1XJ6A

Structure of bjfixlh in the unliganded ferrous form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
molecule keywords Sensor protein fixL
total genus 29
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj6A00
3HJKA 1DP8A 3LIDA 2VEAA 3A0RA 3E4PA 4HQAA 3VOLA 4DJ2A 5HWWA 1XJ2A 4GHIA 3LICA 2KDKA 1BYWA 2PYPA 4I5SA 3A0VA 4JGRA 3VE3A 4EESA 1ODVA 1S4RA 2QJ7A 4HNBA 2JHEA 3K3DA 3K3CA 4HHDA 2K7SA 2OWHA 4NXFA 3NHQA 3F1NA 5G4ZA 5G4YA 2W27A 1TS6A 2KX6A 5A8BA 1XJ3A 1LT0A 3IS2B 4LPZA 4BBTA 4I3IA 2W0NA 4WUJA 2QHKA 2YKHA 1NWZA 4LRZE 3UMEA 3H9WA 2CMNA 3MQQA 1S1YA 4HJ4A 5IU1A 3ICYA 1DP9A 3PYPA 4NXEA 3GDIA 3FG8A 1N9OA 2VV8A 3CLOA 4L9FA 3F1NB 3RH8B 3LUQA 1UGUA 4L9EA 4EQ1A 2V0UA 4JGPA 4NXBA 5TBMB 4K08A 4EEPA 1OJGA 2HV1A 2OWJA 3UB6A 2ZBBA 4HJ3A 1JNUA 4WLAA 5J7EA 3CWFA 4PKYA 3LIBA 4HIAA 5KIZA 2D02A 3EWKA 2V0WA 3UE6A 2V9AA 4L9GA 1P97A 4LRXC 1OJ5A 3BY9A 3H82A 3LIFA 2PR6A 1XFQA 2L4RA 3G6OA 5HZHA 3VE4A 1XJ4A 1T1AA 1T1CA 1T18A 4EXOA 5HWVA 2L0WA 5J3WA 3P7NA 2L1MA 4I39A 1WA9A 3E4QA 2D01A 5F6AA 5HWTA 3C8CA 3OLOA 5J4EA 3RTYA 1S67L 4B9OA 3T50A 4EW7A 4MN6A 5AVFA 4HH3A 2QJ5A 3IS2A 3CAXA 3FC7A 4HH2A 5HSQA 2ZOHA 3MQOA 5AVEA 4XT2B 3UMDA 3LI8A 1S66L 1TS7A 1T1BA 5DJUA 2JN7A 2WKQA 3NOTC 4H6JA 2PR5A 5DKKA 4JGQA 3EEHA 3MFXA 1TS8A 5I5LA 5DJTA 3LIEA 3UB8A 1V9ZA 2VV7A 1LSXA 2WKRA 2YKFA 3F1PB 4BBUA 4F3LB 4M4XA 3SW1A 3HJIA 1OTBA 3NJAA 4KUKA 2A24A 5DKLA 4HI4A 1OTAA 3C2WA 4HJ6A 3ZQ5A 2J80A 4BBVA 2EA9A 2OOLA 2PYRA 2ZOIA 1UWNX 1F98A 2PD7A 1N9NA 3BWLA 3MXQA 4LRYC 1N9LA 3BY8A 2Z6CA 4H6JB 2H28A 2QWSA 5HD5A 4GS9B 1GSVA 4E04A 4KUOA 1OTEA 5F68A 4F3LA 1LL8A 1MZUA 2M1CA 4MN5A 3F1PA 2INWA 4RQ9A 4I3JA 3NOUC 4GS9A 3KX0X 4NXGA 2PHYA 2QKPA 1X0OA 4HY8A 3MJQA 1S4SA 4R38A 4WL9A 4HP9A 1EW0A 4HP4A 5IS1A 1D7EA 3ULFA 2R78A 1F9IA 4R70A 1LSVA 3UB7A 1GSWA 3IBRA 1T19A 3UB9A 3H82B 1DRMA 3LIAA 2Z6DA 4EETB 3H7WA 1P0ZA 2BASA 2I9VA 4PKYG 3E4OA 1OTDA 1S1ZA 3GECA 5HDSA 2VLGA 2PD8A 1XJ6A 4EERA 4KQDA 3F1OB 5F5YA 1GSXA 1LSWA 4EEUA 5HDCA 4WN5A 1D06A 2PDRA 4YWZA 2A24B 4JGOA 2V1BA 4I38A 2V1AA 1OTIA 1KOUA 4GCZA 2VV6A 3LI9A 3H7WB 3MR0A 1UWPX 1Y28A 3B33A 1OT6A 4HOIA 4R3AA 5HDDA 1DP6A 4I3AA 4GHIB 2WKPA 1V9YA 4LLOB 1XFNA 4GW9A 5EFWA 3A0SA 5F69A 4XT2A 2GJ3A 1TS0A 1G28A 1VB6A 2P7JA 3F1OA 3LYXA 3D72A 1OT9A 3PHYA 4R6LA 4WF0A 5HD3A 5TBMA 2B02A 4DJ3A 3NOPC
chains in the Genus database with same CATH superfamily
4QHCA 1KGEA 3C38A 3IH8A 1N9BA 3SS4A 3OPHA 1G68A 4I3IA 3CG5A 5K5BA 3MQQA 1ZKJA 4Y15A 4KZ8A 4L9EA 5TBMB 3GMWA 4KQQA 3D3OA 3PBSA 2HV1A 1FCOA 3RXWA 4OVDA 3G32A 2WAEA 4WM9A 5FI6A 3UPPA 5AQAA 3MSHA 2CC1A 2Y79A 3O86A 1XFQA 4DMZA 5EVIB 1RCJA 1H3QA 5HPIA 5M19A 4H8RA 1FR6A 1NYMA 4KZ4A 1S66L 2HDUA 5L09A 5I5LA 1KE0A 1LSXA 3LY4A 5FQ9A 1CI9A 4M4XA 2QZ6A 5DKLA 4AFIA 1BUEA 2OOLA 4X1LA 3MZFA 4UEYA 3O88A 1HLUP 1K56D 5GL9A 3E98A 3GQZA 5HAPA 4B4ZA 2WZZA 4E3OA 4MCWA 4N9KA 3M2JA 3KO6A 4K0WA 5FASA 1IKGA 3ULFA 3CPTA 3IF6C 2OSUA 4DDSA 2I9VA 1BLHA 1ONGA 1NYYA 2ZQAA 5F5YA 1MWSA 3N8SA 4JGOA 1PZPA 1K0KA 4GB7A 3Q7VB 3PXPA 1EWZA 4NKPA 3T4JA 4ZBEA 3T1SA 5GLCA 1MXOA 2O9CA 5F1GA 1BYWA 3CITA 4S2LA 4HNBA 2OWHA 4DE0A 3VP0A 1MKMA 5IU1A 5E2GA 2Y59A 3VSKA 2IWDA 4N1HA 2EFXA 4KG2A 4EEPA 1J3WA 3BECA 3SOIA 4L9GA 3NIAA 2PR6A 4N1XA 3FPVA 3G6OA 4KZAA 1NJ4A 4X69A 5J3WA 1WA9A 3G31A 5HWTA 1S67L 5FEGA 1LHYA 1CI8A 3I7JA 5AVFA 2QJ5A 3NULA 3VSLA 2FFYA 3MQ0A 3A3JA 3IF6B 3UDIA 3HLBA 2W3FA 3HLDA 3NJAA 2PYRA 2PD7A 2W3EA 1K56A 4GS9B 3O87A 1MZUA 5F82A 2Y2IA 3O3VA 2E8JA 1F2KA 3ZNTA 4HP9A 1F9IA 2FH5A 3UB7A 5DTSA 3FYZA 4IBRA 4LV0A 2Y2NA 4FTXA 2W1TB 4L0LA 1G6OA 3ZFZA 2LB9A 4WZ5C 4R23A 3E2LA 5EVIC 3DTMA 1IFQA 2A3UA 5FQIA 4P6ZM 5C5KA 2GJ3A 2HZ5A 1MC0A 4DJ3A 3TOIA 1GHPA 5GLAA 2VEAA 2HDRA 3ZGAB 4GHIA 1SCWA 4I5SA 2XDMA 2QJ7A 2JHEA 3K3DA 3K3CA 2UV0E 5DFXA 3FV7A 2J8YA 1MWUA 2Y2JA 3IS2B 2B18A 3MBZA 4E6XA 3F1NB 4EQ1A 3JVVA 4MEZA 1ZG6A 3N6IA 4QY6A 2V0WA 2V9AA 4S2NC 1IEMA 5FI7A 1NRJA 3D4FA 4ESPA 5FAPA 2L0WA 2HP9A 3ITBA 5FL3A 4BMWA 4JXWA 3MFDA 3RTYA 1GA9A 2DMWA 5EECA 4ARZB 1VEUA 4JF5A 4WMCD 5DVAA 3HJIA 4LCLA 3C2WA 4O01A 1UWNX 2JCHA 4GKUA 3VFFA 3AGFA 3UDXA 2HP6A 3T4KA 1LL8A 5E2EA 4RQ9A 3C7VA 2Y2LA 3UO9A 4KZ6A 2H0YA 4BJPA 3NECA 3LIAA 1QMFA 4UAAA 5HDSA 4KQDA 4S2NA 1U60A 4P0MA 4R3AA 3QP6A 3S7OA 4JXGA 2MJ6A 4ZJ1A 1GA0A 3ZVTA 2WKHA 2B02A 1TDGA 1DP8A 1P9RA 3A0RA 4Q0JA 3VMAA 1XJ2A 2DCFA 3NDGA 3A0VA 4OONA 3WRTA 4K0XA 4U0XA 4Y0TA 5DTTA 1K57A 2Y55A 3FG8A 2RL3A 4CLCD 4DRTA 4Q0HA 1W63M 2V0UA 3BFFA 2EXBA 1VETB 5IHVA 1YSPA 3HLGA 3LIBA 1E3UA 3CZDA 5AJGA 5KZHA 1ESUA 2G7UA 2XEPA 5HZHA 1C3BA 2HP5A 3RXXA 4DKIA 2EWWA 3SH9A 1CEFA 2ZM0A 3CAXA 5AVEA 2XLNA 2GX5A 5LBRA 2Y2KA 1XGIA 2XF3A 2PU4A 4S2MA 2Z2MB 2A24A 1VM1A 1JTDA 1K6SA 1OTAA 4OLGA 4LRYC 3BY8A 3U2AA 2QWSA 5HD5A 3UE0A 4NEED 2HPBA 3A3FA 1K25A 2C6WB 4GS9A 4NXGA 3BYDA 2G2WA 5FQKA 4E3JA 1XPBA 4KQRA 1N4OA 2G2UA 1JWZA 4PMAA 3GVBA 3BLMA 1Z6FA 3W2ZA 3LEZA 4OQGA 4U0TA 3NBLA 4EWFA 1D06A 1FSWA 2PDRA 3N7WA 2WUQA 1Y28A 4HESA 2AVXA 5EE8A 4GW9A 4YFMA 3A3EA 2P7JA 1GHIA 1Y4OA 1W7FA 4DDYA 4X55A 3IF6A 1ODVA 4CJNA 5G4ZA 4EBLA 1E25A 2XA7S 3UDFA 2NUPC 3HUOA 4BENA 5EV0A 1ES4A 4JGPA 4EUVA 1ZC2A 2OWJA 3M6BA 2ZBBA 1JNUA 4EBPA 5DF8A 4KZ3A 4OP5A 3UE6A 1L3LA 4Y0UA 1ZTUA 3OCNA 3BW6A 4ZRRA 4EXOA 3K2NA 3WS2A 5G18A 1EROA 1SZVA 3QP8A 3R7WA 3OLOA 4WZ4A 3FWLA 1H8MA 1JTGA 1VHMA 3MQOA 1K54C 2OAP1 5EFWA 4N92A 1EI5A 5FDHA 1XP4A 2VV7A 4KZ7A 1KGFA 4LV1A 4YNRA 3ZDJA 3C7UA 3ZQ5A 1K38A 3BWLA 3WRZA 5KMWA 4E04A 3G2ZA 3KX0X 4WELA 2X01A 1L0EA 4HP4A 1TDLA 4R70A 2H5SA 2Y2GA 4EEUA 4R1GA 4EV4A 1LI0A 2ZM2A 3KYEA 1BULA 3WS5A 1BSGA 4HOIA 4PM8A 1J9MA 1PW8A 2P08A 1DJCA 3ZVWA 4II7A 4WF0A 5L8MA 4EU0A 1ALQA 4OPQA 1CK3A 4HQAA 3NDEA 1S0WA 2GZAA 3MZDA 4XXRA 4LENA 2VK3A 5G4YA 1XJ3A 4S2IA 2W0NA 4WUJA 3UMEA 4R3BA 3S7NA 1K54A 3CI6A 4L9FA 5GHZA 5HAQA 4P87A 4RVAA 2ZC4B 4ZTKA 2KOIA 1H0MA 4WLAA 3TE8A 3ZG8B 4G3KA 2JKTM 3GRJA 2L4RA 4A5RA 3OOVA 3QNCA 1BTLA 3M2KA 4XUXA 1JVJA 2ZOHA 2Q9MA 2PR5A 4OOMA 3MFXA 5EPHA 3SS3A 1L0DA 2WKIA 3F1PB 3BLSA 5FI2A 3CUEC 1FCMA 2V8FA 5KSCA 1IYPA 4OKPA 4CPKA 1RGZA 4B93A 3WS1A 1O07A 3BJNA 5JYPA 2ZL1A 4X25A 3JVUA 2H10A 1PYYA 1LSVA 3IBRA 3C30A 4UQIM 1K6RA 1F5MA 3IX8A 1YM1A 1K55A 1S1ZA 4R0QA 3F1OB 2VX8A 3S4XA 1CQAA 2VV6A 1UWPX 1OT6A 5HDDA 5M18A 3NCKA 3ZG0A 4ME4A 1XFNA 3A0SA 2WGWB 3PHYA 5HAIA 5CTMA 3IX3A 1BZAA 1I2WA 1JWVA 1VQQA 3LICA 2GDNA 4JF4A 2ZLYA 4NXFA 4MBFA 2WGWA 3MF0A 2WAFA 5FATA 3OBFA 5EOEA 1XA1A 4S2PA 2EX2A 4BLMA 1HD8A 1UGUA 5E43A 1KDWA 4DN0A 4O7DA 2K31A 4HBTA 3BM6A 4IJGA 5CHUA 5FSRA 4GZBA 2D02A 1BLSA 4OOYA 1OJ5A 3LIFA 1AXBA 1T18A 4ZAMA 3MS6A 4R4SA 2L1MA 3UY6A 3BFEA 2ZM8A 4HH3A 1I5QA 1OMEA 3T1QB 1LL9A 1LI9A 4NK3A 2J3TC 1ES2A 4EBNA 4EQIA 1YLPA 2EX8A 4F3LB 3ITAA 4B88A 2Y4AA 4HI4A 3IXBA 2ZOIA 2J9PA 2Z6CA 4H6JB 4YOFA 4F3LA 3T4LA 2XROA 4QU3A 4G3WA 3TRCA 2ZQCA 5IS1A 3T4QA 2Y91A 3E4OA 4DXBA 1GSXA 1LSWA 5D3OA 4QPRA 1MKIA 4WN5A 3FZCA 1YLYA 2V1BA 3PBTA 1OTIA 3MR0A 2O9BA 1TS0A 3UB8A 3JYIA 3WWXA 3FKWA 1SDEA 4F94A 5AQBA 5DF9A 1W8QA 1Y54A 5HWWA 1XKZA 4EESA 3T4TA 4Z9QA 4Y2FA 3PBQA 5CTNA 1HZOA 1PWCA 1L0GA 1NZOA 1NWZA 1YLJA 3EQVA 3BFGA 4FH4A 3WS0A 3HVFA 3CLOA 3KYQA 4Y5FA 2WK0A 3ZG7B 3RFBA 3CWFA 1KVLA 1YLWA 4E3LA 2BTFP 4PHTA 2ZD8A 2JKFA 4PM9A 3BFCA 3DAVA 1FILA 2I72A 5J4EA 3T50A 4RYEA 1A0KA 4GNUA 2PBYA 4GJ4A 4CLCE 3UMDA 4X68A 2JN7A 4UA6A 2WKRA 4GD8A 1OTBA 4PM7A 3U4LP 4FD8A 4HJ6A 3N8RA 2H28A 5BOHA 1KE3A 2W3GA 4KUOA 4MN5A 2JKRM 4EUZA 1D7EA 1KE4A 4P6BA 1KGGA 4YINA 2Y2PA 1WE4A 1NZUA 2Z6DA 1Q2QA 1P0ZA 1WYCA 2VLGA 1PI5A 1XJ6A 2JE5A 3IF5A 4YWZA 3LGOA 3DWKA 3W4QA 4I38A 1KOUA 3LI9A 1QMEA 3LY3A 4MN7A 3VP1A 5CGXA 3LYXA 3NOPC 4RA7A 1PIOA 4DJ2A 3R4KA 4UQIS 3E4PA 4P6ZS 1YKDA 3G34A 4QB8A 4U3TA 4QY5A 2W27A 2KX6A 3V67A 4BBTA 2OAQ1 4Y7PA 3HREA 3V5MA 3LEQA 5L2FA 4JBFA 1OJGA 3ZG5A 1NLYA 1CF0A 1SHVA 4KZBA 1LLBA 4Y13A 2V8CA 4BD0A 4MN6A 5MC7A 2HGVA 2XRNA 4MLLA 2WKQA 4BD1A 3GTCA 1YAXA 2Q0OA 3T12B 4ID4A 3ZHHA 5F1FA 5AQ9A 1P9WA 1LL5A 3MMHA 4BBVA 4WZ5A 4X56A 1N9NA 4BL3A 3MXSA 3WS4A 3HLWA 4IUKA 4C6YA 2XK1A 3Q82A 4NG2A 1MWRA 4G3VA 1S4SA 1Q2PA 1NXYA 3H82B 3PBOA 1YLZA 3PAEA 4PKYG 5CERA 3UE3A 1PNEA 1OTDA 2LB5A 1VETA 3VV4A 3HLFA 3KSGA 1ZG4A 4M3KA 4BQMA 4IUHA 3C4PA 2OV5A 2XSSA 4DF6A 3R7WB 4RX3A 3OPPA 2WZXA 5F69A 5TBMA 2A2LA 3IBJA 1NLZA 3HJKA 3LIDA 2BG1A 2KDKA 4PPRA 2PYPA 3P01A 4Y3IA 3E2KA 4HHDA 3B42A 1IELA 1I2SA 5TGFA 4GD6A 1ACFA 3VP2A 1DP9A 2Y2OA 2PU2A 3A3DA 1SKOB 2VV8A 3S22A 4IEDA 5EVIA 1W8YA 4S2JA 4JXSA 1JWPA 1P97A 3KSHA 3KSFA 3BY9A 5A91A 4I39A 2XGNA 5IT5A 3RJUA 4B9OA 1BT5A 2HF6A 3B47A 5HSQA 2WADA 2R9XA 5DJTA 1IYQA 3G2YA 3GR2A 5A90A 3LO7A 2WKEA 1N9LA 2PAVP 5EUAA 5HW3A 1GSVA 1SKFA 2WGVA 3M6HA 3OPRA 5J8XA 3E0YA 5GLDA 2PRFA 5EM1A 3SZTA 4E3KA 2P9VA 3IT9A 3BEBA 3UPNA 1G5UA 3LFVA 4EETB 3H7WA 1FOFA 4GLQA 2XD1A 3MXRA 5CRFA 5CECA 2ZMAA 5HL1A 3LR0A 2V1AA 4GCZA 3H7WB 3V3RA 4FCFA 3DTIA 4JF6A 2WKPA 1PZOA 3FPWA 1OT9A 4XUZA 5KSHA 3HUMA 3JPUA 3DBAA 1GCEA 3L9KA 3VE3A 5EVEA 3EQUA 1ES5A 2K7SA 4MNRA 1CEGA 2W1RA 3CUEA 5E2FA 1SKOA 4E3NA 4KG5A 1TVFA 2VZWA 1S1YA 3ISGA 4JPMA 3GDIA 4LFUA 3T1RA 1N9OA 3LUQA 3LR5A 2XA7M 4GDBA 2O9AA 1XGJA 1KVMA 3IX4A 2Q9NA 4LRXC 2W3HA 2XD5A 5HX9A 2ZJ9A 1T1AA 1T1CA 3E4QA 4ZJ2A 4PM6A 2ZQDA 4DE2A 1GHMA 1CJFA 3T4SA 3LI8A 1BLCA 5DJUA 5TFQA 5L07A 4BBUA 3SW1A 2XFTA 3UB6A 5J7EA 4LCMA 2R9WA 1TEMA 3C4OA 4DXCA 1OTEA 4I3JA 4Y0OA 2XH9A 2J3WA 1DJBA 3LR4A 3NOUC 1FIKA 5FQQA 1BLPA 1ES3A 2P9VB 1EW0A 1PRQA 1G6AA 3UN7A 1T19A 4Q8IA 4QJGA 3T4OA 3UPOA 3GECA 2PD8A 5HDCA 3G35A 2Y2MA 3W4OA 2B95A 2K2NA 1XX2A 3ZCZA 4KZ5A 4ZJ3A 2C5WB 4OPYA 2H0TA 4LLOB 3IHBA 2HJEA 3D72A 4MBKA 3MKFA 2FZ0A 1OPXA 5HL6A 3VOLA 4KZ9A 1M6KA 1H8ZA 1S4RA 1AWIA 1K55C 4X1MA 3BRMA 1LT0A 3OPLA 3LR3A 2CMNA 1RGYA 3DTKA 4NXEA 3P98A 5CEBA 5TJJA 5EVID 2IWCA 1YT4A 1SDNA 4PKYA 4OOLA 3H82A 4GN2A 5A93A 3GSGA 2IWBA 2ZQ9A 3N8LA 4FH2A 1IYOA 3BQAA 3FC7A 4HH2A 4XT2B 3S7QA 2W3DA 1TS7A 4MDZA 2HJ9C 4HBUA 4JGQA 3EEHA 1TS8A 5TR7A 2W1TA 4WYYA 5E2HA 1IYSA 5HFOA 4FSFA 1FQGA 4Z1WA 5F68A 1YSQA 1ONHA 4D2OA 2INWA 2EX9A 4S2OA 3A3IA 1X0OA 4HY8A 3HBRA 3IQAA 2R78A 4WMCA 4FOFA 4OPRA 1H5XA 2BASA 2OLUA 3EEAA 3PAGA 1MY8A 5CEDA 3QP5A 3DTEA 1H8YA 1ESIA 3B33A 1V9YA 1DY6A 3HUNA 2ZQ7A 5HD3A 2ZL1B 2EXAA 3SH8A 3OC2A 4JGRA 3ZYTA 3NHQA 3P09A 2VGJA 4KQOA 3IWOA 1VEUB 3H9WA 4LGWA 5EM0A 3V50A 1FCNA 3KYZA 4DE3A 1TF1A 3TJZC 4QWOA 2FFFB 3V3SA 4CLCA 4NXBA 4MBHA 3QP4A 3IXGA 2JBFA 4X6TA 3N4IA 3EWKA 4IVKA 2UWXA 4LV2A 4QD4A 1YMXA 1K4FA 3VFHA 1W5DA 2P04A 2X02A 2Z2LB 3IXDA 4UHUA 3Q7VA 1PI4A 3C8CA 5FAOA 1XA7A 3TSGA 4OP8A 4OQIA 4JKTA 5DKKA 5A92A 2YKFA 1E3UD 5I94A 2HDSA 5DF7A 1HTZA 3MXQA 2VKSA 1TD5A 2M7VA 3VOYA 2M1CA 5FA7A 5GHYA 3F1PA 4C3QA 1FSYA 2QKPA 5EOOA 3MJQA 4WL9A 3Q81A 3EOIA 2VJWA 2ZQ8A 3EGDC 2VGKA 2X71A 4O0PA 4B4XA 1PWGA 2A24B 3OCLA 1M40A 4UA7A 2EX6A 4WEKA 1PWDA 4CLCC 2OLVA 1IKIA 5FDSA 1MBLA 4XT2A 3F1OA 1VB6A 1ERMA 5GLBA 4GOGA 2KLIA 2GNXA 4JLFA 3Q1FA 2DRWA 3HLEA 3OZHA 4NETA 2NUTC 3Q07A 4KENB 3EGXC 4LRZE 5M1AA 2V1ZA 4IHQA 1YPRA 3VOZA 3QNBA 4O8GA 4CQHA 3W8KA 5CHMA 2ZC7A 5CHJA 4HIAA 5KIZA 3PBRA 4D60A 1MPLA 4S2KA 1ERQA 5CGSA 2P74A 3ZNYA 2VGLM 5HWVA 3P7NA 2D01A 4ETZA 1K4EA 4RX2A 2QYBA 3IS2A 4GDNA 5DFYA 1YQSA 2ZC5B 2JC7A 3NOTC 1YMSA 2IA2A 2ZMVA 3LIEA 3IHAA 1V9ZA 2J7VA 2M7UA 1O7EA 4KUKA 3LCEA 2QMIA 3NI9A 2J80A 4WEJA 3AGDA 3QHYA 1F98A 5HARA 2Y2HA 3SS5A 4FUWA 2ZMFA 2PBDP 5FQMA 1K57C 1XXMA 4R38A 3AGEA 4PM5A 2PT7A 2DNSA 3HLCA 3UB9A 4ARZA 3G30A 1DJAA 2HDQA 4LV3A 1ZHHB 4C75A 4Q0IA 2EFUA 4CLCB 2O99A 1PFLA 4I3AA 4IBXA 2XR0A 3NC8A 4E6WA 2JKGA 3NY4A 3DW0A 4IVIA 4E3MA 4X53A 5A8BA 3SH7A 2QHKA 4HJ4A 4OPZA 3CPTB 3QP1A 3G4PA 3C5AA 3IXHA 4R3JA 1W63Q 4HJ3A 3GV9A 3CHWP 2J3TD 2B5RA 2EWVA 4BL2A 1XJ4A 5FEFA 2ACGA 1RP5A 2O0YA 3HCYA 3VP3A 1MWTA 5AQ7A 5CGWA 3TW8A 5DTKA 3CMZA 1HVBA 5CXWA 2ZC3B 2EA9A 3BFDA 4HEFA 2PHYA 5EVLA 4R4RA 5L10A 4N9LA 5GHXA 5HPFA 1GSWA 4MMNA 1PW1A 3UNWA 5F83A 5FQJA 1IOUA 3S1YA 4WBGA 2RCXA 4K91A 4BWIA 3S7PA 1DP6A 3KSIA 4GHIB 2Y2QA 4E3IA 1S6RA 5CX7A 2BLSA 3MKEA 1E4DA 2JKTI 3PTEA 2E8IA 1KDSA 2WGIA 2J9OA 2QPNA 3IWQA 3PR6A 4Y17A 3F1NA 2JKRI 3VP4A 1TS6A 5U47A 4LPZA 2ZC6B 3IH9A 2YKHA 3ZG9B 3ICYA 3PYPA 3UE1A 3RH8B 1NRFA 4ZDXA 4K08A 5JYOA 3O5YA 3T1XA 1NY0A 1FR1A 3VE4A 4JXVA 1L2SA 5F6AA 1L0FA 2WYXA 5FAQA 4UA9A 3DWZA 3PBNA 1T1BA 2Y8HA 4H6JA 4PAUA 1W79A 4OH0A 4OQHA 1Z09A 1WYBA 3L7HA 3W4PA 4P85A 3UB5P 4KG6A 2VGLS 2XQZA 3BQ8A 2XFSA 1DRMA 1YLTA 1D1JA 3IWIA 4DE1A 2V2FF 3D9YA 4ETXA 3FKVA 4OQ0A 4EERA 3MZEA 1STZA 2VA0A 3TG9A 3HL9A 3V39A 3B3XA 4OLDA 3Q7ZA 2V20A 1G28A 4R6LA 3QP2A 4EW7A 3CJMA 2A49A
chains in the Genus database with same CATH topology
4DJ2A 3R4KA 4UQIS 3E4PA 4P6ZS 1YKDA 3OC2A 4JGRA 3ZYTA 1ODVA 5G4ZA 3C38A 3NHQA 4KQOA 2W27A 2KX6A 3V67A 4BBTA 4I3IA 2XA7S 2OAQ1 5K5BA 3H9WA 3MQQA 2NUPC 3KYZA 1TF1A 3TJZC 4CLCA 4L9EA 4NXBA 4JGPA 5TBMB 4EUVA 3D3OA 1OJGA 3PBSA 2HV1A 2OWJA 2ZBBA 1JNUA 1NLYA 3EWKA 3UE6A 1ZTUA 3OCNA 2Y79A 3BW6A 1XFQA 4DMZA 4ZRRA 4EXOA 3K2NA 2P04A 1H3QA 3R7WA 3C8CA 3OLOA 5HPIA 4MN6A 1H8MA 1VHMA 3MQOA 2OAP1 1S66L 2HGVA 2XRNA 5EFWA 5MC7A 2WKQA 5DKKA 5I5LA 1YAXA 2VV7A 1LSXA 2YKFA 4YNRA 4M4XA 5DKLA 1P9WA 4AFIA 3ZQ5A 3MMHA 4BBVA 3MXQA 2OOLA 1N9NA 2VKSA 3BWLA 4UEYA 1TD5A 3E98A 4E04A 2M7VA 4IUKA 2M1CA 3F1PA 4MCWA 4G3VA 3KX0X 2QKPA 4WELA 3KO6A 3MJQA 1S4SA 4WL9A 4HP4A 3ULFA 3EOIA 4R70A 2VJWA 3EGDC 3H82B 3PBOA 2I9VA 4PKYG 3UE3A 4O0PA 1OTDA 2LB5A 5F5YA 4EEUA 3VV4A 3KSGA 4IUHA 2A24B 2XSSA 3OCLA 4JGOA 4WEKA 3R7WB 4HOIA 4CLCC 3PXPA 4NKPA 2P08A 5F69A 4XT2A 3F1OA 1VB6A 3T4JA 5TBMA 2A2LA 4II7A 4WF0A 5L8MA 4EU0A 3IBJA 2KLIA 1NLZA 2O9CA 3HJKA 3LIDA 4HQAA 2GNXA 2GZAA 2KDKA 1BYWA 2PYPA 3CITA 3P01A 4Y3IA 4HNBA 4HHDA 2OWHA 3B42A 5G4YA 2NUTC 1MKMA 1XJ3A 3EGXC 2W0NA 4WUJA 3UMEA 4LRZE 5IU1A 3S7NA 4IHQA 1DP9A 3CI6A 4L9FA 2VV8A 4O8GA 4CQHA 4EEPA 2KOIA 4WLAA 3TE8A 4HIAA 4G3KA 5KIZA 3PBRA 4L9GA 2JKTM 1P97A 3KSHA 3KSFA 3BY9A 2PR6A 3FPVA 2L4RA 3G6OA 2VGLM 3OOVA 5HWVA 5J3WA 3P7NA 4I39A 1WA9A 5IT5A 2D01A 5HWTA 1S67L 4B9OA 4ETZA 5AVFA 2QJ5A 2QYBA 2HF6A 3B47A 3IS2A 5HSQA 5DFYA 2ZOHA 3MQ0A 3NOTC 2PR5A 2ZMVA 2IA2A 4OOMA 3MFXA 5DJTA 3LIEA 1V9ZA 2M7UA 3F1PB 2W3FA 3NJAA 4KUKA 2J80A 4WEJA 2PYRA 3CUEC 1F98A 2PD7A 1N9LA 2W3EA 4B93A 4GS9B 1GSVA 2ZMFA 1MZUA 3BJNA 3E0YA 4R38A 4HP9A 3JVUA 2PT7A 1F9IA 1LSVA 2FH5A 3UB7A 3IBRA 3UB9A 4ARZA 3C30A 4UQIM 1F5MA 3LFVA 4EETB 3H7WA 2W1TB 1S1ZA 1ZHHB 4GLQA 4Q0IA 3F1OB 4L0LA 1G6OA 3LR0A 2VX8A 2LB9A 2V1AA 4GCZA 4CLCB 2VV6A 2O99A 3H7WB 1UWPX 1OT6A 5HDDA 4I3AA 2WKPA 4ME4A 1IFQA 1XFNA 4P6ZM 3A0SA 5C5KA 3FPWA 2GJ3A 1MC0A 1OT9A 3PHYA 4DJ3A 5KSHA 2VEAA 4GHIA 3LICA 4I5SA 3DBAA 3VE3A 3EQUA 2QJ7A 2JHEA 3K3DA 3K3CA 2K7SA 4NXFA 5DFXA 3MF0A 2W1RA 3CUEA 5A8BA 3IS2B 2QHKA 3OBFA 2B18A 2VZWA 1S1YA 4HJ4A 3GDIA 1N9OA 3F1NB 3LUQA 1UGUA 3LR5A 3JVVA 4EQ1A 1W63Q 2XA7M 2O9AA 4DN0A 2K31A 4HJ3A 4IJGA 2D02A 2J3TD 2EWVA 2V0WA 2V9AA 4LRXC 2W3HA 1NRJA 1OJ5A 3LIFA 1XJ4A 1T1AA 1T1CA 1T18A 2L0WA 2L1MA 5FL3A 3E4QA 4BMWA 3RTYA 2O0YA 3HCYA 2DMWA 4HH3A 4ARZB 3T4SA 3LI8A 5DJUA 3TW8A 2J3TC 4BBUA 4F3LB 3SW1A 3HJIA 4HI4A 3C2WA 2EA9A 2ZOIA 3UB6A 4O01A 1UWNX 5J7EA 2Z6CA 4H6JB 4YOFA 3T4KA 1OTEA 4F3LA 1LL8A 3T4LA 4RQ9A 2XROA 4I3JA 3NOUC 2J3WA 3LR4A 4G3WA 2PHYA 3TRCA 1EW0A 5IS1A 5HPFA 3T4QA 4BJPA 1GSWA 1T19A 4MMNA 3LIAA 3T4OA 3E4OA 3GECA 5HDSA 2PD8A 4KQDA 1GSXA 1LSWA 4QPRA 5HDCA 1IOUA 4WN5A 2V1BA 3PBTA 1OTIA 2K2NA 4BWIA 3MR0A 3S7PA 4R3AA 1DP6A 3KSIA 4GHIB 4LLOB 3S7OA 2O9BA 2MJ6A 1TS0A 3UB8A 2HJEA 5CX7A 3D72A 2B02A 2FZ0A 1OPXA 5HL6A 2JKTI 1DP8A 1P9RA 3A0RA 4Q0JA 3VOLA 5DF9A 5HWWA 1XJ2A 4EESA 3A0VA 3T4TA 1S4RA 3PR6A 3F1NA 4Y2FA 2JKRI 3PBQA 1TS6A 1LT0A 4LPZA 2YKHA 3LR3A 1NWZA 2CMNA 3ICYA 3EQVA 3PYPA 4NXEA 3FG8A 3CLOA 5TJJA 3RH8B 4CLCD 3KYQA 4Q0HA 4Y5FA 1W63M 2V0UA 3RFBA 4K08A 1YSPA 3O5YA 3CWFA 4PKYA 3LIBA 4OOLA 5AJGA 4PHTA 3H82A 2G7UA 5HZHA 3VE4A 2EWWA 5F6AA 5J4EA 3T50A 3BQAA 3CAXA 3FC7A 3PBNA 4HH2A 5AVEA 4XT2B 4GJ4A 3S7QA 2W3DA 3UMDA 4CLCE 1TS7A 1T1BA 2GX5A 2HJ9C 2JN7A 2Y8HA 4H6JA 4MDZA 5LBRA 4JGQA 3EEHA 4PAUA 1TS8A 2W1TA 2WKRA 1OTBA 2A24A 1OTAA 4HJ6A 4LRYC 3BY8A 4FSFA 3U2AA 2H28A 2QWSA 5HD5A 4NEED 4Z1WA 2W3GA 4KUOA 5F68A 2VGLS 1YSQA 4MN5A 2INWA 2JKRM 4GS9A 4NXGA 1X0OA 4HY8A 3BQ8A 1D7EA 2R78A 4FOFA 1DRMA 2Z6DA 1P0ZA 2BASA 3W2ZA 4ETXA 2VLGA 1XJ6A 3EEAA 4EERA 1D06A 1STZA 2PDRA 2VA0A 4YWZA 4I38A 1KOUA 3LI9A 3B33A 1Y28A 4MN7A 1V9YA 4GW9A 3LYXA 1G28A 2P7JA 4R6LA 5HD3A 4EW7A 3NOPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJK A;  1DP8 A;  3LID A;  2VEA A;  3A0R A;  3E4P A;  4HQA A;  3VOL A;  4DJ2 A;  5HWW A;  1XJ2 A;  4GHI A;  3LIC A;  2KDK A;  1BYW A;  2PYP A;  4I5S A;  3A0V A;  4JGR A;  3VE3 A;  4EES A;  1ODV A;  1S4R A;  2QJ7 A;  4HNB A;  2JHE A;  3K3D A;  3K3C A;  4HHD A;  2K7S A;  2OWH A;  4NXF A;  3NHQ A;  3F1N A;  5G4Z A;  5G4Y A;  2W27 A;  1TS6 A;  2KX6 A;  5A8B A;  1XJ3 A;  1LT0 A;  3IS2 B;  4LPZ A;  4BBT A;  4I3I A;  2W0N A;  4WUJ A;  2QHK A;  2YKH A;  1NWZ A;  4LRZ E;  3UME A;  3H9W A;  2CMN A;  3MQQ A;  1S1Y A;  4HJ4 A;  5IU1 A;  3ICY A;  1DP9 A;  3PYP A;  4NXE A;  3GDI A;  3FG8 A;  1N9O A;  2VV8 A;  3CLO A;  4L9F A;  3F1N B;  3RH8 B;  3LUQ A;  1UGU A;  4L9E A;  4EQ1 A;  2V0U A;  4JGP A;  4NXB A;  5TBM B;  4K08 A;  4EEP A;  1OJG A;  2HV1 A;  2OWJ A;  3UB6 A;  2ZBB A;  4HJ3 A;  1JNU A;  4WLA A;  5J7E A;  3CWF A;  4PKY A;  3LIB A;  4HIA A;  5KIZ A;  2D02 A;  3EWK A;  2V0W A;  3UE6 A;  2V9A A;  4L9G A;  1P97 A;  4LRX C;  1OJ5 A;  3BY9 A;  3H82 A;  3LIF A;  2PR6 A;  1XFQ A;  2L4R A;  3G6O A;  5HZH A;  3VE4 A;  1XJ4 A;  1T1A A;  1T1C A;  1T18 A;  4EXO A;  5HWV A;  2L0W A;  5J3W A;  3P7N A;  2L1M A;  4I39 A;  1WA9 A;  3E4Q A;  2D01 A;  5F6A A;  5HWT A;  3C8C A;  3OLO A;  5J4E A;  3RTY A;  1S67 L;  4B9O A;  3T50 A;  4EW7 A;  4MN6 A;  5AVF A;  4HH3 A;  2QJ5 A;  3IS2 A;  3CAX A;  3FC7 A;  4HH2 A;  5HSQ A;  2ZOH A;  3MQO A;  5AVE A;  4XT2 B;  3UMD A;  3LI8 A;  1S66 L;  1TS7 A;  1T1B A;  5DJU A;  2JN7 A;  2WKQ A;  3NOT C;  4H6J A;  2PR5 A;  5DKK A;  4JGQ A;  3EEH A;  3MFX A;  1TS8 A;  5I5L A;  5DJT A;  3LIE A;  3UB8 A;  1V9Z A;  2VV7 A;  1LSX A;  2WKR A;  2YKF A;  3F1P B;  4BBU A;  4F3L B;  4M4X A;  3SW1 A;  3HJI A;  1OTB A;  3NJA A;  4KUK A;  2A24 A;  5DKL A;  4HI4 A;  1OTA A;  3C2W A;  4HJ6 A;  3ZQ5 A;  2J80 A;  4BBV A;  2EA9 A;  2OOL A;  2PYR A;  2ZOI A;  1UWN X;  1F98 A;  2PD7 A;  1N9N A;  3BWL A;  3MXQ A;  4LRY C;  1N9L A;  3BY8 A;  2Z6C A;  4H6J B;  2H28 A;  2QWS A;  5HD5 A;  4GS9 B;  1GSV A;  4E04 A;  4KUO A;  1OTE A;  5F68 A;  4F3L A;  1LL8 A;  1MZU A;  2M1C A;  4MN5 A;  3F1P A;  2INW A;  4RQ9 A;  4I3J A;  3NOU C;  4GS9 A;  3KX0 X;  4NXG A;  2PHY A;  2QKP A;  1X0O A;  4HY8 A;  3MJQ A;  1S4S A;  4R38 A;  4WL9 A;  4HP9 A;  1EW0 A;  4HP4 A;  5IS1 A;  1D7E A;  3ULF A;  2R78 A;  1F9I A;  4R70 A;  1LSV A;  3UB7 A;  1GSW A;  3IBR A;  1T19 A;  3UB9 A;  3H82 B;  1DRM A;  3LIA A;  2Z6D A;  4EET B;  3H7W A;  1P0Z A;  2BAS A;  2I9V A;  4PKY G;  3E4O A;  1OTD A;  1S1Z A;  3GEC A;  5HDS A;  2VLG A;  2PD8 A;  1XJ6 A;  4EER A;  4KQD A;  3F1O B;  5F5Y A;  1GSX A;  1LSW A;  4EEU A;  5HDC A;  4WN5 A;  1D06 A;  2PDR A;  4YWZ A;  2A24 B;  4JGO A;  2V1B A;  4I38 A;  2V1A A;  1OTI A;  1KOU A;  4GCZ A;  2VV6 A;  3LI9 A;  3H7W B;  3MR0 A;  1UWP X;  1Y28 A;  3B33 A;  1OT6 A;  4HOI A;  4R3A A;  5HDD A;  1DP6 A;  4I3A A;  4GHI B;  2WKP A;  1V9Y A;  4LLO B;  1XFN A;  4GW9 A;  5EFW A;  3A0S A;  5F69 A;  4XT2 A;  2GJ3 A;  1TS0 A;  1G28 A;  1VB6 A;  2P7J A;  3F1O A;  3LYX A;  3D72 A;  1OT9 A;  3PHY A;  4R6L A;  4WF0 A;  5HD3 A;  5TBM A;  2B02 A;  4DJ3 A;  3NOP C; 
#chains in the Genus database with same CATH topology
 4QHC A;  1KGE A;  3C38 A;  3IH8 A;  1N9B A;  3SS4 A;  3OPH A;  1G68 A;  4I3I A;  3CG5 A;  5K5B A;  3MQQ A;  1ZKJ A;  4Y15 A;  4KZ8 A;  4L9E A;  5TBM B;  3GMW A;  4KQQ A;  3D3O A;  3PBS A;  2HV1 A;  1FCO A;  3RXW A;  4OVD A;  3G32 A;  2WAE A;  4WM9 A;  5FI6 A;  3UPP A;  5AQA A;  3MSH A;  2CC1 A;  2Y79 A;  3O86 A;  1XFQ A;  4DMZ A;  5EVI B;  1RCJ A;  1H3Q A;  5HPI A;  5M19 A;  4H8R A;  1FR6 A;  1NYM A;  4KZ4 A;  1S66 L;  2HDU A;  5L09 A;  5I5L A;  1KE0 A;  1LSX A;  3LY4 A;  5FQ9 A;  1CI9 A;  4M4X A;  2QZ6 A;  5DKL A;  4AFI A;  1BUE A;  2OOL A;  4X1L A;  3MZF A;  4UEY A;  3O88 A;  1HLU P;  1K56 D;  5GL9 A;  3E98 A;  3GQZ A;  5HAP A;  4B4Z A;  2WZZ A;  4E3O A;  4MCW A;  4N9K A;  3M2J A;  3KO6 A;  4K0W A;  5FAS A;  1IKG A;  3ULF A;  3CPT A;  3IF6 C;  2OSU A;  4DDS A;  2I9V A;  1BLH A;  1ONG A;  1NYY A;  2ZQA A;  5F5Y A;  1MWS A;  3N8S A;  4JGO A;  1PZP A;  1K0K A;  4GB7 A;  3Q7V B;  3PXP A;  1EWZ A;  4NKP A;  3T4J A;  4ZBE A;  3T1S A;  5GLC A;  1MXO A;  2O9C A;  5F1G A;  1BYW A;  3CIT A;  4S2L A;  4HNB A;  2OWH A;  4DE0 A;  3VP0 A;  1MKM A;  5IU1 A;  5E2G A;  2Y59 A;  3VSK A;  2IWD A;  4N1H A;  2EFX A;  4KG2 A;  4EEP A;  1J3W A;  3BEC A;  3SOI A;  4L9G A;  3NIA A;  2PR6 A;  4N1X A;  3FPV A;  3G6O A;  4KZA A;  1NJ4 A;  4X69 A;  5J3W A;  1WA9 A;  3G31 A;  5HWT A;  1S67 L;  5FEG A;  1LHY A;  1CI8 A;  3I7J A;  5AVF A;  2QJ5 A;  3NUL A;  3VSL A;  2FFY A;  3MQ0 A;  3A3J A;  3IF6 B;  3UDI A;  3HLB A;  2W3F A;  3HLD A;  3NJA A;  2PYR A;  2PD7 A;  2W3E A;  1K56 A;  4GS9 B;  3O87 A;  1MZU A;  5F82 A;  2Y2I A;  3O3V A;  2E8J A;  1F2K A;  3ZNT A;  4HP9 A;  1F9I A;  2FH5 A;  3UB7 A;  5DTS A;  3FYZ A;  4IBR A;  4LV0 A;  2Y2N A;  4FTX A;  2W1T B;  4L0L A;  1G6O A;  3ZFZ A;  2LB9 A;  4WZ5 C;  4R23 A;  3E2L A;  5EVI C;  3DTM A;  1IFQ A;  2A3U A;  5FQI A;  4P6Z M;  5C5K A;  2GJ3 A;  2HZ5 A;  1MC0 A;  4DJ3 A;  3TOI A;  1GHP A;  5GLA A;  2VEA A;  2HDR A;  3ZGA B;  4GHI A;  1SCW A;  4I5S A;  2XDM A;  2QJ7 A;  2JHE A;  3K3D A;  3K3C A;  2UV0 E;  5DFX A;  3FV7 A;  2J8Y A;  1MWU A;  2Y2J A;  3IS2 B;  2B18 A;  3MBZ A;  4E6X A;  3F1N B;  4EQ1 A;  3JVV A;  4MEZ A;  1ZG6 A;  3N6I A;  4QY6 A;  2V0W A;  2V9A A;  4S2N C;  1IEM A;  5FI7 A;  1NRJ A;  3D4F A;  4ESP A;  5FAP A;  2L0W A;  2HP9 A;  3ITB A;  5FL3 A;  4BMW A;  4JXW A;  3MFD A;  3RTY A;  1GA9 A;  2DMW A;  5EEC A;  4ARZ B;  1VEU A;  4JF5 A;  4WMC D;  5DVA A;  3HJI A;  4LCL A;  3C2W A;  4O01 A;  1UWN X;  2JCH A;  4GKU A;  3VFF A;  3AGF A;  3UDX A;  2HP6 A;  3T4K A;  1LL8 A;  5E2E A;  4RQ9 A;  3C7V A;  2Y2L A;  3UO9 A;  4KZ6 A;  2H0Y A;  4BJP A;  3NEC A;  3LIA A;  1QMF A;  4UAA A;  5HDS A;  4KQD A;  4S2N A;  1U60 A;  4P0M A;  4R3A A;  3QP6 A;  3S7O A;  4JXG A;  2MJ6 A;  4ZJ1 A;  1GA0 A;  3ZVT A;  2WKH A;  2B02 A;  1TDG A;  1DP8 A;  1P9R A;  3A0R A;  4Q0J A;  3VMA A;  1XJ2 A;  2DCF A;  3NDG A;  3A0V A;  4OON A;  3WRT A;  4K0X A;  4U0X A;  4Y0T A;  5DTT A;  1K57 A;  2Y55 A;  3FG8 A;  2RL3 A;  4CLC D;  4DRT A;  4Q0H A;  1W63 M;  2V0U A;  3BFF A;  2EXB A;  1VET B;  5IHV A;  1YSP A;  3HLG A;  3LIB A;  1E3U A;  3CZD A;  5AJG A;  5KZH A;  1ESU A;  2G7U A;  2XEP A;  5HZH A;  1C3B A;  2HP5 A;  3RXX A;  4DKI A;  2EWW A;  3SH9 A;  1CEF A;  2ZM0 A;  3CAX A;  5AVE A;  2XLN A;  2GX5 A;  5LBR A;  2Y2K A;  1XGI A;  2XF3 A;  2PU4 A;  4S2M A;  2Z2M B;  2A24 A;  1VM1 A;  1JTD A;  1K6S A;  1OTA A;  4OLG A;  4LRY C;  3BY8 A;  3U2A A;  2QWS A;  5HD5 A;  3UE0 A;  4NEE D;  2HPB A;  3A3F A;  1K25 A;  2C6W B;  4GS9 A;  4NXG A;  3BYD A;  2G2W A;  5FQK A;  4E3J A;  1XPB A;  4KQR A;  1N4O A;  2G2U A;  1JWZ A;  4PMA A;  3GVB A;  3BLM A;  1Z6F A;  3W2Z A;  3LEZ A;  4OQG A;  4U0T A;  3NBL A;  4EWF A;  1D06 A;  1FSW A;  2PDR A;  3N7W A;  2WUQ A;  1Y28 A;  4HES A;  2AVX A;  5EE8 A;  4GW9 A;  4YFM A;  3A3E A;  2P7J A;  1GHI A;  1Y4O A;  1W7F A;  4DDY A;  4X55 A;  3IF6 A;  1ODV A;  4CJN A;  5G4Z A;  4EBL A;  1E25 A;  2XA7 S;  3UDF A;  2NUP C;  3HUO A;  4BEN A;  5EV0 A;  1ES4 A;  4JGP A;  4EUV A;  1ZC2 A;  2OWJ A;  3M6B A;  2ZBB A;  1JNU A;  4EBP A;  5DF8 A;  4KZ3 A;  4OP5 A;  3UE6 A;  1L3L A;  4Y0U A;  1ZTU A;  3OCN A;  3BW6 A;  4ZRR A;  4EXO A;  3K2N A;  3WS2 A;  5G18 A;  1ERO A;  1SZV A;  3QP8 A;  3R7W A;  3OLO A;  4WZ4 A;  3FWL A;  1H8M A;  1JTG A;  1VHM A;  3MQO A;  1K54 C;  2OAP 1;  5EFW A;  4N92 A;  1EI5 A;  5FDH A;  1XP4 A;  2VV7 A;  4KZ7 A;  1KGF A;  4LV1 A;  4YNR A;  3ZDJ A;  3C7U A;  3ZQ5 A;  1K38 A;  3BWL A;  3WRZ A;  5KMW A;  4E04 A;  3G2Z A;  3KX0 X;  4WEL A;  2X01 A;  1L0E A;  4HP4 A;  1TDL A;  4R70 A;  2H5S A;  2Y2G A;  4EEU A;  4R1G A;  4EV4 A;  1LI0 A;  2ZM2 A;  3KYE A;  1BUL A;  3WS5 A;  1BSG A;  4HOI A;  4PM8 A;  1J9M A;  1PW8 A;  2P08 A;  1DJC A;  3ZVW A;  4II7 A;  4WF0 A;  5L8M A;  4EU0 A;  1ALQ A;  4OPQ A;  1CK3 A;  4HQA A;  3NDE A;  1S0W A;  2GZA A;  3MZD A;  4XXR A;  4LEN A;  2VK3 A;  5G4Y A;  1XJ3 A;  4S2I A;  2W0N A;  4WUJ A;  3UME A;  4R3B A;  3S7N A;  1K54 A;  3CI6 A;  4L9F A;  5GHZ A;  5HAQ A;  4P87 A;  4RVA A;  2ZC4 B;  4ZTK A;  2KOI A;  1H0M A;  4WLA A;  3TE8 A;  3ZG8 B;  4G3K A;  2JKT M;  3GRJ A;  2L4R A;  4A5R A;  3OOV A;  3QNC A;  1BTL A;  3M2K A;  4XUX A;  1JVJ A;  2ZOH A;  2Q9M A;  2PR5 A;  4OOM A;  3MFX A;  5EPH A;  3SS3 A;  1L0D A;  2WKI A;  3F1P B;  3BLS A;  5FI2 A;  3CUE C;  1FCM A;  2V8F A;  5KSC A;  1IYP A;  4OKP A;  4CPK A;  1RGZ A;  4B93 A;  3WS1 A;  1O07 A;  3BJN A;  5JYP A;  2ZL1 A;  4X25 A;  3JVU A;  2H10 A;  1PYY A;  1LSV A;  3IBR A;  3C30 A;  4UQI M;  1K6R A;  1F5M A;  3IX8 A;  1YM1 A;  1K55 A;  1S1Z A;  4R0Q A;  3F1O B;  2VX8 A;  3S4X A;  1CQA A;  2VV6 A;  1UWP X;  1OT6 A;  5HDD A;  5M18 A;  3NCK A;  3ZG0 A;  4ME4 A;  1XFN A;  3A0S A;  2WGW B;  3PHY A;  5HAI A;  5CTM A;  3IX3 A;  1BZA A;  1I2W A;  1JWV A;  1VQQ A;  3LIC A;  2GDN A;  4JF4 A;  2ZLY A;  4NXF A;  4MBF A;  2WGW A;  3MF0 A;  2WAF A;  5FAT A;  3OBF A;  5EOE A;  1XA1 A;  4S2P A;  2EX2 A;  4BLM A;  1HD8 A;  1UGU A;  5E43 A;  1KDW A;  4DN0 A;  4O7D A;  2K31 A;  4HBT A;  3BM6 A;  4IJG A;  5CHU A;  5FSR A;  4GZB A;  2D02 A;  1BLS A;  4OOY A;  1OJ5 A;  3LIF A;  1AXB A;  1T18 A;  4ZAM A;  3MS6 A;  4R4S A;  2L1M A;  3UY6 A;  3BFE A;  2ZM8 A;  4HH3 A;  1I5Q A;  1OME A;  3T1Q B;  1LL9 A;  1LI9 A;  4NK3 A;  2J3T C;  1ES2 A;  4EBN A;  4EQI A;  1YLP A;  2EX8 A;  4F3L B;  3ITA A;  4B88 A;  2Y4A A;  4HI4 A;  3IXB A;  2ZOI A;  2J9P A;  2Z6C A;  4H6J B;  4YOF A;  4F3L A;  3T4L A;  2XRO A;  4QU3 A;  4G3W A;  3TRC A;  2ZQC A;  5IS1 A;  3T4Q A;  2Y91 A;  3E4O A;  4DXB A;  1GSX A;  1LSW A;  5D3O A;  4QPR A;  1MKI A;  4WN5 A;  3FZC A;  1YLY A;  2V1B A;  3PBT A;  1OTI A;  3MR0 A;  2O9B A;  1TS0 A;  3UB8 A;  3JYI A;  3WWX A;  3FKW A;  1SDE A;  4F94 A;  5AQB A;  5DF9 A;  1W8Q A;  1Y54 A;  5HWW A;  1XKZ A;  4EES A;  3T4T A;  4Z9Q A;  4Y2F A;  3PBQ A;  5CTN A;  1HZO A;  1PWC A;  1L0G A;  1NZO A;  1NWZ A;  1YLJ A;  3EQV A;  3BFG A;  4FH4 A;  3WS0 A;  3HVF A;  3CLO A;  3KYQ A;  4Y5F A;  2WK0 A;  3ZG7 B;  3RFB A;  3CWF A;  1KVL A;  1YLW A;  4E3L A;  2BTF P;  4PHT A;  2ZD8 A;  2JKF A;  4PM9 A;  3BFC A;  3DAV A;  1FIL A;  2I72 A;  5J4E A;  3T50 A;  4RYE A;  1A0K A;  4GNU A;  2PBY A;  4GJ4 A;  4CLC E;  3UMD A;  4X68 A;  2JN7 A;  4UA6 A;  2WKR A;  4GD8 A;  1OTB A;  4PM7 A;  3U4L P;  4FD8 A;  4HJ6 A;  3N8R A;  2H28 A;  5BOH A;  1KE3 A;  2W3G A;  4KUO A;  4MN5 A;  2JKR M;  4EUZ A;  1D7E A;  1KE4 A;  4P6B A;  1KGG A;  4YIN A;  2Y2P A;  1WE4 A;  1NZU A;  2Z6D A;  1Q2Q A;  1P0Z A;  1WYC A;  2VLG A;  1PI5 A;  1XJ6 A;  2JE5 A;  3IF5 A;  4YWZ A;  3LGO A;  3DWK A;  3W4Q A;  4I38 A;  1KOU A;  3LI9 A;  1QME A;  3LY3 A;  4MN7 A;  3VP1 A;  5CGX A;  3LYX A;  3NOP C;  4RA7 A;  1PIO A;  4DJ2 A;  3R4K A;  4UQI S;  3E4P A;  4P6Z S;  1YKD A;  3G34 A;  4QB8 A;  4U3T A;  4QY5 A;  2W27 A;  2KX6 A;  3V67 A;  4BBT A;  2OAQ 1;  4Y7P A;  3HRE A;  3V5M A;  3LEQ A;  5L2F A;  4JBF A;  1OJG A;  3ZG5 A;  1NLY A;  1CF0 A;  1SHV A;  4KZB A;  1LLB A;  4Y13 A;  2V8C A;  4BD0 A;  4MN6 A;  5MC7 A;  2HGV A;  2XRN A;  4MLL A;  2WKQ A;  4BD1 A;  3GTC A;  1YAX A;  2Q0O A;  3T12 B;  4ID4 A;  3ZHH A;  5F1F A;  5AQ9 A;  1P9W A;  1LL5 A;  3MMH A;  4BBV A;  4WZ5 A;  4X56 A;  1N9N A;  4BL3 A;  3MXS A;  3WS4 A;  3HLW A;  4IUK A;  4C6Y A;  2XK1 A;  3Q82 A;  4NG2 A;  1MWR A;  4G3V A;  1S4S A;  1Q2P A;  1NXY A;  3H82 B;  3PBO A;  1YLZ A;  3PAE A;  4PKY G;  5CER A;  3UE3 A;  1PNE A;  1OTD A;  2LB5 A;  1VET A;  3VV4 A;  3HLF A;  3KSG A;  1ZG4 A;  4M3K A;  4BQM A;  4IUH A;  3C4P A;  2OV5 A;  2XSS A;  4DF6 A;  3R7W B;  4RX3 A;  3OPP A;  2WZX A;  5F69 A;  5TBM A;  2A2L A;  3IBJ A;  1NLZ A;  3HJK A;  3LID A;  2BG1 A;  2KDK A;  4PPR A;  2PYP A;  3P01 A;  4Y3I A;  3E2K A;  4HHD A;  3B42 A;  1IEL A;  1I2S A;  5TGF A;  4GD6 A;  1ACF A;  3VP2 A;  1DP9 A;  2Y2O A;  2PU2 A;  3A3D A;  1SKO B;  2VV8 A;  3S22 A;  4IED A;  5EVI A;  1W8Y A;  4S2J A;  4JXS A;  1JWP A;  1P97 A;  3KSH A;  3KSF A;  3BY9 A;  5A91 A;  4I39 A;  2XGN A;  5IT5 A;  3RJU A;  4B9O A;  1BT5 A;  2HF6 A;  3B47 A;  5HSQ A;  2WAD A;  2R9X A;  5DJT A;  1IYQ A;  3G2Y A;  3GR2 A;  5A90 A;  3LO7 A;  2WKE A;  1N9L A;  2PAV P;  5EUA A;  5HW3 A;  1GSV A;  1SKF A;  2WGV A;  3M6H A;  3OPR A;  5J8X A;  3E0Y A;  5GLD A;  2PRF A;  5EM1 A;  3SZT A;  4E3K A;  2P9V A;  3IT9 A;  3BEB A;  3UPN A;  1G5U A;  3LFV A;  4EET B;  3H7W A;  1FOF A;  4GLQ A;  2XD1 A;  3MXR A;  5CRF A;  5CEC A;  2ZMA A;  5HL1 A;  3LR0 A;  2V1A A;  4GCZ A;  3H7W B;  3V3R A;  4FCF A;  3DTI A;  4JF6 A;  2WKP A;  1PZO A;  3FPW A;  1OT9 A;  4XUZ A;  5KSH A;  3HUM A;  3JPU A;  3DBA A;  1GCE A;  3L9K A;  3VE3 A;  5EVE A;  3EQU A;  1ES5 A;  2K7S A;  4MNR A;  1CEG A;  2W1R A;  3CUE A;  5E2F A;  1SKO A;  4E3N A;  4KG5 A;  1TVF A;  2VZW A;  1S1Y A;  3ISG A;  4JPM A;  3GDI A;  4LFU A;  3T1R A;  1N9O A;  3LUQ A;  3LR5 A;  2XA7 M;  4GDB A;  2O9A A;  1XGJ A;  1KVM A;  3IX4 A;  2Q9N A;  4LRX C;  2W3H A;  2XD5 A;  5HX9 A;  2ZJ9 A;  1T1A A;  1T1C A;  3E4Q A;  4ZJ2 A;  4PM6 A;  2ZQD A;  4DE2 A;  1GHM A;  1CJF A;  3T4S A;  3LI8 A;  1BLC A;  5DJU A;  5TFQ A;  5L07 A;  4BBU A;  3SW1 A;  2XFT A;  3UB6 A;  5J7E A;  4LCM A;  2R9W A;  1TEM A;  3C4O A;  4DXC A;  1OTE A;  4I3J A;  4Y0O A;  2XH9 A;  2J3W A;  1DJB A;  3LR4 A;  3NOU C;  1FIK A;  5FQQ A;  1BLP A;  1ES3 A;  2P9V B;  1EW0 A;  1PRQ A;  1G6A A;  3UN7 A;  1T19 A;  4Q8I A;  4QJG A;  3T4O A;  3UPO A;  3GEC A;  2PD8 A;  5HDC A;  3G35 A;  2Y2M A;  3W4O A;  2B95 A;  2K2N A;  1XX2 A;  3ZCZ A;  4KZ5 A;  4ZJ3 A;  2C5W B;  4OPY A;  2H0T A;  4LLO B;  3IHB A;  2HJE A;  3D72 A;  4MBK A;  3MKF A;  2FZ0 A;  1OPX A;  5HL6 A;  3VOL A;  4KZ9 A;  1M6K A;  1H8Z A;  1S4R A;  1AWI A;  1K55 C;  4X1M A;  3BRM A;  1LT0 A;  3OPL A;  3LR3 A;  2CMN A;  1RGY A;  3DTK A;  4NXE A;  3P98 A;  5CEB A;  5TJJ A;  5EVI D;  2IWC A;  1YT4 A;  1SDN A;  4PKY A;  4OOL A;  3H82 A;  4GN2 A;  5A93 A;  3GSG A;  2IWB A;  2ZQ9 A;  3N8L A;  4FH2 A;  1IYO A;  3BQA A;  3FC7 A;  4HH2 A;  4XT2 B;  3S7Q A;  2W3D A;  1TS7 A;  4MDZ A;  2HJ9 C;  4HBU A;  4JGQ A;  3EEH A;  1TS8 A;  5TR7 A;  2W1T A;  4WYY A;  5E2H A;  1IYS A;  5HFO A;  4FSF A;  1FQG A;  4Z1W A;  5F68 A;  1YSQ A;  1ONH A;  4D2O A;  2INW A;  2EX9 A;  4S2O A;  3A3I A;  1X0O A;  4HY8 A;  3HBR A;  3IQA A;  2R78 A;  4WMC A;  4FOF A;  4OPR A;  1H5X A;  2BAS A;  2OLU A;  3EEA A;  3PAG A;  1MY8 A;  5CED A;  3QP5 A;  3DTE A;  1H8Y A;  1ESI A;  3B33 A;  1V9Y A;  1DY6 A;  3HUN A;  2ZQ7 A;  5HD3 A;  2ZL1 B;  2EXA A;  3SH8 A;  3OC2 A;  4JGR A;  3ZYT A;  3NHQ A;  3P09 A;  2VGJ A;  4KQO A;  3IWO A;  1VEU B;  3H9W A;  4LGW A;  5EM0 A;  3V50 A;  1FCN A;  3KYZ A;  4DE3 A;  1TF1 A;  3TJZ C;  4QWO A;  2FFF B;  3V3S A;  4CLC A;  4NXB A;  4MBH A;  3QP4 A;  3IXG A;  2JBF A;  4X6T A;  3N4I A;  3EWK A;  4IVK A;  2UWX A;  4LV2 A;  4QD4 A;  1YMX A;  1K4F A;  3VFH A;  1W5D A;  2P04 A;  2X02 A;  2Z2L B;  3IXD A;  4UHU A;  3Q7V A;  1PI4 A;  3C8C A;  5FAO A;  1XA7 A;  3TSG A;  4OP8 A;  4OQI A;  4JKT A;  5DKK A;  5A92 A;  2YKF A;  1E3U D;  5I94 A;  2HDS A;  5DF7 A;  1HTZ A;  3MXQ A;  2VKS A;  1TD5 A;  2M7V A;  3VOY A;  2M1C A;  5FA7 A;  5GHY A;  3F1P A;  4C3Q A;  1FSY A;  2QKP A;  5EOO A;  3MJQ A;  4WL9 A;  3Q81 A;  3EOI A;  2VJW A;  2ZQ8 A;  3EGD C;  2VGK A;  2X71 A;  4O0P A;  4B4X A;  1PWG A;  2A24 B;  3OCL A;  1M40 A;  4UA7 A;  2EX6 A;  4WEK A;  1PWD A;  4CLC C;  2OLV A;  1IKI A;  5FDS A;  1MBL A;  4XT2 A;  3F1O A;  1VB6 A;  1ERM A;  5GLB A;  4GOG A;  2KLI A;  2GNX A;  4JLF A;  3Q1F A;  2DRW A;  3HLE A;  3OZH A;  4NET A;  2NUT C;  3Q07 A;  4KEN B;  3EGX C;  4LRZ E;  5M1A A;  2V1Z A;  4IHQ A;  1YPR A;  3VOZ A;  3QNB A;  4O8G A;  4CQH A;  3W8K A;  5CHM A;  2ZC7 A;  5CHJ A;  4HIA A;  5KIZ A;  3PBR A;  4D60 A;  1MPL A;  4S2K A;  1ERQ A;  5CGS A;  2P74 A;  3ZNY A;  2VGL M;  5HWV A;  3P7N A;  2D01 A;  4ETZ A;  1K4E A;  4RX2 A;  2QYB A;  3IS2 A;  4GDN A;  5DFY A;  1YQS A;  2ZC5 B;  2JC7 A;  3NOT C;  1YMS A;  2IA2 A;  2ZMV A;  3LIE A;  3IHA A;  1V9Z A;  2J7V A;  2M7U A;  1O7E A;  4KUK A;  3LCE A;  2QMI A;  3NI9 A;  2J80 A;  4WEJ A;  3AGD A;  3QHY A;  1F98 A;  5HAR A;  2Y2H A;  3SS5 A;  4FUW A;  2ZMF A;  2PBD P;  5FQM A;  1K57 C;  1XXM A;  4R38 A;  3AGE A;  4PM5 A;  2PT7 A;  2DNS A;  3HLC A;  3UB9 A;  4ARZ A;  3G30 A;  1DJA A;  2HDQ A;  4LV3 A;  1ZHH B;  4C75 A;  4Q0I A;  2EFU A;  4CLC B;  2O99 A;  1PFL A;  4I3A A;  4IBX A;  2XR0 A;  3NC8 A;  4E6W A;  2JKG A;  3NY4 A;  3DW0 A;  4IVI A;  4E3M A;  4X53 A;  5A8B A;  3SH7 A;  2QHK A;  4HJ4 A;  4OPZ A;  3CPT B;  3QP1 A;  3G4P A;  3C5A A;  3IXH A;  4R3J A;  1W63 Q;  4HJ3 A;  3GV9 A;  3CHW P;  2J3T D;  2B5R A;  2EWV A;  4BL2 A;  1XJ4 A;  5FEF A;  2ACG A;  1RP5 A;  2O0Y A;  3HCY A;  3VP3 A;  1MWT A;  5AQ7 A;  5CGW A;  3TW8 A;  5DTK A;  3CMZ A;  1HVB A;  5CXW A;  2ZC3 B;  2EA9 A;  3BFD A;  4HEF A;  2PHY A;  5EVL A;  4R4R A;  5L10 A;  4N9L A;  5GHX A;  5HPF A;  1GSW A;  4MMN A;  1PW1 A;  3UNW A;  5F83 A;  5FQJ A;  1IOU A;  3S1Y A;  4WBG A;  2RCX A;  4K91 A;  4BWI A;  3S7P A;  1DP6 A;  3KSI A;  4GHI B;  2Y2Q A;  4E3I A;  1S6R A;  5CX7 A;  2BLS A;  3MKE A;  1E4D A;  2JKT I;  3PTE A;  2E8I A;  1KDS A;  2WGI A;  2J9O A;  2QPN A;  3IWQ A;  3PR6 A;  4Y17 A;  3F1N A;  2JKR I;  3VP4 A;  1TS6 A;  5U47 A;  4LPZ A;  2ZC6 B;  3IH9 A;  2YKH A;  3ZG9 B;  3ICY A;  3PYP A;  3UE1 A;  3RH8 B;  1NRF A;  4ZDX A;  4K08 A;  5JYO A;  3O5Y A;  3T1X A;  1NY0 A;  1FR1 A;  3VE4 A;  4JXV A;  1L2S A;  5F6A A;  1L0F A;  2WYX A;  5FAQ A;  4UA9 A;  3DWZ A;  3PBN A;  1T1B A;  2Y8H A;  4H6J A;  4PAU A;  1W79 A;  4OH0 A;  4OQH A;  1Z09 A;  1WYB A;  3L7H A;  3W4P A;  4P85 A;  3UB5 P;  4KG6 A;  2VGL S;  2XQZ A;  3BQ8 A;  2XFS A;  1DRM A;  1YLT A;  1D1J A;  3IWI A;  4DE1 A;  2V2F F;  3D9Y A;  4ETX A;  3FKV A;  4OQ0 A;  4EER A;  3MZE A;  1STZ A;  2VA0 A;  3TG9 A;  3HL9 A;  3V39 A;  3B3X A;  4OLD A;  3Q7Z A;  2V20 A;  1G28 A;  4R6L A;  3QP2 A;  4EW7 A;  3CJM A;  2A49 A; 
#chains in the Genus database with same CATH homology
 4DJ2 A;  3R4K A;  4UQI S;  3E4P A;  4P6Z S;  1YKD A;  3OC2 A;  4JGR A;  3ZYT A;  1ODV A;  5G4Z A;  3C38 A;  3NHQ A;  4KQO A;  2W27 A;  2KX6 A;  3V67 A;  4BBT A;  4I3I A;  2XA7 S;  2OAQ 1;  5K5B A;  3H9W A;  3MQQ A;  2NUP C;  3KYZ A;  1TF1 A;  3TJZ C;  4CLC A;  4L9E A;  4NXB A;  4JGP A;  5TBM B;  4EUV A;  3D3O A;  1OJG A;  3PBS A;  2HV1 A;  2OWJ A;  2ZBB A;  1JNU A;  1NLY A;  3EWK A;  3UE6 A;  1ZTU A;  3OCN A;  2Y79 A;  3BW6 A;  1XFQ A;  4DMZ A;  4ZRR A;  4EXO A;  3K2N A;  2P04 A;  1H3Q A;  3R7W A;  3C8C A;  3OLO A;  5HPI A;  4MN6 A;  1H8M A;  1VHM A;  3MQO A;  2OAP 1;  1S66 L;  2HGV A;  2XRN A;  5EFW A;  5MC7 A;  2WKQ A;  5DKK A;  5I5L A;  1YAX A;  2VV7 A;  1LSX A;  2YKF A;  4YNR A;  4M4X A;  5DKL A;  1P9W A;  4AFI A;  3ZQ5 A;  3MMH A;  4BBV A;  3MXQ A;  2OOL A;  1N9N A;  2VKS A;  3BWL A;  4UEY A;  1TD5 A;  3E98 A;  4E04 A;  2M7V A;  4IUK A;  2M1C A;  3F1P A;  4MCW A;  4G3V A;  3KX0 X;  2QKP A;  4WEL A;  3KO6 A;  3MJQ A;  1S4S A;  4WL9 A;  4HP4 A;  3ULF A;  3EOI A;  4R70 A;  2VJW A;  3EGD C;  3H82 B;  3PBO A;  2I9V A;  4PKY G;  3UE3 A;  4O0P A;  1OTD A;  2LB5 A;  5F5Y A;  4EEU A;  3VV4 A;  3KSG A;  4IUH A;  2A24 B;  2XSS A;  3OCL A;  4JGO A;  4WEK A;  3R7W B;  4HOI A;  4CLC C;  3PXP A;  4NKP A;  2P08 A;  5F69 A;  4XT2 A;  3F1O A;  1VB6 A;  3T4J A;  5TBM A;  2A2L A;  4II7 A;  4WF0 A;  5L8M A;  4EU0 A;  3IBJ A;  2KLI A;  1NLZ A;  2O9C A;  3HJK A;  3LID A;  4HQA A;  2GNX A;  2GZA A;  2KDK A;  1BYW A;  2PYP A;  3CIT A;  3P01 A;  4Y3I A;  4HNB A;  4HHD A;  2OWH A;  3B42 A;  5G4Y A;  2NUT C;  1MKM A;  1XJ3 A;  3EGX C;  2W0N A;  4WUJ A;  3UME A;  4LRZ E;  5IU1 A;  3S7N A;  4IHQ A;  1DP9 A;  3CI6 A;  4L9F A;  2VV8 A;  4O8G A;  4CQH A;  4EEP A;  2KOI A;  4WLA A;  3TE8 A;  4HIA A;  4G3K A;  5KIZ A;  3PBR A;  4L9G A;  2JKT M;  1P97 A;  3KSH A;  3KSF A;  3BY9 A;  2PR6 A;  3FPV A;  2L4R A;  3G6O A;  2VGL M;  3OOV A;  5HWV A;  5J3W A;  3P7N A;  4I39 A;  1WA9 A;  5IT5 A;  2D01 A;  5HWT A;  1S67 L;  4B9O A;  4ETZ A;  5AVF A;  2QJ5 A;  2QYB A;  2HF6 A;  3B47 A;  3IS2 A;  5HSQ A;  5DFY A;  2ZOH A;  3MQ0 A;  3NOT C;  2PR5 A;  2ZMV A;  2IA2 A;  4OOM A;  3MFX A;  5DJT A;  3LIE A;  1V9Z A;  2M7U A;  3F1P B;  2W3F A;  3NJA A;  4KUK A;  2J80 A;  4WEJ A;  2PYR A;  3CUE C;  1F98 A;  2PD7 A;  1N9L A;  2W3E A;  4B93 A;  4GS9 B;  1GSV A;  2ZMF A;  1MZU A;  3BJN A;  3E0Y A;  4R38 A;  4HP9 A;  3JVU A;  2PT7 A;  1F9I A;  1LSV A;  2FH5 A;  3UB7 A;  3IBR A;  3UB9 A;  4ARZ A;  3C30 A;  4UQI M;  1F5M A;  3LFV A;  4EET B;  3H7W A;  2W1T B;  1S1Z A;  1ZHH B;  4GLQ A;  4Q0I A;  3F1O B;  4L0L A;  1G6O A;  3LR0 A;  2VX8 A;  2LB9 A;  2V1A A;  4GCZ A;  4CLC B;  2VV6 A;  2O99 A;  3H7W B;  1UWP X;  1OT6 A;  5HDD A;  4I3A A;  2WKP A;  4ME4 A;  1IFQ A;  1XFN A;  4P6Z M;  3A0S A;  5C5K A;  3FPW A;  2GJ3 A;  1MC0 A;  1OT9 A;  3PHY A;  4DJ3 A;  5KSH A;  2VEA A;  4GHI A;  3LIC A;  4I5S A;  3DBA A;  3VE3 A;  3EQU A;  2QJ7 A;  2JHE A;  3K3D A;  3K3C A;  2K7S A;  4NXF A;  5DFX A;  3MF0 A;  2W1R A;  3CUE A;  5A8B A;  3IS2 B;  2QHK A;  3OBF A;  2B18 A;  2VZW A;  1S1Y A;  4HJ4 A;  3GDI A;  1N9O A;  3F1N B;  3LUQ A;  1UGU A;  3LR5 A;  3JVV A;  4EQ1 A;  1W63 Q;  2XA7 M;  2O9A A;  4DN0 A;  2K31 A;  4HJ3 A;  4IJG A;  2D02 A;  2J3T D;  2EWV A;  2V0W A;  2V9A A;  4LRX C;  2W3H A;  1NRJ A;  1OJ5 A;  3LIF A;  1XJ4 A;  1T1A A;  1T1C A;  1T18 A;  2L0W A;  2L1M A;  5FL3 A;  3E4Q A;  4BMW A;  3RTY A;  2O0Y A;  3HCY A;  2DMW A;  4HH3 A;  4ARZ B;  3T4S A;  3LI8 A;  5DJU A;  3TW8 A;  2J3T C;  4BBU A;  4F3L B;  3SW1 A;  3HJI A;  4HI4 A;  3C2W A;  2EA9 A;  2ZOI A;  3UB6 A;  4O01 A;  1UWN X;  5J7E A;  2Z6C A;  4H6J B;  4YOF A;  3T4K A;  1OTE A;  4F3L A;  1LL8 A;  3T4L A;  4RQ9 A;  2XRO A;  4I3J A;  3NOU C;  2J3W A;  3LR4 A;  4G3W A;  2PHY A;  3TRC A;  1EW0 A;  5IS1 A;  5HPF A;  3T4Q A;  4BJP A;  1GSW A;  1T19 A;  4MMN A;  3LIA A;  3T4O A;  3E4O A;  3GEC A;  5HDS A;  2PD8 A;  4KQD A;  1GSX A;  1LSW A;  4QPR A;  5HDC A;  1IOU A;  4WN5 A;  2V1B A;  3PBT A;  1OTI A;  2K2N A;  4BWI A;  3MR0 A;  3S7P A;  4R3A A;  1DP6 A;  3KSI A;  4GHI B;  4LLO B;  3S7O A;  2O9B A;  2MJ6 A;  1TS0 A;  3UB8 A;  2HJE A;  5CX7 A;  3D72 A;  2B02 A;  2FZ0 A;  1OPX A;  5HL6 A;  2JKT I;  1DP8 A;  1P9R A;  3A0R A;  4Q0J A;  3VOL A;  5DF9 A;  5HWW A;  1XJ2 A;  4EES A;  3A0V A;  3T4T A;  1S4R A;  3PR6 A;  3F1N A;  4Y2F A;  2JKR I;  3PBQ A;  1TS6 A;  1LT0 A;  4LPZ A;  2YKH A;  3LR3 A;  1NWZ A;  2CMN A;  3ICY A;  3EQV A;  3PYP A;  4NXE A;  3FG8 A;  3CLO A;  5TJJ A;  3RH8 B;  4CLC D;  3KYQ A;  4Q0H A;  4Y5F A;  1W63 M;  2V0U A;  3RFB A;  4K08 A;  1YSP A;  3O5Y A;  3CWF A;  4PKY A;  3LIB A;  4OOL A;  5AJG A;  4PHT A;  3H82 A;  2G7U A;  5HZH A;  3VE4 A;  2EWW A;  5F6A A;  5J4E A;  3T50 A;  3BQA A;  3CAX A;  3FC7 A;  3PBN A;  4HH2 A;  5AVE A;  4XT2 B;  4GJ4 A;  3S7Q A;  2W3D A;  3UMD A;  4CLC E;  1TS7 A;  1T1B A;  2GX5 A;  2HJ9 C;  2JN7 A;  2Y8H A;  4H6J A;  4MDZ A;  5LBR A;  4JGQ A;  3EEH A;  4PAU A;  1TS8 A;  2W1T A;  2WKR A;  1OTB A;  2A24 A;  1OTA A;  4HJ6 A;  4LRY C;  3BY8 A;  4FSF A;  3U2A A;  2H28 A;  2QWS A;  5HD5 A;  4NEE D;  4Z1W A;  2W3G A;  4KUO A;  5F68 A;  2VGL S;  1YSQ A;  4MN5 A;  2INW A;  2JKR M;  4GS9 A;  4NXG A;  1X0O A;  4HY8 A;  3BQ8 A;  1D7E A;  2R78 A;  4FOF A;  1DRM A;  2Z6D A;  1P0Z A;  2BAS A;  3W2Z A;  4ETX A;  2VLG A;  1XJ6 A;  3EEA A;  4EER A;  1D06 A;  1STZ A;  2PDR A;  2VA0 A;  4YWZ A;  4I38 A;  1KOU A;  3LI9 A;  3B33 A;  1Y28 A;  4MN7 A;  1V9Y A;  4GW9 A;  3LYX A;  1G28 A;  2P7J A;  4R6L A;  5HD3 A;  4EW7 A;  3NOP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...