1XJ3A

Bjfixlh in unliganded ferrous form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
b'DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
molecule tags Signaling protein, transferase
source organism Bradyrhizobium japonicum
publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
total genus 29
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj3A00
4NXFA 4RQ9A 3P7NA 4I39A 3RH8B 2GJ3A 2OWHA 3LI9A 2L4RA 1V9ZA 5F5YA 3LIFA 1F9IA 2VLGA 1GSXA 5HWWA 3BWLA 1N9NA 4LRYC 2VV6A 3FG8A 1LT0A 2L0WA 3GECA 4HH2A 5IU1A 3F1OA 2H28A 3F1NB 1T1CA 1DP9A 2L1MA 2OOLA 1X0OA 5F6AA 3UB8A 2K7SA 2QHKA 3LIEA 4I3JA 3CLOA 1OT9A 3LI8A 4BBVA 1P97A 3UMEA 1Y28A 4EETB 3A0VA 2BASA 4HQAA 4WUJA 4HHDA 1KOUA 1LSXA 3LUQA 2QJ5A 3E4QA 3HJKA 5HDSA 1XJ4A 1S1ZA 1TS6A 3VE4A 3E4PA 1OTAA 3KX0X 4HY8A 4GW9A 1S4RA 4K08A 1OT6A 3NHQA 4I3IA 2WKRA 1S4SA 5HD3A 1LL8A 2QKPA 5TBMA 3T50A 4DJ2A 3SW1A 3ICYA 3MJQA 3BY9A 3H9WA 4I38A 4WF0A 2OWJA 1OTDA 1OTEA 2PD7A 5J3WA 1XFQA 5TBMB 3VE3A 3E4OA 4EW7A 5KIZA 2ZBBA 2D02A 3A0SA 4NXEA 1TS8A 4EERA 4EEPA 4LPZA 1GSWA 4EEUA 1XJ6A 4GHIB 4EQ1A 2JN7A 3G6OA 2A24A 2M1CA 4YWZA 3B33A 4LLOB 4WL9A 4E04A 1N9OA 3IBRA 4F3LA 3F1NA 4KUOA 3LIAA 5HSQA 2KX6A 2PYRA 2D01A 3K3CA 1UWNX 4KUKA 5HD5A 3PYPA 2INWA 4L9FA 4BBTA 3NOUC 1ODVA 1UGUA 1P0ZA 4HP9A 5HDDA 1T19A 2PD8A 3UE6A 3OLOA 2VV8A 4LRXC 2YKHA 2J80A 1S1YA 2PDRA 3EWKA 4I3AA 4R70A 3EEHA 4HH3A 5J4EA 2WKPA 3VOLA 1WA9A 3MQQA 4M4XA 1VB6A 2PR6A 2V1AA 3HJIA 3MR0A 4I5SA 4JGOA 3MFXA 4XT2A 4WN5A 2W27A 3PHYA 4L9GA 1GSVA 2V0UA 2W0NA 4NXGA 4PKYA 4EXOA 5DKLA 4XT2B 5HWVA 2PR5A 4MN6A 1D7EA 3LIDA 4DJ3A 3A0RA 3IS2A 3RTYA 2VV7A 1DRMA 4HJ4A 4PKYG 2ZOIA 4LRZE 1TS0A 1UWPX 3F1OB 1S67L 3H7WB 5IS1A 2VEAA 5EFWA 1MZUA 4HJ3A 1OTIA 1EW0A 1D06A 1NWZA 1OJGA 3C8CA 5AVFA 1T1BA 1XJ3A 2A24B 4JGPA 4BBUA 4R6LA 3UB6A 5AVEA 3UMDA 2Z6CA 3ZQ5A 3H82B 3CAXA 2CMNA 5DJTA 3NOTC 1BYWA 1N9LA 3IS2B 3LICA 4HI4A 3UB9A 5DJUA 1T18A 2PHYA 3MXQA 1DP8A 5HDCA 1LSWA 5HWTA 5A8BA 1V9YA 1XJ2A 2V0WA 3UB7A 2KDKA 3H82A 4EESA 3K3DA 3FC7A 3NJAA 2HV1A 4JGQA 4HNBA 4JGRA 4GS9A 4WLAA 1DP6A 2I9VA 3D72A 4B9OA 2QJ7A 1OTBA 2EA9A 3MQOA 2Z6DA 1F98A 5DKKA 5G4YA 4GCZA 3H7WA 3C2WA 3F1PB 1OJ5A 1S66L 5I5LA 1LSVA 5J7EA 3F1PA 4KQDA 4F3LB 2JHEA 3LYXA 4HJ6A 4HOIA 5F68A 2WKQA 2YKFA 4MN5A 4R3AA 5HZHA 4HIAA 2PYPA 1XFNA 4L9EA 5F69A 1JNUA 1G28A 2QWSA 4GS9B 3ULFA 3BY8A 3NOPC 4HP4A 4H6JA 3CWFA 2P7JA 4GHIA 4R38A 4NXBA 5G4ZA 4H6JB 2B02A 1TS7A 2ZOHA 3LIBA 3GDIA 2V1BA 2V9AA 1T1AA 2R78A
chains in the Genus database with same CATH superfamily
5FL3A 3P7NA 5A93A 5GHXA 2OWHA 1V9ZA 5KSHA 3E0YA 5FQ9A 4H8RA 3MXRA 3F1OA 3MSHA 4LGWA 2L1MA 3LO7A 1ZC2A 4QWOA 1XA1A 1ACFA 1K0KA 5JYPA 2QJ5A 3D9YA 2ZQCA 4WELA 2V1ZA 3WRZA 2HF6A 2PD7A 3TSGA 1XFQA 2VX8A 2IWBA 4QD4A 3A0SA 1TS8A 1K6RA 2ZM0A 2R9WA 4GB7A 4KZ9A 1MWRA 2ZM2A 1HD8A 3C30A 4EBLA 3JVVA 2WGIA 4WM9A 1CJFA 4OPQA 3QHYA 4WZ4A 3VOZA 4F94A 5FA7A 3HL9A 3CZDA 2Y2NA 2XDMA 2Q0OA 4OP5A 2B18A 2Y2OA 5FATA 4MBFA 1BLSA 1KVLA 4ID4A 3T4OA 1EW0A 2XR0A 1OJGA 1T1BA 1CI9A 2IWDA 3KYQA 5DJUA 1T18A 1KDSA 1H8MA 1V9YA 2C5WB 3ITBA 4FCFA 4WEKA 2Y2JA 4WLAA 1YSQA 2RL3A 2EA9A 4IJGA 2VGKA 3IWQA 5EVLA 3M2JA 2YKFA 3BYDA 2P7JA 4C6YA 4NXBA 4H6JB 3UE1A 2B02A 1TS7A 2QPNA 1PZOA 5HWWA 1BULA 1CQAA 3UDFA 4QB8A 1Y54A 3CG5A 1OT9A 2G2WA 4EETB 1YKDA 3EGDC 5GHYA 1NRJA 3OC2A 1JTGA 4ZRRA 2WKRA 3BECA 1YT4A 1W63M 4JPMA 4YWZA 1O7EA 3W4OA 2WZZA 2VGLM 1P0ZA 2Y4AA 1SKFA 4R3JA 4HH3A 4OKPA 3VSKA 1WA9A 3SH8A 4I5SA 4JGOA 4ME4A 1YMXA 2W27A 4KZ5A 1XGJA 3PBQA 4E3KA 2HP6A 4GN2A 5EOEA 5D3OA 1STZA 4GOGA 5FQQA 1ERMA 4LV0A 2Y2IA 3Q1FA 1YQSA 1ES3A 4WYYA 4NETA 4Y17A 5TJJA 3UB6A 3LGOA 5AJGA 1VETB 2QMIA 4R0QA 2W3DA 2LB5A 4JGRA 4UHUA 3D72A 2OSUA 3UB5P 3WS1A 4KQRA 1OJ5A 2OAP1 5J7EA 2M7VA 1I5QA 4Z1WA 2QYBA 2UWXA 4H6JA 3UPOA 5EOOA 2P9VB 1PYYA 1ZKJA 2ZQDA 4Q0IA 3GDIA 3LY3A 4KZ6A 4ARZB 1VETA 3WS5A 4DE3A 3WS2A 3GECA 4B4ZA 3C7VA 1T1CA 2OOLA 2OLVA 2K7SA 3R4KA 4NG2A 3V50A 3OCNA 5GLAA 3V5MA 3HJKA 4GW9A 3ICYA 4R4SA 5KMWA 3PBRA 2FFFB 3EQVA 5GLCA 5J3WA 1OTEA 3B47A 1D1JA 2XLNA 4LV2A 3FKWA 4CLCB 4GHIB 1YLWA 2R9XA 5L8MA 3O87A 1MXOA 2PYRA 2J7VA 2Y2GA 4RA7A 1E4DA 3PR6A 5DF7A 3UE6A 3OLOA 3W4PA 4X1LA 4R70A 4E3MA 1FOFA 3L7HA 3DTEA 4Y2FA 3PHYA 3CMZA 1ONGA 1TF1A 2V0UA 4KENB 4MN6A 2VA0A 1TS0A 1G6OA 3QNCA 4HJ3A 2J8YA 3UE0A 5AVFA 2A24B 3UO9A 3GSGA 1J9MA 5HWTA 1K38A 1XJ2A 1XPBA 1EWZA 2AVXA 3GMWA 4HJ6A 2WKQA 4B93A 5HPIA 1BSGA 4L9EA 5CHUA 4KG2A 2ZOHA 3FYZA 2W1RA 2V2FF 3HUMA 3IQAA 3HVFA 3S22A 5FI7A 1TDGA 4U0XA 2EXBA 5AQBA 3T4KA 1XJ4A 3G35A 3LR0A 2X71A 4CQHA 3PAEA 4CLCE 4UA7A 3TW8A 3QP4A 4EW7A 1DJBA 3NULA 1L0GA 4NXEA 1GSWA 4II7A 4WZ5A 4X56A 3OBFA 2DNSA 2HDSA 3QP6A 4WL9A 4E04A 3IBRA 5E2EA 2V8FA 4UA6A 5HD5A 2EX8A 3FZCA 4LRXC 2VV8A 2XRNA 4I3AA 5U47A 2JE5A 3MS6A 1FCMA 2JKRI 3T1XA 5DFXA 3A0RA 2I72A 3N4IA 3F1OB 3IH9A 2EFXA 2DMWA 1NWZA 1P9RA 3JYIA 4G3VA 3S7QA 3T4JA 3P09A 1SDNA 2A2LA 3C2WA 3OCLA 4IUKA 3BEBA 4Y7PA 4GDNA 3MBZA 1YLJA 5HX9A 4PM7A 3RXXA 2XA7S 4ESPA 5A90A 3BLMA 5CXWA 3TOIA 2VGJA 2GDNA 2ZC3B 3Q7VB 5HAIA 3M6BA 3PAGA 1PFLA 3SS3A 1LSXA 3IX4A 5CGWA 1PWGA 3BJNA 3KX0X 2H0TA 3UNWA 3D4FA 1S0WA 3IXDA 3PBNA 3FPVA 1H5XA 4OPYA 3MKFA 5HL6A 4FOFA 1TVFA 1KE3A 3JPUA 4GJ4A 2H5SA 4LCLA 4X53A 2PDRA 2XK1A 3Q07A 4M4XA 3MR0A 1IKIA 3G2YA 1VQQA 4L9GA 3HCYA 4PKYA 4JF4A 2ZM8A 3DAVA 3HLCA 2EWVA 2ZQ7A 5GLDA 3FWLA 3CITA 4R6LA 1H8ZA 2P74A 1CF0A 3SS5A 2B95A 2FH5A 4U3TA 2A49A 2B5RA 1LSWA 1K6SA 4EXOA 1DJAA 1L2SA 4FH2A 5IT5A 3H7WA 4UA9A 5FASA 1K57A 4PAUA 5F68A 4MBHA 1K56D 1YPRA 4EUVA 1N4OA 2VZWA 4E3LA 4RVAA 4PM5A 1N9BA 3BM6A 2R78A 4LV1A 3UPPA 1Q2PA 3V67A 5GL9A 1F9IA 5JYOA 4S2NC 4AFIA 1E3UA 4KZAA 3A3JA 3B3XA 1LL9A 1KOUA 1TS6A 4Z9QA 3T50A 1KDWA 4LFUA 3UDXA 4X69A 1RGYA 3E4OA 3BFEA 4S2LA 5GHZA 4QHCA 3QP2A 3QP5A 2JN7A 3M2KA 2WZXA 3ZG0A 3L9KA 4EV4A 4D2OA 4KUOA 3IXGA 1UWNX 4PMAA 2XGNA 1UGUA 4CLCC 1PRQA 2PBDP 2P04A 2GNXA 3V39A 3EEHA 4OQGA 1TD5A 2XD1A 3EQUA 4OQHA 3IWIA 1GSVA 2HDQA 1YAXA 4DJ3A 3BFDA 3GRJA 2XFSA 2OLUA 2ZC5B 4HESA 3IWOA 4PM8A 5DFYA 1OTIA 3C8CA 4BBUA 3A3DA 1ONHA 4DF6A 3MZEA 1F5MA 2HJ9C 4CJNA 5HDCA 3UB7A 2KDKA 4MBKA 1WE4A 2XD5A 5HPFA 3IHBA 1IYSA 3UY6A 4HOIA 3NCKA 4R3AA 3TRCA 3ZNYA 3ZHHA 2WADA 3OOVA 3BWLA 2VV6A 3GV9A 4BD0A 4WMCD 1F2KA 3ZFZA 1GHMA 2WAEA 3RXWA 4BBVA 3UMEA 1Y28A 3HREA 3TE8A 1OT6A 2WGWB 1RCJA 5I94A 4L0LA 4WF0A 4YOFA 3O3VA 5KSCA 1RGZA 4Y15A 2ZBBA 3BFFA 3HLEA 3R7WB 1GA0A 2XROA 4GD8A 4MNRA 4S2KA 5HSQA 2KX6A 5E2HA 1ODVA 2WAFA 4P0MA 4XT2A 2Y8HA 5DKLA 2OV5A 5HW3A 4Y5FA 1D7EA 3LIDA 4PKYG 1BLPA 5CX7A 4D60A 2Y79A 2WYXA 4FUWA 5IS1A 1W63Q 1FSYA 2HGVA 2CMNA 1NLZA 3NOTC 4FSFA 1N9LA 3G34A 4ZJ2A 1ES4A 3MXQA 1DP8A 5EVEA 1ESUA 3JVUA 1NLYA 4EESA 3FC7A 2XEPA 5BOHA 1HLUP 4B9OA 3VP1A 2ZC7A 3F1PA 1PW8A 3LYXA 3KYEA 3IT9A 4ZDXA 2W1TA 3VFHA 1NJ4A 5FAOA 3ZG5A 4GHIA 1Y4OA 4BENA 2W3EA 1S6RA 2GJ3A 3HLBA 2L4RA 1XKZA 5EUAA 4X1MA 3BQAA 2VLGA 5IHVA 2JKTM 1JWPA 4I3JA 5EVIC 2P9VA 2EXAA 2KLIA 3LUQA 3E4QA 5HDSA 3ZG9B 2C6WB 4DJ2A 2Y2MA 4Y0OA 2K31A 4JXSA 3G30A 1KGGA 5FQMA 3VE3A 1XXMA 4Q8IA 1HVBA 4E6XA 1IELA 1W8YA 3FKVA 4LPZA 3A3EA 4OOMA 4LLOB 1KE4A 4F3LA 3S1YA 1ALQA 5EE8A 5E43A 3S7NA 1MBLA 4WBGA 2NUTC 3WS4A 3GQZA 3G4PA 3CPTB 2VJWA 2G2UA 5HARA 2PR6A 4LENA 3AGEA 3R7WA 4FH4A 1NRFA 4NXGA 5HWVA 4OPZA 4UQIM 2JCHA 1MY8A 4KZ4A 4QY6A 1L0EA 2GX5A 2JKRM 3E98A 3IF5A 1AXBA 3ZVTA 3K3DA 3TG9A 1YLTA 1NZUA 1NXYA 1OTBA 1PIOA 3F1PB 4EWFA 1U60A 1XFNA 3P01A 4GS9B 4IHQA 3BY8A 1A0KA 3E2KA 2WK0A 4XUXA 4FD8A 2HDRA 5FI6A 4R3BA 3S7OA 2XF3A 1N9NA 2ZL1B 4LRYC 3FG8A 3S4XA 2W3HA 4IBXA 4CLCD 2O0YA 4OP8A 1FQGA 3CLOA 1OPXA 5GLBA 3UN7A 1NYYA 2PAVP 2XSSA 4HY8A 5J8XA 4O0PA 2O99A 1W8QA 3IX3A 3Q81A 5KIZA 4NEED 2O9CA 2Y2PA 1XJ6A 2HZ5A 5FQKA 2FFYA 1VM1A 2DCFA 3G6OA 5FEGA 3F1NA 3VFFA 4DRTA 4OQ0A 4HP9A 1T19A 5A91A 4P85A 3C4OA 5J4EA 1VB6A 2HPBA 3HJIA 3VSLA 4WN5A 2W0NA 4XT2B 4ETZA 5DF9A 2V20A 1XGIA 4WMCA 1C3BA 1XJ3A 1IKGA 2ZJ9A 4DMZA 1FIKA 1PW1A 1ZG4A 4KG6A 4P6ZM 1EROA 4X55A 4JF5A 5G18A 2JKGA 4QU3A 3CUEA 5F69A 1L3LA 3N8SA 5CGSA 3LIBA 2P08A 4JXVA 4UEYA 3NDEA 4K91A 3ZGAB 2ACGA 4NXFA 4KZ3A 3V3SA 1GA9A 5IU1A 3DTKA 2H28A 5EPHA 4S2JA 2PRFA 3SH9A 3HUNA 1P97A 4BL2A 2WKEA 3EGXC 4P6ZS 4KQOA 3GTCA 2V8CA 2OWJA 1BLCA 1FCNA 4MCWA 4N1XA 5DF8A 4ARZA 2ZQ9A 4RX2A 3BFGA 3S7PA 1SKOA 3IH8A 2INWA 4L9FA 4BJPA 3A3FA 4E6WA 1S1YA 2Z2MB 1BT5A 2WKPA 2O9BA 3M6HA 4XXRA 2ZQAA 2EX2A 3RTYA 4OH0A 1DRMA 2W3GA 1FR1A 3NC8A 1IFQA 3E2LA 4JBFA 4KZBA 4RYEA 2XA7M 4PM6A 5EM1A 3KYZA 4QPRA 5DTKA 1G6AA 4JGPA 3LR4A 4UAAA 1W5DA 4YFMA 1BYWA 3GR2A 1K56A 5FAQA 4C75A 4GCZA 1S66L 4F3LB 4MN5A 3KSFA 3G31A 4C3QA 4G3KA 3U4LP 5TR7A 1NZOA 3VP3A 3IF6C 3RH8B 3SOIA 5F5YA 3PXPA 5EVIA 5FQJA 1YM1A 5AQAA 5F83A 3SS4A 4MDZA 4ZAMA 3CPTA 3QNBA 3Q7VA 5KZHA 4CPKA 1ERQA 3VE4A 1OTAA 4MEZA 3IBJA 4K08A 1ZTUA 1DY6A 5HD3A 4X6TA 3NHQA 1M6KA 1S4SA 4I3IA 4XUZA 2QKPA 1JVJA 3H9WA 1PWCA 2X02A 3ZDJA 4E3IA 1K57C 3RFBA 4EEPA 1SZVA 4Q0HA 3ZYTA 2E8IA 2M1CA 3ZVWA 2IA2A 1I2SA 1LI9A 3NECA 2PU4A 1JTDA 5DVAA 4DXCA 3NOUC 2PD8A 4EBNA 2YKHA 3EWKA 4G3WA 4EBPA 3Q7ZA 2UV0E 2Y2KA 3N8LA 3T4SA 1SCWA 2JKFA 1E25A 4GZBA 2VV7A 4HJ4A 4K0WA 1P9WA 1GHPA 3EOIA 1S67L 1SDEA 3OPPA 5EECA 4ZJ3A 4GD6A 2LB9A 2Z6CA 3UB9A 4HBTA 2H10A 5L10A 1M40A 1TDLA 1LLBA 2QZ6A 4R1GA 1ESIA 1PI5A 5TGFA 1XA7A 1CK3A 4GDBA 2JBFA 2Y59A 3NIAA 4MN7A 4P6BA 5CEBA 4ZBEA 3VP2A 3FPWA 2ZLYA 5G4ZA 3KSHA 5F1GA 3PBSA 4OQIA 5CHJA 1ES2A 3QP1A 5F82A 3UPNA 3DW0A 2WUQA 3LIFA 2L0WA 3LFVA 1WYBA 2OAQ1 2K2NA 4OONA 3LEQA 1DP9A 5CRFA 4IBRA 3DWZA 1SHVA 2EFUA 4N92A 3T4QA 1MC0A 1BUEA 4B4XA 3A0VA 2O9AA 3B42A 3V3RA 3P98A 3ZCZA 1BLHA 4B88A 3SW1A 1K25A 3MJQA 3BY9A 5CECA 1WYCA 4I38A 3VMAA 3PBOA 5EVIB 4EQIA 2D02A 1EI5A 2ZC6B 1CEGA 3C5AA 3MKEA 4KUKA 3RJUA 1KGEA 1QMEA 2JC7A 5HDDA 1NY0A 4Y0TA 3QP8A 4JKTA 3SZTA 4U0TA 4EU0A 3N6IA 3AGFA 2ZMAA 4BMWA 3MZDA 4LRZE 4DXBA 2J9OA 1TEMA 1MZUA 3KSIA 2RCXA 1AWIA 3H82B 3CAXA 1BZAA 3MZFA 4Q0JA 3PBTA 5C5KA 2A3UA 3WRTA 2V0WA 3DWKA 3H82A 4IEDA 1ZG6A 2HV1A 1DP6A 2QJ7A 1G5UA 1LI0A 3ZNTA 5DKKA 4UQIS 2PU2A 2HDUA 1IEMA 4BLMA 2Y2QA 3O86A 3FV7A 4ZJ1A 2QWSA 1MKMA 3NOPC 4LV3A 4R38A 4DE0A 1HZOA 4NK3A 4DN0A 2HP5A 3IXBA 2V1BA 5L09A 5M19A 4RQ9A 4I39A 4S2NA 3MQ0A 2BLSA 3BRMA 4EUZA 2ZQ8A 3DTMA 3F1NB 5M18A 2WGWA 4OLDA 4KG5A 1CEFA 2BASA 2VGLS 4DDSA 3E4PA 4JXGA 1PZPA 1PWDA 3G2ZA 1OTDA 5CEDA 4X25A 4IVIA 4DE1A 3DBAA 5FSRA 5HAQA 2PBYA 4N9LA 2HJEA 3UE3A 1MPLA 4N9KA 4BD1A 3AGDA 2Z2LB 3IHAA 3N8RA 2J9PA 5FAPA 3PYPA 4WZ5C 1MWSA 2CC1A 3HLWA 5L07A 3NY4A 3VV4A 3Q82A 1FCOA 5EVID 2PR5A 3IS2A 2ZOIA 2EX9A 1UWPX 1IYQA 4YINA 1VEUA 4MLLA 3HBRA 5DJTA 4N1HA 1LL5A 1JWZA 1VHMA 3HLGA 2PHYA 5A8BA 1GHIA 1ES5A 4HEFA 2Z6DA 3CJMA 2X01A 1LSVA 2JHEA 5HZHA 1QMFA 4PM9A 1H3QA 1G28A 3ULFA 5A92A 4HP4A 3CWFA 4BQMA 1Z09A 4S2PA 2W3FA 4Y0UA 5L2FA 1T1AA 1KGFA 3O88A 4OPRA 5CHMA 2J3WA 4HH2A 3BLSA 1K4FA 1K54A 4PHTA 3CUEC 3IF6B 5F6AA 2QHKA 2M7UA 1FSWA 2ZD8A 3WS0A 5F1FA 3SH7A 3LY4A 4QY5A 4K0XA 5TBMA 3W4QA 2J3TD 2EWWA 1K54C 4WEJA 4DE2A 5MC7A 3LEZA 5M1AA 1J3WA 2JKTI 3N7WA 2ZC4B 4S2IA 1W7FA 1MKIA 4BBTA 5FDSA 5HL1A 3ZG7B 4R23A 4DDYA 1L0FA 2VKSA 3MQQA 5FI2A 2V1AA 5CTMA 3MFXA 2KOIA 4R4RA 5AQ7A 2EX6A 5FDHA 2WKIA 4OVDA 4PPRA 3MXSA 2NUPC 3VP0A 3MFDA 2FZ0A 1O07A 2ZMFA 2Y2LA 1D06A 2Q9MA 4OLGA 3UMDA 3NBLA 1IYOA 3IS2B 4FTXA 3TJZC 4S2MA 4GS9A 2I9VA 1VEUB 2Y55A 5I5LA 5FEFA 3HLDA 1LHYA 5EV0A 2IWCA 1IYPA 4O7DA 1GCEA 3NI9A 4KZ7A 2V9AA 3UDIA 3LI9A 1Q2QA 1GSXA 2MJ6A 4GKUA 4MMNA 2XH9A 3VP4A 5LBRA 1FILA 5K5BA 1X0OA 1G68A 3LIEA 3LI8A 1Z6FA 4GLQA 4HQAA 4WUJA 1DJCA 2XQZA 5TFQA 1RP5A 1L0DA 1S4RA 4P87A 3NDGA 4A5RA 1LL8A 1YLPA 3CHWP 5DTSA 3HUOA 1CI8A 4IUHA 4KZ8A 3MMHA 3T1SA 5EM0A 4QJGA 3LIAA 2D01A 4E3OA 2W1TB 2Y2HA 3C7UA 3ITAA 3I7JA 4M3KA 1E3UD 3VOLA 2XFTA 1YSPA 4HBUA 4CLCA 3LR3A 3LR5A 3MF0A 3IXHA 2G7UA 2VEAA 3C4PA 5EFWA 3PTEA 3C38A 1YMSA 3T12B 3LICA 4HI4A 1KE0A 4KQQA 1H8YA 2Q9NA 4DKIA 1I2WA 3DTIA 4O8GA 1OMEA 1W79A 3NJAA 3T1RA 5G4YA 1K4EA 5HAPA 5CERA 4OOLA 5E2GA 4LCMA 3A3IA 3ZG8B 2HP9A 4HIAA 2PYPA 4ZTKA 1JNUA 3O5YA 2E8JA 3IX8A 4Y13A 4GNUA 1MWTA 5E2FA 4S2OA 4JLFA 4Y3IA 3U2AA 3HLFA 2WKHA 1LT0A 3ISGA 2WGVA 3UB8A 1YLYA 4JXWA 5CTNA 5AQ9A 1MWUA 4HHDA 3BQ8A 3K2NA 3LCEA 4OOYA 1S1ZA 1XP4A 4IVKA 4ETXA 3OPHA 2BG1A 5TBMB 2H0YA 2PT7A 1JWVA 4EERA 4RX3A 4E3JA 1YLZA 5DTTA 3BFCA 4EQ1A 2A24A 3D3OA 3B33A 3IF6A 1N9OA 4YNRA 1K55A 3OPLA 1XX2A 1ZHHB 3K3CA 1NYMA 4BWIA 3EEAA 5CGXA 5HFOA 2J80A 3KO6A 3BW6A 3T4LA 3OPRA 2VK3A 1PI4A 3VOYA 3OZHA 1H0MA 3T4TA 3G32A 3H7WB 2BTFP 4X68A 4EEUA 1SKOB 2Y91A 5AVEA 3ZQ5A 1HTZA 3KSGA 3W8KA 3W2ZA 3GVBA 4NKPA 2DRWA 2J3TC 2ZMVA 4JGQA 4O01A 4HNBA 3T1QB 1K55C 4BL3A 2ZL1A 4JF6A 3MQOA 1F98A 1KVMA 4KQDA 1PNEA 4E3NA 1FR6A 3WWXA 1BTLA 3CI6A 1IOUA 2GZAA 5FQIA
chains in the Genus database with same CATH topology
5FL3A 4RQ9A 3P7NA 4I39A 3MQ0A 2OWHA 1V9ZA 5KSHA 3E0YA 3S7OA 1N9NA 4LRYC 3FG8A 2W3HA 4CLCD 3F1OA 3F1NB 2O0YA 2L1MA 3CLOA 1OPXA 2BASA 1LSXA 2QJ5A 2VGLS 4WELA 2XSSA 3BJNA 3E4PA 3KX0X 4HY8A 4O0PA 2O99A 2HF6A 1OTDA 2PD7A 1XFQA 2VX8A 5KIZA 3DBAA 4NEED 2O9CA 3A0SA 1TS8A 3PBNA 1XJ6A 3FPVA 2HJEA 3G6OA 3UE3A 5HL6A 3F1NA 3C30A 4FOFA 3JVVA 3PYPA 4HP9A 4GJ4A 1T19A 2PDRA 5J4EA 4M4XA 1VB6A 3HJIA 3MR0A 3VV4A 4WN5A 4L9GA 3HCYA 4PKYA 2W0NA 4XT2B 2PR5A 4ETZA 5DF9A 3IS2A 2B18A 2ZOIA 1UWPX 2EWVA 3T4OA 1EW0A 1OJGA 1T1BA 1XJ3A 3CITA 4R6LA 4DMZA 5DJTA 3KYQA 2FH5A 5DJUA 1T18A 1VHMA 2PHYA 1LSWA 1H8MA 1V9YA 4WEKA 5A8BA 4EXOA 4WLAA 1YSQA 5IT5A 2EA9A 2Z6DA 4IJGA 4P6ZM 3H7WA 1LSVA 2JHEA 4PAUA 5F68A 5HZHA 2YKFA 1H3QA 3CUEA 5F69A 1G28A 3ULFA 4HP4A 3CWFA 2P7JA 4NXBA 4H6JB 2B02A 1TS7A 4EUVA 3LIBA 2P08A 2VZWA 2W3FA 4UEYA 1T1AA 2R78A 4NXFA 3V67A 1F9IA 5HWWA 2J3WA 5IU1A 4HH2A 2H28A 4PHTA 3CUEC 5F6AA 4AFIA 2QHKA 2M7UA 1OT9A 1P97A 4EETB 1YKDA 3EGDC 1KOUA 1NRJA 1TS6A 3EGXC 4P6ZS 3OC2A 4ZRRA 2WKRA 4KQOA 5TBMA 3T50A 1W63M 2OWJA 2J3TD 2EWWA 3E4OA 4MCWA 4WEJA 4ARZA 2JN7A 5MC7A 4YWZA 3S7PA 2JKTI 4KUOA 1UWNX 2INWA 4L9FA 2VGLM 4BBTA 4BJPA 1UGUA 1P0ZA 4CLCC 2P04A 1S1YA 2GNXA 3EEHA 4HH3A 2WKPA 2VKSA 1WA9A 1TD5A 2O9BA 2V1AA 3MQQA 4I5SA 4JGOA 4ME4A 3MFXA 3EQUA 2W27A 2KOIA 1GSVA 3PBQA 1YAXA 4DJ3A 3RTYA 1DRMA 2W3GA 1STZA 1IFQA 2NUPC 2XA7M 3KYZA 2FZ0A 5DFYA 4QPRA 2ZMFA 1OTIA 3C8CA 1D06A 4BBUA 4JGPA 5TJJA 3UB6A 3LR4A 3UMDA 5AJGA 1BYWA 3IS2B 1F5MA 2HJ9C 2W3DA 5HDCA 3UB7A 2KDKA 2LB5A 4JGRA 3TJZC 4GS9A 5HPFA 2I9VA 3D72A 5I5LA 4GCZA 1OJ5A 1S66L 2OAP1 2M7VA 5J7EA 4Z1WA 4F3LB 4HOIA 4MN5A 2QYBA 3KSFA 4R3AA 4H6JA 3TRCA 4G3KA 4Q0IA 3GDIA 2V9AA 4ARZB 3RH8B 3LI9A 3OOVA 5F5YA 2MJ6A 1GSXA 3BWLA 4MMNA 2VV6A 3GECA 3PXPA 5LBRA 1T1CA 2OOLA 5K5BA 1X0OA 2K7SA 3R4KA 3LIEA 3OCNA 4MDZA 4BBVA 3LI8A 3UMEA 1Y28A 4GLQA 4HQAA 4WUJA 3HJKA 3TE8A 3VE4A 1OTAA 3IBJA 4GW9A 1S4RA 1ZTUA 4K08A 1OT6A 3NHQA 4I3IA 5HD3A 1S4SA 1LL8A 2QKPA 3ICYA 4L0LA 3H9WA 3PBRA 3EQVA 4WF0A 4YOFA 1OTEA 5J3WA 3B47A 4IUHA 3RFBA 2ZBBA 4EEPA 3MMHA 4CLCB 4GHIB 4Q0HA 3R7WB 3ZYTA 2M1CA 5L8MA 2XROA 2IA2A 3LIAA 5HSQA 2KX6A 2PYRA 2D01A 2W1TB 3NOUC 1ODVA 3PR6A 3UE6A 2PD8A 3OLOA 2YKHA 3EWKA 4G3WA 4R70A 3VOLA 4XT2A 1YSPA 4Y2FA 3PHYA 4CLCA 1TF1A 2V0UA 3T4SA 2Y8HA 5DKLA 3LR3A 4MN6A 1D7EA 3LIDA 4Y5FA 2VV7A 4PKYG 4HJ4A 3LR5A 2VA0A 1P9WA 5CX7A 3MF0A 1TS0A 1G6OA 2G7UA 2Y79A 1S67L 3EOIA 5IS1A 2VEAA 5EFWA 4HJ3A 5AVFA 1W63Q 2A24B 2LB9A 3C38A 2Z6CA 2HGVA 2CMNA 1NLZA 3NOTC 4FSFA 1N9LA 3LICA 4HI4A 3UB9A 3MXQA 1DP8A 5HWTA 4O8GA 3JVUA 1NLYA 1XJ2A 4EESA 3NJAA 3FC7A 4B9OA 5G4YA 3F1PA 4OOLA 3LYXA 4HJ6A 2WKQA 2W1TA 4B93A 5HPIA 4HIAA 4MN7A 2PYPA 4L9EA 1JNUA 3O5YA 3FPWA 4GHIA 5G4ZA 3KSHA 2ZOHA 2W3EA 3PBSA 2W1RA 4Y3IA 3U2AA 2GJ3A 2L4RA 3BQAA 3LIFA 2VLGA 1LT0A 2JKTM 2L0WA 3LFVA 2OAQ1 2K2NA 1DP9A 3UB8A 3T4QA 4I3JA 1MC0A 3T4KA 3A0VA 4HHDA 2KLIA 3BQ8A 3LUQA 2O9AA 3B42A 3E4QA 1XJ4A 1S1ZA 3K2NA 5HDSA 3LR0A 4DJ2A 4CQHA 3SW1A 3MJQA 3BY9A 4ETXA 4I38A 2K31A 4CLCE 3PBOA 3TW8A 5TBMB 3VE3A 4EW7A 2PT7A 2D02A 4NXEA 4EERA 4LPZA 1GSWA 4II7A 4EQ1A 3OBFA 2A24A 3D3OA 3B33A 4OOMA 4LLOB 4WL9A 4E04A 1N9OA 3IBRA 4YNRA 4F3LA 1ZHHB 3K3CA 4BWIA 4KUKA 5HD5A 3EEAA 3S7NA 5HDDA 2NUTC 4LRXC 2VV8A 2XRNA 2J80A 3KO6A 3BW6A 4I3AA 3T4LA 4EU0A 2VJWA 2PR6A 4BMWA 3R7WA 4NXGA 2JKRI 5HWVA 4UQIM 5DFXA 3A0RA 3T4TA 4LRZE 3F1OB 3H7WB 1MZUA 2DMWA 1NWZA 4EEUA 3KSIA 1P9RA 4G3VA 5AVEA 3ZQ5A 3H82B 3CAXA 2GX5A 4Q0JA 3KSGA 3W2ZA 2JKRM 3PBTA 3S7QA 3E98A 5C5KA 3T4JA 4NKPA 2J3TC 2V0WA 2ZMVA 3H82A 3K3DA 2HV1A 4JGQA 4HNBA 4O01A 1DP6A 2QJ7A 1OTBA 3MQOA 2A2LA 1F98A 5DKKA 4UQIS 3C2WA 3F1PB 4KQDA 3OCLA 4IUKA 1XFNA 2QWSA 3P01A 4GS9B 4IHQA 1MKMA 3BY8A 3NOPC 4R38A 4DN0A 3CI6A 1IOUA 2V1BA 2XA7S 2GZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXF A;  4RQ9 A;  3P7N A;  4I39 A;  3RH8 B;  2GJ3 A;  2OWH A;  3LI9 A;  2L4R A;  1V9Z A;  5F5Y A;  3LIF A;  1F9I A;  2VLG A;  1GSX A;  5HWW A;  3BWL A;  1N9N A;  4LRY C;  2VV6 A;  3FG8 A;  1LT0 A;  2L0W A;  3GEC A;  4HH2 A;  5IU1 A;  3F1O A;  2H28 A;  3F1N B;  1T1C A;  1DP9 A;  2L1M A;  2OOL A;  1X0O A;  5F6A A;  3UB8 A;  2K7S A;  2QHK A;  3LIE A;  4I3J A;  3CLO A;  1OT9 A;  3LI8 A;  4BBV A;  1P97 A;  3UME A;  1Y28 A;  4EET B;  3A0V A;  2BAS A;  4HQA A;  4WUJ A;  4HHD A;  1KOU A;  1LSX A;  3LUQ A;  2QJ5 A;  3E4Q A;  3HJK A;  5HDS A;  1XJ4 A;  1S1Z A;  1TS6 A;  3VE4 A;  3E4P A;  1OTA A;  3KX0 X;  4HY8 A;  4GW9 A;  1S4R A;  4K08 A;  1OT6 A;  3NHQ A;  4I3I A;  2WKR A;  1S4S A;  5HD3 A;  1LL8 A;  2QKP A;  5TBM A;  3T50 A;  4DJ2 A;  3SW1 A;  3ICY A;  3MJQ A;  3BY9 A;  3H9W A;  4I38 A;  4WF0 A;  2OWJ A;  1OTD A;  1OTE A;  2PD7 A;  5J3W A;  1XFQ A;  5TBM B;  3VE3 A;  3E4O A;  4EW7 A;  5KIZ A;  2ZBB A;  2D02 A;  3A0S A;  4NXE A;  1TS8 A;  4EER A;  4EEP A;  4LPZ A;  1GSW A;  4EEU A;  1XJ6 A;  4GHI B;  4EQ1 A;  2JN7 A;  3G6O A;  2A24 A;  2M1C A;  4YWZ A;  3B33 A;  4LLO B;  4WL9 A;  4E04 A;  1N9O A;  3IBR A;  4F3L A;  3F1N A;  4KUO A;  3LIA A;  5HSQ A;  2KX6 A;  2PYR A;  2D01 A;  3K3C A;  1UWN X;  4KUK A;  5HD5 A;  3PYP A;  2INW A;  4L9F A;  4BBT A;  3NOU C;  1ODV A;  1UGU A;  1P0Z A;  4HP9 A;  5HDD A;  1T19 A;  2PD8 A;  3UE6 A;  3OLO A;  2VV8 A;  4LRX C;  2YKH A;  2J80 A;  1S1Y A;  2PDR A;  3EWK A;  4I3A A;  4R70 A;  3EEH A;  4HH3 A;  5J4E A;  2WKP A;  3VOL A;  1WA9 A;  3MQQ A;  4M4X A;  1VB6 A;  2PR6 A;  2V1A A;  3HJI A;  3MR0 A;  4I5S A;  4JGO A;  3MFX A;  4XT2 A;  4WN5 A;  2W27 A;  3PHY A;  4L9G A;  1GSV A;  2V0U A;  2W0N A;  4NXG A;  4PKY A;  4EXO A;  5DKL A;  4XT2 B;  5HWV A;  2PR5 A;  4MN6 A;  1D7E A;  3LID A;  4DJ3 A;  3A0R A;  3IS2 A;  3RTY A;  2VV7 A;  1DRM A;  4HJ4 A;  4PKY G;  2ZOI A;  4LRZ E;  1TS0 A;  1UWP X;  3F1O B;  1S67 L;  3H7W B;  5IS1 A;  2VEA A;  5EFW A;  1MZU A;  4HJ3 A;  1OTI A;  1EW0 A;  1D06 A;  1NWZ A;  1OJG A;  3C8C A;  5AVF A;  1T1B A;  1XJ3 A;  2A24 B;  4JGP A;  4BBU A;  4R6L A;  3UB6 A;  5AVE A;  3UMD A;  2Z6C A;  3ZQ5 A;  3H82 B;  3CAX A;  2CMN A;  5DJT A;  3NOT C;  1BYW A;  1N9L A;  3IS2 B;  3LIC A;  4HI4 A;  3UB9 A;  5DJU A;  1T18 A;  2PHY A;  3MXQ A;  1DP8 A;  5HDC A;  1LSW A;  5HWT A;  5A8B A;  1V9Y A;  1XJ2 A;  2V0W A;  3UB7 A;  2KDK A;  3H82 A;  4EES A;  3K3D A;  3FC7 A;  3NJA A;  2HV1 A;  4JGQ A;  4HNB A;  4JGR A;  4GS9 A;  4WLA A;  1DP6 A;  2I9V A;  3D72 A;  4B9O A;  2QJ7 A;  1OTB A;  2EA9 A;  3MQO A;  2Z6D A;  1F98 A;  5DKK A;  5G4Y A;  4GCZ A;  3H7W A;  3C2W A;  3F1P B;  1OJ5 A;  1S66 L;  5I5L A;  1LSV A;  5J7E A;  3F1P A;  4KQD A;  4F3L B;  2JHE A;  3LYX A;  4HJ6 A;  4HOI A;  5F68 A;  2WKQ A;  2YKF A;  4MN5 A;  4R3A A;  5HZH A;  4HIA A;  2PYP A;  1XFN A;  4L9E A;  5F69 A;  1JNU A;  1G28 A;  2QWS A;  4GS9 B;  3ULF A;  3BY8 A;  3NOP C;  4HP4 A;  4H6J A;  3CWF A;  2P7J A;  4GHI A;  4R38 A;  4NXB A;  5G4Z A;  4H6J B;  2B02 A;  1TS7 A;  2ZOH A;  3LIB A;  3GDI A;  2V1B A;  2V9A A;  1T1A A;  2R78 A; 
#chains in the Genus database with same CATH topology
 5FL3 A;  3P7N A;  5A93 A;  5GHX A;  2OWH A;  1V9Z A;  5KSH A;  3E0Y A;  5FQ9 A;  4H8R A;  3MXR A;  3F1O A;  3MSH A;  4LGW A;  2L1M A;  3LO7 A;  1ZC2 A;  4QWO A;  1XA1 A;  1ACF A;  1K0K A;  5JYP A;  2QJ5 A;  3D9Y A;  2ZQC A;  4WEL A;  2V1Z A;  3WRZ A;  2HF6 A;  2PD7 A;  3TSG A;  1XFQ A;  2VX8 A;  2IWB A;  4QD4 A;  3A0S A;  1TS8 A;  1K6R A;  2ZM0 A;  2R9W A;  4GB7 A;  4KZ9 A;  1MWR A;  2ZM2 A;  1HD8 A;  3C30 A;  4EBL A;  3JVV A;  2WGI A;  4WM9 A;  1CJF A;  4OPQ A;  3QHY A;  4WZ4 A;  3VOZ A;  4F94 A;  5FA7 A;  3HL9 A;  3CZD A;  2Y2N A;  2XDM A;  2Q0O A;  4OP5 A;  2B18 A;  2Y2O A;  5FAT A;  4MBF A;  1BLS A;  1KVL A;  4ID4 A;  3T4O A;  1EW0 A;  2XR0 A;  1OJG A;  1T1B A;  1CI9 A;  2IWD A;  3KYQ A;  5DJU A;  1T18 A;  1KDS A;  1H8M A;  1V9Y A;  2C5W B;  3ITB A;  4FCF A;  4WEK A;  2Y2J A;  4WLA A;  1YSQ A;  2RL3 A;  2EA9 A;  4IJG A;  2VGK A;  3IWQ A;  5EVL A;  3M2J A;  2YKF A;  3BYD A;  2P7J A;  4C6Y A;  4NXB A;  4H6J B;  3UE1 A;  2B02 A;  1TS7 A;  2QPN A;  1PZO A;  5HWW A;  1BUL A;  1CQA A;  3UDF A;  4QB8 A;  1Y54 A;  3CG5 A;  1OT9 A;  2G2W A;  4EET B;  1YKD A;  3EGD C;  5GHY A;  1NRJ A;  3OC2 A;  1JTG A;  4ZRR A;  2WKR A;  3BEC A;  1YT4 A;  1W63 M;  4JPM A;  4YWZ A;  1O7E A;  3W4O A;  2WZZ A;  2VGL M;  1P0Z A;  2Y4A A;  1SKF A;  4R3J A;  4HH3 A;  4OKP A;  3VSK A;  1WA9 A;  3SH8 A;  4I5S A;  4JGO A;  4ME4 A;  1YMX A;  2W27 A;  4KZ5 A;  1XGJ A;  3PBQ A;  4E3K A;  2HP6 A;  4GN2 A;  5EOE A;  5D3O A;  1STZ A;  4GOG A;  5FQQ A;  1ERM A;  4LV0 A;  2Y2I A;  3Q1F A;  1YQS A;  1ES3 A;  4WYY A;  4NET A;  4Y17 A;  5TJJ A;  3UB6 A;  3LGO A;  5AJG A;  1VET B;  2QMI A;  4R0Q A;  2W3D A;  2LB5 A;  4JGR A;  4UHU A;  3D72 A;  2OSU A;  3UB5 P;  3WS1 A;  4KQR A;  1OJ5 A;  2OAP 1;  5J7E A;  2M7V A;  1I5Q A;  4Z1W A;  2QYB A;  2UWX A;  4H6J A;  3UPO A;  5EOO A;  2P9V B;  1PYY A;  1ZKJ A;  2ZQD A;  4Q0I A;  3GDI A;  3LY3 A;  4KZ6 A;  4ARZ B;  1VET A;  3WS5 A;  4DE3 A;  3WS2 A;  3GEC A;  4B4Z A;  3C7V A;  1T1C A;  2OOL A;  2OLV A;  2K7S A;  3R4K A;  4NG2 A;  3V50 A;  3OCN A;  5GLA A;  3V5M A;  3HJK A;  4GW9 A;  3ICY A;  4R4S A;  5KMW A;  3PBR A;  2FFF B;  3EQV A;  5GLC A;  5J3W A;  1OTE A;  3B47 A;  1D1J A;  2XLN A;  4LV2 A;  3FKW A;  4CLC B;  4GHI B;  1YLW A;  2R9X A;  5L8M A;  3O87 A;  1MXO A;  2PYR A;  2J7V A;  2Y2G A;  4RA7 A;  1E4D A;  3PR6 A;  5DF7 A;  3UE6 A;  3OLO A;  3W4P A;  4X1L A;  4R70 A;  4E3M A;  1FOF A;  3L7H A;  3DTE A;  4Y2F A;  3PHY A;  3CMZ A;  1ONG A;  1TF1 A;  2V0U A;  4KEN B;  4MN6 A;  2VA0 A;  1TS0 A;  1G6O A;  3QNC A;  4HJ3 A;  2J8Y A;  3UE0 A;  5AVF A;  2A24 B;  3UO9 A;  3GSG A;  1J9M A;  5HWT A;  1K38 A;  1XJ2 A;  1XPB A;  1EWZ A;  2AVX A;  3GMW A;  4HJ6 A;  2WKQ A;  4B93 A;  5HPI A;  1BSG A;  4L9E A;  5CHU A;  4KG2 A;  2ZOH A;  3FYZ A;  2W1R A;  2V2F F;  3HUM A;  3IQA A;  3HVF A;  3S22 A;  5FI7 A;  1TDG A;  4U0X A;  2EXB A;  5AQB A;  3T4K A;  1XJ4 A;  3G35 A;  3LR0 A;  2X71 A;  4CQH A;  3PAE A;  4CLC E;  4UA7 A;  3TW8 A;  3QP4 A;  4EW7 A;  1DJB A;  3NUL A;  1L0G A;  4NXE A;  1GSW A;  4II7 A;  4WZ5 A;  4X56 A;  3OBF A;  2DNS A;  2HDS A;  3QP6 A;  4WL9 A;  4E04 A;  3IBR A;  5E2E A;  2V8F A;  4UA6 A;  5HD5 A;  2EX8 A;  3FZC A;  4LRX C;  2VV8 A;  2XRN A;  4I3A A;  5U47 A;  2JE5 A;  3MS6 A;  1FCM A;  2JKR I;  3T1X A;  5DFX A;  3A0R A;  2I72 A;  3N4I A;  3F1O B;  3IH9 A;  2EFX A;  2DMW A;  1NWZ A;  1P9R A;  3JYI A;  4G3V A;  3S7Q A;  3T4J A;  3P09 A;  1SDN A;  2A2L A;  3C2W A;  3OCL A;  4IUK A;  3BEB A;  4Y7P A;  4GDN A;  3MBZ A;  1YLJ A;  5HX9 A;  4PM7 A;  3RXX A;  2XA7 S;  4ESP A;  5A90 A;  3BLM A;  5CXW A;  3TOI A;  2VGJ A;  2GDN A;  2ZC3 B;  3Q7V B;  5HAI A;  3M6B A;  3PAG A;  1PFL A;  3SS3 A;  1LSX A;  3IX4 A;  5CGW A;  1PWG A;  3BJN A;  3KX0 X;  2H0T A;  3UNW A;  3D4F A;  1S0W A;  3IXD A;  3PBN A;  3FPV A;  1H5X A;  4OPY A;  3MKF A;  5HL6 A;  4FOF A;  1TVF A;  1KE3 A;  3JPU A;  4GJ4 A;  2H5S A;  4LCL A;  4X53 A;  2PDR A;  2XK1 A;  3Q07 A;  4M4X A;  3MR0 A;  1IKI A;  3G2Y A;  1VQQ A;  4L9G A;  3HCY A;  4PKY A;  4JF4 A;  2ZM8 A;  3DAV A;  3HLC A;  2EWV A;  2ZQ7 A;  5GLD A;  3FWL A;  3CIT A;  4R6L A;  1H8Z A;  2P74 A;  1CF0 A;  3SS5 A;  2B95 A;  2FH5 A;  4U3T A;  2A49 A;  2B5R A;  1LSW A;  1K6S A;  4EXO A;  1DJA A;  1L2S A;  4FH2 A;  5IT5 A;  3H7W A;  4UA9 A;  5FAS A;  1K57 A;  4PAU A;  5F68 A;  4MBH A;  1K56 D;  1YPR A;  4EUV A;  1N4O A;  2VZW A;  4E3L A;  4RVA A;  4PM5 A;  1N9B A;  3BM6 A;  2R78 A;  4LV1 A;  3UPP A;  1Q2P A;  3V67 A;  5GL9 A;  1F9I A;  5JYO A;  4S2N C;  4AFI A;  1E3U A;  4KZA A;  3A3J A;  3B3X A;  1LL9 A;  1KOU A;  1TS6 A;  4Z9Q A;  3T50 A;  1KDW A;  4LFU A;  3UDX A;  4X69 A;  1RGY A;  3E4O A;  3BFE A;  4S2L A;  5GHZ A;  4QHC A;  3QP2 A;  3QP5 A;  2JN7 A;  3M2K A;  2WZX A;  3ZG0 A;  3L9K A;  4EV4 A;  4D2O A;  4KUO A;  3IXG A;  1UWN X;  4PMA A;  2XGN A;  1UGU A;  4CLC C;  1PRQ A;  2PBD P;  2P04 A;  2GNX A;  3V39 A;  3EEH A;  4OQG A;  1TD5 A;  2XD1 A;  3EQU A;  4OQH A;  3IWI A;  1GSV A;  2HDQ A;  1YAX A;  4DJ3 A;  3BFD A;  3GRJ A;  2XFS A;  2OLU A;  2ZC5 B;  4HES A;  3IWO A;  4PM8 A;  5DFY A;  1OTI A;  3C8C A;  4BBU A;  3A3D A;  1ONH A;  4DF6 A;  3MZE A;  1F5M A;  2HJ9 C;  4CJN A;  5HDC A;  3UB7 A;  2KDK A;  4MBK A;  1WE4 A;  2XD5 A;  5HPF A;  3IHB A;  1IYS A;  3UY6 A;  4HOI A;  3NCK A;  4R3A A;  3TRC A;  3ZNY A;  3ZHH A;  2WAD A;  3OOV A;  3BWL A;  2VV6 A;  3GV9 A;  4BD0 A;  4WMC D;  1F2K A;  3ZFZ A;  1GHM A;  2WAE A;  3RXW A;  4BBV A;  3UME A;  1Y28 A;  3HRE A;  3TE8 A;  1OT6 A;  2WGW B;  1RCJ A;  5I94 A;  4L0L A;  4WF0 A;  4YOF A;  3O3V A;  5KSC A;  1RGZ A;  4Y15 A;  2ZBB A;  3BFF A;  3HLE A;  3R7W B;  1GA0 A;  2XRO A;  4GD8 A;  4MNR A;  4S2K A;  5HSQ A;  2KX6 A;  5E2H A;  1ODV A;  2WAF A;  4P0M A;  4XT2 A;  2Y8H A;  5DKL A;  2OV5 A;  5HW3 A;  4Y5F A;  1D7E A;  3LID A;  4PKY G;  1BLP A;  5CX7 A;  4D60 A;  2Y79 A;  2WYX A;  4FUW A;  5IS1 A;  1W63 Q;  1FSY A;  2HGV A;  2CMN A;  1NLZ A;  3NOT C;  4FSF A;  1N9L A;  3G34 A;  4ZJ2 A;  1ES4 A;  3MXQ A;  1DP8 A;  5EVE A;  1ESU A;  3JVU A;  1NLY A;  4EES A;  3FC7 A;  2XEP A;  5BOH A;  1HLU P;  4B9O A;  3VP1 A;  2ZC7 A;  3F1P A;  1PW8 A;  3LYX A;  3KYE A;  3IT9 A;  4ZDX A;  2W1T A;  3VFH A;  1NJ4 A;  5FAO A;  3ZG5 A;  4GHI A;  1Y4O A;  4BEN A;  2W3E A;  1S6R A;  2GJ3 A;  3HLB A;  2L4R A;  1XKZ A;  5EUA A;  4X1M A;  3BQA A;  2VLG A;  5IHV A;  2JKT M;  1JWP A;  4I3J A;  5EVI C;  2P9V A;  2EXA A;  2KLI A;  3LUQ A;  3E4Q A;  5HDS A;  3ZG9 B;  2C6W B;  4DJ2 A;  2Y2M A;  4Y0O A;  2K31 A;  4JXS A;  3G30 A;  1KGG A;  5FQM A;  3VE3 A;  1XXM A;  4Q8I A;  1HVB A;  4E6X A;  1IEL A;  1W8Y A;  3FKV A;  4LPZ A;  3A3E A;  4OOM A;  4LLO B;  1KE4 A;  4F3L A;  3S1Y A;  1ALQ A;  5EE8 A;  5E43 A;  3S7N A;  1MBL A;  4WBG A;  2NUT C;  3WS4 A;  3GQZ A;  3G4P A;  3CPT B;  2VJW A;  2G2U A;  5HAR A;  2PR6 A;  4LEN A;  3AGE A;  3R7W A;  4FH4 A;  1NRF A;  4NXG A;  5HWV A;  4OPZ A;  4UQI M;  2JCH A;  1MY8 A;  4KZ4 A;  4QY6 A;  1L0E A;  2GX5 A;  2JKR M;  3E98 A;  3IF5 A;  1AXB A;  3ZVT A;  3K3D A;  3TG9 A;  1YLT A;  1NZU A;  1NXY A;  1OTB A;  1PIO A;  3F1P B;  4EWF A;  1U60 A;  1XFN A;  3P01 A;  4GS9 B;  4IHQ A;  3BY8 A;  1A0K A;  3E2K A;  2WK0 A;  4XUX A;  4FD8 A;  2HDR A;  5FI6 A;  4R3B A;  3S7O A;  2XF3 A;  1N9N A;  2ZL1 B;  4LRY C;  3FG8 A;  3S4X A;  2W3H A;  4IBX A;  4CLC D;  2O0Y A;  4OP8 A;  1FQG A;  3CLO A;  1OPX A;  5GLB A;  3UN7 A;  1NYY A;  2PAV P;  2XSS A;  4HY8 A;  5J8X A;  4O0P A;  2O99 A;  1W8Q A;  3IX3 A;  3Q81 A;  5KIZ A;  4NEE D;  2O9C A;  2Y2P A;  1XJ6 A;  2HZ5 A;  5FQK A;  2FFY A;  1VM1 A;  2DCF A;  3G6O A;  5FEG A;  3F1N A;  3VFF A;  4DRT A;  4OQ0 A;  4HP9 A;  1T19 A;  5A91 A;  4P85 A;  3C4O A;  5J4E A;  1VB6 A;  2HPB A;  3HJI A;  3VSL A;  4WN5 A;  2W0N A;  4XT2 B;  4ETZ A;  5DF9 A;  2V20 A;  1XGI A;  4WMC A;  1C3B A;  1XJ3 A;  1IKG A;  2ZJ9 A;  4DMZ A;  1FIK A;  1PW1 A;  1ZG4 A;  4KG6 A;  4P6Z M;  1ERO A;  4X55 A;  4JF5 A;  5G18 A;  2JKG A;  4QU3 A;  3CUE A;  5F69 A;  1L3L A;  3N8S A;  5CGS A;  3LIB A;  2P08 A;  4JXV A;  4UEY A;  3NDE A;  4K91 A;  3ZGA B;  2ACG A;  4NXF A;  4KZ3 A;  3V3S A;  1GA9 A;  5IU1 A;  3DTK A;  2H28 A;  5EPH A;  4S2J A;  2PRF A;  3SH9 A;  3HUN A;  1P97 A;  4BL2 A;  2WKE A;  3EGX C;  4P6Z S;  4KQO A;  3GTC A;  2V8C A;  2OWJ A;  1BLC A;  1FCN A;  4MCW A;  4N1X A;  5DF8 A;  4ARZ A;  2ZQ9 A;  4RX2 A;  3BFG A;  3S7P A;  1SKO A;  3IH8 A;  2INW A;  4L9F A;  4BJP A;  3A3F A;  4E6W A;  1S1Y A;  2Z2M B;  1BT5 A;  2WKP A;  2O9B A;  3M6H A;  4XXR A;  2ZQA A;  2EX2 A;  3RTY A;  4OH0 A;  1DRM A;  2W3G A;  1FR1 A;  3NC8 A;  1IFQ A;  3E2L A;  4JBF A;  4KZB A;  4RYE A;  2XA7 M;  4PM6 A;  5EM1 A;  3KYZ A;  4QPR A;  5DTK A;  1G6A A;  4JGP A;  3LR4 A;  4UAA A;  1W5D A;  4YFM A;  1BYW A;  3GR2 A;  1K56 A;  5FAQ A;  4C75 A;  4GCZ A;  1S66 L;  4F3L B;  4MN5 A;  3KSF A;  3G31 A;  4C3Q A;  4G3K A;  3U4L P;  5TR7 A;  1NZO A;  3VP3 A;  3IF6 C;  3RH8 B;  3SOI A;  5F5Y A;  3PXP A;  5EVI A;  5FQJ A;  1YM1 A;  5AQA A;  5F83 A;  3SS4 A;  4MDZ A;  4ZAM A;  3CPT A;  3QNB A;  3Q7V A;  5KZH A;  4CPK A;  1ERQ A;  3VE4 A;  1OTA A;  4MEZ A;  3IBJ A;  4K08 A;  1ZTU A;  1DY6 A;  5HD3 A;  4X6T A;  3NHQ A;  1M6K A;  1S4S A;  4I3I A;  4XUZ A;  2QKP A;  1JVJ A;  3H9W A;  1PWC A;  2X02 A;  3ZDJ A;  4E3I A;  1K57 C;  3RFB A;  4EEP A;  1SZV A;  4Q0H A;  3ZYT A;  2E8I A;  2M1C A;  3ZVW A;  2IA2 A;  1I2S A;  1LI9 A;  3NEC A;  2PU4 A;  1JTD A;  5DVA A;  4DXC A;  3NOU C;  2PD8 A;  4EBN A;  2YKH A;  3EWK A;  4G3W A;  4EBP A;  3Q7Z A;  2UV0 E;  2Y2K A;  3N8L A;  3T4S A;  1SCW A;  2JKF A;  1E25 A;  4GZB A;  2VV7 A;  4HJ4 A;  4K0W A;  1P9W A;  1GHP A;  3EOI A;  1S67 L;  1SDE A;  3OPP A;  5EEC A;  4ZJ3 A;  4GD6 A;  2LB9 A;  2Z6C A;  3UB9 A;  4HBT A;  2H10 A;  5L10 A;  1M40 A;  1TDL A;  1LLB A;  2QZ6 A;  4R1G A;  1ESI A;  1PI5 A;  5TGF A;  1XA7 A;  1CK3 A;  4GDB A;  2JBF A;  2Y59 A;  3NIA A;  4MN7 A;  4P6B A;  5CEB A;  4ZBE A;  3VP2 A;  3FPW A;  2ZLY A;  5G4Z A;  3KSH A;  5F1G A;  3PBS A;  4OQI A;  5CHJ A;  1ES2 A;  3QP1 A;  5F82 A;  3UPN A;  3DW0 A;  2WUQ A;  3LIF A;  2L0W A;  3LFV A;  1WYB A;  2OAQ 1;  2K2N A;  4OON A;  3LEQ A;  1DP9 A;  5CRF A;  4IBR A;  3DWZ A;  1SHV A;  2EFU A;  4N92 A;  3T4Q A;  1MC0 A;  1BUE A;  4B4X A;  3A0V A;  2O9A A;  3B42 A;  3V3R A;  3P98 A;  3ZCZ A;  1BLH A;  4B88 A;  3SW1 A;  1K25 A;  3MJQ A;  3BY9 A;  5CEC A;  1WYC A;  4I38 A;  3VMA A;  3PBO A;  5EVI B;  4EQI A;  2D02 A;  1EI5 A;  2ZC6 B;  1CEG A;  3C5A A;  3MKE A;  4KUK A;  3RJU A;  1KGE A;  1QME A;  2JC7 A;  5HDD A;  1NY0 A;  4Y0T A;  3QP8 A;  4JKT A;  3SZT A;  4U0T A;  4EU0 A;  3N6I A;  3AGF A;  2ZMA A;  4BMW A;  3MZD A;  4LRZ E;  4DXB A;  2J9O A;  1TEM A;  1MZU A;  3KSI A;  2RCX A;  1AWI A;  3H82 B;  3CAX A;  1BZA A;  3MZF A;  4Q0J A;  3PBT A;  5C5K A;  2A3U A;  3WRT A;  2V0W A;  3DWK A;  3H82 A;  4IED A;  1ZG6 A;  2HV1 A;  1DP6 A;  2QJ7 A;  1G5U A;  1LI0 A;  3ZNT A;  5DKK A;  4UQI S;  2PU2 A;  2HDU A;  1IEM A;  4BLM A;  2Y2Q A;  3O86 A;  3FV7 A;  4ZJ1 A;  2QWS A;  1MKM A;  3NOP C;  4LV3 A;  4R38 A;  4DE0 A;  1HZO A;  4NK3 A;  4DN0 A;  2HP5 A;  3IXB A;  2V1B A;  5L09 A;  5M19 A;  4RQ9 A;  4I39 A;  4S2N A;  3MQ0 A;  2BLS A;  3BRM A;  4EUZ A;  2ZQ8 A;  3DTM A;  3F1N B;  5M18 A;  2WGW A;  4OLD A;  4KG5 A;  1CEF A;  2BAS A;  2VGL S;  4DDS A;  3E4P A;  4JXG A;  1PZP A;  1PWD A;  3G2Z A;  1OTD A;  5CED A;  4X25 A;  4IVI A;  4DE1 A;  3DBA A;  5FSR A;  5HAQ A;  2PBY A;  4N9L A;  2HJE A;  3UE3 A;  1MPL A;  4N9K A;  4BD1 A;  3AGD A;  2Z2L B;  3IHA A;  3N8R A;  2J9P A;  5FAP A;  3PYP A;  4WZ5 C;  1MWS A;  2CC1 A;  3HLW A;  5L07 A;  3NY4 A;  3VV4 A;  3Q82 A;  1FCO A;  5EVI D;  2PR5 A;  3IS2 A;  2ZOI A;  2EX9 A;  1UWP X;  1IYQ A;  4YIN A;  1VEU A;  4MLL A;  3HBR A;  5DJT A;  4N1H A;  1LL5 A;  1JWZ A;  1VHM A;  3HLG A;  2PHY A;  5A8B A;  1GHI A;  1ES5 A;  4HEF A;  2Z6D A;  3CJM A;  2X01 A;  1LSV A;  2JHE A;  5HZH A;  1QMF A;  4PM9 A;  1H3Q A;  1G28 A;  3ULF A;  5A92 A;  4HP4 A;  3CWF A;  4BQM A;  1Z09 A;  4S2P A;  2W3F A;  4Y0U A;  5L2F A;  1T1A A;  1KGF A;  3O88 A;  4OPR A;  5CHM A;  2J3W A;  4HH2 A;  3BLS A;  1K4F A;  1K54 A;  4PHT A;  3CUE C;  3IF6 B;  5F6A A;  2QHK A;  2M7U A;  1FSW A;  2ZD8 A;  3WS0 A;  5F1F A;  3SH7 A;  3LY4 A;  4QY5 A;  4K0X A;  5TBM A;  3W4Q A;  2J3T D;  2EWW A;  1K54 C;  4WEJ A;  4DE2 A;  5MC7 A;  3LEZ A;  5M1A A;  1J3W A;  2JKT I;  3N7W A;  2ZC4 B;  4S2I A;  1W7F A;  1MKI A;  4BBT A;  5FDS A;  5HL1 A;  3ZG7 B;  4R23 A;  4DDY A;  1L0F A;  2VKS A;  3MQQ A;  5FI2 A;  2V1A A;  5CTM A;  3MFX A;  2KOI A;  4R4R A;  5AQ7 A;  2EX6 A;  5FDH A;  2WKI A;  4OVD A;  4PPR A;  3MXS A;  2NUP C;  3VP0 A;  3MFD A;  2FZ0 A;  1O07 A;  2ZMF A;  2Y2L A;  1D06 A;  2Q9M A;  4OLG A;  3UMD A;  3NBL A;  1IYO A;  3IS2 B;  4FTX A;  3TJZ C;  4S2M A;  4GS9 A;  2I9V A;  1VEU B;  2Y55 A;  5I5L A;  5FEF A;  3HLD A;  1LHY A;  5EV0 A;  2IWC A;  1IYP A;  4O7D A;  1GCE A;  3NI9 A;  4KZ7 A;  2V9A A;  3UDI A;  3LI9 A;  1Q2Q A;  1GSX A;  2MJ6 A;  4GKU A;  4MMN A;  2XH9 A;  3VP4 A;  5LBR A;  1FIL A;  5K5B A;  1X0O A;  1G68 A;  3LIE A;  3LI8 A;  1Z6F A;  4GLQ A;  4HQA A;  4WUJ A;  1DJC A;  2XQZ A;  5TFQ A;  1RP5 A;  1L0D A;  1S4R A;  4P87 A;  3NDG A;  4A5R A;  1LL8 A;  1YLP A;  3CHW P;  5DTS A;  3HUO A;  1CI8 A;  4IUH A;  4KZ8 A;  3MMH A;  3T1S A;  5EM0 A;  4QJG A;  3LIA A;  2D01 A;  4E3O A;  2W1T B;  2Y2H A;  3C7U A;  3ITA A;  3I7J A;  4M3K A;  1E3U D;  3VOL A;  2XFT A;  1YSP A;  4HBU A;  4CLC A;  3LR3 A;  3LR5 A;  3MF0 A;  3IXH A;  2G7U A;  2VEA A;  3C4P A;  5EFW A;  3PTE A;  3C38 A;  1YMS A;  3T12 B;  3LIC A;  4HI4 A;  1KE0 A;  4KQQ A;  1H8Y A;  2Q9N A;  4DKI A;  1I2W A;  3DTI A;  4O8G A;  1OME A;  1W79 A;  3NJA A;  3T1R A;  5G4Y A;  1K4E A;  5HAP A;  5CER A;  4OOL A;  5E2G A;  4LCM A;  3A3I A;  3ZG8 B;  2HP9 A;  4HIA A;  2PYP A;  4ZTK A;  1JNU A;  3O5Y A;  2E8J A;  3IX8 A;  4Y13 A;  4GNU A;  1MWT A;  5E2F A;  4S2O A;  4JLF A;  4Y3I A;  3U2A A;  3HLF A;  2WKH A;  1LT0 A;  3ISG A;  2WGV A;  3UB8 A;  1YLY A;  4JXW A;  5CTN A;  5AQ9 A;  1MWU A;  4HHD A;  3BQ8 A;  3K2N A;  3LCE A;  4OOY A;  1S1Z A;  1XP4 A;  4IVK A;  4ETX A;  3OPH A;  2BG1 A;  5TBM B;  2H0Y A;  2PT7 A;  1JWV A;  4EER A;  4RX3 A;  4E3J A;  1YLZ A;  5DTT A;  3BFC A;  4EQ1 A;  2A24 A;  3D3O A;  3B33 A;  3IF6 A;  1N9O A;  4YNR A;  1K55 A;  3OPL A;  1XX2 A;  1ZHH B;  3K3C A;  1NYM A;  4BWI A;  3EEA A;  5CGX A;  5HFO A;  2J80 A;  3KO6 A;  3BW6 A;  3T4L A;  3OPR A;  2VK3 A;  1PI4 A;  3VOY A;  3OZH A;  1H0M A;  3T4T A;  3G32 A;  3H7W B;  2BTF P;  4X68 A;  4EEU A;  1SKO B;  2Y91 A;  5AVE A;  3ZQ5 A;  1HTZ A;  3KSG A;  3W8K A;  3W2Z A;  3GVB A;  4NKP A;  2DRW A;  2J3T C;  2ZMV A;  4JGQ A;  4O01 A;  4HNB A;  3T1Q B;  1K55 C;  4BL3 A;  2ZL1 A;  4JF6 A;  3MQO A;  1F98 A;  1KVM A;  4KQD A;  1PNE A;  4E3N A;  1FR6 A;  3WWX A;  1BTL A;  3CI6 A;  1IOU A;  2GZA A;  5FQI A; 
#chains in the Genus database with same CATH homology
 5FL3 A;  4RQ9 A;  3P7N A;  4I39 A;  3MQ0 A;  2OWH A;  1V9Z A;  5KSH A;  3E0Y A;  3S7O A;  1N9N A;  4LRY C;  3FG8 A;  2W3H A;  4CLC D;  3F1O A;  3F1N B;  2O0Y A;  2L1M A;  3CLO A;  1OPX A;  2BAS A;  1LSX A;  2QJ5 A;  2VGL S;  4WEL A;  2XSS A;  3BJN A;  3E4P A;  3KX0 X;  4HY8 A;  4O0P A;  2O99 A;  2HF6 A;  1OTD A;  2PD7 A;  1XFQ A;  2VX8 A;  5KIZ A;  3DBA A;  4NEE D;  2O9C A;  3A0S A;  1TS8 A;  3PBN A;  1XJ6 A;  3FPV A;  2HJE A;  3G6O A;  3UE3 A;  5HL6 A;  3F1N A;  3C30 A;  4FOF A;  3JVV A;  3PYP A;  4HP9 A;  4GJ4 A;  1T19 A;  2PDR A;  5J4E A;  4M4X A;  1VB6 A;  3HJI A;  3MR0 A;  3VV4 A;  4WN5 A;  4L9G A;  3HCY A;  4PKY A;  2W0N A;  4XT2 B;  2PR5 A;  4ETZ A;  5DF9 A;  3IS2 A;  2B18 A;  2ZOI A;  1UWP X;  2EWV A;  3T4O A;  1EW0 A;  1OJG A;  1T1B A;  1XJ3 A;  3CIT A;  4R6L A;  4DMZ A;  5DJT A;  3KYQ A;  2FH5 A;  5DJU A;  1T18 A;  1VHM A;  2PHY A;  1LSW A;  1H8M A;  1V9Y A;  4WEK A;  5A8B A;  4EXO A;  4WLA A;  1YSQ A;  5IT5 A;  2EA9 A;  2Z6D A;  4IJG A;  4P6Z M;  3H7W A;  1LSV A;  2JHE A;  4PAU A;  5F68 A;  5HZH A;  2YKF A;  1H3Q A;  3CUE A;  5F69 A;  1G28 A;  3ULF A;  4HP4 A;  3CWF A;  2P7J A;  4NXB A;  4H6J B;  2B02 A;  1TS7 A;  4EUV A;  3LIB A;  2P08 A;  2VZW A;  2W3F A;  4UEY A;  1T1A A;  2R78 A;  4NXF A;  3V67 A;  1F9I A;  5HWW A;  2J3W A;  5IU1 A;  4HH2 A;  2H28 A;  4PHT A;  3CUE C;  5F6A A;  4AFI A;  2QHK A;  2M7U A;  1OT9 A;  1P97 A;  4EET B;  1YKD A;  3EGD C;  1KOU A;  1NRJ A;  1TS6 A;  3EGX C;  4P6Z S;  3OC2 A;  4ZRR A;  2WKR A;  4KQO A;  5TBM A;  3T50 A;  1W63 M;  2OWJ A;  2J3T D;  2EWW A;  3E4O A;  4MCW A;  4WEJ A;  4ARZ A;  2JN7 A;  5MC7 A;  4YWZ A;  3S7P A;  2JKT I;  4KUO A;  1UWN X;  2INW A;  4L9F A;  2VGL M;  4BBT A;  4BJP A;  1UGU A;  1P0Z A;  4CLC C;  2P04 A;  1S1Y A;  2GNX A;  3EEH A;  4HH3 A;  2WKP A;  2VKS A;  1WA9 A;  1TD5 A;  2O9B A;  2V1A A;  3MQQ A;  4I5S A;  4JGO A;  4ME4 A;  3MFX A;  3EQU A;  2W27 A;  2KOI A;  1GSV A;  3PBQ A;  1YAX A;  4DJ3 A;  3RTY A;  1DRM A;  2W3G A;  1STZ A;  1IFQ A;  2NUP C;  2XA7 M;  3KYZ A;  2FZ0 A;  5DFY A;  4QPR A;  2ZMF A;  1OTI A;  3C8C A;  1D06 A;  4BBU A;  4JGP A;  5TJJ A;  3UB6 A;  3LR4 A;  3UMD A;  5AJG A;  1BYW A;  3IS2 B;  1F5M A;  2HJ9 C;  2W3D A;  5HDC A;  3UB7 A;  2KDK A;  2LB5 A;  4JGR A;  3TJZ C;  4GS9 A;  5HPF A;  2I9V A;  3D72 A;  5I5L A;  4GCZ A;  1OJ5 A;  1S66 L;  2OAP 1;  2M7V A;  5J7E A;  4Z1W A;  4F3L B;  4HOI A;  4MN5 A;  2QYB A;  3KSF A;  4R3A A;  4H6J A;  3TRC A;  4G3K A;  4Q0I A;  3GDI A;  2V9A A;  4ARZ B;  3RH8 B;  3LI9 A;  3OOV A;  5F5Y A;  2MJ6 A;  1GSX A;  3BWL A;  4MMN A;  2VV6 A;  3GEC A;  3PXP A;  5LBR A;  1T1C A;  2OOL A;  5K5B A;  1X0O A;  2K7S A;  3R4K A;  3LIE A;  3OCN A;  4MDZ A;  4BBV A;  3LI8 A;  3UME A;  1Y28 A;  4GLQ A;  4HQA A;  4WUJ A;  3HJK A;  3TE8 A;  3VE4 A;  1OTA A;  3IBJ A;  4GW9 A;  1S4R A;  1ZTU A;  4K08 A;  1OT6 A;  3NHQ A;  4I3I A;  5HD3 A;  1S4S A;  1LL8 A;  2QKP A;  3ICY A;  4L0L A;  3H9W A;  3PBR A;  3EQV A;  4WF0 A;  4YOF A;  1OTE A;  5J3W A;  3B47 A;  4IUH A;  3RFB A;  2ZBB A;  4EEP A;  3MMH A;  4CLC B;  4GHI B;  4Q0H A;  3R7W B;  3ZYT A;  2M1C A;  5L8M A;  2XRO A;  2IA2 A;  3LIA A;  5HSQ A;  2KX6 A;  2PYR A;  2D01 A;  2W1T B;  3NOU C;  1ODV A;  3PR6 A;  3UE6 A;  2PD8 A;  3OLO A;  2YKH A;  3EWK A;  4G3W A;  4R70 A;  3VOL A;  4XT2 A;  1YSP A;  4Y2F A;  3PHY A;  4CLC A;  1TF1 A;  2V0U A;  3T4S A;  2Y8H A;  5DKL A;  3LR3 A;  4MN6 A;  1D7E A;  3LID A;  4Y5F A;  2VV7 A;  4PKY G;  4HJ4 A;  3LR5 A;  2VA0 A;  1P9W A;  5CX7 A;  3MF0 A;  1TS0 A;  1G6O A;  2G7U A;  2Y79 A;  1S67 L;  3EOI A;  5IS1 A;  2VEA A;  5EFW A;  4HJ3 A;  5AVF A;  1W63 Q;  2A24 B;  2LB9 A;  3C38 A;  2Z6C A;  2HGV A;  2CMN A;  1NLZ A;  3NOT C;  4FSF A;  1N9L A;  3LIC A;  4HI4 A;  3UB9 A;  3MXQ A;  1DP8 A;  5HWT A;  4O8G A;  3JVU A;  1NLY A;  1XJ2 A;  4EES A;  3NJA A;  3FC7 A;  4B9O A;  5G4Y A;  3F1P A;  4OOL A;  3LYX A;  4HJ6 A;  2WKQ A;  2W1T A;  4B93 A;  5HPI A;  4HIA A;  4MN7 A;  2PYP A;  4L9E A;  1JNU A;  3O5Y A;  3FPW A;  4GHI A;  5G4Z A;  3KSH A;  2ZOH A;  2W3E A;  3PBS A;  2W1R A;  4Y3I A;  3U2A A;  2GJ3 A;  2L4R A;  3BQA A;  3LIF A;  2VLG A;  1LT0 A;  2JKT M;  2L0W A;  3LFV A;  2OAQ 1;  2K2N A;  1DP9 A;  3UB8 A;  3T4Q A;  4I3J A;  1MC0 A;  3T4K A;  3A0V A;  4HHD A;  2KLI A;  3BQ8 A;  3LUQ A;  2O9A A;  3B42 A;  3E4Q A;  1XJ4 A;  1S1Z A;  3K2N A;  5HDS A;  3LR0 A;  4DJ2 A;  4CQH A;  3SW1 A;  3MJQ A;  3BY9 A;  4ETX A;  4I38 A;  2K31 A;  4CLC E;  3PBO A;  3TW8 A;  5TBM B;  3VE3 A;  4EW7 A;  2PT7 A;  2D02 A;  4NXE A;  4EER A;  4LPZ A;  1GSW A;  4II7 A;  4EQ1 A;  3OBF A;  2A24 A;  3D3O A;  3B33 A;  4OOM A;  4LLO B;  4WL9 A;  4E04 A;  1N9O A;  3IBR A;  4YNR A;  4F3L A;  1ZHH B;  3K3C A;  4BWI A;  4KUK A;  5HD5 A;  3EEA A;  3S7N A;  5HDD A;  2NUT C;  4LRX C;  2VV8 A;  2XRN A;  2J80 A;  3KO6 A;  3BW6 A;  4I3A A;  3T4L A;  4EU0 A;  2VJW A;  2PR6 A;  4BMW A;  3R7W A;  4NXG A;  2JKR I;  5HWV A;  4UQI M;  5DFX A;  3A0R A;  3T4T A;  4LRZ E;  3F1O B;  3H7W B;  1MZU A;  2DMW A;  1NWZ A;  4EEU A;  3KSI A;  1P9R A;  4G3V A;  5AVE A;  3ZQ5 A;  3H82 B;  3CAX A;  2GX5 A;  4Q0J A;  3KSG A;  3W2Z A;  2JKR M;  3PBT A;  3S7Q A;  3E98 A;  5C5K A;  3T4J A;  4NKP A;  2J3T C;  2V0W A;  2ZMV A;  3H82 A;  3K3D A;  2HV1 A;  4JGQ A;  4HNB A;  4O01 A;  1DP6 A;  2QJ7 A;  1OTB A;  3MQO A;  2A2L A;  1F98 A;  5DKK A;  4UQI S;  3C2W A;  3F1P B;  4KQD A;  3OCL A;  4IUK A;  1XFN A;  2QWS A;  3P01 A;  4GS9 B;  4IHQ A;  1MKM A;  3BY8 A;  3NOP C;  4R38 A;  4DN0 A;  3CI6 A;  1IOU A;  2V1B A;  2XA7 S;  2GZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...