1XJ6A

Structure of bjfixlh in the unliganded ferrous form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
molecule keywords Sensor protein fixL
molecule tags Signaling protein, transferase
source organism Bradyrhizobium japonicum
total genus 29
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj6A00
3GECA 2JN7A 2EA9A 3VE4A 4I39A 3LI8A 4WUJA 4LRYC 1T19A 3T50A 5DKLA 4GS9B 4LRXC 2W0NA 2QWSA 2PHYA 3F1PB 3E4QA 1GSVA 4LLOB 1XJ6A 4PKYA 4L9EA 1F9IA 3MFXA 3LUQA 2WKRA 5HD3A 1GSXA 2D02A 1OTBA 1OJ5A 2QJ7A 2WKPA 3K3CA 5HDSA 4BBVA 1KOUA 4F3LB 1T1CA 4EEUA 2PYRA 3CLOA 2M1CA 2OOLA 3NOPC 4M4XA 1S1ZA 3EWKA 4GW9A 1XJ4A 5HD5A 4HIAA 5EFWA 3LIBA 2H28A 1LT0A 4I3AA 3MXQA 4HOIA 4HJ4A 1S4RA 3C8CA 2V0WA 2KDKA 4I3JA 3LIEA 2VEAA 1TS7A 4DJ2A 3LIFA 3HJIA 4LRZE 3MQOA 1MZUA 4BBTA 2PYPA 4KQDA 3A0SA 3B33A 4HI4A 4H6JA 5DKKA 2P7JA 5HWWA 5HWVA 1UWNX 2VV7A 5TBMA 4EEPA 1D06A 1S66L 4HJ6A 3F1NA 2INWA 5DJTA 2BASA 3RH8B 3NOTC 5F6AA 2VLGA 4EETB 3CAXA 2R78A 2ZBBA 3FG8A 1DP9A 2V1BA 5J7EA 2QKPA 4GHIB 1N9NA 1DP6A 4GS9A 2Z6DA 1T1AA 2L1MA 4HY8A 3UMDA 2PR5A 3F1PA 3IS2B 3LIAA 4HP9A 4XT2B 3UB6A 4R6LA 4HJ3A 1DRMA 5F69A 5G4ZA 5DJUA 1F98A 1OT9A 3RTYA 5A8BA 4JGPA 4NXFA 2YKFA 4EXOA 4EW7A 1XJ3A 1GSWA 2PD8A 3OLOA 2PD7A 1UGUA 2YKHA 2JHEA 4F3LA 4B9OA 5HWTA 2Z6CA 2OWHA 1OT6A 4HNBA 1OTEA 3H82B 1XJ2A 3ICYA 3H7WB 5J3WA 1LL8A 3C2WA 4JGQA 3UE6A 1EW0A 5AVEA 1V9ZA 3FC7A 3VOLA 1G28A 1S4SA 3KX0X 3SW1A 2VV8A 2OWJA 3EEHA 1D7EA 1Y28A 5IS1A 3MQQA 4GCZA 2A24A 2VV6A 3IBRA 1ODVA 4EQ1A 1V9YA 4EERA 1T18A 3UMEA 4DJ3A 4H6JB 1LSXA 3LIDA 2ZOHA 2QJ5A 3A0RA 1LSVA 1N9LA 3F1OA 3D72A 4MN5A 3E4OA 4LPZA 2W27A 2K7SA 4NXEA 5G4YA 1TS8A 1LSWA 3F1NB 1S1YA 3HJKA 1BYWA 4PKYG 3NOUC 3MJQA 4R3AA 5HDCA 4HQAA 3G6OA 5KIZA 4JGRA 2CMNA 3E4PA 4GHIA 2HV1A 4WLAA 5F68A 1XFQA 4HH2A 2KX6A 1S67L 3BY8A 1XFNA 4NXBA 4JGOA 3IS2A 3LI9A 3H9WA 4XT2A 4I5SA 5HSQA 2B02A 4I38A 4MN6A 4KUKA 2PDRA 4HP4A 2QHKA 5J4EA 4KUOA 3P7NA 2V9AA 3VE3A 1WA9A 2WKQA 2PR6A 5HZHA 1N9OA 1NWZA 3K3DA 5I5LA 3PYPA 1JNUA 3ULFA 1T1BA 2L0WA 4R70A 5AVFA 1DP8A 4E04A 3H82A 4WL9A 1OTIA 3UB8A 5IU1A 3H7WA 3BWLA 4EESA 4NXGA 1VB6A 2V1AA 3GDIA 4K08A 4WF0A 2D01A 1OTAA 4WN5A 1P97A 3CWFA 5F5YA 2J80A 3NJAA 1TS0A 4HH3A 4I3IA 4HHDA 1OJGA 1OTDA 2A24B 3BY9A 2I9VA 1TS6A 4L9GA 5HDDA 3NHQA 3UB7A 2ZOIA 4YWZA 3A0VA 5TBMB 2GJ3A 1P0ZA 2V0UA 3LICA 4L9FA 3ZQ5A 4BBUA 3MR0A 3F1OB 1X0OA 3PHYA 3UB9A 1UWPX 3LYXA 2L4RA 4RQ9A 4R38A
chains in the Genus database with same CATH superfamily
3GECA 2JN7A 2KOIA 5KSHA 3MXSA 3FKVA 2A49A 4LRYC 4G3WA 4EUZA 1N9BA 3NY4A 4GS9B 5CHUA 5DTKA 5CTNA 4ZJ1A 3WRTA 4XXRA 4X69A 3I7JA 1IYPA 3O86A 5KMWA 1IYQA 2XRNA 2XLNA 4F94A 4PKYA 3HLBA 3GRJA 4E3JA 3BM6A 1BLSA 3VOZA 5HARA 2V2FF 2EX6A 3ITBA 4LCLA 4X1MA 2M7UA 2J3TC 2BTFP 4PHTA 3K3CA 5HDSA 3MS6A 2HF6A 4OP8A 1KOUA 4F3LB 3PBTA 5FAQA 3DTEA 4EEUA 1YLYA 2PYRA 4IJGA 4PM6A 4GDBA 4BD1A 3CPTA 2XA7M 3NOPC 4II7A 1S1ZA 3QP5A 3EWKA 2XDMA 2H10A 3M6HA 5AJGA 3GMWA 3HLGA 3MMHA 2G2UA 2VGLM 5CGWA 3LIBA 2XFSA 2H28A 4BMWA 5FL3A 1LT0A 1JTDA 2V0WA 2KDKA 2P9VA 2XEPA 5GLCA 3ZHHA 5HFOA 4Q8IA 3RXWA 1XGJA 4DJ2A 3VSLA 4E6WA 3HJIA 2JKTI 4BBTA 4N1XA 1FR1A 4ZRRA 3T1XA 4H6JA 4U0TA 4EUVA 2LB9A 4X56A 3W2ZA 5HWWA 5CECA 5HWVA 3IH8A 2HPBA 2QYBA 5TBMA 2ZQ8A 5K5BA 1D06A 1FCNA 5EM0A 5A93A 3F1NA 1TVFA 4WEKA 3HREA 4B4XA 5DJTA 4Y15A 2BASA 3ZG9B 3IQAA 4AFIA 3SH9A 1H0MA 4MBFA 1RP5A 2ZL1A 1KGFA 2ZQCA 4CJNA 3N4IA 3O5YA 3IHBA 1KVLA 3BFDA 3VP4A 3Q7VB 1DJCA 1K57C 1DP6A 2JCHA 5FAOA 2PR5A 2I72A 3CJMA 3EGXC 5A90A 4EV4A 3F1PA 2ZC6B 3UB6A 4R4SA 4HJ3A 3MZDA 4OOLA 1DRMA 3ZG0A 1OT9A 2XR0A 1FSYA 1XX2A 3OCLA 4GLQA 4NXFA 4EXOA 2EX9A 3IBJA 2PD8A 1KGEA 5FDSA 1PYYA 2JE5A 1MC0A 4ZAMA 5EECA 3D4FA 2JKGA 4MMNA 3OPPA 3CZDA 4HNBA 1GHPA 3C4OA 2WGWA 4KZ8A 2EX2A 1I2WA 3N8LA 5J3WA 5EV0A 1LL8A 5HX9A 3UE6A 3IF6C 3AGDA 3Q1FA 3A3IA 3LO7A 1G28A 4E3IA 5MC7A 4CLCB 4QY6A 1PWGA 1BUEA 2HJ9C 3M2JA 2V20A 5FEGA 4GCZA 4PMAA 3UNWA 2H0TA 2Y2NA 3IBRA 1TEMA 4Z1WA 2ZC3B 4OQ0A 3R4KA 5EVIB 2FFYA 1V9YA 2ZLYA 4DJ3A 3HLFA 3FZCA 3E2KA 2ZOHA 3A0RA 1N9LA 4KZAA 4DXCA 1N4OA 5CGSA 4MN5A 2K7SA 4GDNA 3VFFA 3B47A 1LSWA 3SS5A 1BYWA 3IHAA 5L07A 4G3KA 3E98A 4PM8A 1PZOA 4HQAA 2XD5A 1K6SA 5KIZA 4GKUA 3E4PA 2ZQ9A 5F68A 4YFMA 3DWZA 3SH8A 2WADA 5GLDA 3EQVA 5HPFA 3VFHA 4R3BA 4XT2A 5GL9A 4KUKA 2PDRA 2QHKA 4KG6A 5J4EA 3N8SA 3IXGA 4N9LA 3LCEA 1WA9A 4WZ4A 4P0MA 2Y2PA 2JBFA 1CI8A 1N9OA 3S7NA 3VOYA 1E4DA 1G68A 1JVJA 3MF0A 4S2LA 1WYBA 1T1BA 2J9OA 3UE3A 4G3VA 3BW6A 4KZ5A 1H8ZA 2AVXA 2IWBA 5AVFA 4E04A 3V5MA 3UB8A 1H3QA 2IA2A 3KO6A 1G6OA 3GDIA 5HW3A 3A3FA 1BT5A 3BECA 2W3DA 2OSUA 5U47A 4WMCD 1BTLA 3V3SA 1TS0A 1ES3A 3Q81A 1I5QA 3IF6A 2WK0A 3PTEA 4MLLA 1HZOA 3UB7A 2ZOIA 5LBRA 3DTMA 3CI6A 3S1YA 3G30A 2Y59A 2O0YA 3MQ0A 3S7OA 1P0ZA 3MKFA 2V0UA 3LICA 3U2AA 4FOFA 5EOEA 3MR0A 1K56D 4R1GA 3V50A 3L9KA 5A91A 1BLHA 3SS4A 4GD8A 4YOFA 2G7UA 1L0GA 4R38A 1ES5A 1HD8A 2BLSA 5HPIA 1DY6A 3HCYA 3VE4A 4ME4A 1PZPA 4FCFA 5E2EA 3NBLA 3LI8A 3T50A 2Y2HA 4JBFA 3FV7A 3OZHA 4Y0OA 1LI9A 1ERMA 5GHZA 2PHYA 1A0KA 1GSVA 4ARZA 1XA1A 2C5WB 1XJ6A 5DTTA 5JYPA 4UHUA 4L9EA 1F9IA 1K4EA 4DE2A 2WKRA 4GD6A 5HD3A 1GSXA 2WKHA 5E43A 1E3UD 2J9PA 3P98A 1OJ5A 1BULA 1ONHA 4BBVA 4OH0A 4UQIM 4E6XA 2FZ0A 4HEFA 1T1CA 3OBFA 3PBQA 3CLOA 1W5DA 3ITAA 3PR6A 2OOLA 2HGVA 4M4XA 4MDZA 1PW8A 5DF9A 4OP5A 1OPXA 2Y2LA 3HLWA 1NJ4A 1Q2QA 1L0EA 1C3BA 5FA7A 1CF0A 4FTXA 5F82A 1MWUA 4I3AA 4JXGA 2K31A 2DCFA 1LHYA 2VZWA 3HLDA 5CHMA 3KSFA 1YLZA 1ONGA 3QP4A 1PW1A 3QNCA 3UDFA 3IX8A 1SKOB 1IEMA 4KQDA 4EBLA 4ETZA 5FI6A 2VA0A 4BENA 5GHXA 4A5RA 1MWRA 4JF4A 1UWNX 4BJPA 4OQGA 2A3UA 3ZVWA 5L2FA 5EE8A 2IWCA 3LEZA 3VMAA 4X1LA 3LR5A 2Z2LB 4EWFA 1TDGA 4S2MA 3RH8B 4EETB 2Y79A 2ZM0A 3CITA 5FQ9A 3CAXA 5KZHA 4K0WA 5AQAA 4S2OA 2ZM8A 4FUWA 3FG8A 3S7PA 2ZC7A 1HLUP 3CUEC 3L7HA 4LV3A 1TF1A 2QKPA 5HAPA 2Y2GA 3NC8A 3S4XA 2PBDP 4U3TA 4GS9A 1ZG6A 2L1MA 3IS2B 3FKWA 1PWDA 4R6LA 4WBGA 1F98A 3RTYA 3TW8A 3HBRA 3P09A 1ZG4A 1J3WA 4EW7A 1XJ3A 5DVAA 1L2SA 1ALQA 3MZFA 3OLOA 4RYEA 1JWVA 5AQ7A 5FATA 4OQHA 2C6WB 2VK3A 4F3LA 4UQIS 3LGOA 4OQIA 2ZC4B 2Z6CA 3LFVA 2VX8A 4CLCC 1OT6A 2Q9MA 1M6KA 1K54C 1PIOA 3H82B 1SHVA 5EVLA 1XJ2A 4S2KA 1ACFA 3A3JA 3DTIA 3H7WB 2NUPC 5J8XA 1VHMA 1YSPA 2QPNA 2XF3A 4MCWA 3SW1A 4DXBA 1ESUA 1BLPA 5EVIC 2PAVP 4KZ6A 1Y28A 2Z2MB 4Q0HA 1E25A 3KYZA 1O7EA 2ZC5B 2P9VB 1ES2A 4DDSA 1EI5A 1XGIA 2A24A 3KSHA 1GA0A 1SDEA 3MSHA 3UO9A 4JLFA 2VV6A 3A3DA 4YINA 4PM9A 4EQ1A 4EERA 5FDHA 4H6JB 3NULA 1K4FA 4OPQA 2QJ5A 1LSVA 1YMSA 2HDQA 2RL3A 4QU3A 5GHYA 3D72A 3C4PA 3E4OA 3ZG8B 5G4YA 3F1NB 2E8JA 4UA6A 1S1YA 4UA9A 1YM1A 2WYXA 3NCKA 4WYYA 1ZC2A 5TJJA 3MJQA 4E3OA 3GTCA 1K25A 1GHMA 4CPKA 1VM1A 4JGRA 4R0QA 2OLVA 5FQMA 1IFQA 1KDSA 4NG2A 1XPBA 1KE4A 3IX3A 4HH2A 1XP4A 4EBNA 4Z9QA 5I94A 1I2SA 1RGYA 2B95A 3CUEA 4I5SA 4CQHA 3G4PA 2B02A 4MN6A 3RFBA 4WMCA 4HP4A 4PAUA 1CK3A 1Y54A 2EXBA 1FR6A 4Y17A 1K0KA 3PXPA 4E3LA 4X68A 4ZJ2A 1RCJA 2HP9A 1NWZA 3T4KA 3C30A 4P6ZS 3K3DA 3ZFZA 3PYPA 3MKEA 3QNBA 3D3OA 5CXWA 3UPPA 3ZDJA 3A3EA 4GNUA 2JKRM 4DN0A 4R70A 3QP8A 1DP8A 2A2LA 4P6BA 1K56A 1LLBA 1WE4A 4GZBA 4C3QA 2RCXA 3BWLA 4EESA 1NZUA 4WF0A 1H5XA 4MN7A 3UE0A 1MKMA 4NK3A 4JF6A 4LV0A 4S2NC 4RA7A 1GA9A 4KZ4A 3IWIA 4X53A 4HH3A 4I3IA 4EBPA 4MEZA 3O88A 1TS6A 1PI5A 4L9GA 3PBNA 5E2HA 2HJEA 3UY6A 4NETA 1YSQA 1KE3A 3RXXA 4Y5FA 3FYZA 2HDUA 1YT4A 3B42A 3ZQ5A 2V8FA 2Y2KA 3G35A 1X0OA 3TE8A 3PHYA 2QZ6A 5EPHA 3OC2A 4GJ4A 1E3UA 3LYXA 2L4RA 5DFYA 3ZCZA 5F1FA 1TDLA 3BFCA 1LL5A 2LB5A 3EGDC 1F2KA 3M6BA 4DDYA 4ZBEA 2ZMFA 4BQMA 1MBLA 5KSCA 1T19A 3ZGAB 1ZHHB 5DKLA 1BSGA 4LRXC 3JYIA 3GVBA 1MY8A 3BFGA 2QWSA 4O0PA 2WAEA 1Y4OA 1FILA 3WS0A 3LEQA 3W8KA 3G2YA 4XUXA 4Q0JA 3QP6A 3LUQA 1K57A 1SKFA 1Z09A 3JVVA 4GOGA 2D02A 3M2KA 3T12B 2QJ7A 5HAIA 1KGGA 3FWLA 3W4OA 1MPLA 2H5SA 4KENB 1QMFA 5E2FA 1YLWA 2WGIA 3UDIA 1P9WA 1K55C 4GN2A 3VP0A 1SDNA 1S0WA 1STZA 3PAGA 4GW9A 5GLBA 1QMEA 3IXDA 4N92A 5CX7A 3WRZA 1KDWA 1U60A 1YLTA 1XJ4A 4R3JA 5HD5A 3W4PA 1ERQA 1CEGA 1YPRA 1LL9A 3U4LP 2XD1A 5HL6A 1HVBA 2Y2JA 4X55A 3MXQA 4HOIA 1IYSA 4OPRA 3OOVA 3SH7A 2JKTM 1SZVA 2EX8A 3Q82A 5CRFA 1CQAA 2X71A 4LRZE 2Y2IA 3K2NA 3IF6B 2JC7A 3MQOA 1MZUA 1L3LA 3LR3A 2O9AA 2PYPA 1MWSA 2WZZA 5DFXA 3VP1A 3T1QB 1J9MA 2J8YA 4S2NA 3TOIA 2DNSA 2VV7A 5L10A 2P08A 2W3HA 1AXBA 2P74A 4DE0A 1S66L 3BRMA 4JKTA 4HJ6A 2WKIA 4FH2A 2INWA 4LV2A 4CLCD 5HL1A 4BWIA 4IBXA 2VLGA 2OLUA 3TJZC 5TFQA 2XGNA 2R78A 2ZBBA 3HUMA 2V1BA 5IT5A 4GHIB 4UAAA 4HBUA 1N9NA 2WAFA 3BLMA 4M3KA 5EVID 4C6YA 4HBTA 4O01A 4HY8A 1HTZA 1VETA 4C75A 1GCEA 3EEAA 3DBAA 5DJUA 5A8BA 4JGPA 4KG2A 4IEDA 1NY0A 2YKFA 2ZM2A 5F83A 1W63Q 3HUOA 4P85A 4S2JA 2R9XA 3OPRA 3IF5A 2PD7A 1UGUA 3S7QA 2GZAA 4D60A 5FI7A 2YKHA 4ESPA 5AQBA 2JHEA 1GHIA 2MJ6A 1EWZA 5HWTA 2OWHA 4QB8A 3WS4A 4OLGA 3VP2A 4KZ3A 4KZBA 4WEJA 3TSGA 1PWCA 3WS2A 3LR0A 3GSGA 3DW0A 4JGQA 3IXBA 1EW0A 3IT9A 3OCNA 1V9ZA 2Y2QA 3FC7A 1IOUA 3OPLA 4MBKA 1K55A 3HVFA 2HDRA 5EVEA 2OWJA 4B93A 1D7EA 5IS1A 2Y8HA 1FOFA 3MQQA 4FH4A 4R4RA 3ZG7B 1NRJA 3B3XA 3UPNA 3N6IA 3MBZA 4YNRA 1W7FA 2HP6A 2GNXA 1Z6FA 1ODVA 1W8YA 4E3NA 3IWOA 5CEBA 2W1TB 3MFDA 3C38A 1W79A 2DMWA 2EWVA 5FASA 3LIDA 3DTKA 3F1OA 3CG5A 3R7WA 3WS5A 1ZKJA 2XFTA 1VEUA 2G2WA 4Y0UA 5CTMA 4S2IA 5TR7A 4NXEA 3FPWA 4X25A 3JPUA 1XA7A 4ID4A 1VQQA 5D3OA 3NOUC 2NUTC 2XROA 2FH5A 3HL9A 2B5RA 2CMNA 3T1SA 4BL2A 3PAEA 2HV1A 4WLAA 2EFXA 4Y3IA 3BY8A 1XFNA 1K6RA 4NXBA 4JGOA 3IS2A 2R9WA 3H9WA 4K91A 1D1JA 4O7DA 4BLMA 5EOOA 5DTSA 4U0XA 4P6ZM 4KUOA 3V67A 3HLEA 1MXOA 2W3GA 1YMXA 2WKQA 1IELA 3BJNA 2JKFA 3GR2A 5DF8A 3CPTB 3D9YA 2WKEA 3IXHA 4R23A 2ZJ9A 3V39A 3QP1A 3EQUA 4OOMA 2L0WA 4PPRA 3GQZA 3H82A 1OTIA 4DRTA 3H7WA 4QY5A 3ZYTA 1JWPA 4L0LA 3T4QA 3G32A 1VB6A 4K08A 4Y13A 1OTAA 4WN5A 1P97A 5M1AA 4IUHA 3C7UA 1MWTA 2A24B 3ISGA 2Y55A 4RX3A 5HDDA 5M18A 4YWZA 4ZTKA 2Y4AA 4RX2A 4NKPA 1O07A 3NDEA 5TBMB 2W3FA 2HZ5A 4IHQA 4QWOA 5CERA 4L9FA 1YLPA 4BBUA 1PFLA 1G5UA 4N1HA 3UB9A 4XUZA 1MKIA 5FQIA 3E2LA 2P04A 2O9BA 1L0FA 2EA9A 2ZL1B 4I39A 2VGKA 4QJGA 3IX4A 3VP3A 4KZ9A 4WUJA 3T4LA 3Q7VA 2W0NA 2ZD8A 1H8YA 2V1ZA 3F1PB 4KQQA 3N7WA 3E4QA 2H0YA 4LLOB 3C7VA 3G34A 3MFXA 4HESA 5CHJA 5DF7A 1KVMA 2EXAA 4DF6A 3SZTA 3CHWP 2ZMVA 2QMIA 2XK1A 4H8RA 1OTBA 1G6AA 1JTGA 3T1RA 2WKPA 4Y7PA 3UE1A 1Q2PA 4B88A 3ZNTA 1ZTUA 3G31A 2UWXA 4N9KA 1FCMA 1JWZA 2O99A 4DE1A 4D2OA 4ZDXA 2M1CA 3BQAA 4NEED 4DKIA 1NLYA 2WGWB 4MNRA 1BZAA 4KQRA 2Y91A 3C5AA 3PBOA 4ZJ3A 4KQOA 4LV1A 3SS3A 4HIAA 5EFWA 4JF5A 2XA7S 4CLCA 4KZ7A 4GB7A 3RJUA 2PU2A 1K54A 4HJ4A 1S4RA 1RGZA 3C8CA 3BFFA 3T4OA 4I3JA 2PBYA 2VGLS 2ZQ7A 1IKIA 5EUAA 3LIEA 2OV5A 5FI2A 2VEAA 1TS7A 2V8CA 1NRFA 3LIFA 4E3MA 2ZQAA 3HLCA 5EVIA 3A0SA 5HAQA 3B33A 2VGJA 3FPVA 5F1GA 4HI4A 2CC1A 5L09A 5DKKA 4Q0IA 2P7JA 4UEYA 3BFEA 1OMEA 1NXYA 3NIAA 2ZQDA 3T4SA 2HDSA 4EEPA 1P9RA 1K38A 3LY3A 1FCOA 2J7VA 4RVAA 2VKSA 3DWKA 3NOTC 5F6AA 3WS1A 4OLDA 5IHVA 2Y2OA 1LI0A 4O8GA 3KYEA 1DP9A 3VV4A 4DMZA 5J7EA 2M7VA 3V3RA 1S6RA 2KLIA 4OONA 2PT7A 2Q9NA 2Z6DA 5FQKA 1T1AA 4JXSA 1NYMA 4FD8A 3UMDA 3KSIA 3BLSA 2W3EA 4IVKA 2O9CA 3LIAA 4HP9A 4XT2B 3GV9A 3S22A 4EQIA 5F69A 5G4ZA 3UDXA 3TG9A 3BQ8A 3HUNA 1GSWA 4WZ5C 1CI9A 4KG5A 1AWIA 1YLJA 4Y2FA 1W8QA 1PI4A 2OAQ1 1W63M 2WUQA 4B9OA 3MXRA 3KYQA 2XH9A 3E0YA 2X01A 4E3KA 4UA7A 1OTEA 4PM7A 3ICYA 5FAPA 3C2WA 2Q0OA 2X02A 5AVEA 4BD0A 3NI9A 2WGVA 3VOLA 5JYOA 3P01A 1S4SA 3KX0X 3UPOA 3Q7ZA 2VV8A 3EEHA 1DJBA 3IH9A 5BOHA 4DE3A 4ETXA 3VSKA 5CGXA 3UN7A 3O3VA 4OVDA 2FFFB 2DRWA 2EFUA 1T18A 3UMEA 1IYOA 1LSXA 2J3TD 1FSWA 3T4TA 1EROA 2IWDA 1KE0A 3DAVA 5EM1A 4LPZA 2W27A 3NDGA 5FQJA 1TS8A 5L8MA 2W1RA 4MBHA 3HJKA 3OPHA 3MZEA 4OKPA 1L0DA 2XSSA 4PKYG 4R3AA 2XQZA 5HDCA 3G6OA 4S2PA 3Q07A 4WM9A 5M19A 4BL3A 4GHIA 4ARZB 1WYCA 4IVIA 5A92A 4PM5A 1XFQA 3JVUA 1YQSA 4P87A 3KSGA 2KX6A 4EU0A 1S67L 4Y0TA 1PNEA 3N8RA 2PRFA 1VETB 3W4QA 4X6TA 3LI9A 2WZXA 2UV0E 1SCWA 2GDNA 1M40A 3QHYA 4JPMA 3ZVTA 5HSQA 3BYDA 4I38A 4JXVA 3ZNYA 4OPZA 4JXWA 2HP5A 1BLCA 2VJWA 4IUKA 3P7NA 2V9AA 3VE3A 1XKZA 2PU4A 2GX5A 4OPYA 4LCMA 2EWWA 4IBRA 5GLAA 1F5MA 1H8MA 3LR4A 4FSFA 2PR6A 5HZHA 2B18A 3ZG5A 3PBSA 5AQ9A 5FEFA 3BEBA 5I5LA 4LENA 1JNUA 5FQQA 3SOIA 3NECA 3T4JA 4LGWA 3ULFA 2Y2MA 4WZ5A 3AGEA 5CEDA 3QP2A 3CMZA 4WL9A 1NZOA 5IU1A 4QPRA 1IKGA 1NYYA 4K0XA 4NXGA 1ESIA 5TGFA 1CJFA 2JKRI 2V1AA 2D01A 2E8IA 3CWFA 3PBRA 2ZMAA 5F5YA 3WWXA 1PRQA 2K2NA 4CLCE 2J3WA 2J80A 3NJAA 5C5KA 4WELA 4HHDA 1OJGA 2BG1A 1OTDA 1FQGA 1SKOA 3BY9A 4QD4A 2I9VA 4QHCA 3NHQA 3G2ZA 5FSRA 1YKDA 3A0VA 1XXMA 1CEFA 2W1TA 3O87A 3TRCA 2GJ3A 3LY4A 1YAXA 1FIKA 4B4ZA 1NLZA 3F1OB 2ACGA 1ES4A 3R7WB 2OAP1 3AGFA 1UWPX 5G18A 4OOYA 4LFUA 1VEUB 3IWQA 1DJAA 3EOIA 1TD5A 4RQ9A 3UB5P 5E2GA
chains in the Genus database with same CATH topology
3GECA 3EGDC 2JN7A 2EA9A 2KOIA 5HPIA 5KSHA 3HCYA 3VE4A 4I39A 4ME4A 2ZMFA 3LI8A 4WUJA 4LRYC 1T19A 4G3WA 3T4LA 1ZHHB 3T50A 5DKLA 4GS9B 4LRXC 2W0NA 2QWSA 2PHYA 3F1PB 3E4QA 1GSVA 4O0PA 4ARZA 4LLOB 1XJ6A 2XRNA 4PKYA 4L9EA 1F9IA 3MFXA 4Q0JA 3LUQA 2WKRA 5HD3A 1GSXA 2M7UA 3JVVA 2ZMVA 2J3TC 2D02A 1OTBA 4PHTA 1OJ5A 2QJ7A 2WKPA 3K3CA 5HDSA 4BBVA 4UQIM 2HF6A 1KOUA 1ZTUA 2FZ0A 4F3LB 3PBTA 1T1CA 4EEUA 3OBFA 2PYRA 2O99A 3PBQA 3CLOA 4IJGA 1P9WA 2M1CA 3BQAA 4NEED 3PR6A 2OOLA 2XA7M 3NOPC 2HGVA 4II7A 4M4XA 1S1ZA 4MDZA 1STZA 5DF9A 1NLYA 3EWKA 1OPXA 4GW9A 5CX7A 3PBOA 5AJGA 1XJ4A 4KQOA 5HD5A 4HIAA 5EFWA 3MMHA 2VGLM 3LIBA 5HL6A 2H28A 2XA7S 4BMWA 4CLCA 5FL3A 1LT0A 4I3AA 2K31A 3MXQA 4HOIA 4HJ4A 1S4RA 3C8CA 3OOVA 2V0WA 2JKTM 2KDKA 3T4OA 4I3JA 2VZWA 3KSFA 2VGLS 3LIEA 2VEAA 1TS7A 4DJ2A 3LIFA 3HJIA 4LRZE 3K2NA 3MQOA 1MZUA 3LR3A 2JKTI 2O9AA 2PYPA 4BBTA 4KQDA 3A0SA 3B33A 4ETZA 3FPVA 4HI4A 4ZRRA 2VA0A 4H6JA 5DFXA 5DKKA 4EUVA 4Q0IA 2LB9A 3W2ZA 2P7JA 5HWWA 4UEYA 5HWVA 1UWNX 2QYBA 2VV7A 5TBMA 2P08A 2W3HA 4BJPA 3T4SA 5K5BA 4EEPA 1D06A 1S66L 1P9RA 4HJ6A 3F1NA 3LR5A 2INWA 4WEKA 4CLCD 5DJTA 4BWIA 2BASA 2VKSA 3RH8B 3NOTC 5F6AA 2VLGA 4AFIA 4EETB 2Y79A 3CITA 3TJZC 3CAXA 4O8GA 2R78A 2ZBBA 3FG8A 1DP9A 3S7PA 3VV4A 4DMZA 2V1BA 3CUEC 5J7EA 1TF1A 5IT5A 2M7VA 3O5YA 2QKPA 4GHIB 2KLIA 1N9NA 2PT7A 1DP6A 4GS9A 2Z6DA 4O01A 1T1AA 2L1MA 4HY8A 3UMDA 3KSIA 2PR5A 2W3EA 3EGXC 3F1PA 3IS2B 2O9CA 3LIAA 4HP9A 4XT2B 3UB6A 4R6LA 4HJ3A 3EEAA 3DBAA 4OOLA 1DRMA 5F69A 5G4ZA 5DJUA 1F98A 1OT9A 3RTYA 3TW8A 5A8BA 4JGPA 3OCLA 4GLQA 4NXFA 2YKFA 4EXOA 4EW7A 3BQ8A 1W63Q 1XJ3A 1GSWA 3IBJA 2PD8A 3OLOA 1MC0A 4Y2FA 2PD7A 1UGUA 3S7QA 2GZAA 2YKHA 2OAQ1 2JHEA 2MJ6A 1W63M 4F3LA 4B9OA 4UQIS 5HWTA 3KYQA 2Z6CA 3LFVA 2OWHA 2VX8A 3E0YA 4MMNA 4CLCC 1OT6A 4HNBA 1OTEA 4WEJA 3H82B 1XJ2A 3ICYA 3LR0A 3H7WB 5J3WA 1LL8A 2NUPC 3C2WA 4JGQA 3UE6A 1VHMA 1EW0A 5AVEA 3OCNA 1V9ZA 1YSPA 3FC7A 3VOLA 1G28A 3P01A 1S4SA 1IOUA 5MC7A 3KX0X 4CLCB 4MCWA 3SW1A 2VV8A 2OWJA 3EEHA 4B93A 1D7EA 4Q0HA 1Y28A 2HJ9C 5IS1A 3KYZA 2Y8HA 3MQQA 1NRJA 4GCZA 3KSHA 2A24A 4ETXA 4YNRA 2VV6A 3IBRA 4Z1WA 2GNXA 3R4KA 1ODVA 4EQ1A 2W1TB 3C38A 1V9YA 4EERA 1T18A 3UMEA 4DJ3A 4H6JB 2DMWA 2EWVA 1LSXA 2J3TD 3LIDA 2ZOHA 2QJ5A 3A0RA 1LSVA 3T4TA 1N9LA 3F1OA 3R7WA 3D72A 4MN5A 3E4OA 4LPZA 2W27A 2K7SA 4NXEA 5G4YA 1TS8A 1LSWA 3B47A 3F1NB 3FPWA 5L8MA 2W1RA 1S1YA 3HJKA 1BYWA 2XSSA 4PKYG 5TJJA 4G3KA 3NOUC 3E98A 3MJQA 2NUTC 4R3AA 2XROA 2FH5A 5HDCA 4HQAA 3G6OA 5KIZA 4JGRA 2CMNA 1IFQA 3E4PA 4GHIA 4ARZB 2HV1A 4WLAA 5F68A 1XFQA 3JVUA 3KSGA 4HH2A 2KX6A 4Y3IA 1S67L 4EU0A 3BY8A 1XFNA 4NXBA 3EQVA 4JGOA 5HPFA 3IS2A 3LI9A 3H9WA 4XT2A 3CUEA 4I5SA 4CQHA 5HSQA 2B02A 4I38A 4MN6A 3RFBA 4KUKA 2PDRA 4HP4A 4PAUA 2QHKA 4P6ZM 5J4EA 2VJWA 4KUOA 4IUKA 3P7NA 2V9AA 3V67A 3VE3A 1WA9A 2GX5A 3PXPA 2W3GA 2EWWA 2WKQA 1H8MA 1F5MA 3LR4A 3BJNA 4FSFA 2PR6A 5HZHA 1N9OA 3S7NA 1NWZA 3T4KA 2B18A 3PBSA 3C30A 4P6ZS 3K3DA 5I5LA 3PYPA 3MF0A 1JNUA 3EQUA 3T4JA 3ULFA 1T1BA 3D3OA 3UE3A 4G3VA 3BW6A 4OOMA 2L0WA 2JKRM 4DN0A 4R70A 5AVFA 1DP8A 2A2LA 4E04A 3H82A 4WL9A 1OTIA 1H3QA 3UB8A 2IA2A 5IU1A 3KO6A 4QPRA 3H7WA 3ZYTA 3BWLA 4EESA 4NXGA 3T4QA 4L0LA 1G6OA 1VB6A 2JKRI 2V1AA 3GDIA 4K08A 4WF0A 2D01A 4MN7A 1OTAA 2W3DA 4WN5A 1P97A 3CWFA 4IUHA 3PBRA 1MKMA 5F5YA 2K2NA 4CLCE 2J3WA 2J80A 3NJAA 1TS0A 4HH3A 4I3IA 5C5KA 4WELA 4HHDA 1OJGA 1OTDA 2A24B 3BY9A 2I9VA 1TS6A 4L9GA 3PBNA 2HJEA 3NHQA 5HDDA 1YSQA 3UB7A 2ZOIA 4YWZA 5LBRA 1YKDA 3A0VA 3CI6A 4NKPA 4Y5FA 2W1TA 5TBMB 3TRCA 2GJ3A 2W3FA 2O0YA 4IHQA 1YAXA 3MQ0A 1P0ZA 3S7OA 2V0UA 3LICA 4L9FA 3U2AA 3B42A 3ZQ5A 4FOFA 4BBUA 3MR0A 3F1OB 1NLZA 1X0OA 3TE8A 3PHYA 3OC2A 4GJ4A 2OAP1 3R7WB 3UB9A 1UWPX 3LYXA 2L4RA 5DFYA 3EOIA 1TD5A 4YOFA 2G7UA 2P04A 4RQ9A 2O9BA 4R38A 2LB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEC A;  2JN7 A;  2EA9 A;  3VE4 A;  4I39 A;  3LI8 A;  4WUJ A;  4LRY C;  1T19 A;  3T50 A;  5DKL A;  4GS9 B;  4LRX C;  2W0N A;  2QWS A;  2PHY A;  3F1P B;  3E4Q A;  1GSV A;  4LLO B;  1XJ6 A;  4PKY A;  4L9E A;  1F9I A;  3MFX A;  3LUQ A;  2WKR A;  5HD3 A;  1GSX A;  2D02 A;  1OTB A;  1OJ5 A;  2QJ7 A;  2WKP A;  3K3C A;  5HDS A;  4BBV A;  1KOU A;  4F3L B;  1T1C A;  4EEU A;  2PYR A;  3CLO A;  2M1C A;  2OOL A;  3NOP C;  4M4X A;  1S1Z A;  3EWK A;  4GW9 A;  1XJ4 A;  5HD5 A;  4HIA A;  5EFW A;  3LIB A;  2H28 A;  1LT0 A;  4I3A A;  3MXQ A;  4HOI A;  4HJ4 A;  1S4R A;  3C8C A;  2V0W A;  2KDK A;  4I3J A;  3LIE A;  2VEA A;  1TS7 A;  4DJ2 A;  3LIF A;  3HJI A;  4LRZ E;  3MQO A;  1MZU A;  4BBT A;  2PYP A;  4KQD A;  3A0S A;  3B33 A;  4HI4 A;  4H6J A;  5DKK A;  2P7J A;  5HWW A;  5HWV A;  1UWN X;  2VV7 A;  5TBM A;  4EEP A;  1D06 A;  1S66 L;  4HJ6 A;  3F1N A;  2INW A;  5DJT A;  2BAS A;  3RH8 B;  3NOT C;  5F6A A;  2VLG A;  4EET B;  3CAX A;  2R78 A;  2ZBB A;  3FG8 A;  1DP9 A;  2V1B A;  5J7E A;  2QKP A;  4GHI B;  1N9N A;  1DP6 A;  4GS9 A;  2Z6D A;  1T1A A;  2L1M A;  4HY8 A;  3UMD A;  2PR5 A;  3F1P A;  3IS2 B;  3LIA A;  4HP9 A;  4XT2 B;  3UB6 A;  4R6L A;  4HJ3 A;  1DRM A;  5F69 A;  5G4Z A;  5DJU A;  1F98 A;  1OT9 A;  3RTY A;  5A8B A;  4JGP A;  4NXF A;  2YKF A;  4EXO A;  4EW7 A;  1XJ3 A;  1GSW A;  2PD8 A;  3OLO A;  2PD7 A;  1UGU A;  2YKH A;  2JHE A;  4F3L A;  4B9O A;  5HWT A;  2Z6C A;  2OWH A;  1OT6 A;  4HNB A;  1OTE A;  3H82 B;  1XJ2 A;  3ICY A;  3H7W B;  5J3W A;  1LL8 A;  3C2W A;  4JGQ A;  3UE6 A;  1EW0 A;  5AVE A;  1V9Z A;  3FC7 A;  3VOL A;  1G28 A;  1S4S A;  3KX0 X;  3SW1 A;  2VV8 A;  2OWJ A;  3EEH A;  1D7E A;  1Y28 A;  5IS1 A;  3MQQ A;  4GCZ A;  2A24 A;  2VV6 A;  3IBR A;  1ODV A;  4EQ1 A;  1V9Y A;  4EER A;  1T18 A;  3UME A;  4DJ3 A;  4H6J B;  1LSX A;  3LID A;  2ZOH A;  2QJ5 A;  3A0R A;  1LSV A;  1N9L A;  3F1O A;  3D72 A;  4MN5 A;  3E4O A;  4LPZ A;  2W27 A;  2K7S A;  4NXE A;  5G4Y A;  1TS8 A;  1LSW A;  3F1N B;  1S1Y A;  3HJK A;  1BYW A;  4PKY G;  3NOU C;  3MJQ A;  4R3A A;  5HDC A;  4HQA A;  3G6O A;  5KIZ A;  4JGR A;  2CMN A;  3E4P A;  4GHI A;  2HV1 A;  4WLA A;  5F68 A;  1XFQ A;  4HH2 A;  2KX6 A;  1S67 L;  3BY8 A;  1XFN A;  4NXB A;  4JGO A;  3IS2 A;  3LI9 A;  3H9W A;  4XT2 A;  4I5S A;  5HSQ A;  2B02 A;  4I38 A;  4MN6 A;  4KUK A;  2PDR A;  4HP4 A;  2QHK A;  5J4E A;  4KUO A;  3P7N A;  2V9A A;  3VE3 A;  1WA9 A;  2WKQ A;  2PR6 A;  5HZH A;  1N9O A;  1NWZ A;  3K3D A;  5I5L A;  3PYP A;  1JNU A;  3ULF A;  1T1B A;  2L0W A;  4R70 A;  5AVF A;  1DP8 A;  4E04 A;  3H82 A;  4WL9 A;  1OTI A;  3UB8 A;  5IU1 A;  3H7W A;  3BWL A;  4EES A;  4NXG A;  1VB6 A;  2V1A A;  3GDI A;  4K08 A;  4WF0 A;  2D01 A;  1OTA A;  4WN5 A;  1P97 A;  3CWF A;  5F5Y A;  2J80 A;  3NJA A;  1TS0 A;  4HH3 A;  4I3I A;  4HHD A;  1OJG A;  1OTD A;  2A24 B;  3BY9 A;  2I9V A;  1TS6 A;  4L9G A;  5HDD A;  3NHQ A;  3UB7 A;  2ZOI A;  4YWZ A;  3A0V A;  5TBM B;  2GJ3 A;  1P0Z A;  2V0U A;  3LIC A;  4L9F A;  3ZQ5 A;  4BBU A;  3MR0 A;  3F1O B;  1X0O A;  3PHY A;  3UB9 A;  1UWP X;  3LYX A;  2L4R A;  4RQ9 A;  4R38 A; 
#chains in the Genus database with same CATH topology
 3GEC A;  2JN7 A;  2KOI A;  5KSH A;  3MXS A;  3FKV A;  2A49 A;  4LRY C;  4G3W A;  4EUZ A;  1N9B A;  3NY4 A;  4GS9 B;  5CHU A;  5DTK A;  5CTN A;  4ZJ1 A;  3WRT A;  4XXR A;  4X69 A;  3I7J A;  1IYP A;  3O86 A;  5KMW A;  1IYQ A;  2XRN A;  2XLN A;  4F94 A;  4PKY A;  3HLB A;  3GRJ A;  4E3J A;  3BM6 A;  1BLS A;  3VOZ A;  5HAR A;  2V2F F;  2EX6 A;  3ITB A;  4LCL A;  4X1M A;  2M7U A;  2J3T C;  2BTF P;  4PHT A;  3K3C A;  5HDS A;  3MS6 A;  2HF6 A;  4OP8 A;  1KOU A;  4F3L B;  3PBT A;  5FAQ A;  3DTE A;  4EEU A;  1YLY A;  2PYR A;  4IJG A;  4PM6 A;  4GDB A;  4BD1 A;  3CPT A;  2XA7 M;  3NOP C;  4II7 A;  1S1Z A;  3QP5 A;  3EWK A;  2XDM A;  2H10 A;  3M6H A;  5AJG A;  3GMW A;  3HLG A;  3MMH A;  2G2U A;  2VGL M;  5CGW A;  3LIB A;  2XFS A;  2H28 A;  4BMW A;  5FL3 A;  1LT0 A;  1JTD A;  2V0W A;  2KDK A;  2P9V A;  2XEP A;  5GLC A;  3ZHH A;  5HFO A;  4Q8I A;  3RXW A;  1XGJ A;  4DJ2 A;  3VSL A;  4E6W A;  3HJI A;  2JKT I;  4BBT A;  4N1X A;  1FR1 A;  4ZRR A;  3T1X A;  4H6J A;  4U0T A;  4EUV A;  2LB9 A;  4X56 A;  3W2Z A;  5HWW A;  5CEC A;  5HWV A;  3IH8 A;  2HPB A;  2QYB A;  5TBM A;  2ZQ8 A;  5K5B A;  1D06 A;  1FCN A;  5EM0 A;  5A93 A;  3F1N A;  1TVF A;  4WEK A;  3HRE A;  4B4X A;  5DJT A;  4Y15 A;  2BAS A;  3ZG9 B;  3IQA A;  4AFI A;  3SH9 A;  1H0M A;  4MBF A;  1RP5 A;  2ZL1 A;  1KGF A;  2ZQC A;  4CJN A;  3N4I A;  3O5Y A;  3IHB A;  1KVL A;  3BFD A;  3VP4 A;  3Q7V B;  1DJC A;  1K57 C;  1DP6 A;  2JCH A;  5FAO A;  2PR5 A;  2I72 A;  3CJM A;  3EGX C;  5A90 A;  4EV4 A;  3F1P A;  2ZC6 B;  3UB6 A;  4R4S A;  4HJ3 A;  3MZD A;  4OOL A;  1DRM A;  3ZG0 A;  1OT9 A;  2XR0 A;  1FSY A;  1XX2 A;  3OCL A;  4GLQ A;  4NXF A;  4EXO A;  2EX9 A;  3IBJ A;  2PD8 A;  1KGE A;  5FDS A;  1PYY A;  2JE5 A;  1MC0 A;  4ZAM A;  5EEC A;  3D4F A;  2JKG A;  4MMN A;  3OPP A;  3CZD A;  4HNB A;  1GHP A;  3C4O A;  2WGW A;  4KZ8 A;  2EX2 A;  1I2W A;  3N8L A;  5J3W A;  5EV0 A;  1LL8 A;  5HX9 A;  3UE6 A;  3IF6 C;  3AGD A;  3Q1F A;  3A3I A;  3LO7 A;  1G28 A;  4E3I A;  5MC7 A;  4CLC B;  4QY6 A;  1PWG A;  1BUE A;  2HJ9 C;  3M2J A;  2V20 A;  5FEG A;  4GCZ A;  4PMA A;  3UNW A;  2H0T A;  2Y2N A;  3IBR A;  1TEM A;  4Z1W A;  2ZC3 B;  4OQ0 A;  3R4K A;  5EVI B;  2FFY A;  1V9Y A;  2ZLY A;  4DJ3 A;  3HLF A;  3FZC A;  3E2K A;  2ZOH A;  3A0R A;  1N9L A;  4KZA A;  4DXC A;  1N4O A;  5CGS A;  4MN5 A;  2K7S A;  4GDN A;  3VFF A;  3B47 A;  1LSW A;  3SS5 A;  1BYW A;  3IHA A;  5L07 A;  4G3K A;  3E98 A;  4PM8 A;  1PZO A;  4HQA A;  2XD5 A;  1K6S A;  5KIZ A;  4GKU A;  3E4P A;  2ZQ9 A;  5F68 A;  4YFM A;  3DWZ A;  3SH8 A;  2WAD A;  5GLD A;  3EQV A;  5HPF A;  3VFH A;  4R3B A;  4XT2 A;  5GL9 A;  4KUK A;  2PDR A;  2QHK A;  4KG6 A;  5J4E A;  3N8S A;  3IXG A;  4N9L A;  3LCE A;  1WA9 A;  4WZ4 A;  4P0M A;  2Y2P A;  2JBF A;  1CI8 A;  1N9O A;  3S7N A;  3VOY A;  1E4D A;  1G68 A;  1JVJ A;  3MF0 A;  4S2L A;  1WYB A;  1T1B A;  2J9O A;  3UE3 A;  4G3V A;  3BW6 A;  4KZ5 A;  1H8Z A;  2AVX A;  2IWB A;  5AVF A;  4E04 A;  3V5M A;  3UB8 A;  1H3Q A;  2IA2 A;  3KO6 A;  1G6O A;  3GDI A;  5HW3 A;  3A3F A;  1BT5 A;  3BEC A;  2W3D A;  2OSU A;  5U47 A;  4WMC D;  1BTL A;  3V3S A;  1TS0 A;  1ES3 A;  3Q81 A;  1I5Q A;  3IF6 A;  2WK0 A;  3PTE A;  4MLL A;  1HZO A;  3UB7 A;  2ZOI A;  5LBR A;  3DTM A;  3CI6 A;  3S1Y A;  3G30 A;  2Y59 A;  2O0Y A;  3MQ0 A;  3S7O A;  1P0Z A;  3MKF A;  2V0U A;  3LIC A;  3U2A A;  4FOF A;  5EOE A;  3MR0 A;  1K56 D;  4R1G A;  3V50 A;  3L9K A;  5A91 A;  1BLH A;  3SS4 A;  4GD8 A;  4YOF A;  2G7U A;  1L0G A;  4R38 A;  1ES5 A;  1HD8 A;  2BLS A;  5HPI A;  1DY6 A;  3HCY A;  3VE4 A;  4ME4 A;  1PZP A;  4FCF A;  5E2E A;  3NBL A;  3LI8 A;  3T50 A;  2Y2H A;  4JBF A;  3FV7 A;  3OZH A;  4Y0O A;  1LI9 A;  1ERM A;  5GHZ A;  2PHY A;  1A0K A;  1GSV A;  4ARZ A;  1XA1 A;  2C5W B;  1XJ6 A;  5DTT A;  5JYP A;  4UHU A;  4L9E A;  1F9I A;  1K4E A;  4DE2 A;  2WKR A;  4GD6 A;  5HD3 A;  1GSX A;  2WKH A;  5E43 A;  1E3U D;  2J9P A;  3P98 A;  1OJ5 A;  1BUL A;  1ONH A;  4BBV A;  4OH0 A;  4UQI M;  4E6X A;  2FZ0 A;  4HEF A;  1T1C A;  3OBF A;  3PBQ A;  3CLO A;  1W5D A;  3ITA A;  3PR6 A;  2OOL A;  2HGV A;  4M4X A;  4MDZ A;  1PW8 A;  5DF9 A;  4OP5 A;  1OPX A;  2Y2L A;  3HLW A;  1NJ4 A;  1Q2Q A;  1L0E A;  1C3B A;  5FA7 A;  1CF0 A;  4FTX A;  5F82 A;  1MWU A;  4I3A A;  4JXG A;  2K31 A;  2DCF A;  1LHY A;  2VZW A;  3HLD A;  5CHM A;  3KSF A;  1YLZ A;  1ONG A;  3QP4 A;  1PW1 A;  3QNC A;  3UDF A;  3IX8 A;  1SKO B;  1IEM A;  4KQD A;  4EBL A;  4ETZ A;  5FI6 A;  2VA0 A;  4BEN A;  5GHX A;  4A5R A;  1MWR A;  4JF4 A;  1UWN X;  4BJP A;  4OQG A;  2A3U A;  3ZVW A;  5L2F A;  5EE8 A;  2IWC A;  3LEZ A;  3VMA A;  4X1L A;  3LR5 A;  2Z2L B;  4EWF A;  1TDG A;  4S2M A;  3RH8 B;  4EET B;  2Y79 A;  2ZM0 A;  3CIT A;  5FQ9 A;  3CAX A;  5KZH A;  4K0W A;  5AQA A;  4S2O A;  2ZM8 A;  4FUW A;  3FG8 A;  3S7P A;  2ZC7 A;  1HLU P;  3CUE C;  3L7H A;  4LV3 A;  1TF1 A;  2QKP A;  5HAP A;  2Y2G A;  3NC8 A;  3S4X A;  2PBD P;  4U3T A;  4GS9 A;  1ZG6 A;  2L1M A;  3IS2 B;  3FKW A;  1PWD A;  4R6L A;  4WBG A;  1F98 A;  3RTY A;  3TW8 A;  3HBR A;  3P09 A;  1ZG4 A;  1J3W A;  4EW7 A;  1XJ3 A;  5DVA A;  1L2S A;  1ALQ A;  3MZF A;  3OLO A;  4RYE A;  1JWV A;  5AQ7 A;  5FAT A;  4OQH A;  2C6W B;  2VK3 A;  4F3L A;  4UQI S;  3LGO A;  4OQI A;  2ZC4 B;  2Z6C A;  3LFV A;  2VX8 A;  4CLC C;  1OT6 A;  2Q9M A;  1M6K A;  1K54 C;  1PIO A;  3H82 B;  1SHV A;  5EVL A;  1XJ2 A;  4S2K A;  1ACF A;  3A3J A;  3DTI A;  3H7W B;  2NUP C;  5J8X A;  1VHM A;  1YSP A;  2QPN A;  2XF3 A;  4MCW A;  3SW1 A;  4DXB A;  1ESU A;  1BLP A;  5EVI C;  2PAV P;  4KZ6 A;  1Y28 A;  2Z2M B;  4Q0H A;  1E25 A;  3KYZ A;  1O7E A;  2ZC5 B;  2P9V B;  1ES2 A;  4DDS A;  1EI5 A;  1XGI A;  2A24 A;  3KSH A;  1GA0 A;  1SDE A;  3MSH A;  3UO9 A;  4JLF A;  2VV6 A;  3A3D A;  4YIN A;  4PM9 A;  4EQ1 A;  4EER A;  5FDH A;  4H6J B;  3NUL A;  1K4F A;  4OPQ A;  2QJ5 A;  1LSV A;  1YMS A;  2HDQ A;  2RL3 A;  4QU3 A;  5GHY A;  3D72 A;  3C4P A;  3E4O A;  3ZG8 B;  5G4Y A;  3F1N B;  2E8J A;  4UA6 A;  1S1Y A;  4UA9 A;  1YM1 A;  2WYX A;  3NCK A;  4WYY A;  1ZC2 A;  5TJJ A;  3MJQ A;  4E3O A;  3GTC A;  1K25 A;  1GHM A;  4CPK A;  1VM1 A;  4JGR A;  4R0Q A;  2OLV A;  5FQM A;  1IFQ A;  1KDS A;  4NG2 A;  1XPB A;  1KE4 A;  3IX3 A;  4HH2 A;  1XP4 A;  4EBN A;  4Z9Q A;  5I94 A;  1I2S A;  1RGY A;  2B95 A;  3CUE A;  4I5S A;  4CQH A;  3G4P A;  2B02 A;  4MN6 A;  3RFB A;  4WMC A;  4HP4 A;  4PAU A;  1CK3 A;  1Y54 A;  2EXB A;  1FR6 A;  4Y17 A;  1K0K A;  3PXP A;  4E3L A;  4X68 A;  4ZJ2 A;  1RCJ A;  2HP9 A;  1NWZ A;  3T4K A;  3C30 A;  4P6Z S;  3K3D A;  3ZFZ A;  3PYP A;  3MKE A;  3QNB A;  3D3O A;  5CXW A;  3UPP A;  3ZDJ A;  3A3E A;  4GNU A;  2JKR M;  4DN0 A;  4R70 A;  3QP8 A;  1DP8 A;  2A2L A;  4P6B A;  1K56 A;  1LLB A;  1WE4 A;  4GZB A;  4C3Q A;  2RCX A;  3BWL A;  4EES A;  1NZU A;  4WF0 A;  1H5X A;  4MN7 A;  3UE0 A;  1MKM A;  4NK3 A;  4JF6 A;  4LV0 A;  4S2N C;  4RA7 A;  1GA9 A;  4KZ4 A;  3IWI A;  4X53 A;  4HH3 A;  4I3I A;  4EBP A;  4MEZ A;  3O88 A;  1TS6 A;  1PI5 A;  4L9G A;  3PBN A;  5E2H A;  2HJE A;  3UY6 A;  4NET A;  1YSQ A;  1KE3 A;  3RXX A;  4Y5F A;  3FYZ A;  2HDU A;  1YT4 A;  3B42 A;  3ZQ5 A;  2V8F A;  2Y2K A;  3G35 A;  1X0O A;  3TE8 A;  3PHY A;  2QZ6 A;  5EPH A;  3OC2 A;  4GJ4 A;  1E3U A;  3LYX A;  2L4R A;  5DFY A;  3ZCZ A;  5F1F A;  1TDL A;  3BFC A;  1LL5 A;  2LB5 A;  3EGD C;  1F2K A;  3M6B A;  4DDY A;  4ZBE A;  2ZMF A;  4BQM A;  1MBL A;  5KSC A;  1T19 A;  3ZGA B;  1ZHH B;  5DKL A;  1BSG A;  4LRX C;  3JYI A;  3GVB A;  1MY8 A;  3BFG A;  2QWS A;  4O0P A;  2WAE A;  1Y4O A;  1FIL A;  3WS0 A;  3LEQ A;  3W8K A;  3G2Y A;  4XUX A;  4Q0J A;  3QP6 A;  3LUQ A;  1K57 A;  1SKF A;  1Z09 A;  3JVV A;  4GOG A;  2D02 A;  3M2K A;  3T12 B;  2QJ7 A;  5HAI A;  1KGG A;  3FWL A;  3W4O A;  1MPL A;  2H5S A;  4KEN B;  1QMF A;  5E2F A;  1YLW A;  2WGI A;  3UDI A;  1P9W A;  1K55 C;  4GN2 A;  3VP0 A;  1SDN A;  1S0W A;  1STZ A;  3PAG A;  4GW9 A;  5GLB A;  1QME A;  3IXD A;  4N92 A;  5CX7 A;  3WRZ A;  1KDW A;  1U60 A;  1YLT A;  1XJ4 A;  4R3J A;  5HD5 A;  3W4P A;  1ERQ A;  1CEG A;  1YPR A;  1LL9 A;  3U4L P;  2XD1 A;  5HL6 A;  1HVB A;  2Y2J A;  4X55 A;  3MXQ A;  4HOI A;  1IYS A;  4OPR A;  3OOV A;  3SH7 A;  2JKT M;  1SZV A;  2EX8 A;  3Q82 A;  5CRF A;  1CQA A;  2X71 A;  4LRZ E;  2Y2I A;  3K2N A;  3IF6 B;  2JC7 A;  3MQO A;  1MZU A;  1L3L A;  3LR3 A;  2O9A A;  2PYP A;  1MWS A;  2WZZ A;  5DFX A;  3VP1 A;  3T1Q B;  1J9M A;  2J8Y A;  4S2N A;  3TOI A;  2DNS A;  2VV7 A;  5L10 A;  2P08 A;  2W3H A;  1AXB A;  2P74 A;  4DE0 A;  1S66 L;  3BRM A;  4JKT A;  4HJ6 A;  2WKI A;  4FH2 A;  2INW A;  4LV2 A;  4CLC D;  5HL1 A;  4BWI A;  4IBX A;  2VLG A;  2OLU A;  3TJZ C;  5TFQ A;  2XGN A;  2R78 A;  2ZBB A;  3HUM A;  2V1B A;  5IT5 A;  4GHI B;  4UAA A;  4HBU A;  1N9N A;  2WAF A;  3BLM A;  4M3K A;  5EVI D;  4C6Y A;  4HBT A;  4O01 A;  4HY8 A;  1HTZ A;  1VET A;  4C75 A;  1GCE A;  3EEA A;  3DBA A;  5DJU A;  5A8B A;  4JGP A;  4KG2 A;  4IED A;  1NY0 A;  2YKF A;  2ZM2 A;  5F83 A;  1W63 Q;  3HUO A;  4P85 A;  4S2J A;  2R9X A;  3OPR A;  3IF5 A;  2PD7 A;  1UGU A;  3S7Q A;  2GZA A;  4D60 A;  5FI7 A;  2YKH A;  4ESP A;  5AQB A;  2JHE A;  1GHI A;  2MJ6 A;  1EWZ A;  5HWT A;  2OWH A;  4QB8 A;  3WS4 A;  4OLG A;  3VP2 A;  4KZ3 A;  4KZB A;  4WEJ A;  3TSG A;  1PWC A;  3WS2 A;  3LR0 A;  3GSG A;  3DW0 A;  4JGQ A;  3IXB A;  1EW0 A;  3IT9 A;  3OCN A;  1V9Z A;  2Y2Q A;  3FC7 A;  1IOU A;  3OPL A;  4MBK A;  1K55 A;  3HVF A;  2HDR A;  5EVE A;  2OWJ A;  4B93 A;  1D7E A;  5IS1 A;  2Y8H A;  1FOF A;  3MQQ A;  4FH4 A;  4R4R A;  3ZG7 B;  1NRJ A;  3B3X A;  3UPN A;  3N6I A;  3MBZ A;  4YNR A;  1W7F A;  2HP6 A;  2GNX A;  1Z6F A;  1ODV A;  1W8Y A;  4E3N A;  3IWO A;  5CEB A;  2W1T B;  3MFD A;  3C38 A;  1W79 A;  2DMW A;  2EWV A;  5FAS A;  3LID A;  3DTK A;  3F1O A;  3CG5 A;  3R7W A;  3WS5 A;  1ZKJ A;  2XFT A;  1VEU A;  2G2W A;  4Y0U A;  5CTM A;  4S2I A;  5TR7 A;  4NXE A;  3FPW A;  4X25 A;  3JPU A;  1XA7 A;  4ID4 A;  1VQQ A;  5D3O A;  3NOU C;  2NUT C;  2XRO A;  2FH5 A;  3HL9 A;  2B5R A;  2CMN A;  3T1S A;  4BL2 A;  3PAE A;  2HV1 A;  4WLA A;  2EFX A;  4Y3I A;  3BY8 A;  1XFN A;  1K6R A;  4NXB A;  4JGO A;  3IS2 A;  2R9W A;  3H9W A;  4K91 A;  1D1J A;  4O7D A;  4BLM A;  5EOO A;  5DTS A;  4U0X A;  4P6Z M;  4KUO A;  3V67 A;  3HLE A;  1MXO A;  2W3G A;  1YMX A;  2WKQ A;  1IEL A;  3BJN A;  2JKF A;  3GR2 A;  5DF8 A;  3CPT B;  3D9Y A;  2WKE A;  3IXH A;  4R23 A;  2ZJ9 A;  3V39 A;  3QP1 A;  3EQU A;  4OOM A;  2L0W A;  4PPR A;  3GQZ A;  3H82 A;  1OTI A;  4DRT A;  3H7W A;  4QY5 A;  3ZYT A;  1JWP A;  4L0L A;  3T4Q A;  3G32 A;  1VB6 A;  4K08 A;  4Y13 A;  1OTA A;  4WN5 A;  1P97 A;  5M1A A;  4IUH A;  3C7U A;  1MWT A;  2A24 B;  3ISG A;  2Y55 A;  4RX3 A;  5HDD A;  5M18 A;  4YWZ A;  4ZTK A;  2Y4A A;  4RX2 A;  4NKP A;  1O07 A;  3NDE A;  5TBM B;  2W3F A;  2HZ5 A;  4IHQ A;  4QWO A;  5CER A;  4L9F A;  1YLP A;  4BBU A;  1PFL A;  1G5U A;  4N1H A;  3UB9 A;  4XUZ A;  1MKI A;  5FQI A;  3E2L A;  2P04 A;  2O9B A;  1L0F A;  2EA9 A;  2ZL1 B;  4I39 A;  2VGK A;  4QJG A;  3IX4 A;  3VP3 A;  4KZ9 A;  4WUJ A;  3T4L A;  3Q7V A;  2W0N A;  2ZD8 A;  1H8Y A;  2V1Z A;  3F1P B;  4KQQ A;  3N7W A;  3E4Q A;  2H0Y A;  4LLO B;  3C7V A;  3G34 A;  3MFX A;  4HES A;  5CHJ A;  5DF7 A;  1KVM A;  2EXA A;  4DF6 A;  3SZT A;  3CHW P;  2ZMV A;  2QMI A;  2XK1 A;  4H8R A;  1OTB A;  1G6A A;  1JTG A;  3T1R A;  2WKP A;  4Y7P A;  3UE1 A;  1Q2P A;  4B88 A;  3ZNT A;  1ZTU A;  3G31 A;  2UWX A;  4N9K A;  1FCM A;  1JWZ A;  2O99 A;  4DE1 A;  4D2O A;  4ZDX A;  2M1C A;  3BQA A;  4NEE D;  4DKI A;  1NLY A;  2WGW B;  4MNR A;  1BZA A;  4KQR A;  2Y91 A;  3C5A A;  3PBO A;  4ZJ3 A;  4KQO A;  4LV1 A;  3SS3 A;  4HIA A;  5EFW A;  4JF5 A;  2XA7 S;  4CLC A;  4KZ7 A;  4GB7 A;  3RJU A;  2PU2 A;  1K54 A;  4HJ4 A;  1S4R A;  1RGZ A;  3C8C A;  3BFF A;  3T4O A;  4I3J A;  2PBY A;  2VGL S;  2ZQ7 A;  1IKI A;  5EUA A;  3LIE A;  2OV5 A;  5FI2 A;  2VEA A;  1TS7 A;  2V8C A;  1NRF A;  3LIF A;  4E3M A;  2ZQA A;  3HLC A;  5EVI A;  3A0S A;  5HAQ A;  3B33 A;  2VGJ A;  3FPV A;  5F1G A;  4HI4 A;  2CC1 A;  5L09 A;  5DKK A;  4Q0I A;  2P7J A;  4UEY A;  3BFE A;  1OME A;  1NXY A;  3NIA A;  2ZQD A;  3T4S A;  2HDS A;  4EEP A;  1P9R A;  1K38 A;  3LY3 A;  1FCO A;  2J7V A;  4RVA A;  2VKS A;  3DWK A;  3NOT C;  5F6A A;  3WS1 A;  4OLD A;  5IHV A;  2Y2O A;  1LI0 A;  4O8G A;  3KYE A;  1DP9 A;  3VV4 A;  4DMZ A;  5J7E A;  2M7V A;  3V3R A;  1S6R A;  2KLI A;  4OON A;  2PT7 A;  2Q9N A;  2Z6D A;  5FQK A;  1T1A A;  4JXS A;  1NYM A;  4FD8 A;  3UMD A;  3KSI A;  3BLS A;  2W3E A;  4IVK A;  2O9C A;  3LIA A;  4HP9 A;  4XT2 B;  3GV9 A;  3S22 A;  4EQI A;  5F69 A;  5G4Z A;  3UDX A;  3TG9 A;  3BQ8 A;  3HUN A;  1GSW A;  4WZ5 C;  1CI9 A;  4KG5 A;  1AWI A;  1YLJ A;  4Y2F A;  1W8Q A;  1PI4 A;  2OAQ 1;  1W63 M;  2WUQ A;  4B9O A;  3MXR A;  3KYQ A;  2XH9 A;  3E0Y A;  2X01 A;  4E3K A;  4UA7 A;  1OTE A;  4PM7 A;  3ICY A;  5FAP A;  3C2W A;  2Q0O A;  2X02 A;  5AVE A;  4BD0 A;  3NI9 A;  2WGV A;  3VOL A;  5JYO A;  3P01 A;  1S4S A;  3KX0 X;  3UPO A;  3Q7Z A;  2VV8 A;  3EEH A;  1DJB A;  3IH9 A;  5BOH A;  4DE3 A;  4ETX A;  3VSK A;  5CGX A;  3UN7 A;  3O3V A;  4OVD A;  2FFF B;  2DRW A;  2EFU A;  1T18 A;  3UME A;  1IYO A;  1LSX A;  2J3T D;  1FSW A;  3T4T A;  1ERO A;  2IWD A;  1KE0 A;  3DAV A;  5EM1 A;  4LPZ A;  2W27 A;  3NDG A;  5FQJ A;  1TS8 A;  5L8M A;  2W1R A;  4MBH A;  3HJK A;  3OPH A;  3MZE A;  4OKP A;  1L0D A;  2XSS A;  4PKY G;  4R3A A;  2XQZ A;  5HDC A;  3G6O A;  4S2P A;  3Q07 A;  4WM9 A;  5M19 A;  4BL3 A;  4GHI A;  4ARZ B;  1WYC A;  4IVI A;  5A92 A;  4PM5 A;  1XFQ A;  3JVU A;  1YQS A;  4P87 A;  3KSG A;  2KX6 A;  4EU0 A;  1S67 L;  4Y0T A;  1PNE A;  3N8R A;  2PRF A;  1VET B;  3W4Q A;  4X6T A;  3LI9 A;  2WZX A;  2UV0 E;  1SCW A;  2GDN A;  1M40 A;  3QHY A;  4JPM A;  3ZVT A;  5HSQ A;  3BYD A;  4I38 A;  4JXV A;  3ZNY A;  4OPZ A;  4JXW A;  2HP5 A;  1BLC A;  2VJW A;  4IUK A;  3P7N A;  2V9A A;  3VE3 A;  1XKZ A;  2PU4 A;  2GX5 A;  4OPY A;  4LCM A;  2EWW A;  4IBR A;  5GLA A;  1F5M A;  1H8M A;  3LR4 A;  4FSF A;  2PR6 A;  5HZH A;  2B18 A;  3ZG5 A;  3PBS A;  5AQ9 A;  5FEF A;  3BEB A;  5I5L A;  4LEN A;  1JNU A;  5FQQ A;  3SOI A;  3NEC A;  3T4J A;  4LGW A;  3ULF A;  2Y2M A;  4WZ5 A;  3AGE A;  5CED A;  3QP2 A;  3CMZ A;  4WL9 A;  1NZO A;  5IU1 A;  4QPR A;  1IKG A;  1NYY A;  4K0X A;  4NXG A;  1ESI A;  5TGF A;  1CJF A;  2JKR I;  2V1A A;  2D01 A;  2E8I A;  3CWF A;  3PBR A;  2ZMA A;  5F5Y A;  3WWX A;  1PRQ A;  2K2N A;  4CLC E;  2J3W A;  2J80 A;  3NJA A;  5C5K A;  4WEL A;  4HHD A;  1OJG A;  2BG1 A;  1OTD A;  1FQG A;  1SKO A;  3BY9 A;  4QD4 A;  2I9V A;  4QHC A;  3NHQ A;  3G2Z A;  5FSR A;  1YKD A;  3A0V A;  1XXM A;  1CEF A;  2W1T A;  3O87 A;  3TRC A;  2GJ3 A;  3LY4 A;  1YAX A;  1FIK A;  4B4Z A;  1NLZ A;  3F1O B;  2ACG A;  1ES4 A;  3R7W B;  2OAP 1;  3AGF A;  1UWP X;  5G18 A;  4OOY A;  4LFU A;  1VEU B;  3IWQ A;  1DJA A;  3EOI A;  1TD5 A;  4RQ9 A;  3UB5 P;  5E2G A; 
#chains in the Genus database with same CATH homology
 3GEC A;  3EGD C;  2JN7 A;  2EA9 A;  2KOI A;  5HPI A;  5KSH A;  3HCY A;  3VE4 A;  4I39 A;  4ME4 A;  2ZMF A;  3LI8 A;  4WUJ A;  4LRY C;  1T19 A;  4G3W A;  3T4L A;  1ZHH B;  3T50 A;  5DKL A;  4GS9 B;  4LRX C;  2W0N A;  2QWS A;  2PHY A;  3F1P B;  3E4Q A;  1GSV A;  4O0P A;  4ARZ A;  4LLO B;  1XJ6 A;  2XRN A;  4PKY A;  4L9E A;  1F9I A;  3MFX A;  4Q0J A;  3LUQ A;  2WKR A;  5HD3 A;  1GSX A;  2M7U A;  3JVV A;  2ZMV A;  2J3T C;  2D02 A;  1OTB A;  4PHT A;  1OJ5 A;  2QJ7 A;  2WKP A;  3K3C A;  5HDS A;  4BBV A;  4UQI M;  2HF6 A;  1KOU A;  1ZTU A;  2FZ0 A;  4F3L B;  3PBT A;  1T1C A;  4EEU A;  3OBF A;  2PYR A;  2O99 A;  3PBQ A;  3CLO A;  4IJG A;  1P9W A;  2M1C A;  3BQA A;  4NEE D;  3PR6 A;  2OOL A;  2XA7 M;  3NOP C;  2HGV A;  4II7 A;  4M4X A;  1S1Z A;  4MDZ A;  1STZ A;  5DF9 A;  1NLY A;  3EWK A;  1OPX A;  4GW9 A;  5CX7 A;  3PBO A;  5AJG A;  1XJ4 A;  4KQO A;  5HD5 A;  4HIA A;  5EFW A;  3MMH A;  2VGL M;  3LIB A;  5HL6 A;  2H28 A;  2XA7 S;  4BMW A;  4CLC A;  5FL3 A;  1LT0 A;  4I3A A;  2K31 A;  3MXQ A;  4HOI A;  4HJ4 A;  1S4R A;  3C8C A;  3OOV A;  2V0W A;  2JKT M;  2KDK A;  3T4O A;  4I3J A;  2VZW A;  3KSF A;  2VGL S;  3LIE A;  2VEA A;  1TS7 A;  4DJ2 A;  3LIF A;  3HJI A;  4LRZ E;  3K2N A;  3MQO A;  1MZU A;  3LR3 A;  2JKT I;  2O9A A;  2PYP A;  4BBT A;  4KQD A;  3A0S A;  3B33 A;  4ETZ A;  3FPV A;  4HI4 A;  4ZRR A;  2VA0 A;  4H6J A;  5DFX A;  5DKK A;  4EUV A;  4Q0I A;  2LB9 A;  3W2Z A;  2P7J A;  5HWW A;  4UEY A;  5HWV A;  1UWN X;  2QYB A;  2VV7 A;  5TBM A;  2P08 A;  2W3H A;  4BJP A;  3T4S A;  5K5B A;  4EEP A;  1D06 A;  1S66 L;  1P9R A;  4HJ6 A;  3F1N A;  3LR5 A;  2INW A;  4WEK A;  4CLC D;  5DJT A;  4BWI A;  2BAS A;  2VKS A;  3RH8 B;  3NOT C;  5F6A A;  2VLG A;  4AFI A;  4EET B;  2Y79 A;  3CIT A;  3TJZ C;  3CAX A;  4O8G A;  2R78 A;  2ZBB A;  3FG8 A;  1DP9 A;  3S7P A;  3VV4 A;  4DMZ A;  2V1B A;  3CUE C;  5J7E A;  1TF1 A;  5IT5 A;  2M7V A;  3O5Y A;  2QKP A;  4GHI B;  2KLI A;  1N9N A;  2PT7 A;  1DP6 A;  4GS9 A;  2Z6D A;  4O01 A;  1T1A A;  2L1M A;  4HY8 A;  3UMD A;  3KSI A;  2PR5 A;  2W3E A;  3EGX C;  3F1P A;  3IS2 B;  2O9C A;  3LIA A;  4HP9 A;  4XT2 B;  3UB6 A;  4R6L A;  4HJ3 A;  3EEA A;  3DBA A;  4OOL A;  1DRM A;  5F69 A;  5G4Z A;  5DJU A;  1F98 A;  1OT9 A;  3RTY A;  3TW8 A;  5A8B A;  4JGP A;  3OCL A;  4GLQ A;  4NXF A;  2YKF A;  4EXO A;  4EW7 A;  3BQ8 A;  1W63 Q;  1XJ3 A;  1GSW A;  3IBJ A;  2PD8 A;  3OLO A;  1MC0 A;  4Y2F A;  2PD7 A;  1UGU A;  3S7Q A;  2GZA A;  2YKH A;  2OAQ 1;  2JHE A;  2MJ6 A;  1W63 M;  4F3L A;  4B9O A;  4UQI S;  5HWT A;  3KYQ A;  2Z6C A;  3LFV A;  2OWH A;  2VX8 A;  3E0Y A;  4MMN A;  4CLC C;  1OT6 A;  4HNB A;  1OTE A;  4WEJ A;  3H82 B;  1XJ2 A;  3ICY A;  3LR0 A;  3H7W B;  5J3W A;  1LL8 A;  2NUP C;  3C2W A;  4JGQ A;  3UE6 A;  1VHM A;  1EW0 A;  5AVE A;  3OCN A;  1V9Z A;  1YSP A;  3FC7 A;  3VOL A;  1G28 A;  3P01 A;  1S4S A;  1IOU A;  5MC7 A;  3KX0 X;  4CLC B;  4MCW A;  3SW1 A;  2VV8 A;  2OWJ A;  3EEH A;  4B93 A;  1D7E A;  4Q0H A;  1Y28 A;  2HJ9 C;  5IS1 A;  3KYZ A;  2Y8H A;  3MQQ A;  1NRJ A;  4GCZ A;  3KSH A;  2A24 A;  4ETX A;  4YNR A;  2VV6 A;  3IBR A;  4Z1W A;  2GNX A;  3R4K A;  1ODV A;  4EQ1 A;  2W1T B;  3C38 A;  1V9Y A;  4EER A;  1T18 A;  3UME A;  4DJ3 A;  4H6J B;  2DMW A;  2EWV A;  1LSX A;  2J3T D;  3LID A;  2ZOH A;  2QJ5 A;  3A0R A;  1LSV A;  3T4T A;  1N9L A;  3F1O A;  3R7W A;  3D72 A;  4MN5 A;  3E4O A;  4LPZ A;  2W27 A;  2K7S A;  4NXE A;  5G4Y A;  1TS8 A;  1LSW A;  3B47 A;  3F1N B;  3FPW A;  5L8M A;  2W1R A;  1S1Y A;  3HJK A;  1BYW A;  2XSS A;  4PKY G;  5TJJ A;  4G3K A;  3NOU C;  3E98 A;  3MJQ A;  2NUT C;  4R3A A;  2XRO A;  2FH5 A;  5HDC A;  4HQA A;  3G6O A;  5KIZ A;  4JGR A;  2CMN A;  1IFQ A;  3E4P A;  4GHI A;  4ARZ B;  2HV1 A;  4WLA A;  5F68 A;  1XFQ A;  3JVU A;  3KSG A;  4HH2 A;  2KX6 A;  4Y3I A;  1S67 L;  4EU0 A;  3BY8 A;  1XFN A;  4NXB A;  3EQV A;  4JGO A;  5HPF A;  3IS2 A;  3LI9 A;  3H9W A;  4XT2 A;  3CUE A;  4I5S A;  4CQH A;  5HSQ A;  2B02 A;  4I38 A;  4MN6 A;  3RFB A;  4KUK A;  2PDR A;  4HP4 A;  4PAU A;  2QHK A;  4P6Z M;  5J4E A;  2VJW A;  4KUO A;  4IUK A;  3P7N A;  2V9A A;  3V67 A;  3VE3 A;  1WA9 A;  2GX5 A;  3PXP A;  2W3G A;  2EWW A;  2WKQ A;  1H8M A;  1F5M A;  3LR4 A;  3BJN A;  4FSF A;  2PR6 A;  5HZH A;  1N9O A;  3S7N A;  1NWZ A;  3T4K A;  2B18 A;  3PBS A;  3C30 A;  4P6Z S;  3K3D A;  5I5L A;  3PYP A;  3MF0 A;  1JNU A;  3EQU A;  3T4J A;  3ULF A;  1T1B A;  3D3O A;  3UE3 A;  4G3V A;  3BW6 A;  4OOM A;  2L0W A;  2JKR M;  4DN0 A;  4R70 A;  5AVF A;  1DP8 A;  2A2L A;  4E04 A;  3H82 A;  4WL9 A;  1OTI A;  1H3Q A;  3UB8 A;  2IA2 A;  5IU1 A;  3KO6 A;  4QPR A;  3H7W A;  3ZYT A;  3BWL A;  4EES A;  4NXG A;  3T4Q A;  4L0L A;  1G6O A;  1VB6 A;  2JKR I;  2V1A A;  3GDI A;  4K08 A;  4WF0 A;  2D01 A;  4MN7 A;  1OTA A;  2W3D A;  4WN5 A;  1P97 A;  3CWF A;  4IUH A;  3PBR A;  1MKM A;  5F5Y A;  2K2N A;  4CLC E;  2J3W A;  2J80 A;  3NJA A;  1TS0 A;  4HH3 A;  4I3I A;  5C5K A;  4WEL A;  4HHD A;  1OJG A;  1OTD A;  2A24 B;  3BY9 A;  2I9V A;  1TS6 A;  4L9G A;  3PBN A;  2HJE A;  3NHQ A;  5HDD A;  1YSQ A;  3UB7 A;  2ZOI A;  4YWZ A;  5LBR A;  1YKD A;  3A0V A;  3CI6 A;  4NKP A;  4Y5F A;  2W1T A;  5TBM B;  3TRC A;  2GJ3 A;  2W3F A;  2O0Y A;  4IHQ A;  1YAX A;  3MQ0 A;  1P0Z A;  3S7O A;  2V0U A;  3LIC A;  4L9F A;  3U2A A;  3B42 A;  3ZQ5 A;  4FOF A;  4BBU A;  3MR0 A;  3F1O B;  1NLZ A;  1X0O A;  3TE8 A;  3PHY A;  3OC2 A;  4GJ4 A;  2OAP 1;  3R7W B;  3UB9 A;  1UWP X;  3LYX A;  2L4R A;  5DFY A;  3EOI A;  1TD5 A;  4YOF A;  2G7U A;  2P04 A;  4RQ9 A;  2O9B A;  4R38 A;  2LB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...