1XJ6A

Structure of bjfixlh in the unliganded ferrous form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 29
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj6A00
3GECA 2PYRA 4HJ4A 3LYXA 3GDIA 4GS9A 5HZHA 3IS2B 1D06A 3H7WA 1OJ5A 4MN6A 5F5YA 2WKQA 3MFXA 1OTIA 1F98A 1S66L 3IBRA 1N9OA 5I5LA 5F6AA 1S4RA 3H82A 1MZUA 4EW7A 3F1OA 3BWLA 2QJ5A 3PHYA 3IS2A 4R70A 4I5SA 4F3LB 2KX6A 3LIFA 2ZBBA 1GSXA 2QJ7A 3FG8A 3CLOA 3E4OA 4XT2A 1S4SA 3CAXA 2L1MA 1P97A 4LRXC 4M4XA 1GSWA 4KUOA 5HD5A 4L9EA 3ICYA 3UMDA 4WL9A 2V1AA 3NOTC 4JGRA 4RQ9A 4JGPA 4HHDA 3H9WA 4EERA 1TS7A 4NXGA 2D01A 4R6LA 2R78A 3A0RA 2PD8A 4NXEA 4I3IA 1N9LA 2M1CA 5DJUA 5DJTA 3H7WB 1JNUA 3D72A 2KDKA 3E4PA 2HV1A 1UWNX 3ZQ5A 5IU1A 3A0SA 4PKYA 5EFWA 3H82B 2QWSA 5HWWA 3F1OB 5F69A 4EETB 3VE4A 3UB8A 1XFNA 2OWJA 2V1BA 3EWKA 4HJ3A 5HDSA 1T1BA 1T18A 3F1NB 1EW0A 3C8CA 4KUKA 4I38A 4XT2B 3RH8B 3ULFA 3PYPA 1V9ZA 2JN7A 2WKRA 1LL8A 2I9VA 2PYPA 1DP9A 2W0NA 4EEPA 5HDDA 1XJ3A 4L9FA 2D02A 5HSQA 1WA9A 3F1NA 5G4YA 2VLGA 4HNBA 1F9IA 3LIEA 3A0VA 4JGQA 3F1PB 1T1CA 2YKFA 1LSVA 4EQ1A 3RTYA 3LIAA 5HDCA 2VV8A 3UB6A 1XJ4A 4LRZE 5J4EA 5HD3A 3LICA 5G4ZA 2YKHA 1ODVA 3T50A 3LI9A 2PDRA 4I39A 3F1PA 1DP8A 3LIBA 2OOLA 4L9GA 2PR5A 4WUJA 3UMEA 2PHYA 3NOPC 2VEAA 3B33A 2A24A 2J80A 1G28A 5DKKA 3HJKA 4E04A 3NJAA 1TS8A 1S67L 3BY8A 2VV6A 1XJ6A 4PKYG 4EEUA 3CWFA 5J7EA 3EEHA 1S1YA 4EXOA 2V0UA 1S1ZA 3LIDA 4BBUA 1OT9A 5KIZA 4HP9A 3E4QA 2OWHA 3G6OA 1UWPX 2QHKA 2GJ3A 1BYWA 4H6JA 5HWVA 1DRMA 3VOLA 3BY9A 1OTBA 4HIAA 1TS6A 2B02A 4HOIA 4R3AA 3UB9A 1D7EA 3P7NA 2ZOHA 2K7SA 4EESA 2L0WA 1VB6A 4LPZA 1OT6A 2BASA 4LRYC 3MR0A 1LSXA 1T1AA 5AVFA 4DJ3A 1T19A 1Y28A 4HP4A 4DJ2A 4BBTA 4K08A 3MXQA 1OJGA 1V9YA 4GHIB 2PR6A 1XJ2A 1P0ZA 3UB7A 4I3JA 5AVEA 3UE6A 2Z6DA 1LSWA 4NXBA 3NOUC 3MJQA 2P7JA 2A24B 1LT0A 4I3AA 2W27A 4YWZA 4MN5A 4GHIA 2CMNA 2ZOIA 3K3CA 4B9OA 5A8BA 1NWZA 1UGUA 3SW1A 4F3LA 4HI4A 4JGOA 1OTEA 3K3DA 4HH3A 2H28A 1OTDA 4WN5A 5F68A 3MQQA 4GCZA 3OLOA 4HQAA 2WKPA 5J3WA 5DKLA 4R38A 4KQDA 1TS0A 1KOUA 1N9NA 2V0WA 3LI8A 5IS1A 4WF0A 5TBMB 5HWTA 4H6JB 3NHQA 1DP6A 4HY8A 2JHEA 2L4RA 3C2WA 1XFQA 4BBVA 2QKPA 1OTAA 4GW9A 2INWA 4LLOB 4WLAA 2PD7A 1GSVA 2V9AA 4HJ6A 3KX0X 4GS9B 5TBMA 3MQOA 3HJIA 4NXFA 3LUQA 2VV7A 1X0OA 3VE3A 4HH2A 3FC7A 2Z6CA 2EA9A
chains in the Genus database with same CATH superfamily
2PYRA 3G2YA 1ES4A 3PBNA 4NEED 1E3UD 4IVIA 1FR1A 3IBJA 3T4JA 3GDIA 1EWZA 3Q1FA 1S0WA 1O07A 3M2KA 3IS2B 4R1GA 1SDEA 1OJ5A 2Y91A 4MN6A 1LI9A 4JXGA 3MFXA 1HTZA 3IBRA 1TD5A 4FSFA 5I5LA 1H0MA 1SKOA 3H82A 4KZBA 1G68A 4S2JA 5M18A 1SHVA 3N4IA 3OOVA 3ZVWA 5CGWA 4R70A 5DTTA 2J3WA 4F3LB 3QNBA 4NKPA 3LIFA 5C5KA 2ZBBA 3PBRA 2G2UA 3E4OA 4XT2A 2H0TA 3EQVA 3B47A 3CAXA 2Z2LB 3T4TA 2EX9A 3RXXA 2JC7A 1G6AA 4LRXC 1DJBA 2WZZA 3WRTA 1GSWA 4KUOA 3TRCA 4EU0A 3BFFA 2Y2KA 3UMDA 2EFUA 1BULA 4WYYA 1OMEA 2HZ5A 2JKRM 1K54C 2WKHA 4KQRA 3S7PA 2HDRA 3IXHA 1CEFA 2AVXA 4C75A 4X1MA 3WS5A 3MF0A 1K57A 3BW6A 4OQGA 1TS7A 3B42A 1QMEA 1YLZA 4K91A 2D01A 5EOOA 2P08A 4Z9QA 1Y54A 1SKFA 1CF0A 1N9LA 3H7WB 5LBRA 1L0FA 1JNUA 3E4PA 3GR2A 1JWPA 1UWNX 4OPZA 3HLCA 4UHUA 4OP8A 5IU1A 4PKYA 2WAFA 5A90A 4AFIA 5EFWA 1TDGA 2QWSA 1VEUB 3UB8A 1XFNA 3HCYA 4S2LA 5J8XA 5KSCA 1PI5A 1IKGA 4HJ3A 5HDSA 4DF6A 1ZG4A 5IT5A 3KYQA 1T18A 5JYOA 1EW0A 3BFCA 2DMWA 3C30A 3C8CA 5EM1A 4OOYA 4KUKA 3T12B 3NI9A 2Y79A 1LI0A 3PYPA 2ZMVA 4KZ8A 1V9ZA 5FQMA 5FQQA 1ES5A 4OLGA 4EUZA 2PYPA 2HDUA 5HDDA 3P01A 1E3UA 2C5WB 1M40A 5HSQA 1PW1A 1K6RA 2VLGA 2XD5A 2OAQ1 3HLWA 5E2FA 4PM9A 2ZM2A 3A0VA 3F1PB 2JKGA 1RCJA 3LY3A 3D3OA 1CQAA 5DVAA 3LIAA 4GKUA 3WS1A 3G35A 3C7VA 3LY4A 4PAUA 1XKZA 1XJ4A 3V67A 4LRZE 3LEZA 3LI9A 3HUOA 1GHMA 2RL3A 1NYMA 4E6WA 3KSFA 1FSYA 1M6KA 3AGEA 4X1LA 4S2MA 2OOLA 4LV3A 1YLPA 2WK0A 3QP5A 2FFYA 2PHYA 3BQ8A 3IF5A 1GA9A 1MKIA 1G28A 5HW3A 4DMZA 1F2KA 3IWOA 1U60A 1CEGA 3UB5P 3NJAA 1GHIA 4PKYG 4Q0IA 4EEUA 3VSKA 3S7NA 2UWXA 1BUEA 1S1YA 4EXOA 2V0UA 1I5QA 1S1ZA 3LIDA 4BBUA 3DTIA 2W1TB 3TOIA 2KOIA 4KZ5A 5KIZA 2DNSA 1QMFA 4MBHA 2J7VA 1RGZA 5FL3A 4CQHA 1NXYA 2XF3A 3O3VA 3VOLA 1BLCA 4Y0UA 4R23A 1OTBA 4IBRA 2Y2JA 4FOFA 1LHYA 3E98A 2J9OA 5CEDA 3T4SA 1ONHA 5AVFA 3ZVTA 1YM1A 4EWFA 4ZAMA 2VGLM 3MKEA 4N1HA 3V5MA 1E25A 4DJ2A 2OSUA 3GQZA 4UEYA 5FDSA 3SS3A 4ME4A 4HBTA 3UB7A 5MC7A 2LB9A 3NBLA 4X55A 3TE8A 5EECA 5AVEA 3OC2A 2Z6DA 1LSWA 3KYEA 4NXBA 2WYXA 4LCMA 3ZNTA 1FR6A 2W1RA 2A24B 3CPTA 5CHJA 1LT0A 5TGFA 3ITBA 3LO7A 3HUMA 4YWZA 5EVLA 3K3CA 4B9OA 2DCFA 2VKSA 4F3LA 1SDNA 4FH4A 5EOEA 4HH3A 1OTDA 1Z09A 1NY0A 3VSLA 4MNRA 3MQQA 2VJWA 3KO6A 4KQDA 3OCNA 1AWIA 1PWCA 1N9BA 1MPLA 4ZRRA 1KOUA 3IX8A 3N7WA 1JTDA 1TVFA 4RA7A 5L07A 4WF0A 2OAP1 2EWWA 3V3SA 3FKVA 1BLHA 2JHEA 3C2WA 1YT4A 1XFQA 3BRMA 2QKPA 2INWA 2W3HA 4WZ4A 3FPWA 2WAEA 1YAXA 4HESA 3MQOA 4QU3A 5HX9A 5KSHA 2J3TD 1X0OA 4ZBEA 1DJCA 3FC7A 4ESPA 1ES3A 4Y3IA 4QHCA 4CPKA 2B18A 2Y2IA 4CLCE 2WADA 3DBAA 4IEDA 3IHBA 2E8IA 3WRZA 1VETB 2Q9NA 3T4OA 3UDIA 3HREA 4GS9A 4QY5A 5HZHA 2X01A 2WGWB 3NCKA 3H7WA 3VP0A 4YNRA 5F1GA 3FZCA 1NZOA 2PBYA 2JCHA 1XA7A 5GLAA 3BECA 3IXBA 5CGXA 2PBDP 4PMAA 5I94A 3WS4A 1S4RA 2IWCA 4UAAA 4EW7A 1XXMA 3QP6A 1NLZA 4Q8IA 4PM8A 4WZ5A 3BWLA 2QJ5A 2I72A 1XP4A 2ZLYA 5AQBA 5FAPA 3G2ZA 1L0EA 1O7EA 1GSXA 4X25A 3LGOA 3T4QA 2Y55A 1RP5A 4JXVA 3T4LA 4NG2A 5GHXA 3V50A 2BG1A 2L1MA 4OP5A 1P97A 3IF6B 4E3OA 4O7DA 1FILA 4N1XA 2G2WA 4WL9A 2XLNA 3AGFA 2W3EA 2P74A 3HLGA 1E4DA 4JXSA 3OCLA 4LV0A 2G7UA 4JGRA 4RQ9A 4JGPA 3Q81A 2EWVA 4EERA 4RYEA 4L0LA 5EM0A 4B4ZA 3ZG0A 2HGVA 2P9VB 3MBZA 3VFHA 2V8FA 1K25A 4NXGA 2R78A 5HFOA 4EBLA 3D9YA 2ZQ8A 3MFDA 3KSHA 1FOFA 1ACFA 5EVIA 3CG5A 1P9WA 3DTMA 2ZQ9A 1YLTA 2MJ6A 3D72A 2KDKA 2HV1A 1ES2A 5EV0A 4PPRA 4CJNA 4D2OA 3OBFA 2EFXA 2H5SA 1YQSA 4FUWA 1K56A 5HAIA 4CLCB 5HPFA 1K57C 2QMIA 2VGLS 2Y2LA 3IXDA 3UO9A 3EWKA 2JBFA 2J8YA 4DDYA 1T1BA 2X02A 4OOMA 5CHUA 4Y7PA 2HF6A 1J9MA 4GOGA 3SH7A 2XFTA 5IHVA 3TJZC 3UPNA 3V3RA 3Q7VB 2XROA 3IXGA 5K5BA 4EEPA 5FATA 3F1NA 3FYZA 5GHZA 3GVBA 1NRJA 4R4SA 1YLWA 5FEGA 2VA0A 4S2OA 3S7QA 1KGGA 5HDCA 2JE5A 3UB6A 5FAOA 4JF4A 1N4OA 2FH5A 5F1FA 5J4EA 2B95A 2YKHA 3T50A 2PDRA 4KZ3A 4MMNA 3IQAA 2PU4A 3LIBA 1NJ4A 4L9GA 3SS5A 4OPYA 2PT7A 2VEAA 2A24A 3HLBA 2HDSA 5DKKA 1IYOA 3VMAA 4JXWA 1Z6FA 3FV7A 3K2NA 3N8SA 1S67L 1JWVA 3UE0A 3ZHHA 4LV2A 2XH9A 4XUXA 3BY8A 1BSGA 2VV6A 3ZG8B 3E0YA 4QD4A 4UA9A 2HDQA 1BLSA 1MXOA 2O0YA 3CHWP 4PHTA 1FIKA 4P6BA 1ERQA 3E4QA 4E3LA 3ZGAB 4XXRA 5F82A 3TG9A 2W3GA 2GJ3A 3PXPA 4GD8A 1PWGA 2ZC3B 5HWVA 1W63Q 1DRMA 4CLCD 2OV5A 4Y0TA 1XGIA 3MXSA 3NY4A 5AQ9A 1KVMA 1ZHHB 4E3NA 5HL1A 3DAVA 3P7NA 1WE4A 3MSHA 4OPQA 3G34A 3T1RA 1VB6A 3IT9A 5L8MA 3UPOA 4JF6A 1T1AA 3CMZA 3N8LA 4WMCD 3R4KA 3GSGA 3NULA 4B4XA 1Y28A 3CI6A 1VETA 3T1XA 4QWOA 5CEBA 1OJGA 1L0GA 3ZFZA 1V9YA 2WGWA 3QHYA 2WKEA 4QB8A 3HLEA 4DE3A 3C4PA 1JVJA 1C3BA 3MJQA 1MKMA 1XX2A 1K38A 2QPNA 3DTEA 3BLMA 1KE3A 2M7UA 5AQAA 4UA7A 4I3AA 3GTCA 5HARA 3SS4A 4GHIA 2CMNA 2ZOIA 4MLLA 5A8BA 1UGUA 3SW1A 4S2PA 4HI4A 3NECA 3SZTA 3EQUA 4GD6A 5GLCA 1OTEA 4BD1A 4DE0A 2A49A 4HEFA 4HQAA 2V2FF 4FH2A 5J3WA 1TS0A 3IF6A 3LI8A 5IS1A 5TBMB 1D1JA 2L4RA 2W3FA 2Y8HA 3ZNYA 1GSVA 4P85A 1IELA 5GHYA 5AQ7A 4Y17A 2ZQCA 4Z1WA 3IX3A 2HJ9C 3QP8A 3A3IA 2O9BA 2P9VA 3LUQA 4E6XA 5FI7A 1TEMA 1P9RA 2B5RA 5FAQA 2GDNA 1TF1A 3GECA 4X53A 1Q2QA 3LYXA 1RGYA 3Q82A 2Y2HA 3ZG9B 3VV4A 1XA1A 5F5YA 4KG6A 1YLJA 1FQGA 2NUPC 5FQIA 1F98A 1MY8A 1S66L 1N9OA 3P98A 5JYPA 1NLYA 1YMSA 4R3JA 1WYBA 4PM6A 4G3VA 1MZUA 2EX8A 3O86A 2X71A 5CX7A 3LEQA 2R9WA 1STZA 2Y2MA 3IS2A 3SH8A 3GRJA 4ZJ1A 3U2AA 3RFBA 2KX6A 3G31A 3FWLA 1NYYA 3UY6A 2KLIA 2ZQDA 4JLFA 2QJ7A 3FG8A 3CLOA 4S2NA 1WYCA 5GLBA 3W4QA 2BTFP 3E2LA 1HZOA 5HD5A 5U47A 5CRFA 3ICYA 4N9KA 2V1AA 1L2SA 3MZEA 1H8ZA 2VK3A 3GMWA 4KZ6A 1YSPA 4QPRA 5DF9A 5CXWA 3T4KA 4HHDA 5CERA 4F94A 3BYDA 3H9WA 4WZ5C 5G18A 3D4FA 1H5XA 1K55A 5CTMA 5CTNA 1FCMA 1G6OA 3CUEA 3HLFA 3S1YA 2Q0OA 2XRNA 4R6LA 3A0RA 4KG5A 2PD8A 1LL9A 1EROA 4OVDA 1A0KA 1GCEA 4Y15A 4I3IA 2XR0A 2M1CA 3LR4A 2O9CA 5TJJA 4D60A 4OH0A 5CHMA 1ALQA 3ZQ5A 1KDWA 4S2KA 4WEJA 2VZWA 5HWWA 3F1OB 5F69A 4EETB 3VE4A 3JYIA 2DRWA 5A93A 5FQ9A 5FASA 2JKFA 5FI2A 4MDZA 1DY6A 3VP3A 1PWDA 3G32A 4M3KA 4ETZA 5E43A 1YMXA 4O01A 3ULFA 5EVIC 1MWTA 3N6IA 1VEUA 3O88A 2JN7A 1IYQA 2ZC6B 2WKRA 2ZM0A 4MN7A 1GA0A 2W0NA 4X56A 3A3EA 3QNCA 3ISGA 1XJ3A 5G4YA 4BL2A 5TFQA 4HNBA 4GDBA 5EVEA 1F9IA 4BMWA 1MWRA 1HLUP 3MKFA 1W8QA 1PNEA 4MCWA 5A92A 1ESIA 4EQ1A 5HAQA 4KZAA 2GNXA 4O8GA 2EXAA 2PRFA 3BFDA 2FZ0A 1PI4A 1ONGA 4DE2A 1ERMA 2H0YA 3VP2A 5F83A 3G4PA 4BENA 4DRTA 3MZFA 3L7HA 2ACGA 4U3TA 4DXBA 4I39A 1K4EA 3F1PA 1PZPA 2Y2QA 4IUKA 2VX8A 3RJUA 2PU2A 2WUQA 4UA6A 4OQ0A 2WKIA 4GDNA 2K31A 3B33A 4U0TA 3CZDA 4MBKA 4O0PA 5DFXA 1S6RA 4E04A 3BEBA 4GB7A 2P04A 2IWDA 1SCWA 4MEZA 3CWFA 3LR0A 3EEHA 2HJEA 4H8RA 3R7WB 1LLBA 2EX2A 4FD8A 3BQAA 2ZC5B 4Q0HA 1IEMA 4E3JA 2HP9A 2OWHA 2ZMAA 3W8KA 3G30A 4DN0A 1XGJA 1BYWA 1PIOA 2XA7M 5FQKA 5DF8A 5L2FA 5CGSA 4UQIM 2UV0E 1PFLA 2W1TA 4ZJ3A 3TSGA 4R3AA 3VOZA 4GNUA 2K7SA 4RX2A 2JKTI 4EESA 4OLDA 2HP6A 2L0WA 4LPZA 2BLSA 3MR0A 1LSXA 4WBGA 2QYBA 3VP1A 3PTEA 1W63M 5L09A 3CPTB 1FCOA 3BM6A 4BBTA 1FCNA 4K08A 3MXQA 4GN2A 4IHQA 2PR6A 1XJ2A 3JVVA 2HP5A 3LFVA 4I3JA 1AXBA 1IKIA 2R9XA 3UE6A 2C6WB 4E3MA 1MWSA 2XQZA 1MBLA 4E3KA 4Y0OA 5KMWA 4KQOA 4P6ZM 3B3XA 3C38A 4QJGA 4MN5A 3UE1A 2Y2GA 3OPPA 4S2IA 4LV1A 2QZ6A 1NWZA 5DF7A 1BTLA 1ZTUA 3PAGA 2WGIA 5M19A 4G3KA 4JGOA 3V39A 2H28A 2IA2A 4WN5A 4BJPA 4GCZA 3S4XA 2WKPA 5GL9A 3A3FA 5TR7A 4WM9A 3PBSA 1N9NA 3IX4A 5A91A 2V0WA 3WWXA 4OQIA 3MXRA 5HWTA 1K4FA 4H6JB 5FQJA 5FDHA 3NC8A 1DP6A 2OLUA 4BBVA 2ZC4B 4P0MA 1IYPA 2Q9MA 3W4OA 4EQIA 2PD7A 4KZ9A 2V9AA 3O5YA 1KGFA 4GS9B 3BLSA 1CI8A 2Y2PA 4NXFA 5AJGA 1PZOA 4HH2A 3NDEA 4EUVA 2IWBA 4Y5FA 2Z6CA 1GHPA 2EA9A 3VFFA 5HL6A 2RCXA 4HJ4A 3DWKA 3IF6C 4ID4A 4WELA 3WS0A 5FSRA 4PM7A 1D06A 2WKQA 2WZXA 1OTIA 1BT5A 3IH9A 4OONA 5FEFA 1L3LA 4KZ4A 1F5MA 2J9PA 3BFEA 1CJFA 3KSIA 2ZQAA 1K54A 5F6AA 3ZCZA 4WEKA 3F1OA 5KZHA 3PHYA 2GZAA 4I5SA 4DXCA 3L9KA 4R4RA 3C7UA 4BWIA 4U0XA 3S7OA 1PW8A 3LR5A 4OQHA 1S4SA 4K0XA 3ZG5A 2ZJ9A 4M4XA 1I2WA 5EUAA 4KQQA 4DDSA 3LCEA 4L9EA 1FSWA 4YOFA 3RXWA 2E8JA 2ZL1B 3U4LP 4JBFA 4IVKA 3NOTC 2VGJA 2XK1A 4EBNA 2PAVP 4CLCC 2ZD8A 4NETA 4ARZB 4BD0A 5EVIB 3OPHA 2EX6A 4GLQA 4X69A 3I7JA 5L10A 1BZAA 4JPMA 3UPPA 1W5DA 3W2ZA 2XA7S 4EBPA 1J3WA 4S2NC 4UQIS 3EOIA 3DWZA 4BLMA 1Q2PA 4NXEA 1DJAA 3LR3A 4FCFA 2Y59A 1SZVA 3WS2A 4E3IA 5DJUA 5DJTA 3CJMA 4II7A 3MQ0A 3HBRA 4R3BA 5GLDA 4NK3A 3QP2A 1L0DA 1YSQA 4DKIA 1MC0A 5M1AA 4EV4A 3EGXC 2W3DA 4X68A 4JKTA 5EPHA 3A0SA 4Y13A 1SKOB 2VGKA 4KENB 2XSSA 3H82B 1VHMA 1K55C 1HD8A 3BJNA 2OWJA 2V1BA 3Q07A 2V20A 3UE3A 3CUEC 2Y4AA 4MBFA 1OPXA 4A5RA 5DTKA 3R7WA 3EEAA 3VP4A 4N9LA 4DE1A 2K2NA 3F1NB 2JKTM 3W4PA 4I38A 4XT2B 3RH8B 4CLCA 4N92A 1KE0A 4BQMA 4P6ZS 1VM1A 3UN7A 1LL8A 3JPUA 2I9VA 1TDLA 1DP9A 3UDXA 1IOUA 4ZJ2A 1JTGA 2ZMFA 5CECA 4L9FA 2D02A 3BFGA 3M6BA 1WA9A 2XD1A 5FA7A 4IBXA 4C6YA 3QP1A 3OPLA 3SOIA 3NDGA 1H3QA 5E2EA 3LIEA 4JGQA 1HVBA 1T1CA 2XEPA 2YKFA 4LCLA 4LGWA 1LSVA 3RTYA 4WMCA 3Q7VA 3S22A 1PYYA 3MMHA 3TW8A 1XPBA 4GJ4A 4RVAA 2VV8A 2GX5A 3JVUA 3AGDA 4HBUA 1IYSA 1W79A 1YKDA 3LICA 5HD3A 3KSGA 1KE4A 5G4ZA 1ODVA 3T1SA 1CI9A 4GZBA 1NZUA 2JKRI 1DP8A 2CC1A 3EGDC 1JWZA 3PBOA 4OPRA 5EVID 3PBTA 2PR5A 4YINA 4WUJA 3IWQA 3NIAA 3UMEA 3SH9A 3NOPC 3A3JA 2EXBA 3IHAA 2J80A 2ZC7A 3OZHA 1PRQA 3HJKA 2HPBA 4BL3A 1TS8A 3C4OA 3E2KA 3DTKA 4B88A 1K56D 1XJ6A 4Q0JA 3CITA 3ITAA 5J7EA 4OOLA 1OT9A 3GV9A 5HPIA 4HP9A 4LENA 4RX3A 3HVFA 4ZTKA 3VOYA 1W7FA 3KYZA 3G6OA 1UWPX 2QHKA 4H6JA 3ZG7B 2FFFB 1W8YA 2O99A 3N8RA 1Y4OA 3BY9A 3ZYTA 4HIAA 1TS6A 2ZQ7A 2B02A 3C5AA 1ZKJA 4XUZA 1KVLA 4HOIA 5DTSA 3UB9A 3HL9A 3HUNA 1D7EA 3FPVA 2ZOHA 4KZ7A 5E2GA 1OT6A 4JF5A 2BASA 3T1QB 4LRYC 4B93A 4ETXA 3IWIA 2O9AA 3IH8A 1ESUA 1KDSA 1I2SA 4DJ3A 2Y2NA 4K0WA 3PAEA 1MWUA 1T19A 4HP4A 3PR6A 2V1ZA 4YFMA 2M7VA 4GHIB 1P0ZA 3PBQA 2NUTC 1YPRA 1VQQA 3ZDJA 1H8YA 3UDFA 2XGNA 3NOUC 2WGVA 5D3OA 2H10A 4OKPA 2P7JA 4PM5A 2W27A 2J3TC 4Y2FA 5FI6A 2XDMA 1K6SA 3M2JA 2Y2OA 5BOHA 1KGEA 4IUHA 2ZM8A 3K3DA 5F68A 4C3QA 3OLOA 4X6TA 5DKLA 4R38A 3UNWA 4ZDXA 5EE8A 3M6HA 1G5UA 1IFQA 1ZG6A 3P09A 3NHQA 1BLPA 1K0KA 4HY8A 1CK3A 2ZL1A 4FTXA 1OTAA 4GW9A 4R0QA 4LLOB 2A3UA 4WLAA 3OPRA 4HJ6A 2A2LA 4QY6A 3QP4A 3KX0X 3MZDA 3O87A 2LB5A 4ARZA 5TBMA 2OLVA 3A3DA 4KG2A 3HJIA 1H8MA 2XFSA 4P87A 2VV7A 5HAPA 2Z2MB 1ZC2A 3VE3A 4G3WA 1LL5A 1NRFA 3Q7ZA 5E2HA 3HLDA 2V8CA 3DW0A 3FKWA 5DFYA 4LFUA 1EI5A 1YLYA 3MS6A 4IJGA
chains in the Genus database with same CATH topology
3DBAA 3GECA 2PYRA 4HJ4A 3PBNA 3LYXA 4NEED 3T4OA 4WELA 3IBJA 3T4JA 3VV4A 3GDIA 4GS9A 5HZHA 3IS2B 1D06A 3H7WA 1OJ5A 4YNRA 4MN6A 5F5YA 2WKQA 3MFXA 1OTIA 2NUPC 1F98A 1S66L 3IBRA 1TD5A 4FSFA 1N9OA 1F5MA 5I5LA 1NLYA 3KSIA 5F6AA 1S4RA 3H82A 1MZUA 4G3VA 4WEKA 4EW7A 3F1OA 5CX7A 1NLZA 3BWLA 2QJ5A 3PHYA 1STZA 3IS2A 3OOVA 2GZAA 4R70A 3U2AA 4I5SA 2J3WA 4F3LB 3RFBA 2KX6A 4NKPA 3LIFA 5C5KA 2KLIA 2ZBBA 4BWIA 3S7OA 3PBRA 3LR5A 1GSXA 2QJ7A 3FG8A 3CLOA 3E4OA 3T4QA 4XT2A 1S4SA 3EQVA 3B47A 3CAXA 3T4TA 3T4LA 2L1MA 1P97A 4LRXC 4M4XA 1GSWA 4KUOA 3TRCA 4EU0A 5HD5A 4L9EA 3ICYA 4YOFA 3UMDA 4WL9A 2V1AA 2W3EA 1YSPA 4QPRA 5DF9A 2JKRM 3T4KA 3NOTC 3OCLA 2G7UA 4JGRA 4RQ9A 4JGPA 4HHDA 4CLCC 3S7PA 2EWVA 3H9WA 4ARZB 4EERA 3MF0A 3BW6A 4L0LA 1TS7A 3B42A 1G6OA 4GLQA 2HGVA 3CUEA 3W2ZA 2XA7S 4NXGA 2D01A 2XRNA 4R6LA 2P08A 2R78A 4UQIS 3EOIA 3A0RA 2PD8A 4NXEA 3KSHA 3LR3A 4I3IA 1P9WA 1N9LA 2M1CA 5DJUA 5DJTA 3H7WB 4II7A 5LBRA 3MQ0A 2MJ6A 1JNUA 3LR4A 3D72A 2KDKA 3E4PA 2HV1A 2O9CA 1UWNX 5TJJA 1YSQA 1MC0A 3OBFA 3EGXC 2W3DA 3ZQ5A 5IU1A 3A0SA 4PKYA 4AFIA 5EFWA 2XSSA 3H82B 2QWSA 1VHMA 4WEJA 2VZWA 4CLCB 5HWWA 3F1OB 5HPFA 5F69A 2VGLS 4EETB 3VE4A 3UB8A 1XFNA 3BJNA 2OWJA 3HCYA 2V1BA 3UE3A 3CUEC 3EWKA 1OPXA 4HJ3A 5HDSA 1T1BA 4OOMA 5IT5A 3R7WA 3KYQA 1T18A 4MDZA 3EEAA 2K2NA 2HF6A 3F1NB 1EW0A 2JKTM 2DMWA 3C30A 3C8CA 4ETZA 4KUKA 4O01A 4I38A 2Y79A 4XT2B 3RH8B 3ULFA 4CLCA 3PYPA 2ZMVA 1V9ZA 2JN7A 2WKRA 4P6ZS 3TJZC 4MN7A 1LL8A 2I9VA 2PYPA 1DP9A 2XROA 2W0NA 4EEPA 5K5BA 1IOUA 5HDDA 3P01A 2ZMFA 1XJ3A 4L9FA 2D02A 5HSQA 1WA9A 3F1NA 5G4YA 2VLGA 4HNBA 2OAQ1 1NRJA 1H3QA 1F9IA 3LIEA 3A0VA 4BMWA 4JGQA 3F1PB 1T1CA 2YKFA 4MCWA 3D3OA 1LSVA 4EQ1A 3RTYA 2VA0A 3S7QA 3LIAA 5HDCA 2GNXA 3MMHA 4O8GA 3TW8A 4GJ4A 2VV8A 2FZ0A 2GX5A 4PAUA 3UB6A 3JVUA 1XJ4A 3V67A 4LRZE 2FH5A 5J4EA 1YKDA 3LICA 5HD3A 3KSGA 2YKHA 5G4ZA 1ODVA 3T50A 3LI9A 2PDRA 4I39A 2JKRI 3F1PA 1DP8A 3KSFA 4MMNA 4IUKA 3EGDC 3LIBA 2VX8A 3PBOA 2OOLA 3PBTA 4L9GA 2PR5A 4WUJA 3UMEA 2PHYA 3BQ8A 2PT7A 3NOPC 2VEAA 2K31A 2A24A 3B33A 2J80A 1G28A 4DMZA 5DKKA 3HJKA 4O0PA 5DFXA 3K2NA 3NJAA 4E04A 1TS8A 1S67L 2P04A 3BY8A 2VV6A 1XJ6A 4PKYG 4Q0IA 4EEUA 4Q0JA 3CWFA 3CITA 3E0YA 3LR0A 3S7NA 5J7EA 3EEHA 1S1YA 4OOLA 4EXOA 2V0UA 1S1ZA 2HJEA 3LIDA 4BBUA 1OT9A 2O0YA 3R7WB 2W1TB 5HPIA 2KOIA 5KIZA 4HP9A 3BQAA 4PHTA 4Q0HA 3E4QA 2OWHA 5FL3A 4CQHA 3KYZA 3G6OA 4DN0A 1UWPX 2W3GA 2QHKA 2GJ3A 1BYWA 3PXPA 4H6JA 2XA7M 5HWVA 1W63Q 1DRMA 2O99A 4CLCD 3VOLA 3BY9A 4UQIM 3ZYTA 1OTBA 4HIAA 1TS6A 2B02A 2W1TA 1ZHHB 4HOIA 4R3AA 3UB9A 1D7EA 4FOFA 3FPVA 3P7NA 2ZOHA 3E98A 2K7SA 2JKTI 4EESA 2L0WA 1VB6A 5L8MA 4LPZA 3T4SA 1OT6A 2BASA 4LRYC 4B93A 3MR0A 1LSXA 1T1AA 4ETXA 5AVFA 2O9AA 2QYBA 4DJ3A 3R4KA 1T19A 1Y28A 2VGLM 3CI6A 1W63M 4HP4A 3PR6A 4DJ2A 4BBTA 4K08A 2M7VA 3MXQA 1OJGA 4IHQA 1V9YA 4UEYA 4GHIB 4ME4A 2PR6A 1XJ2A 3JVVA 1P0ZA 3PBQA 3UB7A 5MC7A 2LB9A 2NUTC 3LFVA 4I3JA 3TE8A 5AVEA 3OC2A 2Z6DA 3UE6A 1LSWA 4NXBA 3NOUC 3MJQA 1MKMA 2P7JA 2W1RA 2A24B 4KQOA 1LT0A 4P6ZM 2M7UA 3C38A 4I3AA 2W27A 4YWZA 2J3TC 4MN5A 4Y2FA 4GHIA 2CMNA 2ZOIA 3K3CA 4B9OA 5A8BA 1NWZA 2VKSA 1UGUA 3SW1A 4F3LA 4HI4A 1ZTUA 4G3KA 3EQUA 4IUHA 4JGOA 1OTEA 3K3DA 4HH3A 2H28A 1OTDA 2IA2A 4WN5A 5F68A 3MQQA 4BJPA 4GCZA 3OLOA 2VJWA 4HQAA 2WKPA 5J3WA 5DKLA 3KO6A 4R38A 4KQDA 3OCNA 1TS0A 4ZRRA 1KOUA 3PBSA 1N9NA 2V0WA 3LI8A 1IFQA 5IS1A 4WF0A 5TBMB 5HWTA 2OAP1 2EWWA 4H6JB 3NHQA 1DP6A 4HY8A 2JHEA 2L4RA 3C2WA 1XFQA 4BBVA 2W3FA 2QKPA 1OTAA 2Y8HA 4GW9A 2INWA 4LLOB 2W3HA 4WLAA 2PD7A 1GSVA 3FPWA 2V9AA 4HJ6A 2A2LA 3KX0X 3O5YA 4ARZA 2LB5A 1YAXA 4Z1WA 2HJ9C 4GS9B 5TBMA 3MQOA 3HJIA 1H8MA 4NXFA 2O9BA 3LUQA 2VV7A 5KSHA 2J3TD 5AJGA 1X0OA 3VE3A 4G3WA 4HH2A 4EUVA 3FC7A 1P9RA 4Y3IA 4Y5FA 2Z6CA 5DFYA 2B18A 2EA9A 4CLCE 1TF1A 5HL6A 4IJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEC A;  2PYR A;  4HJ4 A;  3LYX A;  3GDI A;  4GS9 A;  5HZH A;  3IS2 B;  1D06 A;  3H7W A;  1OJ5 A;  4MN6 A;  5F5Y A;  2WKQ A;  3MFX A;  1OTI A;  1F98 A;  1S66 L;  3IBR A;  1N9O A;  5I5L A;  5F6A A;  1S4R A;  3H82 A;  1MZU A;  4EW7 A;  3F1O A;  3BWL A;  2QJ5 A;  3PHY A;  3IS2 A;  4R70 A;  4I5S A;  4F3L B;  2KX6 A;  3LIF A;  2ZBB A;  1GSX A;  2QJ7 A;  3FG8 A;  3CLO A;  3E4O A;  4XT2 A;  1S4S A;  3CAX A;  2L1M A;  1P97 A;  4LRX C;  4M4X A;  1GSW A;  4KUO A;  5HD5 A;  4L9E A;  3ICY A;  3UMD A;  4WL9 A;  2V1A A;  3NOT C;  4JGR A;  4RQ9 A;  4JGP A;  4HHD A;  3H9W A;  4EER A;  1TS7 A;  4NXG A;  2D01 A;  4R6L A;  2R78 A;  3A0R A;  2PD8 A;  4NXE A;  4I3I A;  1N9L A;  2M1C A;  5DJU A;  5DJT A;  3H7W B;  1JNU A;  3D72 A;  2KDK A;  3E4P A;  2HV1 A;  1UWN X;  3ZQ5 A;  5IU1 A;  3A0S A;  4PKY A;  5EFW A;  3H82 B;  2QWS A;  5HWW A;  3F1O B;  5F69 A;  4EET B;  3VE4 A;  3UB8 A;  1XFN A;  2OWJ A;  2V1B A;  3EWK A;  4HJ3 A;  5HDS A;  1T1B A;  1T18 A;  3F1N B;  1EW0 A;  3C8C A;  4KUK A;  4I38 A;  4XT2 B;  3RH8 B;  3ULF A;  3PYP A;  1V9Z A;  2JN7 A;  2WKR A;  1LL8 A;  2I9V A;  2PYP A;  1DP9 A;  2W0N A;  4EEP A;  5HDD A;  1XJ3 A;  4L9F A;  2D02 A;  5HSQ A;  1WA9 A;  3F1N A;  5G4Y A;  2VLG A;  4HNB A;  1F9I A;  3LIE A;  3A0V A;  4JGQ A;  3F1P B;  1T1C A;  2YKF A;  1LSV A;  4EQ1 A;  3RTY A;  3LIA A;  5HDC A;  2VV8 A;  3UB6 A;  1XJ4 A;  4LRZ E;  5J4E A;  5HD3 A;  3LIC A;  5G4Z A;  2YKH A;  1ODV A;  3T50 A;  3LI9 A;  2PDR A;  4I39 A;  3F1P A;  1DP8 A;  3LIB A;  2OOL A;  4L9G A;  2PR5 A;  4WUJ A;  3UME A;  2PHY A;  3NOP C;  2VEA A;  3B33 A;  2A24 A;  2J80 A;  1G28 A;  5DKK A;  3HJK A;  4E04 A;  3NJA A;  1TS8 A;  1S67 L;  3BY8 A;  2VV6 A;  1XJ6 A;  4PKY G;  4EEU A;  3CWF A;  5J7E A;  3EEH A;  1S1Y A;  4EXO A;  2V0U A;  1S1Z A;  3LID A;  4BBU A;  1OT9 A;  5KIZ A;  4HP9 A;  3E4Q A;  2OWH A;  3G6O A;  1UWP X;  2QHK A;  2GJ3 A;  1BYW A;  4H6J A;  5HWV A;  1DRM A;  3VOL A;  3BY9 A;  1OTB A;  4HIA A;  1TS6 A;  2B02 A;  4HOI A;  4R3A A;  3UB9 A;  1D7E A;  3P7N A;  2ZOH A;  2K7S A;  4EES A;  2L0W A;  1VB6 A;  4LPZ A;  1OT6 A;  2BAS A;  4LRY C;  3MR0 A;  1LSX A;  1T1A A;  5AVF A;  4DJ3 A;  1T19 A;  1Y28 A;  4HP4 A;  4DJ2 A;  4BBT A;  4K08 A;  3MXQ A;  1OJG A;  1V9Y A;  4GHI B;  2PR6 A;  1XJ2 A;  1P0Z A;  3UB7 A;  4I3J A;  5AVE A;  3UE6 A;  2Z6D A;  1LSW A;  4NXB A;  3NOU C;  3MJQ A;  2P7J A;  2A24 B;  1LT0 A;  4I3A A;  2W27 A;  4YWZ A;  4MN5 A;  4GHI A;  2CMN A;  2ZOI A;  3K3C A;  4B9O A;  5A8B A;  1NWZ A;  1UGU A;  3SW1 A;  4F3L A;  4HI4 A;  4JGO A;  1OTE A;  3K3D A;  4HH3 A;  2H28 A;  1OTD A;  4WN5 A;  5F68 A;  3MQQ A;  4GCZ A;  3OLO A;  4HQA A;  2WKP A;  5J3W A;  5DKL A;  4R38 A;  4KQD A;  1TS0 A;  1KOU A;  1N9N A;  2V0W A;  3LI8 A;  5IS1 A;  4WF0 A;  5TBM B;  5HWT A;  4H6J B;  3NHQ A;  1DP6 A;  4HY8 A;  2JHE A;  2L4R A;  3C2W A;  1XFQ A;  4BBV A;  2QKP A;  1OTA A;  4GW9 A;  2INW A;  4LLO B;  4WLA A;  2PD7 A;  1GSV A;  2V9A A;  4HJ6 A;  3KX0 X;  4GS9 B;  5TBM A;  3MQO A;  3HJI A;  4NXF A;  3LUQ A;  2VV7 A;  1X0O A;  3VE3 A;  4HH2 A;  3FC7 A;  2Z6C A;  2EA9 A; 
#chains in the Genus database with same CATH topology
 2PYR A;  3G2Y A;  1ES4 A;  3PBN A;  4NEE D;  1E3U D;  4IVI A;  1FR1 A;  3IBJ A;  3T4J A;  3GDI A;  1EWZ A;  3Q1F A;  1S0W A;  1O07 A;  3M2K A;  3IS2 B;  4R1G A;  1SDE A;  1OJ5 A;  2Y91 A;  4MN6 A;  1LI9 A;  4JXG A;  3MFX A;  1HTZ A;  3IBR A;  1TD5 A;  4FSF A;  5I5L A;  1H0M A;  1SKO A;  3H82 A;  4KZB A;  1G68 A;  4S2J A;  5M18 A;  1SHV A;  3N4I A;  3OOV A;  3ZVW A;  5CGW A;  4R70 A;  5DTT A;  2J3W A;  4F3L B;  3QNB A;  4NKP A;  3LIF A;  5C5K A;  2ZBB A;  3PBR A;  2G2U A;  3E4O A;  4XT2 A;  2H0T A;  3EQV A;  3B47 A;  3CAX A;  2Z2L B;  3T4T A;  2EX9 A;  3RXX A;  2JC7 A;  1G6A A;  4LRX C;  1DJB A;  2WZZ A;  3WRT A;  1GSW A;  4KUO A;  3TRC A;  4EU0 A;  3BFF A;  2Y2K A;  3UMD A;  2EFU A;  1BUL A;  4WYY A;  1OME A;  2HZ5 A;  2JKR M;  1K54 C;  2WKH A;  4KQR A;  3S7P A;  2HDR A;  3IXH A;  1CEF A;  2AVX A;  4C75 A;  4X1M A;  3WS5 A;  3MF0 A;  1K57 A;  3BW6 A;  4OQG A;  1TS7 A;  3B42 A;  1QME A;  1YLZ A;  4K91 A;  2D01 A;  5EOO A;  2P08 A;  4Z9Q A;  1Y54 A;  1SKF A;  1CF0 A;  1N9L A;  3H7W B;  5LBR A;  1L0F A;  1JNU A;  3E4P A;  3GR2 A;  1JWP A;  1UWN X;  4OPZ A;  3HLC A;  4UHU A;  4OP8 A;  5IU1 A;  4PKY A;  2WAF A;  5A90 A;  4AFI A;  5EFW A;  1TDG A;  2QWS A;  1VEU B;  3UB8 A;  1XFN A;  3HCY A;  4S2L A;  5J8X A;  5KSC A;  1PI5 A;  1IKG A;  4HJ3 A;  5HDS A;  4DF6 A;  1ZG4 A;  5IT5 A;  3KYQ A;  1T18 A;  5JYO A;  1EW0 A;  3BFC A;  2DMW A;  3C30 A;  3C8C A;  5EM1 A;  4OOY A;  4KUK A;  3T12 B;  3NI9 A;  2Y79 A;  1LI0 A;  3PYP A;  2ZMV A;  4KZ8 A;  1V9Z A;  5FQM A;  5FQQ A;  1ES5 A;  4OLG A;  4EUZ A;  2PYP A;  2HDU A;  5HDD A;  3P01 A;  1E3U A;  2C5W B;  1M40 A;  5HSQ A;  1PW1 A;  1K6R A;  2VLG A;  2XD5 A;  2OAQ 1;  3HLW A;  5E2F A;  4PM9 A;  2ZM2 A;  3A0V A;  3F1P B;  2JKG A;  1RCJ A;  3LY3 A;  3D3O A;  1CQA A;  5DVA A;  3LIA A;  4GKU A;  3WS1 A;  3G35 A;  3C7V A;  3LY4 A;  4PAU A;  1XKZ A;  1XJ4 A;  3V67 A;  4LRZ E;  3LEZ A;  3LI9 A;  3HUO A;  1GHM A;  2RL3 A;  1NYM A;  4E6W A;  3KSF A;  1FSY A;  1M6K A;  3AGE A;  4X1L A;  4S2M A;  2OOL A;  4LV3 A;  1YLP A;  2WK0 A;  3QP5 A;  2FFY A;  2PHY A;  3BQ8 A;  3IF5 A;  1GA9 A;  1MKI A;  1G28 A;  5HW3 A;  4DMZ A;  1F2K A;  3IWO A;  1U60 A;  1CEG A;  3UB5 P;  3NJA A;  1GHI A;  4PKY G;  4Q0I A;  4EEU A;  3VSK A;  3S7N A;  2UWX A;  1BUE A;  1S1Y A;  4EXO A;  2V0U A;  1I5Q A;  1S1Z A;  3LID A;  4BBU A;  3DTI A;  2W1T B;  3TOI A;  2KOI A;  4KZ5 A;  5KIZ A;  2DNS A;  1QMF A;  4MBH A;  2J7V A;  1RGZ A;  5FL3 A;  4CQH A;  1NXY A;  2XF3 A;  3O3V A;  3VOL A;  1BLC A;  4Y0U A;  4R23 A;  1OTB A;  4IBR A;  2Y2J A;  4FOF A;  1LHY A;  3E98 A;  2J9O A;  5CED A;  3T4S A;  1ONH A;  5AVF A;  3ZVT A;  1YM1 A;  4EWF A;  4ZAM A;  2VGL M;  3MKE A;  4N1H A;  3V5M A;  1E25 A;  4DJ2 A;  2OSU A;  3GQZ A;  4UEY A;  5FDS A;  3SS3 A;  4ME4 A;  4HBT A;  3UB7 A;  5MC7 A;  2LB9 A;  3NBL A;  4X55 A;  3TE8 A;  5EEC A;  5AVE A;  3OC2 A;  2Z6D A;  1LSW A;  3KYE A;  4NXB A;  2WYX A;  4LCM A;  3ZNT A;  1FR6 A;  2W1R A;  2A24 B;  3CPT A;  5CHJ A;  1LT0 A;  5TGF A;  3ITB A;  3LO7 A;  3HUM A;  4YWZ A;  5EVL A;  3K3C A;  4B9O A;  2DCF A;  2VKS A;  4F3L A;  1SDN A;  4FH4 A;  5EOE A;  4HH3 A;  1OTD A;  1Z09 A;  1NY0 A;  3VSL A;  4MNR A;  3MQQ A;  2VJW A;  3KO6 A;  4KQD A;  3OCN A;  1AWI A;  1PWC A;  1N9B A;  1MPL A;  4ZRR A;  1KOU A;  3IX8 A;  3N7W A;  1JTD A;  1TVF A;  4RA7 A;  5L07 A;  4WF0 A;  2OAP 1;  2EWW A;  3V3S A;  3FKV A;  1BLH A;  2JHE A;  3C2W A;  1YT4 A;  1XFQ A;  3BRM A;  2QKP A;  2INW A;  2W3H A;  4WZ4 A;  3FPW A;  2WAE A;  1YAX A;  4HES A;  3MQO A;  4QU3 A;  5HX9 A;  5KSH A;  2J3T D;  1X0O A;  4ZBE A;  1DJC A;  3FC7 A;  4ESP A;  1ES3 A;  4Y3I A;  4QHC A;  4CPK A;  2B18 A;  2Y2I A;  4CLC E;  2WAD A;  3DBA A;  4IED A;  3IHB A;  2E8I A;  3WRZ A;  1VET B;  2Q9N A;  3T4O A;  3UDI A;  3HRE A;  4GS9 A;  4QY5 A;  5HZH A;  2X01 A;  2WGW B;  3NCK A;  3H7W A;  3VP0 A;  4YNR A;  5F1G A;  3FZC A;  1NZO A;  2PBY A;  2JCH A;  1XA7 A;  5GLA A;  3BEC A;  3IXB A;  5CGX A;  2PBD P;  4PMA A;  5I94 A;  3WS4 A;  1S4R A;  2IWC A;  4UAA A;  4EW7 A;  1XXM A;  3QP6 A;  1NLZ A;  4Q8I A;  4PM8 A;  4WZ5 A;  3BWL A;  2QJ5 A;  2I72 A;  1XP4 A;  2ZLY A;  5AQB A;  5FAP A;  3G2Z A;  1L0E A;  1O7E A;  1GSX A;  4X25 A;  3LGO A;  3T4Q A;  2Y55 A;  1RP5 A;  4JXV A;  3T4L A;  4NG2 A;  5GHX A;  3V50 A;  2BG1 A;  2L1M A;  4OP5 A;  1P97 A;  3IF6 B;  4E3O A;  4O7D A;  1FIL A;  4N1X A;  2G2W A;  4WL9 A;  2XLN A;  3AGF A;  2W3E A;  2P74 A;  3HLG A;  1E4D A;  4JXS A;  3OCL A;  4LV0 A;  2G7U A;  4JGR A;  4RQ9 A;  4JGP A;  3Q81 A;  2EWV A;  4EER A;  4RYE A;  4L0L A;  5EM0 A;  4B4Z A;  3ZG0 A;  2HGV A;  2P9V B;  3MBZ A;  3VFH A;  2V8F A;  1K25 A;  4NXG A;  2R78 A;  5HFO A;  4EBL A;  3D9Y A;  2ZQ8 A;  3MFD A;  3KSH A;  1FOF A;  1ACF A;  5EVI A;  3CG5 A;  1P9W A;  3DTM A;  2ZQ9 A;  1YLT A;  2MJ6 A;  3D72 A;  2KDK A;  2HV1 A;  1ES2 A;  5EV0 A;  4PPR A;  4CJN A;  4D2O A;  3OBF A;  2EFX A;  2H5S A;  1YQS A;  4FUW A;  1K56 A;  5HAI A;  4CLC B;  5HPF A;  1K57 C;  2QMI A;  2VGL S;  2Y2L A;  3IXD A;  3UO9 A;  3EWK A;  2JBF A;  2J8Y A;  4DDY A;  1T1B A;  2X02 A;  4OOM A;  5CHU A;  4Y7P A;  2HF6 A;  1J9M A;  4GOG A;  3SH7 A;  2XFT A;  5IHV A;  3TJZ C;  3UPN A;  3V3R A;  3Q7V B;  2XRO A;  3IXG A;  5K5B A;  4EEP A;  5FAT A;  3F1N A;  3FYZ A;  5GHZ A;  3GVB A;  1NRJ A;  4R4S A;  1YLW A;  5FEG A;  2VA0 A;  4S2O A;  3S7Q A;  1KGG A;  5HDC A;  2JE5 A;  3UB6 A;  5FAO A;  4JF4 A;  1N4O A;  2FH5 A;  5F1F A;  5J4E A;  2B95 A;  2YKH A;  3T50 A;  2PDR A;  4KZ3 A;  4MMN A;  3IQA A;  2PU4 A;  3LIB A;  1NJ4 A;  4L9G A;  3SS5 A;  4OPY A;  2PT7 A;  2VEA A;  2A24 A;  3HLB A;  2HDS A;  5DKK A;  1IYO A;  3VMA A;  4JXW A;  1Z6F A;  3FV7 A;  3K2N A;  3N8S A;  1S67 L;  1JWV A;  3UE0 A;  3ZHH A;  4LV2 A;  2XH9 A;  4XUX A;  3BY8 A;  1BSG A;  2VV6 A;  3ZG8 B;  3E0Y A;  4QD4 A;  4UA9 A;  2HDQ A;  1BLS A;  1MXO A;  2O0Y A;  3CHW P;  4PHT A;  1FIK A;  4P6B A;  1ERQ A;  3E4Q A;  4E3L A;  3ZGA B;  4XXR A;  5F82 A;  3TG9 A;  2W3G A;  2GJ3 A;  3PXP A;  4GD8 A;  1PWG A;  2ZC3 B;  5HWV A;  1W63 Q;  1DRM A;  4CLC D;  2OV5 A;  4Y0T A;  1XGI A;  3MXS A;  3NY4 A;  5AQ9 A;  1KVM A;  1ZHH B;  4E3N A;  5HL1 A;  3DAV A;  3P7N A;  1WE4 A;  3MSH A;  4OPQ A;  3G34 A;  3T1R A;  1VB6 A;  3IT9 A;  5L8M A;  3UPO A;  4JF6 A;  1T1A A;  3CMZ A;  3N8L A;  4WMC D;  3R4K A;  3GSG A;  3NUL A;  4B4X A;  1Y28 A;  3CI6 A;  1VET A;  3T1X A;  4QWO A;  5CEB A;  1OJG A;  1L0G A;  3ZFZ A;  1V9Y A;  2WGW A;  3QHY A;  2WKE A;  4QB8 A;  3HLE A;  4DE3 A;  3C4P A;  1JVJ A;  1C3B A;  3MJQ A;  1MKM A;  1XX2 A;  1K38 A;  2QPN A;  3DTE A;  3BLM A;  1KE3 A;  2M7U A;  5AQA A;  4UA7 A;  4I3A A;  3GTC A;  5HAR A;  3SS4 A;  4GHI A;  2CMN A;  2ZOI A;  4MLL A;  5A8B A;  1UGU A;  3SW1 A;  4S2P A;  4HI4 A;  3NEC A;  3SZT A;  3EQU A;  4GD6 A;  5GLC A;  1OTE A;  4BD1 A;  4DE0 A;  2A49 A;  4HEF A;  4HQA A;  2V2F F;  4FH2 A;  5J3W A;  1TS0 A;  3IF6 A;  3LI8 A;  5IS1 A;  5TBM B;  1D1J A;  2L4R A;  2W3F A;  2Y8H A;  3ZNY A;  1GSV A;  4P85 A;  1IEL A;  5GHY A;  5AQ7 A;  4Y17 A;  2ZQC A;  4Z1W A;  3IX3 A;  2HJ9 C;  3QP8 A;  3A3I A;  2O9B A;  2P9V A;  3LUQ A;  4E6X A;  5FI7 A;  1TEM A;  1P9R A;  2B5R A;  5FAQ A;  2GDN A;  1TF1 A;  3GEC A;  4X53 A;  1Q2Q A;  3LYX A;  1RGY A;  3Q82 A;  2Y2H A;  3ZG9 B;  3VV4 A;  1XA1 A;  5F5Y A;  4KG6 A;  1YLJ A;  1FQG A;  2NUP C;  5FQI A;  1F98 A;  1MY8 A;  1S66 L;  1N9O A;  3P98 A;  5JYP A;  1NLY A;  1YMS A;  4R3J A;  1WYB A;  4PM6 A;  4G3V A;  1MZU A;  2EX8 A;  3O86 A;  2X71 A;  5CX7 A;  3LEQ A;  2R9W A;  1STZ A;  2Y2M A;  3IS2 A;  3SH8 A;  3GRJ A;  4ZJ1 A;  3U2A A;  3RFB A;  2KX6 A;  3G31 A;  3FWL A;  1NYY A;  3UY6 A;  2KLI A;  2ZQD A;  4JLF A;  2QJ7 A;  3FG8 A;  3CLO A;  4S2N A;  1WYC A;  5GLB A;  3W4Q A;  2BTF P;  3E2L A;  1HZO A;  5HD5 A;  5U47 A;  5CRF A;  3ICY A;  4N9K A;  2V1A A;  1L2S A;  3MZE A;  1H8Z A;  2VK3 A;  3GMW A;  4KZ6 A;  1YSP A;  4QPR A;  5DF9 A;  5CXW A;  3T4K A;  4HHD A;  5CER A;  4F94 A;  3BYD A;  3H9W A;  4WZ5 C;  5G18 A;  3D4F A;  1H5X A;  1K55 A;  5CTM A;  5CTN A;  1FCM A;  1G6O A;  3CUE A;  3HLF A;  3S1Y A;  2Q0O A;  2XRN A;  4R6L A;  3A0R A;  4KG5 A;  2PD8 A;  1LL9 A;  1ERO A;  4OVD A;  1A0K A;  1GCE A;  4Y15 A;  4I3I A;  2XR0 A;  2M1C A;  3LR4 A;  2O9C A;  5TJJ A;  4D60 A;  4OH0 A;  5CHM A;  1ALQ A;  3ZQ5 A;  1KDW A;  4S2K A;  4WEJ A;  2VZW A;  5HWW A;  3F1O B;  5F69 A;  4EET B;  3VE4 A;  3JYI A;  2DRW A;  5A93 A;  5FQ9 A;  5FAS A;  2JKF A;  5FI2 A;  4MDZ A;  1DY6 A;  3VP3 A;  1PWD A;  3G32 A;  4M3K A;  4ETZ A;  5E43 A;  1YMX A;  4O01 A;  3ULF A;  5EVI C;  1MWT A;  3N6I A;  1VEU A;  3O88 A;  2JN7 A;  1IYQ A;  2ZC6 B;  2WKR A;  2ZM0 A;  4MN7 A;  1GA0 A;  2W0N A;  4X56 A;  3A3E A;  3QNC A;  3ISG A;  1XJ3 A;  5G4Y A;  4BL2 A;  5TFQ A;  4HNB A;  4GDB A;  5EVE A;  1F9I A;  4BMW A;  1MWR A;  1HLU P;  3MKF A;  1W8Q A;  1PNE A;  4MCW A;  5A92 A;  1ESI A;  4EQ1 A;  5HAQ A;  4KZA A;  2GNX A;  4O8G A;  2EXA A;  2PRF A;  3BFD A;  2FZ0 A;  1PI4 A;  1ONG A;  4DE2 A;  1ERM A;  2H0Y A;  3VP2 A;  5F83 A;  3G4P A;  4BEN A;  4DRT A;  3MZF A;  3L7H A;  2ACG A;  4U3T A;  4DXB A;  4I39 A;  1K4E A;  3F1P A;  1PZP A;  2Y2Q A;  4IUK A;  2VX8 A;  3RJU A;  2PU2 A;  2WUQ A;  4UA6 A;  4OQ0 A;  2WKI A;  4GDN A;  2K31 A;  3B33 A;  4U0T A;  3CZD A;  4MBK A;  4O0P A;  5DFX A;  1S6R A;  4E04 A;  3BEB A;  4GB7 A;  2P04 A;  2IWD A;  1SCW A;  4MEZ A;  3CWF A;  3LR0 A;  3EEH A;  2HJE A;  4H8R A;  3R7W B;  1LLB A;  2EX2 A;  4FD8 A;  3BQA A;  2ZC5 B;  4Q0H A;  1IEM A;  4E3J A;  2HP9 A;  2OWH A;  2ZMA A;  3W8K A;  3G30 A;  4DN0 A;  1XGJ A;  1BYW A;  1PIO A;  2XA7 M;  5FQK A;  5DF8 A;  5L2F A;  5CGS A;  4UQI M;  2UV0 E;  1PFL A;  2W1T A;  4ZJ3 A;  3TSG A;  4R3A A;  3VOZ A;  4GNU A;  2K7S A;  4RX2 A;  2JKT I;  4EES A;  4OLD A;  2HP6 A;  2L0W A;  4LPZ A;  2BLS A;  3MR0 A;  1LSX A;  4WBG A;  2QYB A;  3VP1 A;  3PTE A;  1W63 M;  5L09 A;  3CPT B;  1FCO A;  3BM6 A;  4BBT A;  1FCN A;  4K08 A;  3MXQ A;  4GN2 A;  4IHQ A;  2PR6 A;  1XJ2 A;  3JVV A;  2HP5 A;  3LFV A;  4I3J A;  1AXB A;  1IKI A;  2R9X A;  3UE6 A;  2C6W B;  4E3M A;  1MWS A;  2XQZ A;  1MBL A;  4E3K A;  4Y0O A;  5KMW A;  4KQO A;  4P6Z M;  3B3X A;  3C38 A;  4QJG A;  4MN5 A;  3UE1 A;  2Y2G A;  3OPP A;  4S2I A;  4LV1 A;  2QZ6 A;  1NWZ A;  5DF7 A;  1BTL A;  1ZTU A;  3PAG A;  2WGI A;  5M19 A;  4G3K A;  4JGO A;  3V39 A;  2H28 A;  2IA2 A;  4WN5 A;  4BJP A;  4GCZ A;  3S4X A;  2WKP A;  5GL9 A;  3A3F A;  5TR7 A;  4WM9 A;  3PBS A;  1N9N A;  3IX4 A;  5A91 A;  2V0W A;  3WWX A;  4OQI A;  3MXR A;  5HWT A;  1K4F A;  4H6J B;  5FQJ A;  5FDH A;  3NC8 A;  1DP6 A;  2OLU A;  4BBV A;  2ZC4 B;  4P0M A;  1IYP A;  2Q9M A;  3W4O A;  4EQI A;  2PD7 A;  4KZ9 A;  2V9A A;  3O5Y A;  1KGF A;  4GS9 B;  3BLS A;  1CI8 A;  2Y2P A;  4NXF A;  5AJG A;  1PZO A;  4HH2 A;  3NDE A;  4EUV A;  2IWB A;  4Y5F A;  2Z6C A;  1GHP A;  2EA9 A;  3VFF A;  5HL6 A;  2RCX A;  4HJ4 A;  3DWK A;  3IF6 C;  4ID4 A;  4WEL A;  3WS0 A;  5FSR A;  4PM7 A;  1D06 A;  2WKQ A;  2WZX A;  1OTI A;  1BT5 A;  3IH9 A;  4OON A;  5FEF A;  1L3L A;  4KZ4 A;  1F5M A;  2J9P A;  3BFE A;  1CJF A;  3KSI A;  2ZQA A;  1K54 A;  5F6A A;  3ZCZ A;  4WEK A;  3F1O A;  5KZH A;  3PHY A;  2GZA A;  4I5S A;  4DXC A;  3L9K A;  4R4R A;  3C7U A;  4BWI A;  4U0X A;  3S7O A;  1PW8 A;  3LR5 A;  4OQH A;  1S4S A;  4K0X A;  3ZG5 A;  2ZJ9 A;  4M4X A;  1I2W A;  5EUA A;  4KQQ A;  4DDS A;  3LCE A;  4L9E A;  1FSW A;  4YOF A;  3RXW A;  2E8J A;  2ZL1 B;  3U4L P;  4JBF A;  4IVK A;  3NOT C;  2VGJ A;  2XK1 A;  4EBN A;  2PAV P;  4CLC C;  2ZD8 A;  4NET A;  4ARZ B;  4BD0 A;  5EVI B;  3OPH A;  2EX6 A;  4GLQ A;  4X69 A;  3I7J A;  5L10 A;  1BZA A;  4JPM A;  3UPP A;  1W5D A;  3W2Z A;  2XA7 S;  4EBP A;  1J3W A;  4S2N C;  4UQI S;  3EOI A;  3DWZ A;  4BLM A;  1Q2P A;  4NXE A;  1DJA A;  3LR3 A;  4FCF A;  2Y59 A;  1SZV A;  3WS2 A;  4E3I A;  5DJU A;  5DJT A;  3CJM A;  4II7 A;  3MQ0 A;  3HBR A;  4R3B A;  5GLD A;  4NK3 A;  3QP2 A;  1L0D A;  1YSQ A;  4DKI A;  1MC0 A;  5M1A A;  4EV4 A;  3EGX C;  2W3D A;  4X68 A;  4JKT A;  5EPH A;  3A0S A;  4Y13 A;  1SKO B;  2VGK A;  4KEN B;  2XSS A;  3H82 B;  1VHM A;  1K55 C;  1HD8 A;  3BJN A;  2OWJ A;  2V1B A;  3Q07 A;  2V20 A;  3UE3 A;  3CUE C;  2Y4A A;  4MBF A;  1OPX A;  4A5R A;  5DTK A;  3R7W A;  3EEA A;  3VP4 A;  4N9L A;  4DE1 A;  2K2N A;  3F1N B;  2JKT M;  3W4P A;  4I38 A;  4XT2 B;  3RH8 B;  4CLC A;  4N92 A;  1KE0 A;  4BQM A;  4P6Z S;  1VM1 A;  3UN7 A;  1LL8 A;  3JPU A;  2I9V A;  1TDL A;  1DP9 A;  3UDX A;  1IOU A;  4ZJ2 A;  1JTG A;  2ZMF A;  5CEC A;  4L9F A;  2D02 A;  3BFG A;  3M6B A;  1WA9 A;  2XD1 A;  5FA7 A;  4IBX A;  4C6Y A;  3QP1 A;  3OPL A;  3SOI A;  3NDG A;  1H3Q A;  5E2E A;  3LIE A;  4JGQ A;  1HVB A;  1T1C A;  2XEP A;  2YKF A;  4LCL A;  4LGW A;  1LSV A;  3RTY A;  4WMC A;  3Q7V A;  3S22 A;  1PYY A;  3MMH A;  3TW8 A;  1XPB A;  4GJ4 A;  4RVA A;  2VV8 A;  2GX5 A;  3JVU A;  3AGD A;  4HBU A;  1IYS A;  1W79 A;  1YKD A;  3LIC A;  5HD3 A;  3KSG A;  1KE4 A;  5G4Z A;  1ODV A;  3T1S A;  1CI9 A;  4GZB A;  1NZU A;  2JKR I;  1DP8 A;  2CC1 A;  3EGD C;  1JWZ A;  3PBO A;  4OPR A;  5EVI D;  3PBT A;  2PR5 A;  4YIN A;  4WUJ A;  3IWQ A;  3NIA A;  3UME A;  3SH9 A;  3NOP C;  3A3J A;  2EXB A;  3IHA A;  2J80 A;  2ZC7 A;  3OZH A;  1PRQ A;  3HJK A;  2HPB A;  4BL3 A;  1TS8 A;  3C4O A;  3E2K A;  3DTK A;  4B88 A;  1K56 D;  1XJ6 A;  4Q0J A;  3CIT A;  3ITA A;  5J7E A;  4OOL A;  1OT9 A;  3GV9 A;  5HPI A;  4HP9 A;  4LEN A;  4RX3 A;  3HVF A;  4ZTK A;  3VOY A;  1W7F A;  3KYZ A;  3G6O A;  1UWP X;  2QHK A;  4H6J A;  3ZG7 B;  2FFF B;  1W8Y A;  2O99 A;  3N8R A;  1Y4O A;  3BY9 A;  3ZYT A;  4HIA A;  1TS6 A;  2ZQ7 A;  2B02 A;  3C5A A;  1ZKJ A;  4XUZ A;  1KVL A;  4HOI A;  5DTS A;  3UB9 A;  3HL9 A;  3HUN A;  1D7E A;  3FPV A;  2ZOH A;  4KZ7 A;  5E2G A;  1OT6 A;  4JF5 A;  2BAS A;  3T1Q B;  4LRY C;  4B93 A;  4ETX A;  3IWI A;  2O9A A;  3IH8 A;  1ESU A;  1KDS A;  1I2S A;  4DJ3 A;  2Y2N A;  4K0W A;  3PAE A;  1MWU A;  1T19 A;  4HP4 A;  3PR6 A;  2V1Z A;  4YFM A;  2M7V A;  4GHI B;  1P0Z A;  3PBQ A;  2NUT C;  1YPR A;  1VQQ A;  3ZDJ A;  1H8Y A;  3UDF A;  2XGN A;  3NOU C;  2WGV A;  5D3O A;  2H10 A;  4OKP A;  2P7J A;  4PM5 A;  2W27 A;  2J3T C;  4Y2F A;  5FI6 A;  2XDM A;  1K6S A;  3M2J A;  2Y2O A;  5BOH A;  1KGE A;  4IUH A;  2ZM8 A;  3K3D A;  5F68 A;  4C3Q A;  3OLO A;  4X6T A;  5DKL A;  4R38 A;  3UNW A;  4ZDX A;  5EE8 A;  3M6H A;  1G5U A;  1IFQ A;  1ZG6 A;  3P09 A;  3NHQ A;  1BLP A;  1K0K A;  4HY8 A;  1CK3 A;  2ZL1 A;  4FTX A;  1OTA A;  4GW9 A;  4R0Q A;  4LLO B;  2A3U A;  4WLA A;  3OPR A;  4HJ6 A;  2A2L A;  4QY6 A;  3QP4 A;  3KX0 X;  3MZD A;  3O87 A;  2LB5 A;  4ARZ A;  5TBM A;  2OLV A;  3A3D A;  4KG2 A;  3HJI A;  1H8M A;  2XFS A;  4P87 A;  2VV7 A;  5HAP A;  2Z2M B;  1ZC2 A;  3VE3 A;  4G3W A;  1LL5 A;  1NRF A;  3Q7Z A;  5E2H A;  3HLD A;  2V8C A;  3DW0 A;  3FKW A;  5DFY A;  4LFU A;  1EI5 A;  1YLY A;  3MS6 A;  4IJG A; 
#chains in the Genus database with same CATH homology
 3DBA A;  3GEC A;  2PYR A;  4HJ4 A;  3PBN A;  3LYX A;  4NEE D;  3T4O A;  4WEL A;  3IBJ A;  3T4J A;  3VV4 A;  3GDI A;  4GS9 A;  5HZH A;  3IS2 B;  1D06 A;  3H7W A;  1OJ5 A;  4YNR A;  4MN6 A;  5F5Y A;  2WKQ A;  3MFX A;  1OTI A;  2NUP C;  1F98 A;  1S66 L;  3IBR A;  1TD5 A;  4FSF A;  1N9O A;  1F5M A;  5I5L A;  1NLY A;  3KSI A;  5F6A A;  1S4R A;  3H82 A;  1MZU A;  4G3V A;  4WEK A;  4EW7 A;  3F1O A;  5CX7 A;  1NLZ A;  3BWL A;  2QJ5 A;  3PHY A;  1STZ A;  3IS2 A;  3OOV A;  2GZA A;  4R70 A;  3U2A A;  4I5S A;  2J3W A;  4F3L B;  3RFB A;  2KX6 A;  4NKP A;  3LIF A;  5C5K A;  2KLI A;  2ZBB A;  4BWI A;  3S7O A;  3PBR A;  3LR5 A;  1GSX A;  2QJ7 A;  3FG8 A;  3CLO A;  3E4O A;  3T4Q A;  4XT2 A;  1S4S A;  3EQV A;  3B47 A;  3CAX A;  3T4T A;  3T4L A;  2L1M A;  1P97 A;  4LRX C;  4M4X A;  1GSW A;  4KUO A;  3TRC A;  4EU0 A;  5HD5 A;  4L9E A;  3ICY A;  4YOF A;  3UMD A;  4WL9 A;  2V1A A;  2W3E A;  1YSP A;  4QPR A;  5DF9 A;  2JKR M;  3T4K A;  3NOT C;  3OCL A;  2G7U A;  4JGR A;  4RQ9 A;  4JGP A;  4HHD A;  4CLC C;  3S7P A;  2EWV A;  3H9W A;  4ARZ B;  4EER A;  3MF0 A;  3BW6 A;  4L0L A;  1TS7 A;  3B42 A;  1G6O A;  4GLQ A;  2HGV A;  3CUE A;  3W2Z A;  2XA7 S;  4NXG A;  2D01 A;  2XRN A;  4R6L A;  2P08 A;  2R78 A;  4UQI S;  3EOI A;  3A0R A;  2PD8 A;  4NXE A;  3KSH A;  3LR3 A;  4I3I A;  1P9W A;  1N9L A;  2M1C A;  5DJU A;  5DJT A;  3H7W B;  4II7 A;  5LBR A;  3MQ0 A;  2MJ6 A;  1JNU A;  3LR4 A;  3D72 A;  2KDK A;  3E4P A;  2HV1 A;  2O9C A;  1UWN X;  5TJJ A;  1YSQ A;  1MC0 A;  3OBF A;  3EGX C;  2W3D A;  3ZQ5 A;  5IU1 A;  3A0S A;  4PKY A;  4AFI A;  5EFW A;  2XSS A;  3H82 B;  2QWS A;  1VHM A;  4WEJ A;  2VZW A;  4CLC B;  5HWW A;  3F1O B;  5HPF A;  5F69 A;  2VGL S;  4EET B;  3VE4 A;  3UB8 A;  1XFN A;  3BJN A;  2OWJ A;  3HCY A;  2V1B A;  3UE3 A;  3CUE C;  3EWK A;  1OPX A;  4HJ3 A;  5HDS A;  1T1B A;  4OOM A;  5IT5 A;  3R7W A;  3KYQ A;  1T18 A;  4MDZ A;  3EEA A;  2K2N A;  2HF6 A;  3F1N B;  1EW0 A;  2JKT M;  2DMW A;  3C30 A;  3C8C A;  4ETZ A;  4KUK A;  4O01 A;  4I38 A;  2Y79 A;  4XT2 B;  3RH8 B;  3ULF A;  4CLC A;  3PYP A;  2ZMV A;  1V9Z A;  2JN7 A;  2WKR A;  4P6Z S;  3TJZ C;  4MN7 A;  1LL8 A;  2I9V A;  2PYP A;  1DP9 A;  2XRO A;  2W0N A;  4EEP A;  5K5B A;  1IOU A;  5HDD A;  3P01 A;  2ZMF A;  1XJ3 A;  4L9F A;  2D02 A;  5HSQ A;  1WA9 A;  3F1N A;  5G4Y A;  2VLG A;  4HNB A;  2OAQ 1;  1NRJ A;  1H3Q A;  1F9I A;  3LIE A;  3A0V A;  4BMW A;  4JGQ A;  3F1P B;  1T1C A;  2YKF A;  4MCW A;  3D3O A;  1LSV A;  4EQ1 A;  3RTY A;  2VA0 A;  3S7Q A;  3LIA A;  5HDC A;  2GNX A;  3MMH A;  4O8G A;  3TW8 A;  4GJ4 A;  2VV8 A;  2FZ0 A;  2GX5 A;  4PAU A;  3UB6 A;  3JVU A;  1XJ4 A;  3V67 A;  4LRZ E;  2FH5 A;  5J4E A;  1YKD A;  3LIC A;  5HD3 A;  3KSG A;  2YKH A;  5G4Z A;  1ODV A;  3T50 A;  3LI9 A;  2PDR A;  4I39 A;  2JKR I;  3F1P A;  1DP8 A;  3KSF A;  4MMN A;  4IUK A;  3EGD C;  3LIB A;  2VX8 A;  3PBO A;  2OOL A;  3PBT A;  4L9G A;  2PR5 A;  4WUJ A;  3UME A;  2PHY A;  3BQ8 A;  2PT7 A;  3NOP C;  2VEA A;  2K31 A;  2A24 A;  3B33 A;  2J80 A;  1G28 A;  4DMZ A;  5DKK A;  3HJK A;  4O0P A;  5DFX A;  3K2N A;  3NJA A;  4E04 A;  1TS8 A;  1S67 L;  2P04 A;  3BY8 A;  2VV6 A;  1XJ6 A;  4PKY G;  4Q0I A;  4EEU A;  4Q0J A;  3CWF A;  3CIT A;  3E0Y A;  3LR0 A;  3S7N A;  5J7E A;  3EEH A;  1S1Y A;  4OOL A;  4EXO A;  2V0U A;  1S1Z A;  2HJE A;  3LID A;  4BBU A;  1OT9 A;  2O0Y A;  3R7W B;  2W1T B;  5HPI A;  2KOI A;  5KIZ A;  4HP9 A;  3BQA A;  4PHT A;  4Q0H A;  3E4Q A;  2OWH A;  5FL3 A;  4CQH A;  3KYZ A;  3G6O A;  4DN0 A;  1UWP X;  2W3G A;  2QHK A;  2GJ3 A;  1BYW A;  3PXP A;  4H6J A;  2XA7 M;  5HWV A;  1W63 Q;  1DRM A;  2O99 A;  4CLC D;  3VOL A;  3BY9 A;  4UQI M;  3ZYT A;  1OTB A;  4HIA A;  1TS6 A;  2B02 A;  2W1T A;  1ZHH B;  4HOI A;  4R3A A;  3UB9 A;  1D7E A;  4FOF A;  3FPV A;  3P7N A;  2ZOH A;  3E98 A;  2K7S A;  2JKT I;  4EES A;  2L0W A;  1VB6 A;  5L8M A;  4LPZ A;  3T4S A;  1OT6 A;  2BAS A;  4LRY C;  4B93 A;  3MR0 A;  1LSX A;  1T1A A;  4ETX A;  5AVF A;  2O9A A;  2QYB A;  4DJ3 A;  3R4K A;  1T19 A;  1Y28 A;  2VGL M;  3CI6 A;  1W63 M;  4HP4 A;  3PR6 A;  4DJ2 A;  4BBT A;  4K08 A;  2M7V A;  3MXQ A;  1OJG A;  4IHQ A;  1V9Y A;  4UEY A;  4GHI B;  4ME4 A;  2PR6 A;  1XJ2 A;  3JVV A;  1P0Z A;  3PBQ A;  3UB7 A;  5MC7 A;  2LB9 A;  2NUT C;  3LFV A;  4I3J A;  3TE8 A;  5AVE A;  3OC2 A;  2Z6D A;  3UE6 A;  1LSW A;  4NXB A;  3NOU C;  3MJQ A;  1MKM A;  2P7J A;  2W1R A;  2A24 B;  4KQO A;  1LT0 A;  4P6Z M;  2M7U A;  3C38 A;  4I3A A;  2W27 A;  4YWZ A;  2J3T C;  4MN5 A;  4Y2F A;  4GHI A;  2CMN A;  2ZOI A;  3K3C A;  4B9O A;  5A8B A;  1NWZ A;  2VKS A;  1UGU A;  3SW1 A;  4F3L A;  4HI4 A;  1ZTU A;  4G3K A;  3EQU A;  4IUH A;  4JGO A;  1OTE A;  3K3D A;  4HH3 A;  2H28 A;  1OTD A;  2IA2 A;  4WN5 A;  5F68 A;  3MQQ A;  4BJP A;  4GCZ A;  3OLO A;  2VJW A;  4HQA A;  2WKP A;  5J3W A;  5DKL A;  3KO6 A;  4R38 A;  4KQD A;  3OCN A;  1TS0 A;  4ZRR A;  1KOU A;  3PBS A;  1N9N A;  2V0W A;  3LI8 A;  1IFQ A;  5IS1 A;  4WF0 A;  5TBM B;  5HWT A;  2OAP 1;  2EWW A;  4H6J B;  3NHQ A;  1DP6 A;  4HY8 A;  2JHE A;  2L4R A;  3C2W A;  1XFQ A;  4BBV A;  2W3F A;  2QKP A;  1OTA A;  2Y8H A;  4GW9 A;  2INW A;  4LLO B;  2W3H A;  4WLA A;  2PD7 A;  1GSV A;  3FPW A;  2V9A A;  4HJ6 A;  2A2L A;  3KX0 X;  3O5Y A;  4ARZ A;  2LB5 A;  1YAX A;  4Z1W A;  2HJ9 C;  4GS9 B;  5TBM A;  3MQO A;  3HJI A;  1H8M A;  4NXF A;  2O9B A;  3LUQ A;  2VV7 A;  5KSH A;  2J3T D;  5AJG A;  1X0O A;  3VE3 A;  4G3W A;  4HH2 A;  4EUV A;  3FC7 A;  1P9R A;  4Y3I A;  4Y5F A;  2Z6C A;  5DFY A;  2B18 A;  2EA9 A;  4CLC E;  1TF1 A;  5HL6 A;  4IJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...