TD5 A;  5CRF A;  2EX8 A;  3EOI A;  4DE0 A;  2QHK A;  1NYY A;  4L9G A;  1TS8 A;  4KQO A;  3IWI A;  4ZJ1 A;  3KO6 A;  4LEN A;  1NZO A;  4EU0 A;  2L0W A;  4MMN A;  3RXW A;  5CEC A;  3KYQ A;  5IT5 A;  3UB9 A;  2PAV P;  5EM1 A;  4P0M A;  4IUH A;  3A0V A;  4R4S A;  5IS1 A;  4DF6 A;  1DP6 A;  4E3I A;  1S1Z A;  4NK3 A;  3HUM A;  4JGR A;  5GHX A;  1OTI A;  3SH9 A;  4IBR A;  4FD8 A;  3EEA A;  4GCZ A;  3MSH A;  2ZOI A;  3N8L A;  2O9C A;  1XA7 A;  3HLG A;  3DTM A;  2CMN A;  4QY6 A;  3BLM A;  2V2F F;  4G3W A;  3BY8 A;  3NUL A;  4KQR A;  2W0N A;  4PM6 A;  5HDC A;  3UMD A;  2L4R A;  3MQQ A;  1AXB A;  1CEF A;  3NOP C;  4FOF A;  3C7U A;  5C5K A;  4ME4 A;  4LCM A;  3NDE A;  4WM9 A;  2HDS A;  3W4O A;  4P6B A;  1ZG6 A;  4R3A A;  4GS9 B;  1NY0 A;  5HL6 A;  4OON A;  1CI9 A;  4N9L A;  1XJ2 A;  4R0Q A;  2Y2N A;  4LRZ E;  4DDY A;  5E2H A;  2UWX A;  3LI8 A;  1SDN A;  1FR6 A;  4QPR A;  3FKV A;  2W3F A;  3KSI A;  5A92 A;  1WYB A;  4QB8 A;  3IHA A;  3BW6 A;  2ZBB A;  3A3F A;  2XGN A;  2EX6 A;  3A3E A;  3EQV A;  3LR4 A;  1YLY A;  5A91 A;  3T4T A;  2JC7 A;  5HD5 A;  4ARZ B;  1YAX A;  1MWT A;  3UDF A;  4HBU A;  1EW0 A;  3PAG A;  1S66 L;  1VQQ A;  4MNR A;  4PM5 A;  4CLC C;  3C8C A;  4CLC A;  1RGY A;  5KSC A;  3QP6 A;  1YMX A;  4FH4 A;  1PYY A;  2WAE A;  3NC8 A;  1YLP A;  2JKT I;  3CWF A;  5K5B A;  2ZQC A;  3VP2 A;  2ZQD A;  3WRZ A;  3ZGA B;  2DCF A;  5EV0 A;  5EOO A;  2A2L A;  2HPB A;  4E3K A;  2W1T A;  2EXA A;  5DKK A;  3BFE A;  1STZ A;  1L0G A;  3DTI A;  2VZW A;  3CMZ A;  1IYO A;  4C75 A;  3C4P A;  3IS2 B;  4OKP A;  3LIC A;  4R3J A;  5M18 A;  2EWW A;  4N1H A;  3MXQ A;  2ZC6 B;  2H0Y A;  3QP8 A;  2ZC5 B;  1JVJ A;  3O3V A;  2E8J A;  4KZ8 A;  4DXC A;  1TF1 A;  3VOZ A;  4X69 A;  4KZ6 A;  3VMA A;  2P74 A;  2VV8 A;  1RCJ A;  3IHB A;  2P9V A;  5AQ7 A;  2UV0 E;  2XH9 A;  3GSG A;  5BOH A;  5EVE A;  2M7V A;  4DE1 A;  1YSP A;  3T4K A;  3C4O A;  5M1A A;  1KDW A;  5GLC A;  3U2A A;  1O07 A;  1FCN A;  4JXG A;  3M2J A;  4MBH A;  1OME A;  3VP0 A;  1T1A A;  1YKD A;  4Y0T A;  3UNW A;  5F68 A;  2BAS A;  3T1S A;  2J8Y A;  3GQZ A;  3PYP A;  3W2Z A;  4K08 A;  4KG5 A;  2PBD P;  3E98 A;  5A90 A;  5FI7 A;  2PDR A;  3GDI A;  2VV7 A;  4IHQ A;  2BLS A;  4QD4 A;  3VOY A;  2O99 A;  3VFF A;  3T4O A;  3KSH A;  1BZA A;  1FSY A;  4JF5 A;  3ZNT A;  3TRC A;  4UHU A;  4Y3I A;  1BT5 A;  1PZP A;  2ZL1 A;  1XPB A;  3T4S A;  4OPR A;  2VKS A;  2JKR M;  3SOI A;  2PD8 A;  4XUX A;  1E25 A;  1MC0 A;  2XF3 A;  1VB6 A;  5F69 A;  1ES4 A;  4LV3 A;  2QJ5 A;  3LY3 A;  1VHM A;  2XD5 A;  4X68 A;  1QME A;  4EWF A;  4WEK A;  3PTE A;  1I5Q A;  3E2L A;  4QHC A;  1YMS A;  5DKL A;  1FIK A;  4PM8 A;  2C6W B;  1F98 A;  3KYE A;  3K3C A;  4K91 A;  5TR7 A;  2J3T C;  1M40 A;  3LGO A;  1MWS A;  2W1T B;  2XA7 M;  3LR0 A;  3ULF A;  1GSX A;  2Y4A A;  2MJ6 A;  4NXE A;  1A0K A;  2GZA A;  5FAP A;  3E4P A;  1TS7 A;  3AGE A;  2PD7 A;  4R3B A;  2WYX A;  4B4X A;  4E6W A;  4JGO A;  3ZG7 B;  3K2N A;  3LYX A;  3MXS A;  2PU4 A;  2WAD A;  2JKG A;  4RVA A;  4OOM A;  4LFU A;  4JKT A;  1DJC A;  4OLG A;  3SZT A;  3ZG5 A;  3HLC A;  3LI9 A;  1AWI A;  1TVF A;  5DF8 A;  2Z2M B;  1CEG A;  2YKF A;  1ES2 A;  2Y2M A;  4EEP A;  5CER A;  1NJ4 A;  1G6A A;  5CGS A;  2P9V B;  1U60 A;  1ESU A;  3OC2 A;  4R70 A;  5CTN A;  1GHM A;  3D3O A;  5EVL A;  1K56 D;  3JYI A;  3LY4 A;  3OZH A;  3V3S A;  3IX4 A;  4Y15 A;  2AVX A;  1ONH A;  2WKR A;  1E3U A;  4DDS A;  5G4Y A;  3O87 A;  2G2U A;  1PFL A;  4U0X A;  1WYC A;  4PKY A;  3ZHH A;  3MFX A;  4WMC D;  1BTL A;  1VET A;  3V3R A;  3B3X A;  3ZNY A;  1K4F A;  3F1P B;  2A49 A;  2Y2G A;  1LL8 A;  1L3L A;  3IBJ A;  4P87 A;  2JHE A;  3RTY A;  3BFF A;  4R23 A;  2QKP A;  2VJW A;  1ZKJ A;  4D2O A;  3QP2 A;  1YPR A;  1OTB A;  2ZL1 B;  3QP5 A;  5E2G A;  3ISG A;  1E4D A;  4GZB A;  1YT4 A;  3V39 A;  5J7E A;  1N9B A;  3GMW A;  2WUQ A;  1BLC A;  5FAT A;  4ZJ3 A;  3V5M A;  3PAE A;  4LCL A;  5G18 A;  2ZC4 B;  2VX8 A;  2X71 A;  3ZCZ A;  4DE2 A;  2Y79 A;  4QU3 A;  4UQI M;  1JWV A;  1GHI A;  4K0W A;  3T1Q B;  3WWX A;  3QP4 A;  4KZ5 A;  2DMW A;  4E6X A;  5M19 A;  4MEZ A;  5HAP A;  1HD8 A;  3TG9 A;  1G68 A;  4E3O A;  4WL9 A;  2HJE A;  3SH7 A;  3E4O A;  2IWB A;  3HUO A;  3NEC A;  4FUW A;  4CPK A;  1LL9 A;  3S4X A;  2E8I A;  2VGJ A;  4G3V A;  4OH0 A;  2WAF A;  5J4E A;  1PIO A;  1ES3 A;  4JXW A;  1S0W A;  4Y0O A;  4HJ3 A;  4BEN A;  2OSU A;  4CQH A;  3NDG A;  3M6B A;  3GEC A;  4GB7 A;  5DVA A;  4QJG A;  2RL3 A;  3MQO A;  2XD1 A;  2ZMV A;  4B88 A;  2WZX A;  3BLS A;  4BQM A;  3Q7Z A;  3IBR A;  5EOE A;  1XXM A;  4S2M A;  4Q0H A;  3T4L A;  5FQ9 A;  3HUN A;  4ID4 A;  4GKU A;  2VGL M;  5FAQ A;  4LLO B;  3LIA A;  3G2Y A;  4BBU A;  1CQA A;  3EGX C;  5FQK A;  1S4R A;  3O5Y A;  1MPL A;  3WS5 A;  5HPI A;  3OPR A;  1MBL A;  4S2N C;  4DKI A;  2Q9N A;  5KZH A;  2KLI A;  3M2K A;  2H0T A;  3O88 A;  5CHJ A;  1OJ5 A;  3T50 A;  1ERQ A;  3IF6 B;  4WF0 A;  1KGE A;  2Y59 A;  3UPO A;  4NEE D;  1FR1 A;  2XRO A;  3N4I A;  5GHY A;  5E2F A;  2X02 A;  5FI6 A;  2M1C A;  3SH8 A;  1G5U A;  5F82 A;  3IWO A;  4E04 A;  1VET B;  5TGF A;  4ZJ2 A;  1DJA A;  3OBF A;  5FEF A;  2J9O A;  2D01 A;  3ZG9 B;  1N9O A;  3IXG A;  2ZQ8 A;  5J3W A;  3BJN A;  4UAA A;  5FDS A;  2Y2P A;  4B9O A;  2JKR I;  4HEF A;  2HDU A;  3MF0 A;  4HH2 A;  3LR5 A;  1LSX A;  3FG8 A;  3FPV A;  5HAR A;  1UGU A;  1CF0 A;  4BWI A;  2XR0 A;  2DNS A;  3UY6 A;  4GDN A;  3GV9 A;  4Z9Q A;  4BD0 A;  3SS3 A;  3BWL A;  2A24 A;  1XJ4 A;  4E3L A;  2NUP C;  3K3D A;  2Y91 A;  3OOV A;  5DFX A;  4Q8I A;  4BBT A;  4HES A;  4X25 A;  4X55 A;  1GSW A;  1XGJ A;  3BQ8 A;  1SKO A;  3G2Z A;  5EUA A;  1TDG A;  4JLF A;  4IVK A;  3A0S A;  1RGZ A;  1K0K A;  4YOF A;  2W3E A;  4GD8 A;  3OLO A;  3CLO A;  2I9V A;  3CG5 A;  4BD1 A;  4L9F A;  4E3J A;  1FSW A;  5TFQ A;  1H5X A;  4ETX A;  1XX2 A;  2Q0O A;  3A3J A;  4WEJ A;  4GLQ A;  1K55 C;  2R9W A;  4S2J A;  3NCK A;  1K55 A;  2JN7 A;  3KSG A;  4EQ1 A;  1XFQ A;  4OPY A;  4GOG A;  1Y4O A;  4X56 A;  2D02 A;  1YLW A;  1J3W A;  3HBR A;  1IEM A;  2J7V A;  4HP9 A;  4S2K A;  4CJN A;  2BTF P;  4R4R A;  1L0D A;  3TSG A;  4YIN A;  4OQI A;  5CX7 A;  5HPF A;  2QWS A;  1Y28 A;  2XDM A;  1ONG A;  2V9A A;  3JVU A;  3ZDJ A;  3EQU A;  3N7W A;  1W7F A;  4Q0J A;  3G34 A;  4PPR A;  2JCH A;  3PBS A;  4N92 A;  3RXX A;  1H3Q A;  3TJZ C;  1MZU A;  2X01 A;  3IXB A;  1K4E A;  3ZG0 A;  2EX9 A;  2K7S A;  4WMC A;  4RYE A;  1S67 L;  5GHZ A;  2KOI A;  2WKH A;  5CHU A;  3CUE C;  3CUE A;  4XUZ A;  1BLS A;  1Y54 A;  4X1M A;  1T19 A;  2JBF A;  1XJ6 A;  4I3I A;  5F6A A;  3W4Q A;  3RJU A;  1SDE A;  1IYS A;  4EUZ A;  1JTG A;  3G6O A;  4L9E A;  2FFY A;  3UB8 A;  3G30 A;  2WGI A;  4R6L A;  5TBM A;  1SCW A;  4WZ4 A;  2J3W A;  4Q0I A;  2B95 A;  2HP6 A;  2WGW A;  2WKI A;  4BL3 A;  2A24 B;  2M7U A;  2EX2 A;  4JF6 A;  5I5L A;  1SHV A;  3H9W A;  4ZBE A;  3G4P A;  5EM0 A;  1M6K A;  5AJG A;  3WS2 A;  1PW1 A;  2XA7 S;  1SKO B;  3HLB A;  2LB9 A;  3UPP A;  1BLH A;  3PXP A;  2H10 A;  3VOL A;  1NZU A;  3KSF A;  2VA0 A;  1G28 A;  1SKF A;  3S7O A;  2W3H A;  4BMW A;  5FQM A;  3UDI A;  5HL1 A;  4BBV A;  3OCL A;  2B02 A;  4HJ4 A;  3N8S A;  1GA9 A;  4MBK A;  4EW7 A;  4LV1 A;  4DJ2 A;  4EUV A;  1H8M A;  3Q82 A;  3SS4 A;  3VSK A;  2Z2L B;  1FQG A;  4GHI A;  2FZ0 A;  3VE3 A;  2XK1 A;  3F1O A;  1KOU A;  1UWP X;  5A93 A;  4QWO A;  1PI4 A;  2J9P A;  3CIT A;  3VFH A;  4CLC E;  4EQI A;  3A0R A;  3P7N A;  4EER A;  1VEU A;  2ZOH A;  5HWV A;  4CLC B;  4HJ6 A;  3QP1 A;  5HW3 A;  1KVL A;  2ZQ7 A;  5HAQ A;  1PW8 A;  3HLF A;  1W79 A;  3CAX A;  1ERM A;  2DRW A;  3IXD A;  3FV7 A;  1ZTU A;  5AQB A;  5FQQ A;  4FSF A;  3EWK A;  5L09 A;  2W1R A;  2HV1 A;  3UE0 A;  4DRT A;  2QYB A;  5AVF A;  1L0E A;  3FC7 A;  1LT0 A;  4NG2 A;  1NLZ A;  1MXO A;  3C7V A;  2PYP A;  1OPX A;  3L9K A;  3P01 A;  1ES5 A;  1K57 C;  3BEC A;  1T18 A;  1K57 A;  3VE4 A;  1ZG4 A;  3OPP A;  3V67 A;  3H82 A;  2C5W B;  4I3J A;  4A5R A;  3F1N A;  1F9I A;  4DXB A;  5FSR A;  5L07 A;  2R9X A;  3GTC A;  1NYM A;  4Z1W A;  3T1R A;  2QZ6 A;  4WLA A;  4Y2F A;  4G3K A;  3LEQ A;  2GX5 A;  2LB5 A;  5CGX A;  3MR0 A;  1BUE A;  4KG6 A;  4UQI S;  3H7W A;  4O0P A;  5TBM B;  3IX8 A;  3BFG A;  3MXR A;  1VM1 A;  2OOL A;  1CI8 A;  2WGW B;  2ZLY A;  3B33 A;  3DTK A;  3EEH A;  3DWK A;  1ESI A;  1SZV A;  3T4Q A;  4HBT A;  4X1L A;  5FAO A;  4OQH A;  4EBN A;  1IYP A;  4GD6 A;  1DRM A;  3LUQ A;  1K38 A;  5AVE A;  1H0M A;  3C30 A;  3C2W A;  2CC1 A;  3BRM A;  2Q9M A;  1K6S A;  2VLG A;  2V0U A;  4R38 A;  1IEL A;  4UA9 A;  4GJ4 A;  2GDN A;  4EXO A;  2WGV A;  4GN2 A;  4LRY C;  3V50 A;  3D9Y A;  1G6O A;  2OLV A;  4O7D A;  2ZMA A;  4HH3 A;  3LR3 A;  3CJM A;  2V1Z A;  4NXF A;  1ODV A;  4B93 A;  3BQA A;  1GHP A;  4N9K A;  2WKE A;  1LSW A;  1KE0 A;  3GRJ A;  4OQG A;  4WN5 A;  2ZQA A;  3HRE A;  1GCE A;  4GHI B;  4PM9 A;  4K0X A;  2WZZ A;  4HQA A;  1ZC2 A;  3F1O B;  5EPH A;  1X0O A;  1MWR A;  2KDK A;  2IA2 A;  3NIA A;  3UN7 A;  1ZHH B;  4F94 A;  1YSQ A;  1DJB A;  3OPH A;  3UME A;  5HD3 A;  3KX0 X;  1VEU B;  3E2K A;  4EET B;  3NOT C;  1V9Z A;  1P9R A;  3D72 A;  3FPW A;  5L2F A;  3PBQ A;  2OAQ 1;  2J80 A;  2HDR A;  1PI5 A;  4I3A A;  5EVI D;  5HWW A;  5FAS A;  5GLB A;  3BFC A;  4ETZ A;  5F1G A;  1NRJ A;  1I2S A;  3C38 A;  3S7Q A;  1MWU A;  5EFW A;  4WYY A;  3NOU C;  3VP3 A;  3ZQ5 A;  2Y2I A;  3LID A;  5FDH A;  4RX3 A;  2NUT C;  2XLN A;  2EXB A;  1TS6 A;  1TEM A;  1BYW A;  2ZJ9 A;  3UE6 A;  4YFM A;  1GSV A;  3H82 B;  3F1N B;  4HHD A;  3JPU A;  2IWD A;  5FI2 A;  3BEB A;  4MLL A;  3IT9 A;  3Q7V A;  1PWC A;  1LHY A;  1PWG A;  5HFO A;  3E0Y A;  4KZ9 A;  1BUL A;  1NLY A;  4S2L A;  3A3I A;  2INW A;  3PBT A;  4NXB A;  4DJ3 A;  4ARZ A;  3H7W B;  4S2N A;  4LRX C;  1OTA A;  5I94 A;  3QNB A;  1W8Q A;  2P7J A;  1ACF A;  1F2K A;  4U3T A;  4GNU A;  3HLW A;  1DY6 A;  4OOY A;  1NXY A;  3UO9 A;  1OT6 A;  5TJJ A;  2A3U A;  1XFN A;  4Y17 A;  5A8B A;  5CTM A;  2Y2K A;  3NBL A;  3UE1 A;  2PR6 A;  3IS2 A;  3HLD A;  4GW9 A;  4PHT A;  2FFF B;  4P6Z M;  4AFI A;  2PU2 A;  1CK3 A;  3T1X A;  1JWZ A;  3JVV A;  3PR6 A;  4UA6 A;  4ZTK A;  1DP9 A;  4ZRR A;  3T12 B;  3Q07 A;  2PR5 A;  3DAV A;  2V8F A;  5CHM A;  1OTE A;  3WS0 A;  1FOF A;  4XXR A;  1K54 C;  4HOI A;  1K54 A;  4KZ3 A;  4RX2 A;  5CXW A;  5CED A;  3BFD A;  3IH8 A;  1JTD A;  4IUK A;  5CEB A;  3FYZ A;  3IWQ A;  4HY8 A;  2P04 A;  4LV0 A;  4LGW A;  1EI5 A;  3TOI A;  4O8G A;  1NWZ A;  3O86 A;  2EFX A;  2ZQ9 A;  5L10 A;  4ESP A;  5HDS A;  3HVF A;  1W5D A;  3Q1F A;  5F5Y A;  1E3U D;  2QMI A;  4N1X A;  1O7E A;  3NHQ A;  4L0L A;  5JYP A;  4JGP A;  3S7N A;  3LIE A;  3CHW P;  3R7W A;  4RQ9 A;  1N9N A;  1H8Z A;  3DTE A;  1GA0 A;  2Y55 A;  1Q2Q A;  3WS4 A;  5HSQ A;  3PBR A;  1YLZ A;  1JNU A;  2O9B A;  5FEG A;  4WZ5 C;  3QNC A;  2HP9 A;  4WZ5 A;  2XFS A;  3W8K A;  3MS6 A;  4F3L A;  5EE8 A;  1XGI A;  4ZDX A;  3MBZ A;  1PZO A;  2WKQ A;  1IKI A;  3Q7V B;  4KQQ A;  5MC7 A;  1LSV A;  2V0W A;  1KE4 A;  5AQ9 A;  3VSL A;  1LLB A;  2W27 A;  4OPQ A;  1LI0 A;  1CJF A;  5DJT A;  1K56 A;  1D06 A;  4I38 A;  4HIA A;  4MBF A;  2PYR A;  5HDD A;  4JXS A;  5F1F A;  4M3K A;  3IQA A;  4EBP A;  3W4P A;  2EA9 A;  4UA7 A;  3M6H A;  4ZAM A;  1UWN X;  1WE4 A;  4OQ0 A;  3HCY A;  4HP4 A;  1EWZ A;  2HGV A;  3MFD A;  2PHY A;  1Q2P A;  3MZE A;  4M4X A;  3LCE A;  5DFY A;  4YWZ A;  3VP1 A;  4Y7P A;  4PM7 A;  2EFU A;  4KUO A;  4H8R A;  4JGQ A;  3G31 A;  2I72 A;  1NRF A;  3EGD C;  3BM6 A;  3NY4 A;  1TDL A;  5GL9 A;  2WKP A;  3UE3 A;  2P08 A;  2V1B A;  4IED A;  1YLT A;  4DE3 A;  4II7 A;  2HDQ A;  3OCN A;  5KMW A;  4NXG A;  3B47 A;  1FCM A;  3ICY A;  5F83 A;  1Z09 A;  3TE8 A;  4U0T A;  3LO7 A;  3G32 A;  3IXH A;  4B4Z A;  3G35 A;  3L7H A;  5D3O A;  3BY9 A;  1W8Y A;  2OWH A;  5EVI C;  4LPZ A;  5EVI A;  4P85 A;  3LFV A;  4MN7 A;  2Y2O A;  1H8Y A; 
#chains in the Genus database with same CATH homology
 3HJI A;  4R3A A;  4Q0H A;  4GS9 B;  3T4L A;  5HL6 A;  2L1M A;  1XJ2 A;  2OOL A;  3PBO A;  2VGL M;  3B33 A;  4H6J A;  3LIA A;  3CI6 A;  4LLO B;  4LRZ E;  5DJU A;  4BBU A;  3EEH A;  2H28 A;  2HJ9 C;  3T4Q A;  4OOL A;  3EGX C;  3LI8 A;  4BJP A;  3LIF A;  4QPR A;  2W3D A;  1S4R A;  1IFQ A;  2W3F A;  3KSI A;  3O5Y A;  4EES A;  2GJ3 A;  1DRM A;  3LUQ A;  3E4Q A;  3R7W B;  5AVE A;  5HPI A;  3BW6 A;  3C30 A;  2W3G A;  2ZBB A;  3C2W A;  3F1P A;  2G7U A;  2VLG A;  2V0U A;  2KLI A;  3EQV A;  2FH5 A;  3LR4 A;  2HF6 A;  4R38 A;  3T4T A;  5HD5 A;  4GJ4 A;  4ARZ B;  4EXO A;  1YAX A;  5FL3 A;  1OJ5 A;  3PBN A;  3T50 A;  1EW0 A;  4LRY C;  1OT9 A;  1S66 L;  1F5M A;  1G6O A;  4WF0 A;  4CLC C;  4F3L B;  3C8C A;  4CLC A;  4HH3 A;  4NEE D;  3LR3 A;  4NXF A;  4MN5 A;  1ODV A;  5HWT A;  4WUJ A;  2VV6 A;  4B93 A;  2R78 A;  2XRO A;  3BQA A;  2JKT I;  1LSW A;  3CWF A;  1S1Y A;  5K5B A;  2QJ7 A;  4WN5 A;  2M1C A;  4GHI B;  4KQD A;  4HQA A;  4E04 A;  3RFB A;  2A2L A;  3F1O B;  1X0O A;  2KDK A;  3TW8 A;  2W1T A;  4IJG A;  5DKK A;  3OBF A;  2IA2 A;  5L8M A;  4XT2 A;  1ZHH B;  5DF9 A;  1YSQ A;  4NKP A;  1STZ A;  3UME A;  2D01 A;  2VZW A;  5HD3 A;  1N9O A;  5J3W A;  3BJN A;  1T1B A;  3KX0 X;  1OTD A;  4B9O A;  2GNX A;  2JKR I;  3IS2 B;  1S4S A;  3LIC A;  4EET B;  3NOT C;  1WA9 A;  2K31 A;  3MF0 A;  4HH2 A;  2EWW A;  3LR5 A;  1LSX A;  5KSH A;  1V9Z A;  3FPV A;  3FG8 A;  1P9R A;  3D72 A;  3FPW A;  3PBQ A;  1UGU A;  3MXQ A;  2OAQ 1;  2PT7 A;  3DBA A;  2J80 A;  4I3A A;  5HWW A;  4BWI A;  1TF1 A;  4UEY A;  4ETZ A;  1NRJ A;  3C38 A;  3S7Q A;  3BWL A;  5KIZ A;  2A24 A;  1W63 M;  1XJ4 A;  5EFW A;  3NOU C;  1XJ3 A;  3R4K A;  4DMZ A;  2VV8 A;  3ZQ5 A;  2NUP C;  3K3D A;  1P0Z A;  3OOV A;  5DFX A;  3LID A;  4BBT A;  1GSW A;  2K2N A;  3BQ8 A;  2Z6C A;  2NUT C;  3LIB A;  2M7V A;  1TS6 A;  1YSP A;  3A0S A;  1BYW A;  3UE6 A;  3T4K A;  3PHY A;  3MJQ A;  3U2A A;  1GSV A;  4YOF A;  3H82 B;  2W3E A;  3OLO A;  3CLO A;  3F1N B;  4MN6 A;  4HHD A;  1MKM A;  4I5S A;  4HNB A;  1T1A A;  2I9V A;  3RH8 B;  4L9F A;  4CLC D;  3UB7 A;  1YKD A;  5LBR A;  3UB6 A;  5F68 A;  1V9Y A;  2BAS A;  3PYP A;  3W2Z A;  4K08 A;  5G4Z A;  2JKT M;  4ETX A;  3E0Y A;  2VEA A;  3E98 A;  4WEJ A;  4GLQ A;  2PDR A;  3GDI A;  2VV7 A;  1NLY A;  4IHQ A;  2JN7 A;  1T1C A;  2INW A;  3KSG A;  3PBT A;  4NXB A;  4DJ3 A;  3MMH A;  4EQ1 A;  4ARZ A;  2O99 A;  1XFQ A;  3T4O A;  3H7W B;  3KSH A;  4LRX C;  1OTA A;  2D02 A;  3TRC A;  4Y3I A;  2OWJ A;  1P97 A;  4H6J B;  2P7J A;  2OAP 1;  4EEU A;  3T4S A;  4HP9 A;  2VKS A;  2JKR M;  2O9A A;  1OJG A;  3KYZ A;  2PD8 A;  5CX7 A;  2B18 A;  5HPF A;  2QWS A;  1Y28 A;  1MC0 A;  1OT6 A;  1VB6 A;  2V1A A;  2V9A A;  5F69 A;  5TJJ A;  3JVU A;  4I39 A;  1XFN A;  2QJ5 A;  3MQ0 A;  3EQU A;  2VGL S;  5A8B A;  4Q0J A;  1VHM A;  2KX6 A;  3PBS A;  5IU1 A;  2PR6 A;  3IS2 A;  4GW9 A;  1H3Q A;  4KUK A;  4PHT A;  4WEK A;  3TJZ C;  1MZU A;  5DKL A;  4P6Z M;  4AFI A;  1F98 A;  4Y5F A;  2K7S A;  3K3C A;  3JVV A;  2J3T C;  3PR6 A;  1DP9 A;  4ZRR A;  1W63 Q;  1S67 L;  2YKH A;  2PR5 A;  2W1T B;  2KOI A;  2XA7 M;  1D7E A;  4XT2 B;  3CUE C;  1OTE A;  3LR0 A;  3CUE A;  1T19 A;  3ULF A;  4HOI A;  3SW1 A;  1GSX A;  1XJ6 A;  1P9W A;  4I3I A;  2MJ6 A;  3T4J A;  1TS0 A;  4MCW A;  5F6A A;  4NXE A;  2GZA A;  3ZYT A;  3E4P A;  1TS7 A;  4IUK A;  2PD7 A;  4HY8 A;  3G6O A;  3B42 A;  2P04 A;  4JGO A;  4L9E A;  2ZMF A;  4O01 A;  3UB8 A;  4PAU A;  3K2N A;  3LYX A;  4O8G A;  1NWZ A;  5TBM A;  4R6L A;  4YNR A;  2XRN A;  4OOM A;  4GS9 A;  2J3W A;  4Q0I A;  5HDS A;  2Z6D A;  3LI9 A;  2A24 B;  4P6Z S;  1N9L A;  2M7U A;  5F5Y A;  2YKF A;  5I5L A;  3H9W A;  4EEP A;  1DP8 A;  3NHQ A;  4L0L A;  4HI4 A;  2EWV A;  5AJG A;  3NJA A;  4JGP A;  3S7N A;  3LIE A;  3OC2 A;  3R7W A;  4RQ9 A;  1N9N A;  2XA7 S;  2LB9 A;  4R70 A;  3PXP A;  3D3O A;  3VOL A;  3KSF A;  2VA0 A;  1G28 A;  5HSQ A;  3PBR A;  3S7O A;  3VV4 A;  1JNU A;  2O9B A;  2W3H A;  4BMW A;  4BBV A;  3OCL A;  2B02 A;  4F3L A;  2Y8H A;  2WKR A;  4HJ4 A;  4EW7 A;  5G4Y A;  4DJ2 A;  2XSS A;  4EUV A;  2WKQ A;  4WEL A;  1IOU A;  1H8M A;  5MC7 A;  2O0Y A;  1LSV A;  4GHI A;  2V0W A;  2FZ0 A;  4PKY A;  4PKY G;  3MFX A;  3VE3 A;  2W27 A;  3F1O A;  4DN0 A;  1KOU A;  1UWP X;  4MDZ A;  3F1P B;  2J3T D;  3S7P A;  5DJT A;  1D06 A;  1LL8 A;  4I38 A;  3CIT A;  4HIA A;  3IBJ A;  5HZH A;  2JHE A;  4CLC E;  3RTY A;  3HJK A;  2QKP A;  2VJW A;  1TD5 A;  3A0R A;  2PYR A;  3P7N A;  5HDD A;  4EER A;  2ZOH A;  1OTB A;  5HWV A;  4CLC B;  4HJ6 A;  2EA9 A;  3EOI A;  1UWN X;  2QHK A;  4L9G A;  3HCY A;  4HP4 A;  1TS8 A;  5J7E A;  4KQO A;  2HGV A;  3KO6 A;  2PHY A;  3CAX A;  4EU0 A;  4M4X A;  2L0W A;  4MMN A;  5DFY A;  4YWZ A;  5TBM B;  3KYQ A;  5IT5 A;  3UB9 A;  1ZTU A;  4FSF A;  3EWK A;  4IUH A;  3A0V A;  2VX8 A;  5IS1 A;  4KUO A;  4JGQ A;  2Y79 A;  2W1R A;  2HV1 A;  1DP6 A;  4UQI M;  1S1Z A;  2QYB A;  5AVF A;  4JGR A;  1OTI A;  2DMW A;  3FC7 A;  3EGD C;  1LT0 A;  3EEA A;  4GCZ A;  1NLZ A;  2WKP A;  2ZOI A;  2PYP A;  3UE3 A;  2P08 A;  2V1B A;  1OPX A;  3P01 A;  2O9C A;  1T18 A;  3VE4 A;  4WL9 A;  4II7 A;  2HJE A;  3OCN A;  4NXG A;  3B47 A;  3E4O A;  3ICY A;  3V67 A;  2CMN A;  3H82 A;  4I3J A;  3F1N A;  1F9I A;  4G3W A;  3BY8 A;  4Z1W A;  3TE8 A;  4G3V A;  4WLA A;  4Y2F A;  2W0N A;  5J4E A;  4G3K A;  5HDC A;  3UMD A;  2L4R A;  3MQQ A;  4HJ3 A;  3NOP C;  2GX5 A;  4FOF A;  4CQH A;  3BY9 A;  3GEC A;  2LB5 A;  5C5K A;  3MR0 A;  2OWH A;  4ME4 A;  3MQO A;  2ZMV A;  4LPZ A;  3LFV A;  4UQI S;  3IBR A;  4MN7 A;  3H7W A;  4O0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...