1XJ6A

Structure of bjfixlh in the unliganded ferrous form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
molecule keywords Sensor protein fixL
total genus 29
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj6A00
2L4RA 4XT2A 2JHEA 2ZBBA 2L1MA 4EQ1A 4WN5A 3E4PA 3BY9A 4R6LA 2ZOHA 2V0WA 4NXGA 3H82A 1KOUA 4EW7A 1GSXA 4M4XA 3EWKA 1BYWA 2V0UA 1T18A 3A0VA 4HNBA 4EETB 5HSQA 4BBUA 3H7WA 1OT9A 1NWZA 2OWHA 4B9OA 1TS0A 1XJ4A 2PYPA 3E4OA 4KUOA 3MQOA 3LICA 4GHIB 5J7EA 3MJQA 3K3CA 5F69A 3UMEA 3VE3A 2H28A 2BASA 3LIFA 3OLOA 4HP9A 2VLGA 4NXFA 3C8CA 3UB9A 4HIAA 4I5SA 4HH3A 2B02A 1XJ3A 3H7WB 4WL9A 2KX6A 2EA9A 2OOLA 5AVEA 3RTYA 1S1ZA 3T50A 4GHIA 4R70A 4WUJA 5G4ZA 1UGUA 2P7JA 2KDKA 1D06A 1GSVA 4PKYG 1F9IA 5HWVA 2QHKA 3F1NA 3F1PB 5HD3A 3VE4A 2WKPA 4BBVA 4R38A 2A24B 4LRXC 2GJ3A 2K7SA 5J4EA 2INWA 2Z6CA 5J3WA 3RH8B 4HI4A 1T1BA 4HQAA 4L9GA 4KUKA 1JNUA 1OJ5A 3LI8A 1UWNX 1XJ2A 4I3IA 2WKRA 3NOUC 3F1OA 4L9EA 3ULFA 2QJ5A 2D01A 2J80A 2V1AA 3LIAA 3UB8A 2W27A 3D72A 3GECA 2QWSA 1EW0A 4LPZA 3BWLA 1D7EA 4JGQA 3FC7A 3UE6A 4BBTA 2A24A 4LLOB 5HDDA 4WLAA 2PD8A 2ZOIA 3MXQA 3LIEA 2VV7A 1TS8A 3HJKA 1S1YA 4EERA 4WF0A 4JGPA 1LSXA 2R78A 3EEHA 5A8BA 1DP9A 4HH2A 1S4RA 1S67L 1F98A 1LT0A 1DP6A 3IS2B 1XFNA 1P97A 4XT2B 4JGRA 1OTAA 1LSVA 2YKFA 4RQ9A 2W0NA 1OTIA 3FG8A 3G6OA 3IBRA 2QJ7A 3MFXA 4KQDA 2VV6A 5F68A 3VOLA 5HWWA 4HJ3A 4I39A 2JN7A 1MZUA 1OTEA 1VB6A 4HHDA 2PYRA 1N9OA 1DRMA 2OWJA 3H82B 3LYXA 5DJUA 4NXBA 1OTDA 1TS7A 2CMNA 1OT6A 2HV1A 2M1CA 3NJAA 4MN6A 5TBMB 2YKHA 1OTBA 1N9LA 3K3DA 1T1CA 2Z6DA 4HOIA 3UB7A 3CAXA 4EEPA 3PHYA 1LSWA 1TS6A 1V9ZA 1XFQA 2PR5A 3H9WA 3CLOA 1ODVA 3KX0X 1XJ6A 5G4YA 1WA9A 5HD5A 5I5LA 4H6JA 4GS9A 1DP8A 4E04A 4F3LB 3LI9A 4YWZA 5KIZA 2L0WA 4EEUA 3NOTC 4LRYC 5DKKA 3A0RA 4I38A 1OJGA 2VEAA 5TBMA 5EFWA 4JGOA 2V9AA 3F1PA 5HWTA 3F1NB 2I9VA 2V1BA 3HJIA 3NOPC 2VV8A 5DJTA 3ZQ5A 1GSWA 2PHYA 3PYPA 1N9NA 2QKPA 3NHQA 4MN5A 5IU1A 4HP4A 4F3LA 3B33A 4H6JB 3C2WA 5AVFA 3UB6A 4I3AA 4EXOA 1S66L 4HY8A 3UMDA 4DJ3A 5IS1A 2D02A 3A0SA 3IS2A 3F1OB 3GDIA 3P7NA 4LRZE 4I3JA 3LIDA 4R3AA 5DKLA 2WKQA 4GW9A 3ICYA 4L9FA 5F5YA 3LUQA 1Y28A 3CWFA 3MQQA 3SW1A 2PDRA 4HJ4A 1LL8A 4NXEA 1V9YA 3BY8A 1T1AA 5HDSA 4HJ6A 5HZHA 3LIBA 1UWPX 1P0ZA 4EESA 4GCZA 1X0OA 5F6AA 2PD7A 1S4SA 4GS9B 1G28A 1T19A 4K08A 4DJ2A 3MR0A 5HDCA 4PKYA 2PR6A 3E4QA
chains in the Genus database with same CATH superfamily
4IEDA 3CJMA 4R6LA 5TR7A 5EVLA 1K54C 3KYZA 2OWHA 4FD8A 5MC7A 3WWXA 4CJNA 5FSRA 5FAQA 3C8CA 3QP5A 4OOLA 4KG5A 1WE4A 2KX6A 1PNEA 3MXSA 1IYPA 5GLCA 2C6WB 4Y5FA 2Y2NA 4PKYG 3Q1FA 4CLCC 3VMAA 5FQ9A 1J9MA 1E25A 2X01A 4G3WA 3DTMA 4HQAA 2JKTI 4IVIA 5EV0A 1W8YA 1GA9A 3V3SA 3T4JA 1TF1A 3HUMA 4C75A 4CPKA 3FPVA 2E8JA 3GMWA 3IX3A 3T12B 4HJ3A 2JN7A 5EM1A 2HP9A 4E3MA 3FKVA 3NI9A 2EXBA 4E6XA 3UB7A 4LCLA 2WGWB 4MLLA 4E04A 1WA9A 2J3TD 1CI8A 1ESUA 1IKIA 3NULA 4OH0A 4X6TA 3GVBA 5EFWA 5CGSA 3BW6A 3WS0A 4HP4A 1SKOA 3UMDA 3S1YA 3LR4A 5CEDA 3VOZA 2QPNA 2ZL1A 3CWFA 4DRTA 3BY8A 4FCFA 1UWPX 1ES5A 3MR0A 4WF0A 1NZUA 4A5RA 1IKGA 2WGWA 1KOUA 3LR0A 3T4KA 1OT9A 5CRFA 2ZLYA 4B4ZA 3HLEA 4WELA 4Y0UA 5HPFA 4MBFA 3T1XA 3T50A 1CQAA 3D4FA 1FOFA 1TVFA 5A92A 1CK3A 3ISGA 2EFUA 4OQHA 2PRFA 1YLZA 1Q2QA 2B18A 4L9GA 1OJ5A 4I3IA 5TGFA 3BLSA 2QJ5A 4ARZB 1STZA 3FWLA 3LGOA 1K25A 1L0EA 3D72A 4BD1A 2G7UA 2J9OA 3O5YA 4WLAA 3MXQA 4XXRA 1GHIA 2B95A 1ZC2A 4P6ZM 3IT9A 2ZMFA 1G68A 5EOEA 3W8KA 4OQGA 2HV1A 1RGYA 2Z2MB 4IJGA 3CAXA 4UQIM 2ZQ8A 1HZOA 1LI0A 2H10A 1CEGA 3CLOA 5FDHA 3WRZA 4X1MA 3UDFA 2L0WA 1ALQA 1W7FA 1PYYA 3Q7VA 2VEAA 4JGOA 3B42A 2A2LA 1KGGA 5GHXA 5GLDA 3VV4A 3M6HA 1N9NA 4Q0HA 1DY6A 4E3IA 1MXOA 2FH5A 4C6YA 3C7VA 5J8XA 2C5WB 4FOFA 3LUQA 4QY6A 2EX2A 4EESA 4S2OA 4RVAA 5D3OA 4RX3A 2JHEA 3E4PA 3EEAA 3HLGA 2A3UA 4B9OA 2Y2IA 3E4OA 4MN7A 4ZBEA 5J7EA 2XROA 1L0DA 3EQVA 4ZJ1A 4KZ8A 2VA0A 2P7JA 4P6ZS 3P01A 5CTMA 1NRJA 2WKPA 4OPRA 4LRXC 3HLDA 5CHJA 5DTTA 5HPIA 1UWNX 3VP1A 4ETXA 3BLMA 2Y2MA 3V67A 3BFGA 4JGPA 5FA7A 1NY0A 3FV7A 1DP6A 4Y17A 4UAAA 3L9KA 1ES4A 1OTIA 3IF6B 2OLVA 1EROA 3H82B 3N7WA 1OTBA 1IFQA 2Z6DA 3KSGA 2R9XA 4M3KA 1LSWA 3OPRA 3LY4A 4L0LA 4UA7A 5A91A 4OLDA 3F1PA 1FQGA 4BD0A 3NIAA 1OPXA 3NHQA 3T4QA 2OV5A 3Q7VB 1S66L 4E3OA 2XF3A 4ETZA 3LR5A 3TG9A 1V9YA 3HREA 3NECA 1BTLA 5HAQA 4DJ2A 1S4SA 3M6BA 3BJNA 4IUKA 2WADA 1Y54A 4WZ4A 4WMCD 3AGEA 5FI6A 5EOOA 2V0WA 4PAUA 1K54A 5CX7A 3VP3A 2XD5A 3MQOA 4GHIB 2M7VA 3VE3A 3LIFA 1I5QA 3IX4A 3U2AA 4OPQA 3JVVA 2NUPC 1MWRA 3S22A 2JCHA 2VKSA 1W63Q 2KDKA 1D06A 2XR0A 3ZYTA 3BYDA 2Y4AA 3IQAA 3VE4A 4E3KA 2INWA 1XP4A 5FI7A 3G32A 4KUKA 2O9BA 2WKIA 4MBHA 3T1SA 4IBXA 4WEKA 3UE6A 3FC7A 2HJEA 1PRQA 1PWDA 1Q2PA 4JF6A 4O7DA 2O9AA 2QJ7A 5HWWA 4GB7A 2J3WA 1N9OA 4O8GA 4Y0TA 4HEFA 4U0TA 4YFMA 5BOHA 4OKPA 3UPPA 5TBMB 1YSQA 4OONA 3S7PA 2XSSA 3JYIA 2IWBA 1NRFA 3A3EA 4LCMA 4EEUA 5TBMA 5L2FA 1W8QA 1FR6A 1H3QA 5HW3A 3LEQA 3TE8A 3KSHA 4Y15A 4QWOA 4I3AA 4JXVA 2D02A 1GCEA 3NY4A 3T4LA 3AGFA 4S2NA 3N6IA 1NYMA 3HCYA 4UQIS 4FUWA 3ZG8B 4QU3A 1SDEA 3WS2A 2WK0A 4EQ1A 1ZG6A 2ZOHA 4Q8IA 3M2KA 3LR3A 3PAGA 3MJQA 3BM6A 2VLGA 3LY3A 2VGKA 1K0KA 1BT5A 5CTNA 1YAXA 4WYYA 1AXBA 4B93A 5G4ZA 1GSVA 4K0XA 1GHMA 2WAEA 5KSCA 1NLZA 1FCMA 3E0YA 4BLMA 4DDYA 1IELA 3F1OA 1H5XA 3NCKA 3UB8A 3C7UA 4KZ9A 4O0PA 1YLYA 2WKEA 1LHYA 2WZXA 3OCLA 2VV7A 1YLPA 3HLBA 2V1ZA 1GA0A 1NZOA 2YKFA 3ZCZA 5F68A 3UPOA 1FCOA 2BLSA 2HJ9C 3ZFZA 1K38A 4N9LA 3ZHHA 4EUZA 3PR6A 4OP8A 4BMWA 3H9WA 2X02A 3A3FA 3CITA 3GTCA 4O01A 3LI9A 1OJGA 2RL3A 4OOMA 3O88A 3ZQ5A 1SDNA 3T1RA 4WEJA 1MWTA 4MN5A 2XRNA 4LENA 3B33A 2XLNA 4R3AA 4GKUA 4HESA 4DKIA 2P9VB 3IHBA 5EVEA 3DTIA 3QP6A 5AQ7A 1F5MA 1KGEA 1C3BA 2ZC6B 3NC8A 5GLBA 5HAPA 3O3VA 4BBUA 3PAEA 4GJ4A 5AJGA 3WS1A 1TEMA 3OLOA 1K56A 3HL9A 4NXFA 2W1TB 4I5SA 5G18A 4QPRA 2OOLA 5FAOA 1UGUA 3ZG9B 2VJWA 4E6WA 3F1PB 4BBVA 2K7SA 3UE3A 4G3VA 4DE1A 2QYBA 4QB8A 3CHWP 1HTZA 1VETA 3VSLA 2P08A 5E43A 3N8LA 2H0YA 4PHTA 4JGQA 4S2PA 3I7JA 2A24A 1M40A 1MY8A 4EBNA 2ACGA 4NKPA 4EERA 4PM6A 1DP9A 1S67L 1F98A 1XFNA 3PBQA 5E2EA 1K4EA 5HARA 1TS7A 5U47A 2H0TA 2PU4A 3K3DA 2GNXA 1YSPA 3FPWA 1XFQA 1NXYA 1FCNA 4ZRRA 4JF5A 3O87A 4PMAA 4WM9A 5DJTA 3NBLA 3IF6A 2H5SA 1BLHA 4DJ3A 1JWZA 1JTDA 3OOVA 2E8IA 4GW9A 5F5YA 4PM5A 3CMZA 3QNBA 1OMEA 2HDSA 5FI2A 4GS9B 1T19A 2HP6A 4LV1A 3E4QA 5E2HA 2FFYA 1PFLA 4Q0JA 1JVJA 4EETB 4HNBA 5EE8A 1IOUA 1FSWA 1YLJA 3E98A 5GL9A 2X71A 1PZPA 2W3HA 2Z2LB 4DXCA 3E2LA 1K55A 4EBPA 5GHYA 5A90A 3ZG5A 4JXWA 2XK1A 3OCNA 2A24B 1JTGA 3RXXA 1GHPA 2O0YA 4WZ5C 3LIAA 3SZTA 2BG1A 4XUXA 1SKFA 4BJPA 1ZKJA 1TS8A 1CJFA 1S4RA 4KQOA 1VB6A 1O07A 3BEBA 2Y91A 3CPTB 3UDIA 4HOIA 5F83A 1CF0A 3QP4A 1XKZA 4DN0A 3BRMA 5FQKA 3S7NA 5F1GA 3LEZA 1CEFA 5F82A 2WZZA 3F1NB 3W2ZA 3G34A 2PHYA 4YOFA 3TW8A 4KZAA 5AVFA 2FFFB 2BTFP 3HUOA 1BLSA 1LL8A 3MKFA 3FZCA 3MZFA 1P0ZA 4Y3IA 4QD4A 3N8SA 1SZVA 2VX8A 4PKYA 4PPRA 5GLAA 5AQ9A 4GD6A 5EVIC 4N1HA 4K0WA 5HSQA 1ONHA 3H7WA 3JPUA 2O99A 4FH4A 4UEYA 2PYPA 1QMEA 1BULA 4WZ5A 1WYCA 3UMEA 3C30A 1PW8A 4MEZA 3PBTA 3TJZC 4R70A 4WUJA 2QHKA 2GJ3A 2Y2JA 3CI6A 4NETA 2HF6A 2G2WA 2J9PA 1EWZA 3GECA 1I2WA 1D7EA 3BWLA 2AVXA 2WKHA 4BWIA 1IYOA 3LO7A 1ONGA 4EUVA 5A8BA 3QP8A 3IF5A 3WS5A 3GSGA 1L3LA 3ZGAB 4NXBA 4DXBA 3NJAA 5DF8A 2XFTA 3MQ0A 1YLTA 4EEPA 2ZMVA 2GZAA 1ODVA 4KG2A 5KIZA 2A49A 3G2ZA 3MBZA 1KE4A 4QHCA 5EECA 2ZC3B 4CQHA 3N4IA 4ME4A 3T4SA 4GN2A 1ES2A 2VGLS 1RCJA 3IS2A 3GDIA 4OPZA 1Y28A 3R7WA 3LIBA 2V8CA 4MDZA 5FQJA 1H8ZA 2ZBBA 3DAVA 2K2NA 3PBOA 1P9RA 3H82A 3MS6A 4H8RA 1GSXA 1BYWA 1HVBA 1T18A 4JBFA 5EVIA 5KMWA 2GDNA 1EI5A 4DF6A 1XJ4A 2ZQCA 5TJJA 3VFFA 5F69A 2BASA 2P04A 2VZWA 3DTEA 3KSFA 1TD5A 3ZG0A 4ARZA 1M6KA 4ZDXA 2IA2A 2JKTM 1WYBA 2XGNA 5FQQA 4CLCE 5EPHA 3ZNYA 2DRWA 4R0QA 4Y7PA 2XA7S 4Z9QA 1XJ2A 3ZDJA 3NOUC 3PBSA 2M7UA 5KZHA 1EW0A 1XA7A 3W4PA 3E2KA 3BFEA 2ZOIA 3MKEA 1K57A 3QP2A 5KSHA 3EEHA 4KZ6A 1LSVA 4RQ9A 3FG8A 3V39A 3G6OA 3HLCA 2Y55A 3V50A 1L0FA 3UNWA 4P87A 3EOIA 2Y79A 3TSGA 3CG5A 1N9LA 3G31A 3ITBA 3ZNTA 3ZVTA 3GQZA 5DKKA 5CERA 4PM7A 2I9VA 2V1BA 3Q81A 2ZL1B 2XFSA 4KZ4A 1E3UD 4PM9A 3C2WA 3UN7A 1YM1A 3GRJA 3IWOA 3P7NA 2KOIA 2W1RA 2EFXA 5HL1A 2WKQA 2B5RA 1KE3A 2WGIA 4NG2A 3SS4A 4HJ6A 2Q0OA 3ZVWA 4CLCB 3KYEA 4K08A 4HBUA 3S7QA 1FILA 2PR6A 2HP5A 2OAQ1 2L4RA 3DWZA 2ZM2A 3BY9A 4QJGA 4S2IA 5A93A 1XGJA 3Q07A 4Y0OA 2RCXA 4R4RA 5DFXA 3NDEA 5M19A 1NWZA 5FQIA 2XD1A 5EVID 2J3TC 3EGXC 1PI5A 1L2SA 2VGLM 1SKOB 2CC1A 1LLBA 2HDQA 2JKFA 2DNSA 1F9IA 5J3WA 4AFIA 4EV4A 1JWVA 2MJ6A 2V1AA 3IXBA 2QWSA 3EGDC 4LLOB 5HDDA 1H0MA 2Y8HA 2EWVA 4R3BA 3T1QB 4P85A 1FSYA 4OQIA 2EWWA 1BUEA 1MBLA 3BQAA 1YPRA 2W0NA 3IBRA 1KE0A 3G30A 1MZUA 5DJUA 1BZAA 3IWIA 1KVMA 2WUQA 1S6RA 2ZC4B 3PHYA 2O9CA 3KX0X 4P6BA 3PBRA 1DP8A 1S0WA 4DE3A 4LRYC 2W3DA 2JKGA 5FASA 4GD8A 4N92A 2ZC7A 4GDBA 1RP5A 4LRZE 3EQUA 3KSIA 4L9FA 4ESPA 3WS4A 4HJ4A 4YINA 5HDSA 2W1TA 3HUNA 1BLPA 2PAVP 4GCZA 3W4QA 3OPPA 4EW7A 5M1AA 1VQQA 3A0VA 2QZ6A 1PIOA 1ACFA 4MBKA 4IUHA 4BL3A 3DBAA 4K91A 1XXMA 1PI4A 2IWCA 1NJ4A 3A3IA 3VSKA 5FAPA 4JLFA 1HD8A 4JXGA 4OP5A 1XJ3A 3F1NA 4JXSA 1P9WA 5CGXA 1ZTUA 2WAFA 2JC7A 3SOIA 5E2FA 4OQ0A 2Q9NA 2NUTC 3S4XA 2W27A 2ZJ9A 2XH9A 1XGIA 2PD8A 1JWPA 5EUAA 5DF9A 1MC0A 3IH9A 4HH2A 2EX6A 1L0GA 3UPNA 1VM1A 3MFXA 3UY6A 4DE2A 2VV6A 1IEMA 4I39A 4ZJ2A 3HLFA 1NYYA 4Y2FA 3HLWA 5CGWA 3MF0A 1T1CA 4KQRA 1DJBA 1E4DA 5IT5A 1V9ZA 1XX2A 5FQMA 4GS9A 4F3LB 3IBJA 3BFDA 5IHVA 3G35A 4OOYA 2V9AA 5HWTA 3NOPC 5JYOA 5C5KA 1O7EA 2PT7A 4EQIA 1MWUA 2JKRI 4Q0IA 4F3LA 3UO9A 2ZQAA 3D3OA 2WYXA 4KG6A 4OPYA 4X69A 2VK3A 4ID4A 5FL3A 3O86A 1VHMA 4ZAMA 4XT2A 3L7HA 3MFDA 4WN5A 3BQ8A 2V2FF 3EWKA 1KVLA 4DDSA 3T4OA 3PXPA 3FKWA 1YQSA 3IWQA 3V5MA 3UB9A 4HIAA 5EM0A 2PBDP 4GHIA 2XDMA 1HLUP 4X53A 5GHZA 3VOYA 4DE0A 1G6AA 1MWSA 2WKRA 4E3LA 3VP0A 2V8FA 3A3DA 3IXDA 3HBRA 4LFUA 1I2SA 2IWDA 2Y2HA 1BSGA 3PBNA 5M18A 3GR2A 5AQAA 4R1GA 1S1YA 5CHUA 4R23A 4RYEA 3UDXA 2VGJA 1J3WA 1OTAA 4X55A 2HDRA 1SCWA 3VOLA 3SH8A 1ES3A 4D2OA 4HHDA 4LV2A 5EVIB 4N9KA 2PU2A 3C5AA 1FR1A 4JF4A 4IVKA 2YKHA 2K31A 1DJCA 1K56D 1TS6A 5HWVA 5HD5A 4IBRA 5G4YA 1ZHHB 3MSHA 1G6OA 2XEPA 4CLCD 3RXWA 5AQBA 2ZMAA 2QKPA 3ITAA 3UB6A 4I3JA 5CEBA 5DKLA 3MQQA 3DTKA 2HPBA 1IYQA 2J8YA 4JKTA 2P74A 2LB5A 4UA9A 4R4SA 1YT4A 4RX2A 3OBFA 3C4OA 4PM8A 4EU0A 3JVUA 4R3JA 2V0UA 3W4OA 3PTEA 3N8RA 1E3UA 1SHVA 3K3CA 2H28A 2UWXA 4HP9A 4KZ7A 4F94A 2ZD8A 4FSFA 3R4KA 2EA9A 1Z6FA 3RJUA 1S1ZA 4FTXA 2EX9A 1K6SA 2JKRM 4NK3A 5HD3A 2Y2QA 1DJAA 3MXRA 1JNUA 3BECA 3LI8A 5FEFA 3KYQA 2Y2LA 2J80A 4GZBA 4JPMA 4BBTA 3GV9A 3LIEA 2PBYA 1ERQA 1LSXA 2FZ0A 4KZ5A 1A0KA 1YMSA 4LV0A 4KZ3A 1OTEA 2PYRA 3B3XA 4N1XA 3LYXA 4B88A 5HFOA 1OTDA 3OPLA 4EBLA 4MN6A 1MKIA 2HZ5A 5HX9A 4S2NC 4YWZA 3NOTC 3A0RA 2LB9A 3MZEA 1GSWA 3VP4A 3VP2A 3BFFA 1N4OA 4U0XA 1U60A 2OAP1 3KO6A 3LIDA 3B47A 1PWGA 5I94A 2EXAA 5F6AA 1PWCA 3SS3A 4Z1WA 1XPBA 3T4TA 4G3KA 4C3QA 1KGFA 3P09A 2G2UA 2JE5A 5L10A 4S2LA 3QHYA 3VFHA 4BQMA 3OZHA 2HDUA 3K2NA 3C4PA 3RTYA 3ZG7B 3CUEA 3AGDA 3OC2A 4R38A 5J4EA 3MZDA 2Z6CA 5HAIA 1LL9A 4X56A 3DW0A 2KLIA 3G4PA 5FDSA 3CZDA 3R7WB 1K55C 2XA7M 3FYZA 4X1LA 3IX8A 3IHAA 1P97A 5CHMA 5DFYA 1DRMA 1Y4OA 2XQZA 2HGVA 2W3GA 3CUEC 4ZJ3A 2ZQ9A 4B4XA 4HBTA 5I5LA 3RH8B 1XJ6A 4CLCA 4XUZA 4IHQA 1VETB 2V20A 2ZQDA 1LL5A 2Y2KA 5DVAA 1IYSA 1G5UA 5JYPA 3M2JA 4BENA 4HY8A 2Y59A 3ICYA 3Q7ZA 2R9WA 2PDRA 2Q9MA 1T1AA 3UB5P 1KDSA 4II7A 5FATA 1KDWA 1MKMA 2PD7A 5L09A 1NLYA 1G28A 2JBFA 2L1MA 4KZBA 3G2YA 4NXGA 5HL6A 3UE0A 3HVFA 4KUOA 3LFVA 5LBRA 1K6RA 4X68A 5DTSA 5FEGA 4KQQA 4MNRA 3RFBA 5CXWA 2B02A 3H7WB 4WL9A 5E2GA 3SH7A 3OPHA 3TRCA 4E3NA 1YKDA 4UA6A 2Y2GA 4HI4A 1W63M 1H8MA 3C38A 3U4LP 4L9EA 3ULFA 2D01A 3QP1A 4LPZA 3Q82A 3HJKA 1LT0A 3CPTA 4XT2B 4JGRA 1QMFA 5DTKA 2GX5A 3IF6C 4UHUA 1OT6A 2M1CA 2ZM0A 3S7OA 4GDNA 1VEUA 2PR5A 4U3TA 1PW1A 1BLCA 4I38A 1YMXA 1ERMA 4QY5A 4S2KA 3MMHA 5K5BA 4S2MA 1AWIA 3SH9A 1CI9A 2ZC5B 4Y13A 1W5DA 1F2KA 4GLQA 4H6JB 2EX8A 5L8MA 5IS1A 1LI9A 5TFQA 1Z09A 4MCWA 4X25A 2DCFA 4OVDA 4GNUA 3SS5A 1K4FA 2ZQ7A 5CECA 5F1FA 5HZHA 4D60A 3V3RA 1X0OA 2Y2OA 3TOIA 1K57C 2W3EA 1ZG4A 4M4XA 2WGVA 4ZTKA 4WBGA 1TS0A 4OLGA 3LICA 3LCEA 4WMCA 3WRTA 2ZM8A 1TDLA 1TDGA 4HH3A 5AVEA 1W79A 3UE1A 1D1JA 1PZOA 1T1BA 1N9BA 1FIKA 2DMWA 5L07A 4RA7A 3NDGA 3D9YA 3IXHA 2P9VA 4KENB 2UV0E 1YLWA 2R78A 4E3JA 3IS2B 3P98A 4LV3A 1VEUB 1XA1A 1H8YA 3IXGA 4KQDA 4YNRA 2OWJA 5DF7A 1MPLA 2CMNA 2W3FA 1ESIA 4LGWA 1RGZA 3DWKA 4EXOA 4GOGA 4H6JA 4FH2A 3HJIA 2VV8A 2QMIA 3PYPA 3IH8A 5IU1A 4DMZA 2J7VA 4P0MA 3A3JA 3A0SA 3F1OB 4EWFA 2OLUA 4BL2A 3SW1A 4MMNA 2Y2PA 4NXEA 3BFCA 4S2JA 3QNCA 4NEED 5HDCA 2I72A 2OSUA
chains in the Genus database with same CATH topology
3PBOA 2ZBBA 2K2NA 4EU0A 4EQ1A 1P9RA 4R6LA 2ZOHA 3JVUA 3H82A 1GSXA 1BYWA 2V0UA 1T18A 3KYZA 2OWHA 3LR3A 1XJ4A 3MJQA 5TJJA 5MC7A 3K3CA 5F69A 2H28A 2BASA 4HP9A 2P04A 2VLGA 3C8CA 4FSFA 4OOLA 2VZWA 3R4KA 2KX6A 2EA9A 1YAXA 3KSFA 1S1ZA 4B93A 5G4ZA 1TD5A 4Y5FA 1GSVA 4ARZA 2JKRM 4PKYG 5HD3A 2IA2A 2JKTM 4CLCC 4CLCE 4G3WA 1NLZA 4HQAA 1JNUA 3E0YA 2XA7S 3LI8A 1XJ2A 2JKTI 3NOUC 3F1OA 3PBSA 2M7UA 3KYQA 2J80A 3UB8A 3T4JA 1EW0A 4O0PA 1TF1A 4BBTA 2ZOIA 3OCLA 3LIEA 2VV7A 3FPVA 5KSHA 1LSXA 3EEHA 2FZ0A 1LSVA 2YKFA 4RQ9A 3FG8A 3G6OA 5F68A 4HJ3A 2JN7A 1OTEA 2PYRA 2HJ9C 3LYXA 3EOIA 1OTDA 2Y79A 4MN6A 3UB7A 1N9LA 3PR6A 4BMWA 3H9WA 3CITA 4E04A 1WA9A 4O01A 2J3TD 3LI9A 4YWZA 3NOTC 5DKKA 3A0RA 1OJGA 5EFWA 4OOMA 2I9VA 2V1BA 2LB9A 3BW6A 3ZQ5A 1GSWA 4WEJA 4MN5A 2XRNA 4HP4A 3B33A 3C2WA 3UMDA 3P7NA 2OAP1 2KOIA 2W1RA 3KO6A 3LR4A 4R3AA 3LIDA 2WKQA 3B47A 3CWFA 3BY8A 4HJ6A 1UWPX 5F6AA 4CLCB 4K08A 1F5MA 3S7QA 3MR0A 4WF0A 2PR6A 2OAQ1 2L4RA 4Z1WA 3T4TA 3BY9A 4G3KA 1KOUA 3LR0A 3T4KA 4BBUA 1OT9A 5DFXA 1NWZA 4GJ4A 5AJGA 2J3TC 3EGXC 3OLOA 4WELA 2VGLM 4NXFA 2W1TB 4I5SA 3K2NA 5HPFA 4QPRA 3T50A 3RTYA 2OOLA 3CUEA 1UGUA 2VJWA 1F9IA 3F1PB 4BBVA 3OC2A 4R38A 5J4EA 2K7SA 3UE3A 2Z6CA 4G3VA 2B18A 5J3WA 2QYBA 4L9GA 4AFIA 1OJ5A 4I3IA 2QJ5A 4ARZB 1STZA 2KLIA 2MJ6A 2V1AA 3D72A 2P08A 2QWSA 3R7WB 2G7UA 4PHTA 3EGDC 4JGQA 2A24A 2XA7M 3O5YA 4LLOB 5HDDA 4WLAA 3MXQA 2Y8HA 2EWVA 4NKPA 4EERA 1DP9A 2EWWA 4P6ZM 1S67L 1F98A 1XFNA 3PBQA 1P97A 3BQAA 2W0NA 3IBRA 2ZMFA 1MZUA 5DFYA 5DJUA 1DRMA 2HGVA 2W3GA 1TS7A 2HV1A 3CUEC 3K3DA 2GNXA 4IJGA 3CAXA 3PHYA 4UQIM 2O9CA 1YSPA 3KX0X 1XFQA 3FPWA 3CLOA 3PBRA 5I5LA 1XJ6A 3RH8B 4CLCA 1DP8A 4IHQA 4ZRRA 2L0WA 4LRYC 2W3DA 2VEAA 4JGOA 3B42A 5DJTA 2A2LA 3VV4A 1N9NA 4Q0HA 2FH5A 4HY8A 4DJ3A 4LRZE 3EQUA 3KSIA 3OOVA 4FOFA 4GW9A 3ICYA 4L9FA 5F5YA 3LUQA 2PDRA 4HJ4A 1T1AA 5HDSA 2W1TA 4II7A 4EESA 4GCZA 1MKMA 2PD7A 4GS9B 1NLYA 1G28A 1T19A 3E4QA 2JHEA 2L1MA 3E4PA 4NXGA 4Q0JA 5HL6A 4EW7A 3A0VA 4HNBA 4EETB 3EEAA 1IOUA 4B9OA 3E4OA 3E98A 4KUOA 3LFVA 4IUHA 4MN7A 5LBRA 5J7EA 3DBAA 2XROA 2W3HA 3EQVA 3RFBA 2B02A 1XJ3A 3H7WB 4WL9A 2VA0A 2P7JA 3TRCA 1YKDA 4P6ZS 3F1NA 3P01A 1NRJA 2WKPA 1P9WA 3OCNA 2A24B 4LRXC 1ZTUA 4HI4A 5HPIA 1W63M 1H8MA 2O0YA 1UWNX 3C38A 4L9EA 3ULFA 2D01A 3LIAA 2NUTC 2W27A 4LPZA 4ETXA 2PD8A 4BJPA 3V67A 1TS8A 3HJKA 5DF9A 1MC0A 4JGPA 4HH2A 1S4RA 1LT0A 1DP6A 4XT2B 4JGRA 1OTIA 4KQOA 3MFXA 2VV6A 4I39A 2GX5A 1VB6A 3H82B 4Y2FA 1OT6A 2M1CA 4HOIA 1OTBA 3S7OA 3MF0A 1T1CA 1IFQA 2Z6DA 3KSGA 5IT5A 1LSWA 1V9ZA 4L0LA 4DN0A 2PR5A 3S7NA 4GS9A 4F3LB 3IBJA 4I38A 3MMHA 2V9AA 3F1PA 5HWTA 3F1NB 3W2ZA 5K5BA 3NOPC 2PHYA 5C5KA 1OPXA 4YOFA 3NHQA 3TW8A 2PT7A 3T4QA 4Q0IA 2JKRI 4F3LA 4GLQA 4H6JB 5AVFA 3D3OA 1S66L 5L8MA 5IS1A 4MCWA 4ETZA 3LR5A 1LL8A 1V9YA 5HZHA 1P0ZA 4Y3IA 1X0OA 5FL3A 4DJ2A 1S4SA 3BJNA 4IUKA 2VX8A 1VHMA 4PKYA 4XT2A 4WN5A 2V0WA 4PAUA 2W3EA 5CX7A 3BQ8A 4M4XA 3EWKA 5HSQA 3H7WA 2O99A 4UEYA 1TS0A 3T4OA 2PYPA 3PXPA 3MQOA 3LICA 4GHIB 3UMEA 2M7VA 3VE3A 3C30A 3LIFA 3U2AA 3UB9A 4HIAA 4HH3A 3JVVA 2NUPC 5AVEA 3PBTA 3TJZC 4GHIA 4R70A 2VKSA 4WUJA 1W63Q 2KDKA 1D06A 2QHKA 3ZYTA 3VE4A 2GJ3A 2INWA 1T1BA 4KUKA 3CI6A 2O9BA 2WKRA 2HF6A 2DMWA 3GECA 3BWLA 1D7EA 4WEKA 3UE6A 3FC7A 4BWIA 2HJEA 3PBNA 1S1YA 4EUVA 2R78A 5A8BA 3IS2B 2O9AA 1OTAA 4KQDA 2QJ7A 3VOLA 5HWWA 4YNRA 2J3WA 4HHDA 1N9OA 2OWJA 4O8GA 4NXBA 2CMNA 2W3FA 3NJAA 3MQ0A 5TBMB 1YSQA 2YKHA 2K31A 3S7PA 4EEPA 1TS6A 2XSSA 2ZMVA 4EXOA 2GZAA 1ODVA 5HWVA 5HD5A 5G4YA 5KIZA 4H6JA 1ZHHB 1G6OA 4EEUA 4CLCD 5TBMA 4CQHA 3HJIA 4ME4A 3T4SA 2VV8A 3PYPA 1H3QA 2QKPA 5IU1A 4DMZA 3TE8A 2VGLS 3KSHA 3UB6A 4I3AA 2D02A 3A0SA 3IS2A 3F1OB 3GDIA 4I3JA 5DKLA 3SW1A 4MMNA 3T4LA 3MQQA 1Y28A 4NXEA 3R7WA 3LIBA 2LB5A 3HCYA 4MDZA 4UQIS 3OBFA 4NEED 5HDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4R A;  4XT2 A;  2JHE A;  2ZBB A;  2L1M A;  4EQ1 A;  4WN5 A;  3E4P A;  3BY9 A;  4R6L A;  2ZOH A;  2V0W A;  4NXG A;  3H82 A;  1KOU A;  4EW7 A;  1GSX A;  4M4X A;  3EWK A;  1BYW A;  2V0U A;  1T18 A;  3A0V A;  4HNB A;  4EET B;  5HSQ A;  4BBU A;  3H7W A;  1OT9 A;  1NWZ A;  2OWH A;  4B9O A;  1TS0 A;  1XJ4 A;  2PYP A;  3E4O A;  4KUO A;  3MQO A;  3LIC A;  4GHI B;  5J7E A;  3MJQ A;  3K3C A;  5F69 A;  3UME A;  3VE3 A;  2H28 A;  2BAS A;  3LIF A;  3OLO A;  4HP9 A;  2VLG A;  4NXF A;  3C8C A;  3UB9 A;  4HIA A;  4I5S A;  4HH3 A;  2B02 A;  1XJ3 A;  3H7W B;  4WL9 A;  2KX6 A;  2EA9 A;  2OOL A;  5AVE A;  3RTY A;  1S1Z A;  3T50 A;  4GHI A;  4R70 A;  4WUJ A;  5G4Z A;  1UGU A;  2P7J A;  2KDK A;  1D06 A;  1GSV A;  4PKY G;  1F9I A;  5HWV A;  2QHK A;  3F1N A;  3F1P B;  5HD3 A;  3VE4 A;  2WKP A;  4BBV A;  4R38 A;  2A24 B;  4LRX C;  2GJ3 A;  2K7S A;  5J4E A;  2INW A;  2Z6C A;  5J3W A;  3RH8 B;  4HI4 A;  1T1B A;  4HQA A;  4L9G A;  4KUK A;  1JNU A;  1OJ5 A;  3LI8 A;  1UWN X;  1XJ2 A;  4I3I A;  2WKR A;  3NOU C;  3F1O A;  4L9E A;  3ULF A;  2QJ5 A;  2D01 A;  2J80 A;  2V1A A;  3LIA A;  3UB8 A;  2W27 A;  3D72 A;  3GEC A;  2QWS A;  1EW0 A;  4LPZ A;  3BWL A;  1D7E A;  4JGQ A;  3FC7 A;  3UE6 A;  4BBT A;  2A24 A;  4LLO B;  5HDD A;  4WLA A;  2PD8 A;  2ZOI A;  3MXQ A;  3LIE A;  2VV7 A;  1TS8 A;  3HJK A;  1S1Y A;  4EER A;  4WF0 A;  4JGP A;  1LSX A;  2R78 A;  3EEH A;  5A8B A;  1DP9 A;  4HH2 A;  1S4R A;  1S67 L;  1F98 A;  1LT0 A;  1DP6 A;  3IS2 B;  1XFN A;  1P97 A;  4XT2 B;  4JGR A;  1OTA A;  1LSV A;  2YKF A;  4RQ9 A;  2W0N A;  1OTI A;  3FG8 A;  3G6O A;  3IBR A;  2QJ7 A;  3MFX A;  4KQD A;  2VV6 A;  5F68 A;  3VOL A;  5HWW A;  4HJ3 A;  4I39 A;  2JN7 A;  1MZU A;  1OTE A;  1VB6 A;  4HHD A;  2PYR A;  1N9O A;  1DRM A;  2OWJ A;  3H82 B;  3LYX A;  5DJU A;  4NXB A;  1OTD A;  1TS7 A;  2CMN A;  1OT6 A;  2HV1 A;  2M1C A;  3NJA A;  4MN6 A;  5TBM B;  2YKH A;  1OTB A;  1N9L A;  3K3D A;  1T1C A;  2Z6D A;  4HOI A;  3UB7 A;  3CAX A;  4EEP A;  3PHY A;  1LSW A;  1TS6 A;  1V9Z A;  1XFQ A;  2PR5 A;  3H9W A;  3CLO A;  1ODV A;  3KX0 X;  1XJ6 A;  5G4Y A;  1WA9 A;  5HD5 A;  5I5L A;  4H6J A;  4GS9 A;  1DP8 A;  4E04 A;  4F3L B;  3LI9 A;  4YWZ A;  5KIZ A;  2L0W A;  4EEU A;  3NOT C;  4LRY C;  5DKK A;  3A0R A;  4I38 A;  1OJG A;  2VEA A;  5TBM A;  5EFW A;  4JGO A;  2V9A A;  3F1P A;  5HWT A;  3F1N B;  2I9V A;  2V1B A;  3HJI A;  3NOP C;  2VV8 A;  5DJT A;  3ZQ5 A;  1GSW A;  2PHY A;  3PYP A;  1N9N A;  2QKP A;  3NHQ A;  4MN5 A;  5IU1 A;  4HP4 A;  4F3L A;  3B33 A;  4H6J B;  3C2W A;  5AVF A;  3UB6 A;  4I3A A;  4EXO A;  1S66 L;  4HY8 A;  3UMD A;  4DJ3 A;  5IS1 A;  2D02 A;  3A0S A;  3IS2 A;  3F1O B;  3GDI A;  3P7N A;  4LRZ E;  4I3J A;  3LID A;  4R3A A;  5DKL A;  2WKQ A;  4GW9 A;  3ICY A;  4L9F A;  5F5Y A;  3LUQ A;  1Y28 A;  3CWF A;  3MQQ A;  3SW1 A;  2PDR A;  4HJ4 A;  1LL8 A;  4NXE A;  1V9Y A;  3BY8 A;  1T1A A;  5HDS A;  4HJ6 A;  5HZH A;  3LIB A;  1UWP X;  1P0Z A;  4EES A;  4GCZ A;  1X0O A;  5F6A A;  2PD7 A;  1S4S A;  4GS9 B;  1G28 A;  1T19 A;  4K08 A;  4DJ2 A;  3MR0 A;  5HDC A;  4PKY A;  2PR6 A;  3E4Q A; 
#chains in the Genus database with same CATH topology
 4IED A;  3CJM A;  4R6L A;  5TR7 A;  5EVL A;  1K54 C;  3KYZ A;  2OWH A;  4FD8 A;  5MC7 A;  3WWX A;  4CJN A;  5FSR A;  5FAQ A;  3C8C A;  3QP5 A;  4OOL A;  4KG5 A;  1WE4 A;  2KX6 A;  1PNE A;  3MXS A;  1IYP A;  5GLC A;  2C6W B;  4Y5F A;  2Y2N A;  4PKY G;  3Q1F A;  4CLC C;  3VMA A;  5FQ9 A;  1J9M A;  1E25 A;  2X01 A;  4G3W A;  3DTM A;  4HQA A;  2JKT I;  4IVI A;  5EV0 A;  1W8Y A;  1GA9 A;  3V3S A;  3T4J A;  1TF1 A;  3HUM A;  4C75 A;  4CPK A;  3FPV A;  2E8J A;  3GMW A;  3IX3 A;  3T12 B;  4HJ3 A;  2JN7 A;  5EM1 A;  2HP9 A;  4E3M A;  3FKV A;  3NI9 A;  2EXB A;  4E6X A;  3UB7 A;  4LCL A;  2WGW B;  4MLL A;  4E04 A;  1WA9 A;  2J3T D;  1CI8 A;  1ESU A;  1IKI A;  3NUL A;  4OH0 A;  4X6T A;  3GVB A;  5EFW A;  5CGS A;  3BW6 A;  3WS0 A;  4HP4 A;  1SKO A;  3UMD A;  3S1Y A;  3LR4 A;  5CED A;  3VOZ A;  2QPN A;  2ZL1 A;  3CWF A;  4DRT A;  3BY8 A;  4FCF A;  1UWP X;  1ES5 A;  3MR0 A;  4WF0 A;  1NZU A;  4A5R A;  1IKG A;  2WGW A;  1KOU A;  3LR0 A;  3T4K A;  1OT9 A;  5CRF A;  2ZLY A;  4B4Z A;  3HLE A;  4WEL A;  4Y0U A;  5HPF A;  4MBF A;  3T1X A;  3T50 A;  1CQA A;  3D4F A;  1FOF A;  1TVF A;  5A92 A;  1CK3 A;  3ISG A;  2EFU A;  4OQH A;  2PRF A;  1YLZ A;  1Q2Q A;  2B18 A;  4L9G A;  1OJ5 A;  4I3I A;  5TGF A;  3BLS A;  2QJ5 A;  4ARZ B;  1STZ A;  3FWL A;  3LGO A;  1K25 A;  1L0E A;  3D72 A;  4BD1 A;  2G7U A;  2J9O A;  3O5Y A;  4WLA A;  3MXQ A;  4XXR A;  1GHI A;  2B95 A;  1ZC2 A;  4P6Z M;  3IT9 A;  2ZMF A;  1G68 A;  5EOE A;  3W8K A;  4OQG A;  2HV1 A;  1RGY A;  2Z2M B;  4IJG A;  3CAX A;  4UQI M;  2ZQ8 A;  1HZO A;  1LI0 A;  2H10 A;  1CEG A;  3CLO A;  5FDH A;  3WRZ A;  4X1M A;  3UDF A;  2L0W A;  1ALQ A;  1W7F A;  1PYY A;  3Q7V A;  2VEA A;  4JGO A;  3B42 A;  2A2L A;  1KGG A;  5GHX A;  5GLD A;  3VV4 A;  3M6H A;  1N9N A;  4Q0H A;  1DY6 A;  4E3I A;  1MXO A;  2FH5 A;  4C6Y A;  3C7V A;  5J8X A;  2C5W B;  4FOF A;  3LUQ A;  4QY6 A;  2EX2 A;  4EES A;  4S2O A;  4RVA A;  5D3O A;  4RX3 A;  2JHE A;  3E4P A;  3EEA A;  3HLG A;  2A3U A;  4B9O A;  2Y2I A;  3E4O A;  4MN7 A;  4ZBE A;  5J7E A;  2XRO A;  1L0D A;  3EQV A;  4ZJ1 A;  4KZ8 A;  2VA0 A;  2P7J A;  4P6Z S;  3P01 A;  5CTM A;  1NRJ A;  2WKP A;  4OPR A;  4LRX C;  3HLD A;  5CHJ A;  5DTT A;  5HPI A;  1UWN X;  3VP1 A;  4ETX A;  3BLM A;  2Y2M A;  3V67 A;  3BFG A;  4JGP A;  5FA7 A;  1NY0 A;  3FV7 A;  1DP6 A;  4Y17 A;  4UAA A;  3L9K A;  1ES4 A;  1OTI A;  3IF6 B;  2OLV A;  1ERO A;  3H82 B;  3N7W A;  1OTB A;  1IFQ A;  2Z6D A;  3KSG A;  2R9X A;  4M3K A;  1LSW A;  3OPR A;  3LY4 A;  4L0L A;  4UA7 A;  5A91 A;  4OLD A;  3F1P A;  1FQG A;  4BD0 A;  3NIA A;  1OPX A;  3NHQ A;  3T4Q A;  2OV5 A;  3Q7V B;  1S66 L;  4E3O A;  2XF3 A;  4ETZ A;  3LR5 A;  3TG9 A;  1V9Y A;  3HRE A;  3NEC A;  1BTL A;  5HAQ A;  4DJ2 A;  1S4S A;  3M6B A;  3BJN A;  4IUK A;  2WAD A;  1Y54 A;  4WZ4 A;  4WMC D;  3AGE A;  5FI6 A;  5EOO A;  2V0W A;  4PAU A;  1K54 A;  5CX7 A;  3VP3 A;  2XD5 A;  3MQO A;  4GHI B;  2M7V A;  3VE3 A;  3LIF A;  1I5Q A;  3IX4 A;  3U2A A;  4OPQ A;  3JVV A;  2NUP C;  1MWR A;  3S22 A;  2JCH A;  2VKS A;  1W63 Q;  2KDK A;  1D06 A;  2XR0 A;  3ZYT A;  3BYD A;  2Y4A A;  3IQA A;  3VE4 A;  4E3K A;  2INW A;  1XP4 A;  5FI7 A;  3G32 A;  4KUK A;  2O9B A;  2WKI A;  4MBH A;  3T1S A;  4IBX A;  4WEK A;  3UE6 A;  3FC7 A;  2HJE A;  1PRQ A;  1PWD A;  1Q2P A;  4JF6 A;  4O7D A;  2O9A A;  2QJ7 A;  5HWW A;  4GB7 A;  2J3W A;  1N9O A;  4O8G A;  4Y0T A;  4HEF A;  4U0T A;  4YFM A;  5BOH A;  4OKP A;  3UPP A;  5TBM B;  1YSQ A;  4OON A;  3S7P A;  2XSS A;  3JYI A;  2IWB A;  1NRF A;  3A3E A;  4LCM A;  4EEU A;  5TBM A;  5L2F A;  1W8Q A;  1FR6 A;  1H3Q A;  5HW3 A;  3LEQ A;  3TE8 A;  3KSH A;  4Y15 A;  4QWO A;  4I3A A;  4JXV A;  2D02 A;  1GCE A;  3NY4 A;  3T4L A;  3AGF A;  4S2N A;  3N6I A;  1NYM A;  3HCY A;  4UQI S;  4FUW A;  3ZG8 B;  4QU3 A;  1SDE A;  3WS2 A;  2WK0 A;  4EQ1 A;  1ZG6 A;  2ZOH A;  4Q8I A;  3M2K A;  3LR3 A;  3PAG A;  3MJQ A;  3BM6 A;  2VLG A;  3LY3 A;  2VGK A;  1K0K A;  1BT5 A;  5CTN A;  1YAX A;  4WYY A;  1AXB A;  4B93 A;  5G4Z A;  1GSV A;  4K0X A;  1GHM A;  2WAE A;  5KSC A;  1NLZ A;  1FCM A;  3E0Y A;  4BLM A;  4DDY A;  1IEL A;  3F1O A;  1H5X A;  3NCK A;  3UB8 A;  3C7U A;  4KZ9 A;  4O0P A;  1YLY A;  2WKE A;  1LHY A;  2WZX A;  3OCL A;  2VV7 A;  1YLP A;  3HLB A;  2V1Z A;  1GA0 A;  1NZO A;  2YKF A;  3ZCZ A;  5F68 A;  3UPO A;  1FCO A;  2BLS A;  2HJ9 C;  3ZFZ A;  1K38 A;  4N9L A;  3ZHH A;  4EUZ A;  3PR6 A;  4OP8 A;  4BMW A;  3H9W A;  2X02 A;  3A3F A;  3CIT A;  3GTC A;  4O01 A;  3LI9 A;  1OJG A;  2RL3 A;  4OOM A;  3O88 A;  3ZQ5 A;  1SDN A;  3T1R A;  4WEJ A;  1MWT A;  4MN5 A;  2XRN A;  4LEN A;  3B33 A;  2XLN A;  4R3A A;  4GKU A;  4HES A;  4DKI A;  2P9V B;  3IHB A;  5EVE A;  3DTI A;  3QP6 A;  5AQ7 A;  1F5M A;  1KGE A;  1C3B A;  2ZC6 B;  3NC8 A;  5GLB A;  5HAP A;  3O3V A;  4BBU A;  3PAE A;  4GJ4 A;  5AJG A;  3WS1 A;  1TEM A;  3OLO A;  1K56 A;  3HL9 A;  4NXF A;  2W1T B;  4I5S A;  5G18 A;  4QPR A;  2OOL A;  5FAO A;  1UGU A;  3ZG9 B;  2VJW A;  4E6W A;  3F1P B;  4BBV A;  2K7S A;  3UE3 A;  4G3V A;  4DE1 A;  2QYB A;  4QB8 A;  3CHW P;  1HTZ A;  1VET A;  3VSL A;  2P08 A;  5E43 A;  3N8L A;  2H0Y A;  4PHT A;  4JGQ A;  4S2P A;  3I7J A;  2A24 A;  1M40 A;  1MY8 A;  4EBN A;  2ACG A;  4NKP A;  4EER A;  4PM6 A;  1DP9 A;  1S67 L;  1F98 A;  1XFN A;  3PBQ A;  5E2E A;  1K4E A;  5HAR A;  1TS7 A;  5U47 A;  2H0T A;  2PU4 A;  3K3D A;  2GNX A;  1YSP A;  3FPW A;  1XFQ A;  1NXY A;  1FCN A;  4ZRR A;  4JF5 A;  3O87 A;  4PMA A;  4WM9 A;  5DJT A;  3NBL A;  3IF6 A;  2H5S A;  1BLH A;  4DJ3 A;  1JWZ A;  1JTD A;  3OOV A;  2E8I A;  4GW9 A;  5F5Y A;  4PM5 A;  3CMZ A;  3QNB A;  1OME A;  2HDS A;  5FI2 A;  4GS9 B;  1T19 A;  2HP6 A;  4LV1 A;  3E4Q A;  5E2H A;  2FFY A;  1PFL A;  4Q0J A;  1JVJ A;  4EET B;  4HNB A;  5EE8 A;  1IOU A;  1FSW A;  1YLJ A;  3E98 A;  5GL9 A;  2X71 A;  1PZP A;  2W3H A;  2Z2L B;  4DXC A;  3E2L A;  1K55 A;  4EBP A;  5GHY A;  5A90 A;  3ZG5 A;  4JXW A;  2XK1 A;  3OCN A;  2A24 B;  1JTG A;  3RXX A;  1GHP A;  2O0Y A;  4WZ5 C;  3LIA A;  3SZT A;  2BG1 A;  4XUX A;  1SKF A;  4BJP A;  1ZKJ A;  1TS8 A;  1CJF A;  1S4R A;  4KQO A;  1VB6 A;  1O07 A;  3BEB A;  2Y91 A;  3CPT B;  3UDI A;  4HOI A;  5F83 A;  1CF0 A;  3QP4 A;  1XKZ A;  4DN0 A;  3BRM A;  5FQK A;  3S7N A;  5F1G A;  3LEZ A;  1CEF A;  5F82 A;  2WZZ A;  3F1N B;  3W2Z A;  3G34 A;  2PHY A;  4YOF A;  3TW8 A;  4KZA A;  5AVF A;  2FFF B;  2BTF P;  3HUO A;  1BLS A;  1LL8 A;  3MKF A;  3FZC A;  3MZF A;  1P0Z A;  4Y3I A;  4QD4 A;  3N8S A;  1SZV A;  2VX8 A;  4PKY A;  4PPR A;  5GLA A;  5AQ9 A;  4GD6 A;  5EVI C;  4N1H A;  4K0W A;  5HSQ A;  1ONH A;  3H7W A;  3JPU A;  2O99 A;  4FH4 A;  4UEY A;  2PYP A;  1QME A;  1BUL A;  4WZ5 A;  1WYC A;  3UME A;  3C30 A;  1PW8 A;  4MEZ A;  3PBT A;  3TJZ C;  4R70 A;  4WUJ A;  2QHK A;  2GJ3 A;  2Y2J A;  3CI6 A;  4NET A;  2HF6 A;  2G2W A;  2J9P A;  1EWZ A;  3GEC A;  1I2W A;  1D7E A;  3BWL A;  2AVX A;  2WKH A;  4BWI A;  1IYO A;  3LO7 A;  1ONG A;  4EUV A;  5A8B A;  3QP8 A;  3IF5 A;  3WS5 A;  3GSG A;  1L3L A;  3ZGA B;  4NXB A;  4DXB A;  3NJA A;  5DF8 A;  2XFT A;  3MQ0 A;  1YLT A;  4EEP A;  2ZMV A;  2GZA A;  1ODV A;  4KG2 A;  5KIZ A;  2A49 A;  3G2Z A;  3MBZ A;  1KE4 A;  4QHC A;  5EEC A;  2ZC3 B;  4CQH A;  3N4I A;  4ME4 A;  3T4S A;  4GN2 A;  1ES2 A;  2VGL S;  1RCJ A;  3IS2 A;  3GDI A;  4OPZ A;  1Y28 A;  3R7W A;  3LIB A;  2V8C A;  4MDZ A;  5FQJ A;  1H8Z A;  2ZBB A;  3DAV A;  2K2N A;  3PBO A;  1P9R A;  3H82 A;  3MS6 A;  4H8R A;  1GSX A;  1BYW A;  1HVB A;  1T18 A;  4JBF A;  5EVI A;  5KMW A;  2GDN A;  1EI5 A;  4DF6 A;  1XJ4 A;  2ZQC A;  5TJJ A;  3VFF A;  5F69 A;  2BAS A;  2P04 A;  2VZW A;  3DTE A;  3KSF A;  1TD5 A;  3ZG0 A;  4ARZ A;  1M6K A;  4ZDX A;  2IA2 A;  2JKT M;  1WYB A;  2XGN A;  5FQQ A;  4CLC E;  5EPH A;  3ZNY A;  2DRW A;  4R0Q A;  4Y7P A;  2XA7 S;  4Z9Q A;  1XJ2 A;  3ZDJ A;  3NOU C;  3PBS A;  2M7U A;  5KZH A;  1EW0 A;  1XA7 A;  3W4P A;  3E2K A;  3BFE A;  2ZOI A;  3MKE A;  1K57 A;  3QP2 A;  5KSH A;  3EEH A;  4KZ6 A;  1LSV A;  4RQ9 A;  3FG8 A;  3V39 A;  3G6O A;  3HLC A;  2Y55 A;  3V50 A;  1L0F A;  3UNW A;  4P87 A;  3EOI A;  2Y79 A;  3TSG A;  3CG5 A;  1N9L A;  3G31 A;  3ITB A;  3ZNT A;  3ZVT A;  3GQZ A;  5DKK A;  5CER A;  4PM7 A;  2I9V A;  2V1B A;  3Q81 A;  2ZL1 B;  2XFS A;  4KZ4 A;  1E3U D;  4PM9 A;  3C2W A;  3UN7 A;  1YM1 A;  3GRJ A;  3IWO A;  3P7N A;  2KOI A;  2W1R A;  2EFX A;  5HL1 A;  2WKQ A;  2B5R A;  1KE3 A;  2WGI A;  4NG2 A;  3SS4 A;  4HJ6 A;  2Q0O A;  3ZVW A;  4CLC B;  3KYE A;  4K08 A;  4HBU A;  3S7Q A;  1FIL A;  2PR6 A;  2HP5 A;  2OAQ 1;  2L4R A;  3DWZ A;  2ZM2 A;  3BY9 A;  4QJG A;  4S2I A;  5A93 A;  1XGJ A;  3Q07 A;  4Y0O A;  2RCX A;  4R4R A;  5DFX A;  3NDE A;  5M19 A;  1NWZ A;  5FQI A;  2XD1 A;  5EVI D;  2J3T C;  3EGX C;  1PI5 A;  1L2S A;  2VGL M;  1SKO B;  2CC1 A;  1LLB A;  2HDQ A;  2JKF A;  2DNS A;  1F9I A;  5J3W A;  4AFI A;  4EV4 A;  1JWV A;  2MJ6 A;  2V1A A;  3IXB A;  2QWS A;  3EGD C;  4LLO B;  5HDD A;  1H0M A;  2Y8H A;  2EWV A;  4R3B A;  3T1Q B;  4P85 A;  1FSY A;  4OQI A;  2EWW A;  1BUE A;  1MBL A;  3BQA A;  1YPR A;  2W0N A;  3IBR A;  1KE0 A;  3G30 A;  1MZU A;  5DJU A;  1BZA A;  3IWI A;  1KVM A;  2WUQ A;  1S6R A;  2ZC4 B;  3PHY A;  2O9C A;  3KX0 X;  4P6B A;  3PBR A;  1DP8 A;  1S0W A;  4DE3 A;  4LRY C;  2W3D A;  2JKG A;  5FAS A;  4GD8 A;  4N92 A;  2ZC7 A;  4GDB A;  1RP5 A;  4LRZ E;  3EQU A;  3KSI A;  4L9F A;  4ESP A;  3WS4 A;  4HJ4 A;  4YIN A;  5HDS A;  2W1T A;  3HUN A;  1BLP A;  2PAV P;  4GCZ A;  3W4Q A;  3OPP A;  4EW7 A;  5M1A A;  1VQQ A;  3A0V A;  2QZ6 A;  1PIO A;  1ACF A;  4MBK A;  4IUH A;  4BL3 A;  3DBA A;  4K91 A;  1XXM A;  1PI4 A;  2IWC A;  1NJ4 A;  3A3I A;  3VSK A;  5FAP A;  4JLF A;  1HD8 A;  4JXG A;  4OP5 A;  1XJ3 A;  3F1N A;  4JXS A;  1P9W A;  5CGX A;  1ZTU A;  2WAF A;  2JC7 A;  3SOI A;  5E2F A;  4OQ0 A;  2Q9N A;  2NUT C;  3S4X A;  2W27 A;  2ZJ9 A;  2XH9 A;  1XGI A;  2PD8 A;  1JWP A;  5EUA A;  5DF9 A;  1MC0 A;  3IH9 A;  4HH2 A;  2EX6 A;  1L0G A;  3UPN A;  1VM1 A;  3MFX A;  3UY6 A;  4DE2 A;  2VV6 A;  1IEM A;  4I39 A;  4ZJ2 A;  3HLF A;  1NYY A;  4Y2F A;  3HLW A;  5CGW A;  3MF0 A;  1T1C A;  4KQR A;  1DJB A;  1E4D A;  5IT5 A;  1V9Z A;  1XX2 A;  5FQM A;  4GS9 A;  4F3L B;  3IBJ A;  3BFD A;  5IHV A;  3G35 A;  4OOY A;  2V9A A;  5HWT A;  3NOP C;  5JYO A;  5C5K A;  1O7E A;  2PT7 A;  4EQI A;  1MWU A;  2JKR I;  4Q0I A;  4F3L A;  3UO9 A;  2ZQA A;  3D3O A;  2WYX A;  4KG6 A;  4OPY A;  4X69 A;  2VK3 A;  4ID4 A;  5FL3 A;  3O86 A;  1VHM A;  4ZAM A;  4XT2 A;  3L7H A;  3MFD A;  4WN5 A;  3BQ8 A;  2V2F F;  3EWK A;  1KVL A;  4DDS A;  3T4O A;  3PXP A;  3FKW A;  1YQS A;  3IWQ A;  3V5M A;  3UB9 A;  4HIA A;  5EM0 A;  2PBD P;  4GHI A;  2XDM A;  1HLU P;  4X53 A;  5GHZ A;  3VOY A;  4DE0 A;  1G6A A;  1MWS A;  2WKR A;  4E3L A;  3VP0 A;  2V8F A;  3A3D A;  3IXD A;  3HBR A;  4LFU A;  1I2S A;  2IWD A;  2Y2H A;  1BSG A;  3PBN A;  5M18 A;  3GR2 A;  5AQA A;  4R1G A;  1S1Y A;  5CHU A;  4R23 A;  4RYE A;  3UDX A;  2VGJ A;  1J3W A;  1OTA A;  4X55 A;  2HDR A;  1SCW A;  3VOL A;  3SH8 A;  1ES3 A;  4D2O A;  4HHD A;  4LV2 A;  5EVI B;  4N9K A;  2PU2 A;  3C5A A;  1FR1 A;  4JF4 A;  4IVK A;  2YKH A;  2K31 A;  1DJC A;  1K56 D;  1TS6 A;  5HWV A;  5HD5 A;  4IBR A;  5G4Y A;  1ZHH B;  3MSH A;  1G6O A;  2XEP A;  4CLC D;  3RXW A;  5AQB A;  2ZMA A;  2QKP A;  3ITA A;  3UB6 A;  4I3J A;  5CEB A;  5DKL A;  3MQQ A;  3DTK A;  2HPB A;  1IYQ A;  2J8Y A;  4JKT A;  2P74 A;  2LB5 A;  4UA9 A;  4R4S A;  1YT4 A;  4RX2 A;  3OBF A;  3C4O A;  4PM8 A;  4EU0 A;  3JVU A;  4R3J A;  2V0U A;  3W4O A;  3PTE A;  3N8R A;  1E3U A;  1SHV A;  3K3C A;  2H28 A;  2UWX A;  4HP9 A;  4KZ7 A;  4F94 A;  2ZD8 A;  4FSF A;  3R4K A;  2EA9 A;  1Z6F A;  3RJU A;  1S1Z A;  4FTX A;  2EX9 A;  1K6S A;  2JKR M;  4NK3 A;  5HD3 A;  2Y2Q A;  1DJA A;  3MXR A;  1JNU A;  3BEC A;  3LI8 A;  5FEF A;  3KYQ A;  2Y2L A;  2J80 A;  4GZB A;  4JPM A;  4BBT A;  3GV9 A;  3LIE A;  2PBY A;  1ERQ A;  1LSX A;  2FZ0 A;  4KZ5 A;  1A0K A;  1YMS A;  4LV0 A;  4KZ3 A;  1OTE A;  2PYR A;  3B3X A;  4N1X A;  3LYX A;  4B88 A;  5HFO A;  1OTD A;  3OPL A;  4EBL A;  4MN6 A;  1MKI A;  2HZ5 A;  5HX9 A;  4S2N C;  4YWZ A;  3NOT C;  3A0R A;  2LB9 A;  3MZE A;  1GSW A;  3VP4 A;  3VP2 A;  3BFF A;  1N4O A;  4U0X A;  1U60 A;  2OAP 1;  3KO6 A;  3LID A;  3B47 A;  1PWG A;  5I94 A;  2EXA A;  5F6A A;  1PWC A;  3SS3 A;  4Z1W A;  1XPB A;  3T4T A;  4G3K A;  4C3Q A;  1KGF A;  3P09 A;  2G2U A;  2JE5 A;  5L10 A;  4S2L A;  3QHY A;  3VFH A;  4BQM A;  3OZH A;  2HDU A;  3K2N A;  3C4P A;  3RTY A;  3ZG7 B;  3CUE A;  3AGD A;  3OC2 A;  4R38 A;  5J4E A;  3MZD A;  2Z6C A;  5HAI A;  1LL9 A;  4X56 A;  3DW0 A;  2KLI A;  3G4P A;  5FDS A;  3CZD A;  3R7W B;  1K55 C;  2XA7 M;  3FYZ A;  4X1L A;  3IX8 A;  3IHA A;  1P97 A;  5CHM A;  5DFY A;  1DRM A;  1Y4O A;  2XQZ A;  2HGV A;  2W3G A;  3CUE C;  4ZJ3 A;  2ZQ9 A;  4B4X A;  4HBT A;  5I5L A;  3RH8 B;  1XJ6 A;  4CLC A;  4XUZ A;  4IHQ A;  1VET B;  2V20 A;  2ZQD A;  1LL5 A;  2Y2K A;  5DVA A;  1IYS A;  1G5U A;  5JYP A;  3M2J A;  4BEN A;  4HY8 A;  2Y59 A;  3ICY A;  3Q7Z A;  2R9W A;  2PDR A;  2Q9M A;  1T1A A;  3UB5 P;  1KDS A;  4II7 A;  5FAT A;  1KDW A;  1MKM A;  2PD7 A;  5L09 A;  1NLY A;  1G28 A;  2JBF A;  2L1M A;  4KZB A;  3G2Y A;  4NXG A;  5HL6 A;  3UE0 A;  3HVF A;  4KUO A;  3LFV A;  5LBR A;  1K6R A;  4X68 A;  5DTS A;  5FEG A;  4KQQ A;  4MNR A;  3RFB A;  5CXW A;  2B02 A;  3H7W B;  4WL9 A;  5E2G A;  3SH7 A;  3OPH A;  3TRC A;  4E3N A;  1YKD A;  4UA6 A;  2Y2G A;  4HI4 A;  1W63 M;  1H8M A;  3C38 A;  3U4L P;  4L9E A;  3ULF A;  2D01 A;  3QP1 A;  4LPZ A;  3Q82 A;  3HJK A;  1LT0 A;  3CPT A;  4XT2 B;  4JGR A;  1QMF A;  5DTK A;  2GX5 A;  3IF6 C;  4UHU A;  1OT6 A;  2M1C A;  2ZM0 A;  3S7O A;  4GDN A;  1VEU A;  2PR5 A;  4U3T A;  1PW1 A;  1BLC A;  4I38 A;  1YMX A;  1ERM A;  4QY5 A;  4S2K A;  3MMH A;  5K5B A;  4S2M A;  1AWI A;  3SH9 A;  1CI9 A;  2ZC5 B;  4Y13 A;  1W5D A;  1F2K A;  4GLQ A;  4H6J B;  2EX8 A;  5L8M A;  5IS1 A;  1LI9 A;  5TFQ A;  1Z09 A;  4MCW A;  4X25 A;  2DCF A;  4OVD A;  4GNU A;  3SS5 A;  1K4F A;  2ZQ7 A;  5CEC A;  5F1F A;  5HZH A;  4D60 A;  3V3R A;  1X0O A;  2Y2O A;  3TOI A;  1K57 C;  2W3E A;  1ZG4 A;  4M4X A;  2WGV A;  4ZTK A;  4WBG A;  1TS0 A;  4OLG A;  3LIC A;  3LCE A;  4WMC A;  3WRT A;  2ZM8 A;  1TDL A;  1TDG A;  4HH3 A;  5AVE A;  1W79 A;  3UE1 A;  1D1J A;  1PZO A;  1T1B A;  1N9B A;  1FIK A;  2DMW A;  5L07 A;  4RA7 A;  3NDG A;  3D9Y A;  3IXH A;  2P9V A;  4KEN B;  2UV0 E;  1YLW A;  2R78 A;  4E3J A;  3IS2 B;  3P98 A;  4LV3 A;  1VEU B;  1XA1 A;  1H8Y A;  3IXG A;  4KQD A;  4YNR A;  2OWJ A;  5DF7 A;  1MPL A;  2CMN A;  2W3F A;  1ESI A;  4LGW A;  1RGZ A;  3DWK A;  4EXO A;  4GOG A;  4H6J A;  4FH2 A;  3HJI A;  2VV8 A;  2QMI A;  3PYP A;  3IH8 A;  5IU1 A;  4DMZ A;  2J7V A;  4P0M A;  3A3J A;  3A0S A;  3F1O B;  4EWF A;  2OLU A;  4BL2 A;  3SW1 A;  4MMN A;  2Y2P A;  4NXE A;  3BFC A;  4S2J A;  3QNC A;  4NEE D;  5HDC A;  2I72 A;  2OSU A; 
#chains in the Genus database with same CATH homology
 3PBO A;  2ZBB A;  2K2N A;  4EU0 A;  4EQ1 A;  1P9R A;  4R6L A;  2ZOH A;  3JVU A;  3H82 A;  1GSX A;  1BYW A;  2V0U A;  1T18 A;  3KYZ A;  2OWH A;  3LR3 A;  1XJ4 A;  3MJQ A;  5TJJ A;  5MC7 A;  3K3C A;  5F69 A;  2H28 A;  2BAS A;  4HP9 A;  2P04 A;  2VLG A;  3C8C A;  4FSF A;  4OOL A;  2VZW A;  3R4K A;  2KX6 A;  2EA9 A;  1YAX A;  3KSF A;  1S1Z A;  4B93 A;  5G4Z A;  1TD5 A;  4Y5F A;  1GSV A;  4ARZ A;  2JKR M;  4PKY G;  5HD3 A;  2IA2 A;  2JKT M;  4CLC C;  4CLC E;  4G3W A;  1NLZ A;  4HQA A;  1JNU A;  3E0Y A;  2XA7 S;  3LI8 A;  1XJ2 A;  2JKT I;  3NOU C;  3F1O A;  3PBS A;  2M7U A;  3KYQ A;  2J80 A;  3UB8 A;  3T4J A;  1EW0 A;  4O0P A;  1TF1 A;  4BBT A;  2ZOI A;  3OCL A;  3LIE A;  2VV7 A;  3FPV A;  5KSH A;  1LSX A;  3EEH A;  2FZ0 A;  1LSV A;  2YKF A;  4RQ9 A;  3FG8 A;  3G6O A;  5F68 A;  4HJ3 A;  2JN7 A;  1OTE A;  2PYR A;  2HJ9 C;  3LYX A;  3EOI A;  1OTD A;  2Y79 A;  4MN6 A;  3UB7 A;  1N9L A;  3PR6 A;  4BMW A;  3H9W A;  3CIT A;  4E04 A;  1WA9 A;  4O01 A;  2J3T D;  3LI9 A;  4YWZ A;  3NOT C;  5DKK A;  3A0R A;  1OJG A;  5EFW A;  4OOM A;  2I9V A;  2V1B A;  2LB9 A;  3BW6 A;  3ZQ5 A;  1GSW A;  4WEJ A;  4MN5 A;  2XRN A;  4HP4 A;  3B33 A;  3C2W A;  3UMD A;  3P7N A;  2OAP 1;  2KOI A;  2W1R A;  3KO6 A;  3LR4 A;  4R3A A;  3LID A;  2WKQ A;  3B47 A;  3CWF A;  3BY8 A;  4HJ6 A;  1UWP X;  5F6A A;  4CLC B;  4K08 A;  1F5M A;  3S7Q A;  3MR0 A;  4WF0 A;  2PR6 A;  2OAQ 1;  2L4R A;  4Z1W A;  3T4T A;  3BY9 A;  4G3K A;  1KOU A;  3LR0 A;  3T4K A;  4BBU A;  1OT9 A;  5DFX A;  1NWZ A;  4GJ4 A;  5AJG A;  2J3T C;  3EGX C;  3OLO A;  4WEL A;  2VGL M;  4NXF A;  2W1T B;  4I5S A;  3K2N A;  5HPF A;  4QPR A;  3T50 A;  3RTY A;  2OOL A;  3CUE A;  1UGU A;  2VJW A;  1F9I A;  3F1P B;  4BBV A;  3OC2 A;  4R38 A;  5J4E A;  2K7S A;  3UE3 A;  2Z6C A;  4G3V A;  2B18 A;  5J3W A;  2QYB A;  4L9G A;  4AFI A;  1OJ5 A;  4I3I A;  2QJ5 A;  4ARZ B;  1STZ A;  2KLI A;  2MJ6 A;  2V1A A;  3D72 A;  2P08 A;  2QWS A;  3R7W B;  2G7U A;  4PHT A;  3EGD C;  4JGQ A;  2A24 A;  2XA7 M;  3O5Y A;  4LLO B;  5HDD A;  4WLA A;  3MXQ A;  2Y8H A;  2EWV A;  4NKP A;  4EER A;  1DP9 A;  2EWW A;  4P6Z M;  1S67 L;  1F98 A;  1XFN A;  3PBQ A;  1P97 A;  3BQA A;  2W0N A;  3IBR A;  2ZMF A;  1MZU A;  5DFY A;  5DJU A;  1DRM A;  2HGV A;  2W3G A;  1TS7 A;  2HV1 A;  3CUE C;  3K3D A;  2GNX A;  4IJG A;  3CAX A;  3PHY A;  4UQI M;  2O9C A;  1YSP A;  3KX0 X;  1XFQ A;  3FPW A;  3CLO A;  3PBR A;  5I5L A;  1XJ6 A;  3RH8 B;  4CLC A;  1DP8 A;  4IHQ A;  4ZRR A;  2L0W A;  4LRY C;  2W3D A;  2VEA A;  4JGO A;  3B42 A;  5DJT A;  2A2L A;  3VV4 A;  1N9N A;  4Q0H A;  2FH5 A;  4HY8 A;  4DJ3 A;  4LRZ E;  3EQU A;  3KSI A;  3OOV A;  4FOF A;  4GW9 A;  3ICY A;  4L9F A;  5F5Y A;  3LUQ A;  2PDR A;  4HJ4 A;  1T1A A;  5HDS A;  2W1T A;  4II7 A;  4EES A;  4GCZ A;  1MKM A;  2PD7 A;  4GS9 B;  1NLY A;  1G28 A;  1T19 A;  3E4Q A;  2JHE A;  2L1M A;  3E4P A;  4NXG A;  4Q0J A;  5HL6 A;  4EW7 A;  3A0V A;  4HNB A;  4EET B;  3EEA A;  1IOU A;  4B9O A;  3E4O A;  3E98 A;  4KUO A;  3LFV A;  4IUH A;  4MN7 A;  5LBR A;  5J7E A;  3DBA A;  2XRO A;  2W3H A;  3EQV A;  3RFB A;  2B02 A;  1XJ3 A;  3H7W B;  4WL9 A;  2VA0 A;  2P7J A;  3TRC A;  1YKD A;  4P6Z S;  3F1N A;  3P01 A;  1NRJ A;  2WKP A;  1P9W A;  3OCN A;  2A24 B;  4LRX C;  1ZTU A;  4HI4 A;  5HPI A;  1W63 M;  1H8M A;  2O0Y A;  1UWN X;  3C38 A;  4L9E A;  3ULF A;  2D01 A;  3LIA A;  2NUT C;  2W27 A;  4LPZ A;  4ETX A;  2PD8 A;  4BJP A;  3V67 A;  1TS8 A;  3HJK A;  5DF9 A;  1MC0 A;  4JGP A;  4HH2 A;  1S4R A;  1LT0 A;  1DP6 A;  4XT2 B;  4JGR A;  1OTI A;  4KQO A;  3MFX A;  2VV6 A;  4I39 A;  2GX5 A;  1VB6 A;  3H82 B;  4Y2F A;  1OT6 A;  2M1C A;  4HOI A;  1OTB A;  3S7O A;  3MF0 A;  1T1C A;  1IFQ A;  2Z6D A;  3KSG A;  5IT5 A;  1LSW A;  1V9Z A;  4L0L A;  4DN0 A;  2PR5 A;  3S7N A;  4GS9 A;  4F3L B;  3IBJ A;  4I38 A;  3MMH A;  2V9A A;  3F1P A;  5HWT A;  3F1N B;  3W2Z A;  5K5B A;  3NOP C;  2PHY A;  5C5K A;  1OPX A;  4YOF A;  3NHQ A;  3TW8 A;  2PT7 A;  3T4Q A;  4Q0I A;  2JKR I;  4F3L A;  4GLQ A;  4H6J B;  5AVF A;  3D3O A;  1S66 L;  5L8M A;  5IS1 A;  4MCW A;  4ETZ A;  3LR5 A;  1LL8 A;  1V9Y A;  5HZH A;  1P0Z A;  4Y3I A;  1X0O A;  5FL3 A;  4DJ2 A;  1S4S A;  3BJN A;  4IUK A;  2VX8 A;  1VHM A;  4PKY A;  4XT2 A;  4WN5 A;  2V0W A;  4PAU A;  2W3E A;  5CX7 A;  3BQ8 A;  4M4X A;  3EWK A;  5HSQ A;  3H7W A;  2O99 A;  4UEY A;  1TS0 A;  3T4O A;  2PYP A;  3PXP A;  3MQO A;  3LIC A;  4GHI B;  3UME A;  2M7V A;  3VE3 A;  3C30 A;  3LIF A;  3U2A A;  3UB9 A;  4HIA A;  4HH3 A;  3JVV A;  2NUP C;  5AVE A;  3PBT A;  3TJZ C;  4GHI A;  4R70 A;  2VKS A;  4WUJ A;  1W63 Q;  2KDK A;  1D06 A;  2QHK A;  3ZYT A;  3VE4 A;  2GJ3 A;  2INW A;  1T1B A;  4KUK A;  3CI6 A;  2O9B A;  2WKR A;  2HF6 A;  2DMW A;  3GEC A;  3BWL A;  1D7E A;  4WEK A;  3UE6 A;  3FC7 A;  4BWI A;  2HJE A;  3PBN A;  1S1Y A;  4EUV A;  2R78 A;  5A8B A;  3IS2 B;  2O9A A;  1OTA A;  4KQD A;  2QJ7 A;  3VOL A;  5HWW A;  4YNR A;  2J3W A;  4HHD A;  1N9O A;  2OWJ A;  4O8G A;  4NXB A;  2CMN A;  2W3F A;  3NJA A;  3MQ0 A;  5TBM B;  1YSQ A;  2YKH A;  2K31 A;  3S7P A;  4EEP A;  1TS6 A;  2XSS A;  2ZMV A;  4EXO A;  2GZA A;  1ODV A;  5HWV A;  5HD5 A;  5G4Y A;  5KIZ A;  4H6J A;  1ZHH B;  1G6O A;  4EEU A;  4CLC D;  5TBM A;  4CQH A;  3HJI A;  4ME4 A;  3T4S A;  2VV8 A;  3PYP A;  1H3Q A;  2QKP A;  5IU1 A;  4DMZ A;  3TE8 A;  2VGL S;  3KSH A;  3UB6 A;  4I3A A;  2D02 A;  3A0S A;  3IS2 A;  3F1O B;  3GDI A;  4I3J A;  5DKL A;  3SW1 A;  4MMN A;  3T4L A;  3MQQ A;  1Y28 A;  4NXE A;  3R7W A;  3LIB A;  2LB5 A;  3HCY A;  4MDZ A;  4UQI S;  3OBF A;  4NEE D;  5HDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...