1XJ3A

Bjfixlh in unliganded ferrous form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 29
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj3A00
4PKYA 2V9AA 5DJTA 3NOTC 2A24A 1F98A 3G6OA 3PYPA 5KIZA 3CAXA 2W27A 2BASA 5DKLA 4MN5A 4GS9B 1N9NA 4PKYG 4EW7A 1OJ5A 4R3AA 3UMDA 3NOUC 1VB6A 1P0ZA 1N9LA 4GW9A 2QWSA 5HDDA 4YWZA 3F1PB 5HSQA 3ZQ5A 5J4EA 3B33A 3LICA 4I5SA 5HD3A 3FC7A 5AVEA 4NXEA 3E4QA 3GECA 2JN7A 3A0SA 4GHIB 3T50A 3MJQA 2JHEA 1JNUA 4NXGA 3MR0A 2D01A 5TBMB 2GJ3A 3CWFA 4RQ9A 2V1AA 4GS9A 4HH2A 4WF0A 3LIFA 4HP4A 5HDSA 4I39A 1XJ4A 4HJ6A 3MFXA 5DKKA 3GDIA 4EQ1A 1TS8A 3IBRA 5F68A 4LLOB 2PD8A 5HDCA 1BYWA 2I9VA 2PYRA 3UB6A 3IS2B 3MQQA 3F1PA 2V0WA 3ULFA 2EA9A 3A0RA 3HJKA 2L4RA 2PR5A 4EEUA 4B9OA 4EERA 3LIEA 4GHIA 3FG8A 3H82B 3F1OB 2QJ7A 1XJ2A 4HOIA 4HHDA 4LPZA 2Z6DA 1S66L 3UB9A 1S4SA 2PD7A 1N9OA 4KUKA 3D72A 5A8BA 1S67L 5I5LA 5TBMA 1S1YA 3KX0X 1T1CA 3F1NB 3EEHA 1WA9A 1S4RA 4NXBA 1OTBA 1T1BA 4NXFA 4LRYC 3LI8A 1GSVA 1XJ3A 2PHYA 2J80A 1DP8A 3IS2A 1G28A 3CLOA 1LSWA 3UB8A 3LIBA 5IS1A 2INWA 2QKPA 1LSXA 4HI4A 4DJ3A 2ZOIA 4I3IA 3A0VA 5DJUA 1KOUA 3H82A 3F1OA 4HQAA 1GSXA 3SW1A 2QJ5A 2V0UA 3ICYA 4HJ3A 2P7JA 2YKHA 2VV7A 1T18A 4L9FA 2ZOHA 2WKPA 5HWWA 4LRXC 3K3CA 3LYXA 3HJIA 4I38A 2R78A 1T19A 3F1NA 1TS7A 1XJ6A 3H7WB 4HY8A 1OT9A 4BBTA 3E4PA 2CMNA 2WKRA 2Z6CA 4E04A 1P97A 4XT2B 1V9ZA 1F9IA 2VV8A 4R70A 5HZHA 2KDKA 4F3LB 4K08A 1MZUA 3RH8B 1OTAA 3UMEA 5J3WA 1NWZA 5EFWA 3UB7A 3VE4A 3BWLA 1OTDA 3UE6A 4EEPA 3C8CA 5J7EA 1S1ZA 3K3DA 4BBUA 2VEAA 2B02A 4KUOA 1OTEA 1XFNA 2M1CA 3H7WA 4H6JB 4M4XA 1LSVA 2V1BA 4LRZE 3VOLA 4JGOA 1OT6A 2VLGA 4XT2A 4WUJA 3VE3A 1TS0A 3BY9A 4HJ4A 4F3LA 4R6LA 3OLOA 1D7EA 4EETB 3BY8A 4WLAA 1DRMA 1Y28A 1ODVA 1T1AA 1DP6A 4EXOA 4JGRA 5F5YA 1OTIA 3H9WA 3LIAA 2PYPA 4H6JA 3LUQA 4EESA 3LI9A 2HV1A 4HH3A 1LT0A 5HWVA 5F69A 3RTYA 5AVFA 2PR6A 4WL9A 1V9YA 4R38A 3E4OA 2VV6A 1LL8A 1XFQA 2L1MA 4I3JA 1DP9A 5HWTA 4L9GA 5F6AA 1UWPX 2W0NA 3EWKA 4I3AA 3MXQA 1UWNX 5IU1A 1UGUA 2K7SA 2WKQA 1EW0A 4HNBA 2OWJA 4HIAA 2A24B 2PDRA 5G4YA 3NJAA 2OWHA 3PHYA 3NOPC 5G4ZA 5HD5A 1OJGA 4L9EA 2L0WA 4HP9A 4BBVA 3LIDA 3C2WA 4KQDA 4JGPA 1TS6A 2OOLA 3P7NA 2YKFA 1D06A 3NHQA 4WN5A 4MN6A 2QHKA 2ZBBA 3MQOA 1GSWA 4GCZA 2KX6A 1X0OA 2H28A 4JGQA 2D02A 4DJ2A
chains in the Genus database with same CATH superfamily
4E3NA 4OOMA 3T4SA 4Y0OA 2A24A 4BL2A 1ACFA 3OZHA 4BLMA 3PYPA 4GB7A 2VZWA 2O9CA 5F82A 1MWUA 1G6AA 3S22A 4X6TA 4DDYA 5FQ9A 3V5MA 3VV4A 1BULA 3ZG5A 1M40A 1PI5A 1OJ5A 4R3AA 4GJ4A 4UQIM 1VB6A 1G6OA 4MBHA 4OVDA 2Y2IA 5A92A 4YWZA 2M7VA 3LEZA 5J4EA 4P6ZS 2JKGA 3UPNA 4Y15A 2W3DA 2WGWB 5AVEA 2XROA 3GECA 2EX2A 4MNRA 3A0SA 4PM5A 1GHMA 3T50A 3V67A 4LV3A 3KO6A 4JXSA 1YT4A 1MC0A 1TDLA 4NXGA 2J9OA 3MR0A 4P87A 1ZKJA 5TBMB 2V1AA 1ESUA 5E43A 4I39A 1XJ4A 3GDIA 2V8FA 5TJJA 4OLGA 1H0MA 3IBRA 5JYOA 3V39A 2PD8A 5HAIA 3OPRA 2I9VA 2WGIA 4YNRA 4JBFA 3B3XA 3ZG8B 3PAEA 4C75A 3ULFA 2EA9A 3NDEA 4HBUA 2OLVA 4B9OA 4UQIS 1Y4OA 4EERA 2B18A 4GHIA 3E2KA 4KZ5A 3F1OB 1K4FA 4JF4A 4S2KA 4DKIA 1S0WA 2JKTM 1MKIA 4HOIA 4E3MA 4HHDA 4N9LA 3HLCA 5AQAA 2ZC6B 2BG1A 4C6YA 3KSHA 1KVLA 1S4SA 4KUKA 4KZ3A 2XA7S 4ARZB 3KSFA 2W3FA 3F1NB 4PMAA 3T4QA 4X56A 3T1XA 2Y55A 1EROA 1JWPA 3TW8A 4MCWA 1GSVA 1WE4A 3ITAA 4E3OA 2NUPC 1HVBA 5HPFA 5L10A 2J80A 1LSWA 3LIBA 3QP4A 2C6WB 1PWDA 4CLCA 4MN7A 5IS1A 5CECA 5M1AA 4S2NA 5HFOA 3EQUA 4DJ3A 1TF1A 2ZOIA 3A0VA 4MMNA 3WS1A 2W3EA 3SW1A 3W4PA 4Y13A 3IF5A 4HJ3A 3W4OA 2P7JA 5KZHA 3QP2A 3MXSA 4KZ9A 2ZOHA 5HWWA 1VHMA 3K3CA 2VX8A 4N9KA 2OV5A 1BLCA 4ETXA 3FKWA 2K31A 4HY8A 5K5BA 1OT9A 1MKMA 4FOFA 4BL3A 5EVIA 1BZAA 1WYBA 4Q0IA 3GMWA 4OPQA 3ZYTA 1P97A 4KZ8A 4XT2B 2ZQAA 3IT9A 5FDHA 1F9IA 1XPBA 2Y4AA 4R70A 3P09A 5CXWA 1YKDA 2KDKA 2FZ0A 5F1FA 2G2UA 5EVEA 3RH8B 2ZC4B 3T4JA 2KLIA 2VKSA 4YINA 1IYOA 1H3QA 1ESIA 3SZTA 1NWZA 1VQQA 2QPNA 3C38A 4RA7A 2HP6A 3UB7A 3UE6A 4BWIA 4EEPA 3LR4A 2XFSA 3C8CA 1S1ZA 4OPYA 3SOIA 1ES4A 1KGGA 1RCJA 4GN2A 1OTEA 1XA7A 1XFNA 2M1CA 3AGDA 4H6JB 3IF6C 3Q7ZA 4X1LA 1IYSA 1LSVA 2BTFP 2ZLYA 1LL5A 4JGOA 2XK1A 1I5QA 1OT6A 1PYYA 4O0PA 5CEDA 3T4LA 3SS5A 1EWZA 4F3LA 2O0YA 2GX5A 3NC8A 1XX2A 1KGEA 3UPPA 3OLOA 3BFGA 1QMFA 4MDZA 4XXRA 4LENA 3GV9A 1D7EA 2XH9A 4LV2A 5CEBA 4UA6A 3UE1A 2XFTA 3QHYA 1Y28A 3NCKA 1BUEA 5EVLA 1Q2QA 3BFDA 4MLLA 4JGRA 3R4KA 1OTIA 4PAUA 4CPKA 3MS6A 3LIAA 3SH9A 3MSHA 2ZL1B 1L0DA 2JCHA 2HV1A 4HH3A 3I7JA 1LI0A 4WELA 4WYYA 3BW6A 3JYIA 3LCEA 4EV4A 1F5MA 4RYEA 1V9YA 3NBLA 3E4OA 2VV6A 3M6BA 1XFQA 4I3JA 3DBAA 2QZ6A 2W0NA 3S1YA 3LY3A 4I3AA 4NETA 1UWNX 1BSGA 1SDNA 5IU1A 1XGIA 3N4IA 2PDRA 5JYPA 4U0TA 3PHYA 2HDSA 4BD1A 5IHVA 5HD5A 1VETA 4G3KA 1MPLA 2HF6A 2WAEA 1XGJA 4FH4A 2OLUA 1ERMA 1ZC2A 4Y3IA 3LIDA 4KQDA 4RX3A 1CK3A 2IWCA 3P7NA 4U3TA 4Q0JA 3IH9A 4WN5A 1P9RA 3UPOA 2QHKA 1GSWA 5HW3A 4GCZA 3FKVA 5CHJA 1HLUP 1IKIA 4JGQA 2E8JA 3G2ZA 1K54A 5FI6A 4Y0TA 4PKYA 5DF8A 1BTLA 2V2FF 4OOYA 2P04A 4JF6A 5DJTA 1GA0A 1WYCA 5HX9A 1Y54A 3WS4A 2BASA 5DKLA 2ZQ7A 2HJ9C 1KGFA 5EM0A 3VOYA 3IWQA 1N9NA 3OPLA 1NYMA 4OH0A 4PM6A 4WM9A 2XSSA 3WS2A 4NK3A 1MWRA 3UMDA 3DTEA 1P0ZA 2P9VB 3S7OA 1TEMA 2HDRA 2A49A 3AGEA 2WGVA 2QWSA 3ZQ5A 3B33A 1KDSA 4IBRA 3ITBA 1CEFA 2WZXA 2EWWA 3OPPA 5TR7A 2G2WA 2W1RA 1RGYA 4N1XA 2PAVP 3MJQA 2ZQDA 4LCMA 2JHEA 1JNUA 2A3UA 1SKOB 3QNCA 4LFUA 2D01A 3Q7VB 1YPRA 3A3EA 3CWFA 4QY6A 1E3UA 5AQBA 3LIFA 4E6XA 5HDSA 1NRFA 5FA7A 1TS8A 4ZTKA 5EM1A 3PAGA 4KQQA 1ZTUA 4WZ5A 3VSKA 1BYWA 3TE8A 4R3BA 2PRFA 3EGDC 3MMHA 3TJZC 2ZM0A 3BEBA 3HLDA 3LR0A 2PR5A 3A3JA 1ES2A 2WGWA 3VFFA 2PT7A 2X71A 3LIEA 2JKRI 3OCLA 3RFBA 3PR6A 3SH7A 2Y79A 2XDMA 2O9BA 2A2LA 4LPZA 3B42A 1DJAA 4GD8A 3UB9A 4KG5A 1GHIA 1K25A 1N9OA 3GR2A 1S67L 5TBMA 1S1YA 3KYQA 3CPTB 2XD1A 4EWFA 4LV0A 3BLMA 3EEHA 3TG9A 3CZDA 1JWZA 3M2JA 5CGXA 4BMWA 4JPMA 1FILA 4NXBA 3HBRA 5DTKA 4LRYC 3M6HA 4Z9QA 4DXCA 3L7HA 3A3IA 4LGWA 3KYEA 2EFXA 1XJ3A 3AGFA 2PHYA 4KENB 1G28A 2O9AA 3W4QA 3CMZA 1JWVA 1FSWA 2QKPA 3A3FA 5DJUA 1STZA 3F1OA 4IUHA 3DTMA 4HQAA 4E6WA 3IX8A 1SCWA 2QJ5A 2V0UA 1SKFA 3ICYA 3U4LP 1E4DA 3VP0A 2VV7A 4JF5A 1T18A 2RL3A 3JVUA 4C3QA 4LRXC 4RX2A 4ARZA 1HD8A 3UE0A 3F1NA 1TS7A 4OPRA 2XEPA 3H7WB 4Z1WA 4BBTA 4BJPA 3OBFA 3E4PA 2ZC7A 2PBYA 3PBQA 4D60A 1MY8A 3UB5P 1CI9A 4IUKA 2GZAA 3HUMA 1K55A 4M3KA 5HZHA 3JVVA 4KG2A 5FEGA 1YMXA 2Z2MB 2LB5A 5FQQA 3UMEA 4WEKA 1N9BA 4GOGA 3N6IA 3O88A 1L3LA 2W1TB 2EX8A 4A5RA 2H0TA 3BWLA 1C3BA 3N7WA 3OC2A 4CJNA 3SH8A 3K3DA 2Y59A 4BBUA 4EU0A 3G30A 4ZRRA 2VEAA 4PHTA 1HZOA 2WK0A 3FZCA 3BQAA 2VGJA 5GHZA 2V1BA 2DRWA 2O99A 4LRZE 3T1RA 3VOLA 4S2MA 4FD8A 4Y17A 3GQZA 4XT2A 4WUJA 3UDFA 4HJ4A 2EXAA 2WKEA 3D3OA 5KSHA 3WWXA 5FASA 4ZJ2A 3Q07A 3TOIA 4R6LA 1XXMA 1RGZA 4ME4A 2NUTC 3G31A 4ETZA 3NIAA 3EQVA 3KSGA 1W63M 4FTXA 3ZG0A 1YSQA 3IX4A 4WLAA 1NZOA 4S2IA 1ODVA 2HP5A 3ZNTA 4S2OA 1ES3A 1VM1A 4KZAA 4OLDA 4D2OA 4WBGA 2ACGA 3DW0A 4H6JA 4EESA 4KZBA 2B95A 1M6KA 4II7A 3NULA 2PU4A 4R38A 4UA9A 3ZDJA 2R9WA 5CX7A 2B5RA 2JE5A 5F6AA 3E2LA 3MXQA 5GLCA 1UGUA 5FI7A 2VA0A 5MC7A 5DFYA 2E8IA 3NJAA 4L0LA 3HREA 4XUXA 1OJGA 2K2NA 4R1GA 5CTNA 2L0WA 3C30A 3O5YA 2UV0E 3UO9A 4CLCD 2AVXA 2PBDP 1G5UA 2VGLM 4Y2FA 2GNXA 4JGPA 2ZL1A 2OOLA 3PBSA 2YKFA 1ONHA 1L0EA 2QMIA 1JTDA 4MN6A 4HBTA 4HESA 5J8XA 3MQOA 1W7FA 2WKHA 2QYBA 2H28A 3IH8A 4MEZA 1K54C 2ZMFA 4DJ2A 2DNSA 3NOTC 1NZUA 4Y5FA 1W79A 2ZMAA 1K56A 1IKGA 4DXBA 3LEQA 5EVID 3DAVA 3NECA 4EBNA 3CAXA 5G18A 4IEDA 4DMZA 4OOLA 3ZGAB 2ZQ8A 3VP1A 4GS9B 5GHXA 1O7EA 4ZBEA 2J9PA 2IWDA 4X69A 1IEMA 1FIKA 5DTTA 2C5WB 1FSYA 3NOUC 2P74A 3DWKA 4KQRA 1QMEA 4PM9A 1N9LA 1W63Q 2V1ZA 4GW9A 4Y0UA 2XD5A 3IHBA 5HDDA 2IWBA 3F1PB 2JKTI 3BRMA 3IWOA 3LICA 4I5SA 5HD3A 1LI9A 2WZZA 3FC7A 4UA7A 3V3SA 2JN7A 3R7WB 1PW1A 2EXBA 2R9XA 5L07A 3C7UA 2EX9A 5BOHA 1K6RA 5FSRA 4UEYA 4R4SA 4JKTA 4AFIA 3A3DA 4RQ9A 4ZAMA 2WYXA 4HH2A 2Q0OA 3C7VA 4JXWA 4HP4A 3T1SA 1VEUB 1KE4A 4S2LA 4HJ6A 1YM1A 1YAXA 4DE0A 1AXBA 4LLOB 5HDCA 3ZG9B 2G7UA 5CERA 1K57C 2P9VA 3ZVTA 4FH2A 1TVFA 3ZVWA 2PYRA 3BYDA 4X53A 1J9MA 3L9KA 4RVAA 1KE3A 3S4XA 1ERQA 3IS2B 2Y2HA 5HAPA 3HJKA 4EEUA 4X68A 3T4KA 1ALQA 3BJNA 2P08A 5AJGA 2XF3A 3H82B 2J3WA 2QJ7A 2OSUA 4HEFA 1PI4A 3GRJA 4LCLA 2Z6DA 3LR3A 4N92A 5FEFA 1SKOA 2PD7A 3G35A 2Y2KA 2Y2JA 3Q7VA 2Y8HA 3KX0X 4O8GA 3D9YA 1T1CA 3S7NA 4ZJ1A 4WMCA 1WA9A 5EPHA 1NLYA 3NI9A 4BENA 1OTBA 1T1BA 5CGWA 1EI5A 3LR5A 1Z6FA 4NXFA 2ZMVA 2ZM8A 3LI8A 4FSFA 1G68A 1CF0A 2ZD8A 3W2ZA 1W8YA 3QNBA 1Z09A 5A91A 2CC1A 3UB8A 5L09A 2GDNA 4GLQA 4MBFA 2XLNA 3CUEA 2HJEA 4U0XA 4HI4A 4WEJA 3FPWA 4OQ0A 4NKPA 2V20A 1AWIA 3HVFA 1TD5A 1GSXA 4FUWA 1IYQA 4QU3A 4IHQA 1FCOA 1YLWA 3T4TA 4E3JA 3CPTA 5HPIA 3HJIA 3IHAA 1XKZA 2R78A 1T19A 3FV7A 4Y7PA 1DY6A 4KZ6A 5L8MA 5L2FA 1XJ6A 2Q9MA 3IF6B 4ZDXA 5DTSA 1H5XA 5FAPA 2WKRA 2Z6CA 4ZJ3A 1KE0A 1Q2PA 2Z2LB 2OAQ1 1K55C 3QP6A 4PPRA 3BM6A 5HARA 4PM7A 2HGVA 3WS0A 3TSGA 1OTAA 3E98A 2J8YA 5AQ7A 3MQ0A 2X02A 3G2YA 3PTEA 3VE4A 1RP5A 1OTDA 5DFXA 1PW8A 3UY6A 5EOOA 4K91A 1PWGA 5E2EA 4F94A 4KZ7A 4P6ZM 1SHVA 2XR0A 4DE1A 3EOIA 3BECA 3T4OA 3HUOA 2B02A 4IJGA 3HLWA 3QP1A 2WKIA 1YLYA 1YLPA 4CLCE 2PU2A 3H7WA 3MZFA 5DVAA 4EUVA 3CG5A 2EX6A 3EGXC 1CJFA 1YLZA 1K38A 2ZJ9A 3CHWP 5EE8A 3D4FA 3C5AA 3HL9A 1OMEA 5GLBA 4R3JA 3DTKA 1TS0A 3BY9A 4E3IA 4GNUA 3PXPA 4X55A 4EBPA 2WADA 1E3UD 5E2GA 4QPRA 2KOIA 2I72A 3KYZA 3LO7A 4CLCC 2ZQCA 2W1TA 4S2NC 1DRMA 4GKUA 3HCYA 5EOEA 4BQMA 4EQIA 1ONGA 2FFFB 3LFVA 1H8ZA 1YQSA 5F5YA 1FOFA 5D3OA 4YFMA 5GL9A 3H9WA 1XP4A 1BLPA 3O3VA 2XRNA 1NY0A 3VOZA 4XUZA 2HDUA 2PYPA 3LI9A 1IELA 1W8QA 5HWVA 3MZEA 5AQ9A 5GHYA 3RTYA 5CHUA 5EV0A 2BLSA 5AVFA 4WZ4A 1CEGA 1J3WA 2PR6A 3CJMA 5TFQA 2ZM2A 2XA7M 1FR1A 5EVIC 5FAOA 5HWTA 5FATA 4JLFA 2M7UA 3OCNA 2K7SA 2WKQA 4E3LA 4HNBA 2OWJA 1GCEA 4HIAA 4MBKA 1DJBA 2A24B 2ZQ9A 3CITA 1L0GA 3SS4A 2OWHA 1K6SA 1PZOA 3NOPC 5FQJA 3FPVA 4P0MA 1PFLA 4HP9A 3MZDA 2H10A 4BBVA 3C2WA 4O01A 2IA2A 1TS6A 1L0FA 2VK3A 2JC7A 1D06A 3S7QA 4R0QA 1DJCA 1N4OA 2ZBBA 2KX6A 1X0OA 5A90A 3IWIA 1E25A 2JKFA 1D1JA 4B93A 5E2HA 3CI6A 2ZC3B 4OQGA 3BLSA 2V9AA 2Y2MA 1LL9A 3UNWA 1K4EA 3WRTA 4KZ4A 5FQKA 4JXVA 1F98A 3G6OA 3TRCA 1ZG6A 5KIZA 2W27A 5TGFA 4QJGA 4Q0HA 1CQAA 4UHUA 5C5KA 5GLAA 1LHYA 4JXGA 1PZPA 3HUNA 4MN5A 3N8LA 5F1GA 3BQ8A 1ZG4A 3IXHA 2J3TD 4NEED 4PKYG 3UDIA 1FR6A 2JBFA 2ZC5B 3FYZA 3UDXA 4EW7A 4EBLA 3MFDA 3FWLA 3G34A 4YOFA 3PBRA 3S7PA 5HL1A 5FQIA 4OP8A 5LBRA 2H5SA 2HP9A 4NG2A 4X1MA 4GDNA 5HAQA 5HSQA 3VP2A 3ZNYA 1IYPA 1NXYA 3HLGA 4GDBA 4NXEA 3E4QA 4GHIB 4LV1A 2H0YA 5FDSA 1W5DA 3O86A 2Q9NA 5FI2A 5FL3A 4QHCA 5CTMA 2GJ3A 4DF6A 4GS9A 4IVKA 4WF0A 3MKFA 3B47A 4ID4A 2HPBA 1BLHA 3MFXA 5DKKA 4EQ1A 5DF7A 5F68A 4B4ZA 3HLEA 3IX3A 3UB6A 3P01A 1F2KA 3MQQA 3F1PA 1HTZA 2V0WA 3A0RA 3MF0A 3V50A 4CLCB 2L4RA 3BFCA 3GTCA 4QB8A 4G3WA 4DE3A 3R7WA 3FG8A 3IBJA 1XJ2A 2LB9A 3W8KA 2Y2OA 1S66L 3VSLA 4OPZA 3Q1FA 3RXWA 3G4PA 3WRZA 3D72A 5A8BA 5I5LA 3QP8A 3N8RA 1YMSA 4O7DA 1GHPA 1VEUA 3DTIA 5KMWA 1S4RA 4ESPA 4KG6A 4DDSA 4EUZA 3ZCZA 4DN0A 4X25A 3NY4A 4OQIA 5EVIB 1JVJA 3O87A 4CQHA 4K0WA 1FCNA 4P6BA 5M18A 1DP8A 3IS2A 3CLOA 4E3KA 3C4OA 3ZFZA 1OPXA 3IXBA 3CUEC 4B4XA 2INWA 1LSXA 3RXXA 4I3IA 2VGLS 3OPHA 5IT5A 2Y2QA 1KOUA 3H82A 3PBOA 4DRTA 1YLTA 3VP3A 1MBLA 1CI8A 2XGNA 2WUQA 3IXDA 1PIOA 4OONA 2YKHA 3JPUA 2Y2NA 4L9FA 2JKRM 2WKPA 1H8MA 1MWTA 2HZ5A 3LYXA 3HLFA 4I38A 2Y2GA 3LGOA 1L2SA 5I94A 4S2PA 1PRQA 2FFYA 5U47A 3SS3A 2CMNA 4IBXA 4OP5A 1SZVA 2MJ6A 3VMAA 4OQHA 4E04A 1K56D 5EUAA 1IFQA 3P98A 1O07A 1V9ZA 3E0YA 2HDQA 5A93A 2VV8A 4WZ5C 2FH5A 4F3LB 4K08A 1MZUA 3C4PA 3MBZA 5J3WA 4KQOA 2OAP1 5E2FA 5EFWA 5CGSA 1SDEA 4GZBA 5DF9A 1NYYA 5J7EA 2VJWA 2Y2LA 4Q8IA 2EWVA 3WS5A 3GSGA 3MKEA 4KUOA 1TDGA 2RCXA 3IF6A 4M4XA 1P9WA 2Y91A 1A0KA 3U2AA 4QY5A 3ISGA 3N8SA 5GLDA 3GVBA 3VFHA 3DWZA 3MXRA 1FQGA 2VLGA 3Q81A 1GA9A 3KSIA 3VE3A 1LLBA 2V8CA 4R4RA 3RJUA 1IOUA 3UN7A 3HLBA 3OOVA 1NRJA 1PWCA 3BFEA 1I2SA 1JTGA 5F83A 3ZHHA 4H8RA 2VGKA 5EECA 1BT5A 1NLZA 4EETB 3BY8A 2W3GA 3QP5A 1BLSA 3IQAA 1VETB 4B88A 3G32A 2X01A 1XA1A 2XQZA 3K2NA 4UAAA 3V3RA 1T1AA 4QD4A 3IXGA 2DCFA 1ES5A 1DP6A 4GD6A 4EXOA 1KDWA 4DE2A 1S6RA 3T1QB 3LUQA 1LT0A 4S2JA 5HL6A 5F69A 3LY4A 1FCMA 1KVMA 3NDGA 4WL9A 4PM8A 4G3VA 2DMWA 1LL8A 2L1MA 1DP9A 4L9GA 1UWPX 1U60A 1ZHHB 3EWKA 1YLJA 5FQMA 2Y2PA 3ZG7B 4WMCD 1EW0A 1MXOA 4QWOA 4P85A 1PNEA 4R23A 2J3TC 5G4YA 3PBNA 1H8YA 3BFFA 3Q82A 3M2KA 5G4ZA 5CRFA 3T12B 5FAQA 4L9EA 4BD0A 2J7VA 2EFUA 4OKPA 3UE3A 3EEAA 1K57A 4K0XA 5CHMA 1I2WA 1MWSA 4N1HA 4IVIA 2UWXA 3VP4A 5M19A 3NHQA 1YSPA 1K0KA 4FCFA 2W3HA 3PBTA 1NJ4A 5KSCA 2D02A 2WAFA
chains in the Genus database with same CATH topology
4PKYA 2V9AA 4OOMA 2P04A 5DJTA 3NOTC 3T4SA 4Y5FA 2A24A 1F98A 3G6OA 3TRCA 3PYPA 2VZWA 5KIZA 3CAXA 2W27A 2BASA 4Q0HA 5DKLA 4DMZA 2HJ9C 4OOLA 5C5KA 2O9CA 4MN5A 4GS9B 1N9NA 3BQ8A 2J3TD 4NEED 4PKYG 3VV4A 2XSSA 4EW7A 1OJ5A 4R3AA 3UMDA 3NOUC 4GJ4A 4UQIM 4YOFA 1VB6A 3PBRA 3S7PA 1G6OA 1P0ZA 3S7OA 5LBRA 1N9LA 1W63Q 4GW9A 2QWSA 5HDDA 4YWZA 2M7VA 3F1PB 5HSQA 3ZQ5A 5J4EA 2JKTI 3B33A 3LICA 4I5SA 4P6ZS 5HD3A 3FC7A 2W3DA 5AVEA 4NXEA 2XROA 3E4QA 3GECA 2JN7A 2EWWA 3A0SA 4GHIB 3R7WB 2W1RA 3T50A 3V67A 3KO6A 3MJQA 1MC0A 2JHEA 1JNUA 4UEYA 4NXGA 5FL3A 3MR0A 4AFIA 2D01A 5TBMB 2GJ3A 3CWFA 4RQ9A 2V1AA 4GS9A 4HH2A 4WF0A 3LIFA 4HP4A 3B47A 5HDSA 4I39A 1XJ4A 4HJ6A 3MFXA 5DKKA 3GDIA 1YAXA 4EQ1A 5TJJA 1TS8A 3IBRA 5F68A 4LLOB 2PD8A 5HDCA 1ZTUA 2G7UA 1BYWA 2I9VA 2PYRA 4YNRA 3TE8A 3EGDC 3UB6A 3IS2B 3MMHA 3TJZC 3P01A 3MQQA 3F1PA 2V0WA 3ULFA 2EA9A 3A0RA 3LR0A 3MF0A 3HJKA 4CLCB 2L4RA 2PR5A 4EEUA 4B9OA 4UQIS 3T4KA 4EERA 2B18A 2PT7A 4G3WA 3LIEA 3BJNA 2P08A 4GHIA 5AJGA 2JKRI 3R7WA 3OCLA 3RFBA 3FG8A 3H82B 2J3WA 3F1OB 3IBJA 2QJ7A 3PR6A 1XJ2A 2JKTM 2LB9A 4HOIA 2Y79A 4HHDA 2O9BA 2A2LA 4LPZA 3B42A 2Z6DA 1S66L 3LR3A 3UB9A 3KSHA 1S4SA 2PD7A 1N9OA 4KUKA 3D72A 5A8BA 2XA7S 1S67L 5I5LA 5TBMA 1S1YA 3KYQA 2Y8HA 4ARZB 3KX0X 3KSFA 4O8GA 2W3FA 1T1CA 3S7NA 3F1NB 3EEHA 1WA9A 1NLYA 1S4RA 4BMWA 3T4QA 4NXBA 1OTBA 1T1BA 4DN0A 3LR5A 4NXFA 2ZMVA 4LRYC 3LI8A 4FSFA 3TW8A 4MCWA 1GSVA 4CQHA 3W2ZA 1XJ3A 2NUPC 5HPFA 2PHYA 2J80A 1DP8A 3IS2A 1G28A 2O9AA 3CLOA 1LSWA 3UB8A 3LIBA 4GLQA 4CLCA 1OPXA 4MN7A 5IS1A 3CUEA 2HJEA 3CUEC 2INWA 2QKPA 3EQUA 1LSXA 4HI4A 4DJ3A 4WEJA 1TF1A 2ZOIA 3FPWA 4I3IA 2VGLS 3A0VA 5DJUA 1STZA 5IT5A 4NKPA 1KOUA 3H82A 3F1OA 3PBOA 1TD5A 4IUHA 4MMNA 4HQAA 1GSXA 2W3EA 3SW1A 2QJ5A 2V0UA 3ICYA 4HJ3A 2P7JA 2YKHA 2VV7A 1T18A 4L9FA 2JKRM 4IHQA 2ZOHA 2WKPA 3JVUA 1H8MA 3T4TA 5HWWA 4LRXC 1VHMA 3K3CA 2VX8A 3LYXA 4ARZA 5HPIA 3HJIA 4I38A 2R78A 1T19A 3F1NA 4ETXA 1TS7A 5L8MA 1XJ6A 3H7WB 2K31A 4Z1WA 4HY8A 5K5BA 1OT9A 4BBTA 1MKMA 4BJPA 3OBFA 3E4PA 4FOFA 4Q0IA 3PBQA 2CMNA 2MJ6A 2WKRA 2Z6CA 3ZYTA 4E04A 1P97A 4IUKA 4XT2B 2GZAA 1IFQA 1V9ZA 3E0YA 2OAQ1 1F9IA 2VV8A 4R70A 5HZHA 1YKDA 2KDKA 2FZ0A 3JVVA 2FH5A 2HGVA 4F3LB 4K08A 1MZUA 3RH8B 3T4JA 2KLIA 2VKSA 1H3QA 2LB5A 1OTAA 3UMEA 3E98A 5J3WA 1NWZA 4WEKA 4KQOA 3C38A 2OAP1 3MQ0A 5EFWA 2W1TB 3UB7A 3VE4A 3BWLA 1OTDA 5DF9A 5DFXA 3UE6A 4BWIA 4EEPA 3LR4A 3C8CA 5J7EA 1S1ZA 2VJWA 3OC2A 4P6ZM 2EWVA 3K3DA 3EOIA 4BBUA 4EU0A 4ZRRA 2VEAA 4PHTA 3T4OA 2B02A 4IJGA 4KUOA 1OTEA 1XFNA 2M1CA 4CLCE 3BQAA 3H7WA 4H6JB 4M4XA 4EUVA 1LSVA 2V1BA 3EGXC 2O99A 1P9WA 4LRZE 3VOLA 3U2AA 4JGOA 1OT6A 2VLGA 4XT2A 4O0PA 4WUJA 3KSIA 3VE3A 1TS0A 3BY9A 4HJ4A 3D3OA 3PXPA 3T4LA 1IOUA 5KSHA 3OOVA 4F3LA 2O0YA 2GX5A 1NRJA 4QPRA 2KOIA 3KYZA 4R6LA 3OLOA 4MDZA 4ME4A 2NUTC 4CLCC 4ETZA 3EQVA 1NLZA 3KSGA 1D7EA 2W1TA 1W63M 4EETB 1YSQA 3BY8A 4WLAA 2W3GA 1DRMA 1Y28A 3K2NA 1ODVA 3HCYA 1T1AA 1DP6A 3LFVA 4EXOA 4JGRA 5F5YA 3R4KA 1OTIA 4PAUA 3H9WA 3LIAA 2XRNA 2PYPA 4H6JA 3LUQA 4EESA 3LI9A 2HV1A 4HH3A 1LT0A 5HWVA 4II7A 5HL6A 5F69A 4WELA 3RTYA 3BW6A 5AVFA 1F5MA 2PR6A 4WL9A 1V9YA 4R38A 3E4OA 4G3VA 2DMWA 2XA7M 2VV6A 1LL8A 1XFQA 2L1MA 4I3JA 5CX7A 1DP9A 5HWTA 4L9GA 5F6AA 3DBAA 1UWPX 1ZHHB 2M7UA 2W0NA 3EWKA 4I3AA 3MXQA 3OCNA 1UWNX 5IU1A 1UGUA 2K7SA 2WKQA 1EW0A 2VA0A 4HNBA 2OWJA 5MC7A 4HIAA 5DFYA 2J3TC 2A24B 3CITA 2PDRA 5G4YA 3NJAA 2OWHA 3PHYA 3PBNA 4L0LA 3NOPC 5G4ZA 5HD5A 1OJGA 4G3KA 2K2NA 3FPVA 4L9EA 2HF6A 2L0WA 3C30A 3O5YA 4HP9A 3UE3A 3EEAA 4BBVA 4CLCD 4Y3IA 3LIDA 3C2WA 2VGLM 4KQDA 4O01A 4Y2FA 2IA2A 2GNXA 4JGPA 1TS6A 2OOLA 3P7NA 3PBSA 2YKFA 1D06A 3S7QA 4Q0JA 3NHQA 4WN5A 1P9RA 4MN6A 1YSPA 2QHKA 2ZBBA 3MQOA 1GSWA 4GCZA 2KX6A 1X0OA 2W3HA 3PBTA 2QYBA 2H28A 4JGQA 4B93A 2D02A 2ZMFA 3CI6A 4DJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKY A;  2V9A A;  5DJT A;  3NOT C;  2A24 A;  1F98 A;  3G6O A;  3PYP A;  5KIZ A;  3CAX A;  2W27 A;  2BAS A;  5DKL A;  4MN5 A;  4GS9 B;  1N9N A;  4PKY G;  4EW7 A;  1OJ5 A;  4R3A A;  3UMD A;  3NOU C;  1VB6 A;  1P0Z A;  1N9L A;  4GW9 A;  2QWS A;  5HDD A;  4YWZ A;  3F1P B;  5HSQ A;  3ZQ5 A;  5J4E A;  3B33 A;  3LIC A;  4I5S A;  5HD3 A;  3FC7 A;  5AVE A;  4NXE A;  3E4Q A;  3GEC A;  2JN7 A;  3A0S A;  4GHI B;  3T50 A;  3MJQ A;  2JHE A;  1JNU A;  4NXG A;  3MR0 A;  2D01 A;  5TBM B;  2GJ3 A;  3CWF A;  4RQ9 A;  2V1A A;  4GS9 A;  4HH2 A;  4WF0 A;  3LIF A;  4HP4 A;  5HDS A;  4I39 A;  1XJ4 A;  4HJ6 A;  3MFX A;  5DKK A;  3GDI A;  4EQ1 A;  1TS8 A;  3IBR A;  5F68 A;  4LLO B;  2PD8 A;  5HDC A;  1BYW A;  2I9V A;  2PYR A;  3UB6 A;  3IS2 B;  3MQQ A;  3F1P A;  2V0W A;  3ULF A;  2EA9 A;  3A0R A;  3HJK A;  2L4R A;  2PR5 A;  4EEU A;  4B9O A;  4EER A;  3LIE A;  4GHI A;  3FG8 A;  3H82 B;  3F1O B;  2QJ7 A;  1XJ2 A;  4HOI A;  4HHD A;  4LPZ A;  2Z6D A;  1S66 L;  3UB9 A;  1S4S A;  2PD7 A;  1N9O A;  4KUK A;  3D72 A;  5A8B A;  1S67 L;  5I5L A;  5TBM A;  1S1Y A;  3KX0 X;  1T1C A;  3F1N B;  3EEH A;  1WA9 A;  1S4R A;  4NXB A;  1OTB A;  1T1B A;  4NXF A;  4LRY C;  3LI8 A;  1GSV A;  1XJ3 A;  2PHY A;  2J80 A;  1DP8 A;  3IS2 A;  1G28 A;  3CLO A;  1LSW A;  3UB8 A;  3LIB A;  5IS1 A;  2INW A;  2QKP A;  1LSX A;  4HI4 A;  4DJ3 A;  2ZOI A;  4I3I A;  3A0V A;  5DJU A;  1KOU A;  3H82 A;  3F1O A;  4HQA A;  1GSX A;  3SW1 A;  2QJ5 A;  2V0U A;  3ICY A;  4HJ3 A;  2P7J A;  2YKH A;  2VV7 A;  1T18 A;  4L9F A;  2ZOH A;  2WKP A;  5HWW A;  4LRX C;  3K3C A;  3LYX A;  3HJI A;  4I38 A;  2R78 A;  1T19 A;  3F1N A;  1TS7 A;  1XJ6 A;  3H7W B;  4HY8 A;  1OT9 A;  4BBT A;  3E4P A;  2CMN A;  2WKR A;  2Z6C A;  4E04 A;  1P97 A;  4XT2 B;  1V9Z A;  1F9I A;  2VV8 A;  4R70 A;  5HZH A;  2KDK A;  4F3L B;  4K08 A;  1MZU A;  3RH8 B;  1OTA A;  3UME A;  5J3W A;  1NWZ A;  5EFW A;  3UB7 A;  3VE4 A;  3BWL A;  1OTD A;  3UE6 A;  4EEP A;  3C8C A;  5J7E A;  1S1Z A;  3K3D A;  4BBU A;  2VEA A;  2B02 A;  4KUO A;  1OTE A;  1XFN A;  2M1C A;  3H7W A;  4H6J B;  4M4X A;  1LSV A;  2V1B A;  4LRZ E;  3VOL A;  4JGO A;  1OT6 A;  2VLG A;  4XT2 A;  4WUJ A;  3VE3 A;  1TS0 A;  3BY9 A;  4HJ4 A;  4F3L A;  4R6L A;  3OLO A;  1D7E A;  4EET B;  3BY8 A;  4WLA A;  1DRM A;  1Y28 A;  1ODV A;  1T1A A;  1DP6 A;  4EXO A;  4JGR A;  5F5Y A;  1OTI A;  3H9W A;  3LIA A;  2PYP A;  4H6J A;  3LUQ A;  4EES A;  3LI9 A;  2HV1 A;  4HH3 A;  1LT0 A;  5HWV A;  5F69 A;  3RTY A;  5AVF A;  2PR6 A;  4WL9 A;  1V9Y A;  4R38 A;  3E4O A;  2VV6 A;  1LL8 A;  1XFQ A;  2L1M A;  4I3J A;  1DP9 A;  5HWT A;  4L9G A;  5F6A A;  1UWP X;  2W0N A;  3EWK A;  4I3A A;  3MXQ A;  1UWN X;  5IU1 A;  1UGU A;  2K7S A;  2WKQ A;  1EW0 A;  4HNB A;  2OWJ A;  4HIA A;  2A24 B;  2PDR A;  5G4Y A;  3NJA A;  2OWH A;  3PHY A;  3NOP C;  5G4Z A;  5HD5 A;  1OJG A;  4L9E A;  2L0W A;  4HP9 A;  4BBV A;  3LID A;  3C2W A;  4KQD A;  4JGP A;  1TS6 A;  2OOL A;  3P7N A;  2YKF A;  1D06 A;  3NHQ A;  4WN5 A;  4MN6 A;  2QHK A;  2ZBB A;  3MQO A;  1GSW A;  4GCZ A;  2KX6 A;  1X0O A;  2H28 A;  4JGQ A;  2D02 A;  4DJ2 A; 
#chains in the Genus database with same CATH topology
 4E3N A;  4OOM A;  3T4S A;  4Y0O A;  2A24 A;  4BL2 A;  1ACF A;  3OZH A;  4BLM A;  3PYP A;  4GB7 A;  2VZW A;  2O9C A;  5F82 A;  1MWU A;  1G6A A;  3S22 A;  4X6T A;  4DDY A;  5FQ9 A;  3V5M A;  3VV4 A;  1BUL A;  3ZG5 A;  1M40 A;  1PI5 A;  1OJ5 A;  4R3A A;  4GJ4 A;  4UQI M;  1VB6 A;  1G6O A;  4MBH A;  4OVD A;  2Y2I A;  5A92 A;  4YWZ A;  2M7V A;  3LEZ A;  5J4E A;  4P6Z S;  2JKG A;  3UPN A;  4Y15 A;  2W3D A;  2WGW B;  5AVE A;  2XRO A;  3GEC A;  2EX2 A;  4MNR A;  3A0S A;  4PM5 A;  1GHM A;  3T50 A;  3V67 A;  4LV3 A;  3KO6 A;  4JXS A;  1YT4 A;  1MC0 A;  1TDL A;  4NXG A;  2J9O A;  3MR0 A;  4P87 A;  1ZKJ A;  5TBM B;  2V1A A;  1ESU A;  5E43 A;  4I39 A;  1XJ4 A;  3GDI A;  2V8F A;  5TJJ A;  4OLG A;  1H0M A;  3IBR A;  5JYO A;  3V39 A;  2PD8 A;  5HAI A;  3OPR A;  2I9V A;  2WGI A;  4YNR A;  4JBF A;  3B3X A;  3ZG8 B;  3PAE A;  4C75 A;  3ULF A;  2EA9 A;  3NDE A;  4HBU A;  2OLV A;  4B9O A;  4UQI S;  1Y4O A;  4EER A;  2B18 A;  4GHI A;  3E2K A;  4KZ5 A;  3F1O B;  1K4F A;  4JF4 A;  4S2K A;  4DKI A;  1S0W A;  2JKT M;  1MKI A;  4HOI A;  4E3M A;  4HHD A;  4N9L A;  3HLC A;  5AQA A;  2ZC6 B;  2BG1 A;  4C6Y A;  3KSH A;  1KVL A;  1S4S A;  4KUK A;  4KZ3 A;  2XA7 S;  4ARZ B;  3KSF A;  2W3F A;  3F1N B;  4PMA A;  3T4Q A;  4X56 A;  3T1X A;  2Y55 A;  1ERO A;  1JWP A;  3TW8 A;  4MCW A;  1GSV A;  1WE4 A;  3ITA A;  4E3O A;  2NUP C;  1HVB A;  5HPF A;  5L10 A;  2J80 A;  1LSW A;  3LIB A;  3QP4 A;  2C6W B;  1PWD A;  4CLC A;  4MN7 A;  5IS1 A;  5CEC A;  5M1A A;  4S2N A;  5HFO A;  3EQU A;  4DJ3 A;  1TF1 A;  2ZOI A;  3A0V A;  4MMN A;  3WS1 A;  2W3E A;  3SW1 A;  3W4P A;  4Y13 A;  3IF5 A;  4HJ3 A;  3W4O A;  2P7J A;  5KZH A;  3QP2 A;  3MXS A;  4KZ9 A;  2ZOH A;  5HWW A;  1VHM A;  3K3C A;  2VX8 A;  4N9K A;  2OV5 A;  1BLC A;  4ETX A;  3FKW A;  2K31 A;  4HY8 A;  5K5B A;  1OT9 A;  1MKM A;  4FOF A;  4BL3 A;  5EVI A;  1BZA A;  1WYB A;  4Q0I A;  3GMW A;  4OPQ A;  3ZYT A;  1P97 A;  4KZ8 A;  4XT2 B;  2ZQA A;  3IT9 A;  5FDH A;  1F9I A;  1XPB A;  2Y4A A;  4R70 A;  3P09 A;  5CXW A;  1YKD A;  2KDK A;  2FZ0 A;  5F1F A;  2G2U A;  5EVE A;  3RH8 B;  2ZC4 B;  3T4J A;  2KLI A;  2VKS A;  4YIN A;  1IYO A;  1H3Q A;  1ESI A;  3SZT A;  1NWZ A;  1VQQ A;  2QPN A;  3C38 A;  4RA7 A;  2HP6 A;  3UB7 A;  3UE6 A;  4BWI A;  4EEP A;  3LR4 A;  2XFS A;  3C8C A;  1S1Z A;  4OPY A;  3SOI A;  1ES4 A;  1KGG A;  1RCJ A;  4GN2 A;  1OTE A;  1XA7 A;  1XFN A;  2M1C A;  3AGD A;  4H6J B;  3IF6 C;  3Q7Z A;  4X1L A;  1IYS A;  1LSV A;  2BTF P;  2ZLY A;  1LL5 A;  4JGO A;  2XK1 A;  1I5Q A;  1OT6 A;  1PYY A;  4O0P A;  5CED A;  3T4L A;  3SS5 A;  1EWZ A;  4F3L A;  2O0Y A;  2GX5 A;  3NC8 A;  1XX2 A;  1KGE A;  3UPP A;  3OLO A;  3BFG A;  1QMF A;  4MDZ A;  4XXR A;  4LEN A;  3GV9 A;  1D7E A;  2XH9 A;  4LV2 A;  5CEB A;  4UA6 A;  3UE1 A;  2XFT A;  3QHY A;  1Y28 A;  3NCK A;  1BUE A;  5EVL A;  1Q2Q A;  3BFD A;  4MLL A;  4JGR A;  3R4K A;  1OTI A;  4PAU A;  4CPK A;  3MS6 A;  3LIA A;  3SH9 A;  3MSH A;  2ZL1 B;  1L0D A;  2JCH A;  2HV1 A;  4HH3 A;  3I7J A;  1LI0 A;  4WEL A;  4WYY A;  3BW6 A;  3JYI A;  3LCE A;  4EV4 A;  1F5M A;  4RYE A;  1V9Y A;  3NBL A;  3E4O A;  2VV6 A;  3M6B A;  1XFQ A;  4I3J A;  3DBA A;  2QZ6 A;  2W0N A;  3S1Y A;  3LY3 A;  4I3A A;  4NET A;  1UWN X;  1BSG A;  1SDN A;  5IU1 A;  1XGI A;  3N4I A;  2PDR A;  5JYP A;  4U0T A;  3PHY A;  2HDS A;  4BD1 A;  5IHV A;  5HD5 A;  1VET A;  4G3K A;  1MPL A;  2HF6 A;  2WAE A;  1XGJ A;  4FH4 A;  2OLU A;  1ERM A;  1ZC2 A;  4Y3I A;  3LID A;  4KQD A;  4RX3 A;  1CK3 A;  2IWC A;  3P7N A;  4U3T A;  4Q0J A;  3IH9 A;  4WN5 A;  1P9R A;  3UPO A;  2QHK A;  1GSW A;  5HW3 A;  4GCZ A;  3FKV A;  5CHJ A;  1HLU P;  1IKI A;  4JGQ A;  2E8J A;  3G2Z A;  1K54 A;  5FI6 A;  4Y0T A;  4PKY A;  5DF8 A;  1BTL A;  2V2F F;  4OOY A;  2P04 A;  4JF6 A;  5DJT A;  1GA0 A;  1WYC A;  5HX9 A;  1Y54 A;  3WS4 A;  2BAS A;  5DKL A;  2ZQ7 A;  2HJ9 C;  1KGF A;  5EM0 A;  3VOY A;  3IWQ A;  1N9N A;  3OPL A;  1NYM A;  4OH0 A;  4PM6 A;  4WM9 A;  2XSS A;  3WS2 A;  4NK3 A;  1MWR A;  3UMD A;  3DTE A;  1P0Z A;  2P9V B;  3S7O A;  1TEM A;  2HDR A;  2A49 A;  3AGE A;  2WGV A;  2QWS A;  3ZQ5 A;  3B33 A;  1KDS A;  4IBR A;  3ITB A;  1CEF A;  2WZX A;  2EWW A;  3OPP A;  5TR7 A;  2G2W A;  2W1R A;  1RGY A;  4N1X A;  2PAV P;  3MJQ A;  2ZQD A;  4LCM A;  2JHE A;  1JNU A;  2A3U A;  1SKO B;  3QNC A;  4LFU A;  2D01 A;  3Q7V B;  1YPR A;  3A3E A;  3CWF A;  4QY6 A;  1E3U A;  5AQB A;  3LIF A;  4E6X A;  5HDS A;  1NRF A;  5FA7 A;  1TS8 A;  4ZTK A;  5EM1 A;  3PAG A;  4KQQ A;  1ZTU A;  4WZ5 A;  3VSK A;  1BYW A;  3TE8 A;  4R3B A;  2PRF A;  3EGD C;  3MMH A;  3TJZ C;  2ZM0 A;  3BEB A;  3HLD A;  3LR0 A;  2PR5 A;  3A3J A;  1ES2 A;  2WGW A;  3VFF A;  2PT7 A;  2X71 A;  3LIE A;  2JKR I;  3OCL A;  3RFB A;  3PR6 A;  3SH7 A;  2Y79 A;  2XDM A;  2O9B A;  2A2L A;  4LPZ A;  3B42 A;  1DJA A;  4GD8 A;  3UB9 A;  4KG5 A;  1GHI A;  1K25 A;  1N9O A;  3GR2 A;  1S67 L;  5TBM A;  1S1Y A;  3KYQ A;  3CPT B;  2XD1 A;  4EWF A;  4LV0 A;  3BLM A;  3EEH A;  3TG9 A;  3CZD A;  1JWZ A;  3M2J A;  5CGX A;  4BMW A;  4JPM A;  1FIL A;  4NXB A;  3HBR A;  5DTK A;  4LRY C;  3M6H A;  4Z9Q A;  4DXC A;  3L7H A;  3A3I A;  4LGW A;  3KYE A;  2EFX A;  1XJ3 A;  3AGF A;  2PHY A;  4KEN B;  1G28 A;  2O9A A;  3W4Q A;  3CMZ A;  1JWV A;  1FSW A;  2QKP A;  3A3F A;  5DJU A;  1STZ A;  3F1O A;  4IUH A;  3DTM A;  4HQA A;  4E6W A;  3IX8 A;  1SCW A;  2QJ5 A;  2V0U A;  1SKF A;  3ICY A;  3U4L P;  1E4D A;  3VP0 A;  2VV7 A;  4JF5 A;  1T18 A;  2RL3 A;  3JVU A;  4C3Q A;  4LRX C;  4RX2 A;  4ARZ A;  1HD8 A;  3UE0 A;  3F1N A;  1TS7 A;  4OPR A;  2XEP A;  3H7W B;  4Z1W A;  4BBT A;  4BJP A;  3OBF A;  3E4P A;  2ZC7 A;  2PBY A;  3PBQ A;  4D60 A;  1MY8 A;  3UB5 P;  1CI9 A;  4IUK A;  2GZA A;  3HUM A;  1K55 A;  4M3K A;  5HZH A;  3JVV A;  4KG2 A;  5FEG A;  1YMX A;  2Z2M B;  2LB5 A;  5FQQ A;  3UME A;  4WEK A;  1N9B A;  4GOG A;  3N6I A;  3O88 A;  1L3L A;  2W1T B;  2EX8 A;  4A5R A;  2H0T A;  3BWL A;  1C3B A;  3N7W A;  3OC2 A;  4CJN A;  3SH8 A;  3K3D A;  2Y59 A;  4BBU A;  4EU0 A;  3G30 A;  4ZRR A;  2VEA A;  4PHT A;  1HZO A;  2WK0 A;  3FZC A;  3BQA A;  2VGJ A;  5GHZ A;  2V1B A;  2DRW A;  2O99 A;  4LRZ E;  3T1R A;  3VOL A;  4S2M A;  4FD8 A;  4Y17 A;  3GQZ A;  4XT2 A;  4WUJ A;  3UDF A;  4HJ4 A;  2EXA A;  2WKE A;  3D3O A;  5KSH A;  3WWX A;  5FAS A;  4ZJ2 A;  3Q07 A;  3TOI A;  4R6L A;  1XXM A;  1RGZ A;  4ME4 A;  2NUT C;  3G31 A;  4ETZ A;  3NIA A;  3EQV A;  3KSG A;  1W63 M;  4FTX A;  3ZG0 A;  1YSQ A;  3IX4 A;  4WLA A;  1NZO A;  4S2I A;  1ODV A;  2HP5 A;  3ZNT A;  4S2O A;  1ES3 A;  1VM1 A;  4KZA A;  4OLD A;  4D2O A;  4WBG A;  2ACG A;  3DW0 A;  4H6J A;  4EES A;  4KZB A;  2B95 A;  1M6K A;  4II7 A;  3NUL A;  2PU4 A;  4R38 A;  4UA9 A;  3ZDJ A;  2R9W A;  5CX7 A;  2B5R A;  2JE5 A;  5F6A A;  3E2L A;  3MXQ A;  5GLC A;  1UGU A;  5FI7 A;  2VA0 A;  5MC7 A;  5DFY A;  2E8I A;  3NJA A;  4L0L A;  3HRE A;  4XUX A;  1OJG A;  2K2N A;  4R1G A;  5CTN A;  2L0W A;  3C30 A;  3O5Y A;  2UV0 E;  3UO9 A;  4CLC D;  2AVX A;  2PBD P;  1G5U A;  2VGL M;  4Y2F A;  2GNX A;  4JGP A;  2ZL1 A;  2OOL A;  3PBS A;  2YKF A;  1ONH A;  1L0E A;  2QMI A;  1JTD A;  4MN6 A;  4HBT A;  4HES A;  5J8X A;  3MQO A;  1W7F A;  2WKH A;  2QYB A;  2H28 A;  3IH8 A;  4MEZ A;  1K54 C;  2ZMF A;  4DJ2 A;  2DNS A;  3NOT C;  1NZU A;  4Y5F A;  1W79 A;  2ZMA A;  1K56 A;  1IKG A;  4DXB A;  3LEQ A;  5EVI D;  3DAV A;  3NEC A;  4EBN A;  3CAX A;  5G18 A;  4IED A;  4DMZ A;  4OOL A;  3ZGA B;  2ZQ8 A;  3VP1 A;  4GS9 B;  5GHX A;  1O7E A;  4ZBE A;  2J9P A;  2IWD A;  4X69 A;  1IEM A;  1FIK A;  5DTT A;  2C5W B;  1FSY A;  3NOU C;  2P74 A;  3DWK A;  4KQR A;  1QME A;  4PM9 A;  1N9L A;  1W63 Q;  2V1Z A;  4GW9 A;  4Y0U A;  2XD5 A;  3IHB A;  5HDD A;  2IWB A;  3F1P B;  2JKT I;  3BRM A;  3IWO A;  3LIC A;  4I5S A;  5HD3 A;  1LI9 A;  2WZZ A;  3FC7 A;  4UA7 A;  3V3S A;  2JN7 A;  3R7W B;  1PW1 A;  2EXB A;  2R9X A;  5L07 A;  3C7U A;  2EX9 A;  5BOH A;  1K6R A;  5FSR A;  4UEY A;  4R4S A;  4JKT A;  4AFI A;  3A3D A;  4RQ9 A;  4ZAM A;  2WYX A;  4HH2 A;  2Q0O A;  3C7V A;  4JXW A;  4HP4 A;  3T1S A;  1VEU B;  1KE4 A;  4S2L A;  4HJ6 A;  1YM1 A;  1YAX A;  4DE0 A;  1AXB A;  4LLO B;  5HDC A;  3ZG9 B;  2G7U A;  5CER A;  1K57 C;  2P9V A;  3ZVT A;  4FH2 A;  1TVF A;  3ZVW A;  2PYR A;  3BYD A;  4X53 A;  1J9M A;  3L9K A;  4RVA A;  1KE3 A;  3S4X A;  1ERQ A;  3IS2 B;  2Y2H A;  5HAP A;  3HJK A;  4EEU A;  4X68 A;  3T4K A;  1ALQ A;  3BJN A;  2P08 A;  5AJG A;  2XF3 A;  3H82 B;  2J3W A;  2QJ7 A;  2OSU A;  4HEF A;  1PI4 A;  3GRJ A;  4LCL A;  2Z6D A;  3LR3 A;  4N92 A;  5FEF A;  1SKO A;  2PD7 A;  3G35 A;  2Y2K A;  2Y2J A;  3Q7V A;  2Y8H A;  3KX0 X;  4O8G A;  3D9Y A;  1T1C A;  3S7N A;  4ZJ1 A;  4WMC A;  1WA9 A;  5EPH A;  1NLY A;  3NI9 A;  4BEN A;  1OTB A;  1T1B A;  5CGW A;  1EI5 A;  3LR5 A;  1Z6F A;  4NXF A;  2ZMV A;  2ZM8 A;  3LI8 A;  4FSF A;  1G68 A;  1CF0 A;  2ZD8 A;  3W2Z A;  1W8Y A;  3QNB A;  1Z09 A;  5A91 A;  2CC1 A;  3UB8 A;  5L09 A;  2GDN A;  4GLQ A;  4MBF A;  2XLN A;  3CUE A;  2HJE A;  4U0X A;  4HI4 A;  4WEJ A;  3FPW A;  4OQ0 A;  4NKP A;  2V20 A;  1AWI A;  3HVF A;  1TD5 A;  1GSX A;  4FUW A;  1IYQ A;  4QU3 A;  4IHQ A;  1FCO A;  1YLW A;  3T4T A;  4E3J A;  3CPT A;  5HPI A;  3HJI A;  3IHA A;  1XKZ A;  2R78 A;  1T19 A;  3FV7 A;  4Y7P A;  1DY6 A;  4KZ6 A;  5L8M A;  5L2F A;  1XJ6 A;  2Q9M A;  3IF6 B;  4ZDX A;  5DTS A;  1H5X A;  5FAP A;  2WKR A;  2Z6C A;  4ZJ3 A;  1KE0 A;  1Q2P A;  2Z2L B;  2OAQ 1;  1K55 C;  3QP6 A;  4PPR A;  3BM6 A;  5HAR A;  4PM7 A;  2HGV A;  3WS0 A;  3TSG A;  1OTA A;  3E98 A;  2J8Y A;  5AQ7 A;  3MQ0 A;  2X02 A;  3G2Y A;  3PTE A;  3VE4 A;  1RP5 A;  1OTD A;  5DFX A;  1PW8 A;  3UY6 A;  5EOO A;  4K91 A;  1PWG A;  5E2E A;  4F94 A;  4KZ7 A;  4P6Z M;  1SHV A;  2XR0 A;  4DE1 A;  3EOI A;  3BEC A;  3T4O A;  3HUO A;  2B02 A;  4IJG A;  3HLW A;  3QP1 A;  2WKI A;  1YLY A;  1YLP A;  4CLC E;  2PU2 A;  3H7W A;  3MZF A;  5DVA A;  4EUV A;  3CG5 A;  2EX6 A;  3EGX C;  1CJF A;  1YLZ A;  1K38 A;  2ZJ9 A;  3CHW P;  5EE8 A;  3D4F A;  3C5A A;  3HL9 A;  1OME A;  5GLB A;  4R3J A;  3DTK A;  1TS0 A;  3BY9 A;  4E3I A;  4GNU A;  3PXP A;  4X55 A;  4EBP A;  2WAD A;  1E3U D;  5E2G A;  4QPR A;  2KOI A;  2I72 A;  3KYZ A;  3LO7 A;  4CLC C;  2ZQC A;  2W1T A;  4S2N C;  1DRM A;  4GKU A;  3HCY A;  5EOE A;  4BQM A;  4EQI A;  1ONG A;  2FFF B;  3LFV A;  1H8Z A;  1YQS A;  5F5Y A;  1FOF A;  5D3O A;  4YFM A;  5GL9 A;  3H9W A;  1XP4 A;  1BLP A;  3O3V A;  2XRN A;  1NY0 A;  3VOZ A;  4XUZ A;  2HDU A;  2PYP A;  3LI9 A;  1IEL A;  1W8Q A;  5HWV A;  3MZE A;  5AQ9 A;  5GHY A;  3RTY A;  5CHU A;  5EV0 A;  2BLS A;  5AVF A;  4WZ4 A;  1CEG A;  1J3W A;  2PR6 A;  3CJM A;  5TFQ A;  2ZM2 A;  2XA7 M;  1FR1 A;  5EVI C;  5FAO A;  5HWT A;  5FAT A;  4JLF A;  2M7U A;  3OCN A;  2K7S A;  2WKQ A;  4E3L A;  4HNB A;  2OWJ A;  1GCE A;  4HIA A;  4MBK A;  1DJB A;  2A24 B;  2ZQ9 A;  3CIT A;  1L0G A;  3SS4 A;  2OWH A;  1K6S A;  1PZO A;  3NOP C;  5FQJ A;  3FPV A;  4P0M A;  1PFL A;  4HP9 A;  3MZD A;  2H10 A;  4BBV A;  3C2W A;  4O01 A;  2IA2 A;  1TS6 A;  1L0F A;  2VK3 A;  2JC7 A;  1D06 A;  3S7Q A;  4R0Q A;  1DJC A;  1N4O A;  2ZBB A;  2KX6 A;  1X0O A;  5A90 A;  3IWI A;  1E25 A;  2JKF A;  1D1J A;  4B93 A;  5E2H A;  3CI6 A;  2ZC3 B;  4OQG A;  3BLS A;  2V9A A;  2Y2M A;  1LL9 A;  3UNW A;  1K4E A;  3WRT A;  4KZ4 A;  5FQK A;  4JXV A;  1F98 A;  3G6O A;  3TRC A;  1ZG6 A;  5KIZ A;  2W27 A;  5TGF A;  4QJG A;  4Q0H A;  1CQA A;  4UHU A;  5C5K A;  5GLA A;  1LHY A;  4JXG A;  1PZP A;  3HUN A;  4MN5 A;  3N8L A;  5F1G A;  3BQ8 A;  1ZG4 A;  3IXH A;  2J3T D;  4NEE D;  4PKY G;  3UDI A;  1FR6 A;  2JBF A;  2ZC5 B;  3FYZ A;  3UDX A;  4EW7 A;  4EBL A;  3MFD A;  3FWL A;  3G34 A;  4YOF A;  3PBR A;  3S7P A;  5HL1 A;  5FQI A;  4OP8 A;  5LBR A;  2H5S A;  2HP9 A;  4NG2 A;  4X1M A;  4GDN A;  5HAQ A;  5HSQ A;  3VP2 A;  3ZNY A;  1IYP A;  1NXY A;  3HLG A;  4GDB A;  4NXE A;  3E4Q A;  4GHI B;  4LV1 A;  2H0Y A;  5FDS A;  1W5D A;  3O86 A;  2Q9N A;  5FI2 A;  5FL3 A;  4QHC A;  5CTM A;  2GJ3 A;  4DF6 A;  4GS9 A;  4IVK A;  4WF0 A;  3MKF A;  3B47 A;  4ID4 A;  2HPB A;  1BLH A;  3MFX A;  5DKK A;  4EQ1 A;  5DF7 A;  5F68 A;  4B4Z A;  3HLE A;  3IX3 A;  3UB6 A;  3P01 A;  1F2K A;  3MQQ A;  3F1P A;  1HTZ A;  2V0W A;  3A0R A;  3MF0 A;  3V50 A;  4CLC B;  2L4R A;  3BFC A;  3GTC A;  4QB8 A;  4G3W A;  4DE3 A;  3R7W A;  3FG8 A;  3IBJ A;  1XJ2 A;  2LB9 A;  3W8K A;  2Y2O A;  1S66 L;  3VSL A;  4OPZ A;  3Q1F A;  3RXW A;  3G4P A;  3WRZ A;  3D72 A;  5A8B A;  5I5L A;  3QP8 A;  3N8R A;  1YMS A;  4O7D A;  1GHP A;  1VEU A;  3DTI A;  5KMW A;  1S4R A;  4ESP A;  4KG6 A;  4DDS A;  4EUZ A;  3ZCZ A;  4DN0 A;  4X25 A;  3NY4 A;  4OQI A;  5EVI B;  1JVJ A;  3O87 A;  4CQH A;  4K0W A;  1FCN A;  4P6B A;  5M18 A;  1DP8 A;  3IS2 A;  3CLO A;  4E3K A;  3C4O A;  3ZFZ A;  1OPX A;  3IXB A;  3CUE C;  4B4X A;  2INW A;  1LSX A;  3RXX A;  4I3I A;  2VGL S;  3OPH A;  5IT5 A;  2Y2Q A;  1KOU A;  3H82 A;  3PBO A;  4DRT A;  1YLT A;  3VP3 A;  1MBL A;  1CI8 A;  2XGN A;  2WUQ A;  3IXD A;  1PIO A;  4OON A;  2YKH A;  3JPU A;  2Y2N A;  4L9F A;  2JKR M;  2WKP A;  1H8M A;  1MWT A;  2HZ5 A;  3LYX A;  3HLF A;  4I38 A;  2Y2G A;  3LGO A;  1L2S A;  5I94 A;  4S2P A;  1PRQ A;  2FFY A;  5U47 A;  3SS3 A;  2CMN A;  4IBX A;  4OP5 A;  1SZV A;  2MJ6 A;  3VMA A;  4OQH A;  4E04 A;  1K56 D;  5EUA A;  1IFQ A;  3P98 A;  1O07 A;  1V9Z A;  3E0Y A;  2HDQ A;  5A93 A;  2VV8 A;  4WZ5 C;  2FH5 A;  4F3L B;  4K08 A;  1MZU A;  3C4P A;  3MBZ A;  5J3W A;  4KQO A;  2OAP 1;  5E2F A;  5EFW A;  5CGS A;  1SDE A;  4GZB A;  5DF9 A;  1NYY A;  5J7E A;  2VJW A;  2Y2L A;  4Q8I A;  2EWV A;  3WS5 A;  3GSG A;  3MKE A;  4KUO A;  1TDG A;  2RCX A;  3IF6 A;  4M4X A;  1P9W A;  2Y91 A;  1A0K A;  3U2A A;  4QY5 A;  3ISG A;  3N8S A;  5GLD A;  3GVB A;  3VFH A;  3DWZ A;  3MXR A;  1FQG A;  2VLG A;  3Q81 A;  1GA9 A;  3KSI A;  3VE3 A;  1LLB A;  2V8C A;  4R4R A;  3RJU A;  1IOU A;  3UN7 A;  3HLB A;  3OOV A;  1NRJ A;  1PWC A;  3BFE A;  1I2S A;  1JTG A;  5F83 A;  3ZHH A;  4H8R A;  2VGK A;  5EEC A;  1BT5 A;  1NLZ A;  4EET B;  3BY8 A;  2W3G A;  3QP5 A;  1BLS A;  3IQA A;  1VET B;  4B88 A;  3G32 A;  2X01 A;  1XA1 A;  2XQZ A;  3K2N A;  4UAA A;  3V3R A;  1T1A A;  4QD4 A;  3IXG A;  2DCF A;  1ES5 A;  1DP6 A;  4GD6 A;  4EXO A;  1KDW A;  4DE2 A;  1S6R A;  3T1Q B;  3LUQ A;  1LT0 A;  4S2J A;  5HL6 A;  5F69 A;  3LY4 A;  1FCM A;  1KVM A;  3NDG A;  4WL9 A;  4PM8 A;  4G3V A;  2DMW A;  1LL8 A;  2L1M A;  1DP9 A;  4L9G A;  1UWP X;  1U60 A;  1ZHH B;  3EWK A;  1YLJ A;  5FQM A;  2Y2P A;  3ZG7 B;  4WMC D;  1EW0 A;  1MXO A;  4QWO A;  4P85 A;  1PNE A;  4R23 A;  2J3T C;  5G4Y A;  3PBN A;  1H8Y A;  3BFF A;  3Q82 A;  3M2K A;  5G4Z A;  5CRF A;  3T12 B;  5FAQ A;  4L9E A;  4BD0 A;  2J7V A;  2EFU A;  4OKP A;  3UE3 A;  3EEA A;  1K57 A;  4K0X A;  5CHM A;  1I2W A;  1MWS A;  4N1H A;  4IVI A;  2UWX A;  3VP4 A;  5M19 A;  3NHQ A;  1YSP A;  1K0K A;  4FCF A;  2W3H A;  3PBT A;  1NJ4 A;  5KSC A;  2D02 A;  2WAF A; 
#chains in the Genus database with same CATH homology
 4PKY A;  2V9A A;  4OOM A;  2P04 A;  5DJT A;  3NOT C;  3T4S A;  4Y5F A;  2A24 A;  1F98 A;  3G6O A;  3TRC A;  3PYP A;  2VZW A;  5KIZ A;  3CAX A;  2W27 A;  2BAS A;  4Q0H A;  5DKL A;  4DMZ A;  2HJ9 C;  4OOL A;  5C5K A;  2O9C A;  4MN5 A;  4GS9 B;  1N9N A;  3BQ8 A;  2J3T D;  4NEE D;  4PKY G;  3VV4 A;  2XSS A;  4EW7 A;  1OJ5 A;  4R3A A;  3UMD A;  3NOU C;  4GJ4 A;  4UQI M;  4YOF A;  1VB6 A;  3PBR A;  3S7P A;  1G6O A;  1P0Z A;  3S7O A;  5LBR A;  1N9L A;  1W63 Q;  4GW9 A;  2QWS A;  5HDD A;  4YWZ A;  2M7V A;  3F1P B;  5HSQ A;  3ZQ5 A;  5J4E A;  2JKT I;  3B33 A;  3LIC A;  4I5S A;  4P6Z S;  5HD3 A;  3FC7 A;  2W3D A;  5AVE A;  4NXE A;  2XRO A;  3E4Q A;  3GEC A;  2JN7 A;  2EWW A;  3A0S A;  4GHI B;  3R7W B;  2W1R A;  3T50 A;  3V67 A;  3KO6 A;  3MJQ A;  1MC0 A;  2JHE A;  1JNU A;  4UEY A;  4NXG A;  5FL3 A;  3MR0 A;  4AFI A;  2D01 A;  5TBM B;  2GJ3 A;  3CWF A;  4RQ9 A;  2V1A A;  4GS9 A;  4HH2 A;  4WF0 A;  3LIF A;  4HP4 A;  3B47 A;  5HDS A;  4I39 A;  1XJ4 A;  4HJ6 A;  3MFX A;  5DKK A;  3GDI A;  1YAX A;  4EQ1 A;  5TJJ A;  1TS8 A;  3IBR A;  5F68 A;  4LLO B;  2PD8 A;  5HDC A;  1ZTU A;  2G7U A;  1BYW A;  2I9V A;  2PYR A;  4YNR A;  3TE8 A;  3EGD C;  3UB6 A;  3IS2 B;  3MMH A;  3TJZ C;  3P01 A;  3MQQ A;  3F1P A;  2V0W A;  3ULF A;  2EA9 A;  3A0R A;  3LR0 A;  3MF0 A;  3HJK A;  4CLC B;  2L4R A;  2PR5 A;  4EEU A;  4B9O A;  4UQI S;  3T4K A;  4EER A;  2B18 A;  2PT7 A;  4G3W A;  3LIE A;  3BJN A;  2P08 A;  4GHI A;  5AJG A;  2JKR I;  3R7W A;  3OCL A;  3RFB A;  3FG8 A;  3H82 B;  2J3W A;  3F1O B;  3IBJ A;  2QJ7 A;  3PR6 A;  1XJ2 A;  2JKT M;  2LB9 A;  4HOI A;  2Y79 A;  4HHD A;  2O9B A;  2A2L A;  4LPZ A;  3B42 A;  2Z6D A;  1S66 L;  3LR3 A;  3UB9 A;  3KSH A;  1S4S A;  2PD7 A;  1N9O A;  4KUK A;  3D72 A;  5A8B A;  2XA7 S;  1S67 L;  5I5L A;  5TBM A;  1S1Y A;  3KYQ A;  2Y8H A;  4ARZ B;  3KX0 X;  3KSF A;  4O8G A;  2W3F A;  1T1C A;  3S7N A;  3F1N B;  3EEH A;  1WA9 A;  1NLY A;  1S4R A;  4BMW A;  3T4Q A;  4NXB A;  1OTB A;  1T1B A;  4DN0 A;  3LR5 A;  4NXF A;  2ZMV A;  4LRY C;  3LI8 A;  4FSF A;  3TW8 A;  4MCW A;  1GSV A;  4CQH A;  3W2Z A;  1XJ3 A;  2NUP C;  5HPF A;  2PHY A;  2J80 A;  1DP8 A;  3IS2 A;  1G28 A;  2O9A A;  3CLO A;  1LSW A;  3UB8 A;  3LIB A;  4GLQ A;  4CLC A;  1OPX A;  4MN7 A;  5IS1 A;  3CUE A;  2HJE A;  3CUE C;  2INW A;  2QKP A;  3EQU A;  1LSX A;  4HI4 A;  4DJ3 A;  4WEJ A;  1TF1 A;  2ZOI A;  3FPW A;  4I3I A;  2VGL S;  3A0V A;  5DJU A;  1STZ A;  5IT5 A;  4NKP A;  1KOU A;  3H82 A;  3F1O A;  3PBO A;  1TD5 A;  4IUH A;  4MMN A;  4HQA A;  1GSX A;  2W3E A;  3SW1 A;  2QJ5 A;  2V0U A;  3ICY A;  4HJ3 A;  2P7J A;  2YKH A;  2VV7 A;  1T18 A;  4L9F A;  2JKR M;  4IHQ A;  2ZOH A;  2WKP A;  3JVU A;  1H8M A;  3T4T A;  5HWW A;  4LRX C;  1VHM A;  3K3C A;  2VX8 A;  3LYX A;  4ARZ A;  5HPI A;  3HJI A;  4I38 A;  2R78 A;  1T19 A;  3F1N A;  4ETX A;  1TS7 A;  5L8M A;  1XJ6 A;  3H7W B;  2K31 A;  4Z1W A;  4HY8 A;  5K5B A;  1OT9 A;  4BBT A;  1MKM A;  4BJP A;  3OBF A;  3E4P A;  4FOF A;  4Q0I A;  3PBQ A;  2CMN A;  2MJ6 A;  2WKR A;  2Z6C A;  3ZYT A;  4E04 A;  1P97 A;  4IUK A;  4XT2 B;  2GZA A;  1IFQ A;  1V9Z A;  3E0Y A;  2OAQ 1;  1F9I A;  2VV8 A;  4R70 A;  5HZH A;  1YKD A;  2KDK A;  2FZ0 A;  3JVV A;  2FH5 A;  2HGV A;  4F3L B;  4K08 A;  1MZU A;  3RH8 B;  3T4J A;  2KLI A;  2VKS A;  1H3Q A;  2LB5 A;  1OTA A;  3UME A;  3E98 A;  5J3W A;  1NWZ A;  4WEK A;  4KQO A;  3C38 A;  2OAP 1;  3MQ0 A;  5EFW A;  2W1T B;  3UB7 A;  3VE4 A;  3BWL A;  1OTD A;  5DF9 A;  5DFX A;  3UE6 A;  4BWI A;  4EEP A;  3LR4 A;  3C8C A;  5J7E A;  1S1Z A;  2VJW A;  3OC2 A;  4P6Z M;  2EWV A;  3K3D A;  3EOI A;  4BBU A;  4EU0 A;  4ZRR A;  2VEA A;  4PHT A;  3T4O A;  2B02 A;  4IJG A;  4KUO A;  1OTE A;  1XFN A;  2M1C A;  4CLC E;  3BQA A;  3H7W A;  4H6J B;  4M4X A;  4EUV A;  1LSV A;  2V1B A;  3EGX C;  2O99 A;  1P9W A;  4LRZ E;  3VOL A;  3U2A A;  4JGO A;  1OT6 A;  2VLG A;  4XT2 A;  4O0P A;  4WUJ A;  3KSI A;  3VE3 A;  1TS0 A;  3BY9 A;  4HJ4 A;  3D3O A;  3PXP A;  3T4L A;  1IOU A;  5KSH A;  3OOV A;  4F3L A;  2O0Y A;  2GX5 A;  1NRJ A;  4QPR A;  2KOI A;  3KYZ A;  4R6L A;  3OLO A;  4MDZ A;  4ME4 A;  2NUT C;  4CLC C;  4ETZ A;  3EQV A;  1NLZ A;  3KSG A;  1D7E A;  2W1T A;  1W63 M;  4EET B;  1YSQ A;  3BY8 A;  4WLA A;  2W3G A;  1DRM A;  1Y28 A;  3K2N A;  1ODV A;  3HCY A;  1T1A A;  1DP6 A;  3LFV A;  4EXO A;  4JGR A;  5F5Y A;  3R4K A;  1OTI A;  4PAU A;  3H9W A;  3LIA A;  2XRN A;  2PYP A;  4H6J A;  3LUQ A;  4EES A;  3LI9 A;  2HV1 A;  4HH3 A;  1LT0 A;  5HWV A;  4II7 A;  5HL6 A;  5F69 A;  4WEL A;  3RTY A;  3BW6 A;  5AVF A;  1F5M A;  2PR6 A;  4WL9 A;  1V9Y A;  4R38 A;  3E4O A;  4G3V A;  2DMW A;  2XA7 M;  2VV6 A;  1LL8 A;  1XFQ A;  2L1M A;  4I3J A;  5CX7 A;  1DP9 A;  5HWT A;  4L9G A;  5F6A A;  3DBA A;  1UWP X;  1ZHH B;  2M7U A;  2W0N A;  3EWK A;  4I3A A;  3MXQ A;  3OCN A;  1UWN X;  5IU1 A;  1UGU A;  2K7S A;  2WKQ A;  1EW0 A;  2VA0 A;  4HNB A;  2OWJ A;  5MC7 A;  4HIA A;  5DFY A;  2J3T C;  2A24 B;  3CIT A;  2PDR A;  5G4Y A;  3NJA A;  2OWH A;  3PHY A;  3PBN A;  4L0L A;  3NOP C;  5G4Z A;  5HD5 A;  1OJG A;  4G3K A;  2K2N A;  3FPV A;  4L9E A;  2HF6 A;  2L0W A;  3C30 A;  3O5Y A;  4HP9 A;  3UE3 A;  3EEA A;  4BBV A;  4CLC D;  4Y3I A;  3LID A;  3C2W A;  2VGL M;  4KQD A;  4O01 A;  4Y2F A;  2IA2 A;  2GNX A;  4JGP A;  1TS6 A;  2OOL A;  3P7N A;  3PBS A;  2YKF A;  1D06 A;  3S7Q A;  4Q0J A;  3NHQ A;  4WN5 A;  1P9R A;  4MN6 A;  1YSP A;  2QHK A;  2ZBB A;  3MQO A;  1GSW A;  4GCZ A;  2KX6 A;  1X0O A;  2W3H A;  3PBT A;  2QYB A;  2H28 A;  4JGQ A;  4B93 A;  2D02 A;  2ZMF A;  3CI6 A;  4DJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...