1XJCA

X-ray crystal structure of mobb protein homolog from bacillus stearothermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
165
structure length
145
Chain Sequence
MNVWQVVGYKHSGKTTLMEKWVAAAVREGWRVGTVKHHGAVATAVEGDGLLQLHLRRPLWRLDDVLALYAPLRLDLVLVEGYKQERHPKVVLVRSEEDWASLQHLANIRAVIAWEPLEGPLAHPVFSLADDDEYIPWLMNEVRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of MobB protein homolog from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
molecule keywords MobB protein homolog
total genus 35
structure length 145
sequence length 165
ec nomenclature
pdb deposition date 2004-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xjcA00
1ZU5A 1Z6XA 1J99A 1G8HA 2I3BA 3QXCA 1R0WA 3LA6A 4TLDA 3TE6A 4RD3A 1II8B 2J87A 4XH9B 4MKIA 3U7FB 3HU2A 4LHZA 1D6JA 5JBQA 1CLUA 2QE7A 4JLKA 4DUGA 1OFTA 2B8TA 4H1VA 4DLZA 1P4SA 1YVDA 2RHDA 3TBKA 4A8JA 2ZJBA 2FPKA 2PCLA 4JBXA 2ZANA 4EFMA 4KJZA 2ZSDA 1C4OA 1W47A 3TR5A 4CYMA 2FZ4A 1ZVQA 2ZRGA 4HDCA 2ZJ2A 2YJTD 3CO5A 4MDFA 1SXJC 4KODA 5BWMA 3M0EA 3AKYA 3QKSA 3BH6A 1DAEA 2IYSA 2JDID 2P5TB 3OIWA 4MUAA 2ZR0A 3W6PA 2YWHA 3BXZA 3IPXA 4LHYA 4XSGA 4ARZA 1GAJA 1T8TA 2JIZD 2ZE8A 1JNYA 3PUYA 4V0KA 2X77A 2J41A 3M1IA 4X8OA 3ZS9A 3OAAA 4DCSA 2V4ZA 2QSZA 4XWKA 2J7PD 5FL7D 5GVRA 3WHKA 4PQFA 1YRAA 4QC2A 3RC3A 3PUXA 4D6PA 4HUTA 2CE7A 4LZZA 4P31A 5GVSA 1N6LA 4K8OA 2GF9A 2WPDA 1KNXA 2CL7X 2P2LA 4RZ2A 4EFLA 5KYKA 1TEXA 4B2PA 1VG8A 1KOFA 1SXJE 1A4RA 2EVWX 2HUPA 2WOOA 3O8RA 2FSHA 2CJWA 3P4YA 3N70A 4G5SA 4BZQA 1CIPA 2Y8EA 4ZIRA 4FMCF 5KUTA 2AWOA 2QM7A 1Q1ZA 3QEJA 1US8B 5FFMA 2QENA 4TL6A 4IHQA 3THWB 2GXSA 2IL1A 4OQNA 3C5HA 4LYHA 5LD2B 3FGNA 3ZS8A 4Z8XA 4JZKA 1SVWA 2D7CA 1JB1A 2WJIA 4GP7A 3U3JA 5JHGB 1TF2A 5KDOA 4B6EA 1TX4B 2A30A 1Z2CA 3GJXC 3H86A 4ZV4A 5J47A 1AZTA 2VHCA 4TLAA 3AKDA 1W0KA 3MMPA 5B58C 1OJLA 2ZRLA 2DWOA 1LY1A 3TW4A 3CH4B 4S35A 5GADl 2ZIAA 1X3SA 3B1XA 3TSOA 1QDEA 3QOFA 4UQOA 5L3SB 1XJ0A 1R6BX 2QRNA 4B73A 3ZZ0A 2PJZA 2CCGA 4NL4H 2K5UA 4XWAA 1IJEA 1QVAA 4UXJA 1ZINA 3BH0A 4NH0A 3U4QA 4DDUA 2NG1A 1P6XA 2ZI4A 3CZQA 4NYIR 3ZD7A 1M2OB 2J3EA 4UNSA 2GF0A 2XNSA 5L3RA 2TMKA 5CYPA 4Q1BA 1M7GA 3I4LA 1XEWX 4LY6A 1JR6A 1S0UA 2OZEA 3NH6A 3WP0A 1G5PA 4Q1CA 1IOZA 2EQBA 4LBYA 1CJMA 1E2LA 1E0SA 3FFAA 5DIFA 3U6KA 2QT1A 2F1JA 1KO8A 2QUZA 4DSUA 3GP8A 5GJBA 4YXWA 1JXOA 5HKKD 3I32A 2J5XA 4HAXA 4WZAE 1U2RA 3RABA 3MWKA 3W34A 1NVXQ 4IOLA 5AJWA 2QN6A 1OH6A 1OIWA 2JATA 2OFOA 3TH5A 2Z6VA 3CB4A 2ZRHA 2WAXA 4Q66C 5EQTA 4TLBA 2IWHA 1NVUQ 5KOYA 5B64A 2IW3A 4U02A 2FEMA 1ESNA 4NZYA 4V0MA 1RFLA 1NP6A 1JR3A 1S3SA 1SGWA 2GBLC 3SEAA 2NGRA 1GSIA 5J4YA 2ZJZA 1D5CA 1KDRA 4RZ3A 2IS4A 4LYJA 4PAQA 2PT5A 3IGFA 2JIZA 1YZUA 2R6CA 1FPMA 2V1XA 3EW9A 2IXEA 2ZI7A 2BCGY 1HUQA 1U9IA 1FW6A 1P2SA 4US2R 5KPDA 2PZGA 2Q21A 3AVOA 3GFOA 4URUR 1GFIA 3QKTA 4J0QA 2V7QA 4JS0A 4BRWA 1KNQA 2ZRCA 1MO5A 1AQYA 2QNRA 2ZYUX 5E3HA 2D62A 2WMNB 4PR0A 3Q5EA 3EPLA 1IONA 2QG6A 4YLGA 3WY9A 3LXRA 421PA 1KI7A 1T5IA 1DG3A 4GMDA 2JLYA 2HCBA 3JZAA 4TTRA 2RAPA 2Z0MA 3RRZA 4NPHA 4BLRA 3WHLA 3NEYA 3WYFA 2XZLA 2O8DA 1I2DA 1P3JA 4GDFA 1XFAA 2BIFA 4C0JA 4PTLA 1NG1A 4D82A 2IX3A 2DFLA 1L4UA 2WZQA 1VHTA 1XXHE 2FSGA 2N42A 2JLZA 2G3YA 2QSYA 1CJVC 2AKYA 3I73A 2VHTA 1EXMA 3MSXA 1J2JA 1KI1A 4S2EA 1JR3E 2E87A 2CHGA 2H18A 1E9FA 3R7WB 2YOHA 5JI2E 1X1SA 3F8TA 3D6TB 1E96A 3AVVA 3BC1A 1ZD1A 4RD0A 2IT1A 5TV2A 3U4QB 2YNMA 2YOFA 2ONKA 2PMDA 5FOXA 3TJZA 2GXUA 4TZ6A 3B1YA 3CNNA 4LBVA 3EIQA 4D4MA 1ZNWA 1E9AA 1P9WA 4P4TA 4B48A 1XCGB 4CRWB 3SJBA 1R10A 3HU1A 3SS8A 1R0YA 4MRNA 2VTKA 4MKGA 3OEEA 3BOSA 2QP3A 4HLUC 3VAAA 4BASA 3EZ7A 3UWOA 1OH8A 5BYKA 4M1MA 4PC2A 3I92A 2GWHA 4R71A 4C0AC 4WOPA 4W5JA 2HXSA 4M9QA 2CK3D 1DOAA 4KSCA 3EWSA 5FBQB 5CB8A 1II9A 1UFQA 1YR7A 4UJ5A 5JCPA 1S9DA 1CR0A 3TNFA 3OFNA 5FPTA 1G18A 4AIIA 3RS2A 2XTMA 1U0HC 3ZH9B 2WKQA 4G5RA 2WVJA 2QAGA 3IO3A 4DLXA 1E2MA 5K8LA 2JCSA 2ZYTX 1XEWY 2H7VA 4FIDA 3DMNA 4FWTA 4IKEA 3K70B 4Q9LA 4DCVA 1IN6A 2YZ2A 3RRYA 3PR1A 3X1ZA 4D0NA 5FTKA 1TADA 1XJCA 3VR1A 1JAIA 1CF4A 3E70C 1JALA 2FSIA 4V0OA 2ZITA 1AS2A 3ZD6A 3IHWA 2HYDA 4CZ2A 1GWNA 4FI3C 3MUFA 2VL7A 3CONA 3EIHA 5TXGA 1E9BA 3VHXA 4BZXA 3KQLA 3A4NA 1ZCBA 3R7WA 2GXAA 4A15A 2X2EA 2R65A 3L43A 5JCZA 1DELA 3THXA 1W44A 4JYBA 1SXJA 2OBLA 3KL4A 1SVKA 4HATA 4EDHA 3DM9B 2EU8A 4IDPA 2QPAA 4DXAA 4AKHA 1K6MA 1LW7A 3RWOA 3TAHA 3SN6A 1DAHA 4KSBA 4TMVA 4H1UA 2AFHE 2ATXA 2J0SA 2BWJA 721PA 1K5DA 5C4MA 2FFQA 2WJYA 2ZR7A 4AG6A 3OEHD 2WKRA 1CS4C 1NLZA 3GQBA 1N2CE 1OV4A 4UNQA 1XZQA 3TRFA 3SYLA 1QHIA 2OG2A 3OE7D 4Q4AB 1NJFA 4Z51A 2CJWB 3LNCA 4JBYA 5AJVB 3P27A 1N25A 3NDPA 3AP1A 2W6ID 1DE0A 4PC7A 2IYRA 5J4HA 2BCJQ 3CZPA 1G5RA 5EUMA 1TQ4A 1RPZA 3VHLB 5L3QA 2DB3A 2J0QA 3VX4A 5AK0A 5E95A 3H2YA 1W7AA 2BEJA 1KIMA 3TQFA 4BECA 3GLIA 3T1QA 4HAUA 4ARZB 3B78A 3P4XA 4CIDA 2IHYA 3ZDQA 4C4PA 4NTZA 1D9ZA 3L82B 3SOPA 1G41A 1II0A 5JFGA 2BOVA 4KO8A 3JZMA 2KBFA 4L15A 2ORVA 2GILA 1FFHA 2RMKA 5TB5A 1ZRHA 1E2DA 2ZEJA 2WWFA 3KKOA 4GFDA 5CM9C 5KNDA 3EA0A 4A6PA 3LVQE 2WWIA 1E2FA 4RVCA 4PO8A 1XTQA 1A5TA 3SE0A 3UK6A 3EZ6A 3GLHE 2G9NA 3RS3A 3DZDA 1RE0A 1KJYA 3E2IA 4L16A 1Z06A 2J46A 2AKAB 3QXSA 4Q4AA 2OCBA 4OHZA 2Q0HA 2O8DB 2VRWA 3D8BA 1KDPA 2VF8A 2ZSAA 1O3YA 5CDFE 2GRJA 2G88A 1Q1QA 4TT3A 3VMFA 4B44A 5JWOA 2REXB 1I4DD 1E1RD 1IXRC 1RZ3A 3PUWA 2BBOA 4RCYA 3U6BA 3FHCB 3JVVA 1CR1A 4Q01A 3WBKA 3B1WA 2ZS9A 1OYWA 2CBZA 5FR1A 4EJSC 2J9RA 2IS6A 2FE4A 4MGIR 3U60B 2FPMA 3RS0A 5HPYB 3U44B 5JRJA 5HZHA 3AM1A 2VO1A 4YQFA 5LDDC 4DCUA 1W5TA 1NVVQ 2H5EA 4GOXA 1SHZA 4P4SA 4EPWA 2D3WA 3CPHA 2J59A 2YINC 2FSFA 1HT1E 5C18A 5KTYA 2I1QA 2ECKA 4PHGA 3QNUA 5H68A 3OIUA 1XEXB 2V8OA 4U5XA 4DEXA 4DLTA 3WBJA 3Q7PA 2BBWA 4JLDA 4MKHA 4K46A 3X1YA 1S1CA 2IYTA 2AR7A 4QBHA 2KB0A 3CBQA 1YZLA 1ZMXA 1S96A 4MYCA 1LVGA 1W46A 2FG5A 2RGGA 521PA 5IRCD 4YDSA 4ZO4A 3ZZUA 1J8MF 1VCMA 1U94A 3PEYA 1ZU4A 3HP1A 5HCIA 1WB9A 1DAFA 1E98A 4Q47A 4LJ5A 1VKJA 1YE8A 2J45A 2XOKD 2ZI3A 1N5KA 3ZIAD 2OFXA 1QHHB 5JS7A 1GL7A 2QMHA 3AF2A 1TUIA 1OT3A 4LX0A 1ZNXA 4RSGA 2OSBA 2BHRA 1OXUA 3SDZA 3QXXA 1GITA 1P73A 2CCKA 4KHZA 3V9PA 4DWJA 1NRJB 2D2EA 4LSGA 4KCGA 4OQFA 4AC9A 4PHHA 2GJAA 4B33A 1EK0A 2J7PA 3UPUA 4UXIA 4JVNA 3OAAD 5IK2A 2ZI6A 2YKGA 1COWA 2A9KA 3PQCA 3RANA 1JEEA 1XEXA 3PUZA 4LJ4A 4N0DA 2WWHA 1T3HA 1JPJA 5FTMA 1RRFA 3MFYA 1FOEB 1VG0B 2WJHA 3ASZA 1E2NA 5DI3B 1H8HA 5GJWC 4DB4A 4M4SA 1G21E 3E5HA 4O25A 5AJXA 4EPRA 1HURA 4FW9A 3U44A 4PPQA 1OH7A 1JJVA 1BOFA 3H0KA 1M34E 3CWZA 3QSYA 1MKYA 2FV8A 2OCYC 1AZSC 4MRPA 5TY0A 2OV2A 2UZIR 2NO1A 5FPHA 2NTYC 1W4AA 2QA5A 1F5NA 4TLEA 1CKEA 3CNOA 4R2HA 3MWYW 1KK1A 4ASUA 5CITA 4A82A 3THYB 1NI3A 1KDTA 1KK0A 3A1VA 3PCRB 4KVAA 1Q21A 1FX0B 1XX6A 2QEQA 2VQSA 2ZU6A 3QVVA 1RYHA 3AQ4A 1SVIA 2HJVA 3NG1A 1T3SA 2XXAA 1L2TA 3B9QA 2XTNA 3I5XA 1M8PA 3K9LA 2YC2C 1QHXA 1Z08A 2GCOA 1E79A 4LGMA 3TK1A 3BB3A 2GBLA 1YZKA 1Z0IA 5FPYA 1QVRA 2PLRA 1FNNA 4Q7KA 3IIKA 1XPRA 4A36A 2C78A 2IEYA 4PZLA 4QGHA 4TMTA 3TKLA 2AK3A 4UNPA 1R5BA 1Z2AA 3CF6R 4B3DA 4FN5A 3H84A 1OYYA 2YWGA 4MH0R 4A2PA 2PZFA 2AHOA 2VHJA 4I4LA 3RS5A 2W2TA 1N6RA 4LBZA 1DPFA 5ANRB 3PG5A 2RGXA 1GKYA 5BN4A 5K8UA 4AKEA 1T6NA 1XDBA 5EE5B 3TGPA 1DO0A 3CF2A 4OQXA 4FMDB 2VIIA 3A37A 1T0HB 1P2TA 4PSVA 2PLFA 3M6AA 3GJ8A 2ATVA 5L3VA 2LKDA 2RCNA 4US0R 4LV8B 3EZFA 5LB4A 3DOFA 2ZJOA 2VHQA 3MAAC 3WNDA 3ZIAA 3M4YA 2V1UA 1SZPA 3GD7A 2BV3A 4DT1B 1VCOA 2EFGA 3H4MA 1XCMA 1KDOA 4PO9A 1LTQA 5HCNA 3K0AA 4URVR 2A5FA 2IYWA 4F92B 4C0QC 1QZXA 3OIVA 1F48A 1N5IA 4I1VA 5KNBA 5FTNA 1SVMA 3AGPA 4B3GA 2QP4A 1DAGA 1IHUA 3GLHB 2BJWA 4ZCMA 1AA9A 2BMEA 3SQWA 1Z22A 2NQ2C 2C8VA 3GEIA 3TUIC 4C30A 1G6OA 1XF9A 2ANCA 3G82C 4UNRA 1XD2B 3VKWA 1ZM9A 3QG1A 1M74A 4NONA 4Q9IA 4Y0AA 3IO5A 2O8BA 3P26A 2F1RA 2CVHA 2ZYVX 2GJ8A 2ZS7A 2G0TA 3MCAA 3I61A 1IQPA 5E7IA 5L3QB 1W36B 1N6HA 1RW4A 3A4MA 4Q1DA 3R20A 1UBFA 4Q7JB 3FHOA 4GOJA 2PX0A 3AF0A 1GKIA 1ZD9A 2RGNC 3D3QA 3E1SA 1W2GA 1OXVA 2Q3HA 3Q9LA 4KFSA 3LWNA 3GEHA 1DADA 4TTQA 4BUJA 2CNWD 4EPYA 1YHNA 3EPKA 1W1WA 2P67A 4M9SA 2BVNA 2B6HA 1H8ED 4B6FA 3T1OA 4ZDKA 1Q20A 5JJLA 2F9LA 4B43A 5FOVA 1IXZA 5JMTA 4P33A 3MWJA 2F6RA 4WZ6A 1CBUA 5CIQA 3FMIA 1G1MA 1ELOA 1KJWA 3CRW1 3QUSA 5JJIA 4DDTA 2GXQA 2ANBA 3QY0A 4YMUA 2NO7A 2QZ4A 1KY3A 4EIWA 3ADBA 1XMIA 1Y63A 2GK6A 5DN6D 3ZVLA 1G3RA 2G0NA 2Q9BA 4ASUD 4ZKEA 4M1TA 1PUIA 5SZHB 3PXGA 2QT0A 3VR5A 4LUCA 3GLIB 3ADCA 1N5LA 2QTFA 5FL3A 1GG2A 1KTVA 5CLQA 3SBEA 3CRVA 4LDJA 2EW1A 5KSOA 2IWRA 5FTLA 3LBIA 3BD9A 4Q4HA 1FZQA 1P60A 1E79D 1UKZA 4DLYA 2JJ8A 3FMFA 1SHKA 2FWRA 5F98A 1OFUX 2WV9A 1KI4A 3K0SA 2NPIA 5FTJA 4LCBA 4OI1A 4LHVA 1BH2A 2VP0A 1JECA 1OFHA 4Q48A 2IC5A 1NMYA 4CGZA 3CPJB 2IK8A 2OCAA 2P6RA 3TR0A 4CEHB 1Z0AA 1IY0A 3QEOA 1R5OA 4M9XA 3AB3A 3HPRA 1K8RA 2VF7A 4NMMA 1COWD 1KKMA 5J5CA 1KO1A 1UKYA 1E2KA 4AYWA 1EWQA 4D25A 1SKYB 4B34A 1E2IA 1Z6TA 2V54A 3EG5A 4EUNA 3OZXA 1E2PA 2H92A 2MMGA 1BKDR 1KKLA 4RFSA 1VG9B 2O0KA 4W5WA 2BC9A 3C7KA 3TLXA 4BEBA 4GPTA 2W83A 4JLNA 1X8JA 4JLMA 1GZSA 3SC3A 1IBRA 1VIAA 1H8EA 2ZRIA 1OHHD 3Q8XB 5FI0B 4Q4JB 1S3GA 3U5ZB 1ZM7A 2XOKA 4HB3A 1TF7A 1EFRD 3KKQA 3QF4A 4JL6A 3QQ5A 2R62A 2ZE7A 5K8TA 5TMPA 4R9UC 2BMDA 5JHHB 5EXPA 3IKJA 2GVDC 2GDJA 4LC0A 2ERXA 2ZJ5A 3DM5A 3CRQA 3K70C 2QPOA 2VP4A 2OAP1 2CE2X 5DYIA 1G3IA 3K1JA 5K8IA 4TL7A 1JQLB 2FJUA 3LW8A 2ZRJA 4QFMA 4UKDA 5D3MB 5J4VA 1E9DA 1AKEA 2QAGB 2QTHA 4LI0A 2REBA 1OXXK 4LJ7A 2XNDA 2BEKA 4N0EA 3GEEA 3F5FA 2WIBA 2A5JA 3LD9A 1R5NA 4ZPXA 5JWRA 1NSFA 1P5ZB 1XTJA 1CJTC 1WXQA 2C03A 2DY1A 1GNQA 5BN5A 5LBIA 1XXHB 2AK2A 4Q1AA 3RS4A 5F3WB 1Q0UA 1FNMA 4FD2A 1SKYE 1KSGA 3K0CC 4GRAA 3BK7A 4W7SA 5JRZA 1NVVR 4F4CA 1XTKA 3LFUA 3FTQA 4KFRA 1RC8A 2F3RA 2YC4C 4BEJA 4TMWA 1TTTA 3TW8B 1NN0A 2BBSA 3OIYA 3FKSD 3KJGA 4U7DA 1XTSA 2GAOA 1IN5A 3D7MA 2JLWA 1UM8A 2XZPA 5FH9A 3UXMA 4LPKA 3OF5A 1KAOA 1GDDA 3EC2A 2NZ8A 2ZROA 1WMSA 3HR8A 2GJSA 4GNKA 1XWIA 2P65A 2XGJA 1EFTA 2CVFA 4G5OA 3K0EA 3C8UA 3W3AA 1TEVA 1CTQA 1G7SA 2WBLC 3IEVA 3VR2A 3U2QA 4LV5B 1SQ5A 3Q72A 3NC1C 2CHQA 4X8MA 1TL7C 4Z1MD 1UBGA 4IDHA 4B35A 4DSOA 4MDEA 2ZM5A 2F1HA 3TVDA 4RD1A 4TN1A 1UKVY 3B1ZA 1ZM3A 4EAQA 1Z29A 2ODNA 3DKVA 3RSOA 1R0XA 1OIXA 2ZQ5A 5EP2A 2DFNA 1FX0A 2HLDD 2DCUA 2X1VA 4DDVA 3A1UA 1E99A 3ASYA 3HDTA 1DAKA 4TLCA 2QAJA 1MRSA 3CR8A 3KKPA 2ZRFA 1SXJB 3QPUA 4FCTA 1Q1EA 4IVPA 4A2WA 4UNNA 1N3BA 4WAUA 1PLLA 1AIPA 3L0SA 2OILA 3W6NA 1JQJC 3T15A 3OEHA 2CNWA 4FMDF 4NBSA 4RKEA 3UG6A 1KHTA 3LBHA 2BM0A 2GEUA 2IA5A 4XWOA 3NDBB 4X8HA 2IS2A 1DVRA 4A4DA 3P20A 4G01B 2WJJA 2FEOA 4P0TA 1F2TB 5DN6A 4WBSA 3SFZA 2NZJA 3A36A 2P0EA 4WVFA 2GTPA 1ZW6A 2P6UA 4OBEA 1JR3D 3CLVA 5FBLB 1YR6A 4MYTA 4QHYA 2CMKA 3IQWA 4BLPA 1ZCAA 1YR9A 1QG4A 5AR1A 2HDNB 2V3CC 4F93B 5KSYA 1JXMA 4M2LA 1VECA 4NYMQ 1FUUA 4POAA 4ZCLA 2VYFA 1HT2E 2C2HA 2OAQ1 3IEUA 2QP9X 2OM2A 4IVQA 2JLXA 2W6JD 3OE7A 2C98A 2CLSA 1S2MA 1DARA 3SJCA 4PHFA 4DCTA 5FUWA 3KFXA 2MSDB 4I99A 3SBDA 1AGPA 3LQQA 4KXFB 1B0UA 3A58B 3A4LA 5DI9A 2D7DA 4MQBA 2NO0A 4TYWA 3O47A 3QPWA 2OXCA 2XXAB 4JSYA 1EGAA 5FUXA 2ODWA 6Q21A 1DTSA 4B3XA 2P6NA 1OW3B 3QG5A 4C3ZA 2OHFA 1Q44A 4JKIA 3R9WA 2F43B 3DEFA 1ZIOA 1DEKA 4URYR 3UMFA 2ZSEA 5EE1A 1W4BA 3I8SA 4YMSA 2UKDA 3GCGA 4QKQA 4M1WA 1KI8A 1VYVA 2ZAOA 2J0UB 3IQXA 4M9ZA 3CF0A 3IBGA 4P32A 2W2VA 1YU9A 3U3KA 3T1TA 2YYZA 3FMPB 5HE8A 1G4AE 1KI6A 2RGNA 3MRSA 3Q5DA 2FA9A 3OEED 3T06B 4HAYA 3FVQA 1W0KD 4CEJB 1N6PA 4RZUA 2ZRNA 1KJZA 4M8NE 4PXAA 4WXPA 5JEEA 1Q1BA 1B23P 3R8CA 5DGXA 2H1LA 3HWSA 3KZ1E 4OK6A 3J81k 2OLJA 3UKDA 1Z0FA 5AUOB 2J1LA 2QMEA 2NIPA 3K09C 2XAUA 4QJ3A 3I5YA 4HB0A 4KLNA 3AF1A 3KTAB 4BFZA 5CYOA 2WIAA 2F55A 5J40A 1S8FA 4CT5A 2JLRA 5F2EA 4IEEA 2IYVA 5IT5A 4AURA 2V6JA 5IHPA 1E2QA 1KI2A 1NJGA 2ZRPA 3KFVA 821PA 1G7RA 1AK2A 2I1VB 4WXRA 1RIFA 2RKOA 2IUUA 4BLOA 2WWXA 4ZIRB 1A2KC 2OT3B 3ICQB 3W6OA 1R8SA 4ACAA 3U61B 2FFBA 1XNJA 2E9SA 1OE0A 1E4VA 3HJNA 2GEVA 1TUEA 4MGKR 5EP1A 3X1WA 4RKFA 5JLJA 3N5CA 2JLVA 1DO2A 2ODBA 4BPBA 2QRZA 1YR8A 4DKXA 4DSTA 4DC9A 1JAHA 1N6KA 5SZKB 4DSNA 3QKUA 4P3YA 3ZLJA 2IS1A 3RWMB 3LBNA 1IN8A 1RYFA 3GLGB 1ZNZA 2OUKA 1GL9B 3PFIA 1TU4A 3B85A 1OFIA 3GLHA 3LY5A 2AXNA 4Q21A 1KI3A 4NYMR 3MLEA 3FHTA 2Q9AA 4JSTA 4P4SB 3VNVA 4WZBE 1D2EA 3CX6A 4OKSA 2D06A 5G41A 3DOEA 4A2QA 3ZZTA 3B5JA 4EPXA 4US1R 3CH5A 5EZ6B 1JPNA 3KXLA 1HE1C 3L0OA 1E9SA 4D0LB 2C77A 3RHFA 1NBMD 3VTKA 1Z28A 2Z5FA 3X1DA 3GMTA 2MSCB 4JJZA 3VU9B 5JECA 4DLSA 1W48A 4MITA 1XP8A 1R8QA 5KU1A 2V7QD 2C9CA 3SQXA 4X8LA 3ND8A 1US8A 1CRQA 2RGEA 2YOGA 3C4JA 2ZUDA 3AP2A 4IXNA 1U0LA 3FWYA 5KSPA 2Q6TA 1KMHB 2DYKA 4HZUA 4HLCA 1YZNA 3NBZC 1WRBA 2JJ1D 2CHVA 2KJQA 3AGQA 4FCVA 4I1SA 4MYUA 2RGAA 1NF3A 4ACBA 4AY2A 5FBRB 4EKDA 4NCNA 2X2FA 1SVOA 1T9HA 1DG1G 2NPFA 5FPKA 3K09A 2I4IA 2YWFA 1LB1B 1H65A 4JL5A 3EA5A 3KJEA 5SZJA 1FQKA 4B71A 2WICA 2CCJA 4O2RA 2NO6A 2R2AA 4QBFA 3W8RA 2B21A 4HLDA 5FR2A 4ON9A 3BERA 1N6IA 3T5DA 1TAGA 4QG7A 1LV7A 3H1TA 4A8JB 1Q3HA 4ILEA 2D74A 5KNCA 2KE5A 2PMKA 2GHIA 1Z6YA 2WJVA 2ZI5A 5EXSA 4B76A 2B7CA 1U90A 3K0CA 1WQ1R 3BJIC 1E32A 1U0JA 5TVKA 1YZTA 3VQTA 2VSOA 3MJHA 2HXYA 4HUQA 1EX7A 1ZUHA 4TL9A 4RFVA 3EX7C 3VR4A 4TMZA 1Q57A 1XU4A 1UEIA 4L9WA 4QGGA 2V6IA 5DNYB 3MD0A 1BMFA 3MJRA 4OI4A 2AD5A 1G8FA 3TVTA 1L4YA 1WBBA 4JLBA 5FUVA 4QM7A 2WSSA 1VCNA 4YDHB 1UBEA 4IOMA 2EFDB 2ZE5A 1QG2A 3BWDD 2ZTSA 3FDIA 2FGJA 3MWLA 4BLQA 5JSZB 4MKFA 4IDQA 1U8AA 3RS7A 3WNBA 1M7HA 3BFKA 4Q18A 3SU8A 1W49A 2OXRA 5EP4A 1IN7A 4IOKA 3NH9A 2GCOB 4AYTA 2YHSA 3ZVNA 1ZIPA 4DDWA 1IY1A 3C41J 3T61A 4IW3B 3RLFA 5E4FA 3BB1A 1HV8A 5FL7A 2Z4SA 2XSZA 5IDVA 2O52A 2O8CB 1WP9A 3S1AA 3NHBA 4B32A 1C1YA 1GIAA 2H57A 1XJQA 1W36D 1W0JD 2PT7A 1WF3A 4OI0A 1Z0JA 3WRXC 1UDXA 5H1YA 1XEFA 5D3MA 4XOIA 1QHGA 5CLLA 4DLVA 5FOWA 4JJKA 5CK5A 2XJ4A 3IBYA 3LH5A 1GKUB 4QHTA 1GILA 1HE8B 1R7RA 1VIYA 3Q7QA 1DS6A 2IUTA 3VR6A 1D2MA 1G64A 2FFHA 4BFYA 4NDZA 4E5UA 3DVLA 2W58A 1Q22A 1XD2A 4AWXA 2XZOA 2QI9C 2WHXA 2FF7A 3TAUA 3HYTA 5J4KA 4OHWA 1N6NA 1DBSA 1SXJD 4G5GA 2IYXA 4AKIA 2VP6A 2UVQA 5LD2C 3B13B 3OESA 3SYKA 3UANA 1K5GA 1NKSA 2HT6A 1UJ2A 3CRMA 1PZNA 1P61B 4OQMA 1TPZA 1SVSA 4CVNA 4XIGS 3CRRA 1G9XA 2ZREA 4LJAA 3FKQA 4HUQB 4AKGA 1QF9A 2AX4A 3FMOB 4Q1FA 4C0LA 4DLWA 3KTAA 4TYPA 4B2LA 2ZS8A 1KZGB 5EE0A 1OIVA 2XSZD 4MRVA 5IK2D 2BKUA 4LWZA 4HB2A 3LLMA 5JZVA 3SHWA 5DO9A 3PVSA 2IXFA 4AD8A 2FOLA 5BQ5A 1XMVA 4F4IA 3BFXA 1F6BA 2FGKA 3GJ0A 4Q1EA 4XD7A 3V4RA 2O5VA 1T0JB 4QJ4A 5LB2A 3T35A 4DT1A 1CU1A 5EP3A 3S1AB 1YKSA 3CIOA 1NBME 1NL3A 4CF7A 2Q9CA 5F9FA 2HCJB 4Q5IA 1ZUNB 2QAGC 2IBMA 1NIPA 1VCIA 2ZETA 4KVGA 1E9CA 2WWYA 1YZQA 2C04A 1LF0A 5KDLA 1MV5A 1A7JA 2QMOA 2WWWA 4Q02A 1KO5A 2VBCA 1KO7A 3QF4B 2C96A 3THXB 2QQEA 5L8VA 2ODEA 1MO3A 2YWEA 3KUCA 4UJ3A 3K8YA 3B7GA 4LJYA 1XTRA 2D2FA 4IDOA 3L8ZA 1KSJA 2ZRAA 1BS1A 1KAGA 2WMOB 1NMZA 4BFXA 1X8LA 3NC0C 4QNRA 1U98A 3NKVA 2IUSA 4PPFA 1W36C 3PEWA 1G7CA 1G3UA 1GOTA 2GZAA 2GZDA 4GI7A 5AJYA 4W9MC 4B74A 4KV9A 5KO2A 1II8A 1J70A 1SKQA 2OESA 3PIRA 3A1WA 4F38A 3ND9A 1ZBDA 3NIBA 3V4FA 4EFNA 1FP7A 4AI6A 1CP2A 1KY2A 2FU5C 1AN0A 1NG9A 2XB2A 5CM8B 3THWA 1NIJA 1S1MA 2RGBA 1HY3A 3KX2A 3NHAA 3WYAA 1ZYUA 2A3RA 2LKCA 5DSZA 2EYQA 3QXJA 4ZCIA 4M0LA 1RRCA 3LV8A 1BYUA 1HA3A 4XTRA 3KQKA 1GM5A 3DKPA 1EFCA 2XB4A 3I8XA 4PPGA 4Q9KA 2HT1A 5DHFA 4A9AA 3DO6A 2W6JA 2GK7A 2JJ2A 1UF9A 4TYYA 1XD9A 1YQTA 1ZNYA 2PZEA 3EAQA 2FMXA 2REOA 4XD7D 2GCPA 2FPLA 2F3TA 4Q9JA 1KYIA 2VP5A 1GNRA 1FUKA 3DZ8A 1UAAA 3B9PA 5DI3A 1FQJA 1IAQA 5AWFC 3T5GA 3KKMA 4BWYA 1NY5A 1OSNA 1E2JA 1GTVA 1TQ2A 4PC6A 3LW7A 3AH8A 1ZM2A 2IEZA 4Q4JA 4AG5A 2DHRA 4YMVA 1F2UA 2A5YB 3QENA 2R6AA 4IRUB 4NHOA 1KI9A 3VR3A 3REGA 621PA 1YJ5A 1G5TA 1WDTA 2EWVA 2V55B 1W5SA 3C16C 1T4GA 2GZHA 2Q3FA 1MABA 1M6NA 2IHBA 4O3MA 1TQ6A 2G77B 3QVUA 1E4YA 1HH4A 4R7ZA 3K0AB 4QM6A 2FH5B 3THYA 2QBYA 3MGCA 2F1IA 4D26A 5HKKA 2PJRA 4R98A 2C95A 1HTWA 2DWPA 4LRWA 3TSZA 4KBGA 4PZZA 3AF3A 2ZUBA 3RNLA 1IXSB 3A6PC 5EXXA 2IXGA 4Q03A 1J7KA 3LLUA 1P75A 4Z1MA 4QJ5A 3NTUA 3SR0A 4GMXA 4NYJR 3LO5A 3BGWA 4YC7A 5BW8A 1N5JA 4Q4LA 4XVUA 3GLFA 2IYZA 3AVTA 2GESA 4HSEA 4G5QA 5ELXA 4II7A 1XRJA 1YZGA 4DLRA 4C7OA 1XMSA 1WBDA 2PH1A 4L8GA 2Q3MA 3BFVA 3RSLA 3UIEA 2HLDA 3PITA 4H9GA 4JLPA 4XJXA 2OEPA 2HF9A 4LJ6A 3WMFA 1M7BA 2GAAA 3G0HA 4RD6A 4C0HA 1WE2A 4A0GA 1E6CA 3W8NA 2R6DA 4QBGB 2RH5A 4C9BA 3IHLA 4TWZA 1RVDA 2QBYB 1Z5ZA 2ORWA 3FKSA 2AFIE 3EC1A 4DLUA 4MRSA 3IPYA 5J4LA 3B8HA 4B75A 1G19A 1Z0KA 2OFWA 3V00A 5FBVB 2Z43A 3EIEA 2WOJA 4TYQA 3KXKA 2H16A 1KZ7B 1XXHA 2AN9A 4M1OA 1OKKD 3AUXA 2HYIC 2GETA 1JBKA 1OLOA 4ITRC 4ESVA 3QXHA 1G3QA 3MG9A 1E0KA 2J0VA 2EFHB 2W00A 3P32A 1XD8A 4FMCB 1G6HA 1LS6A 4XTCS 5P21A 5IF9A 4BFWA 2V9PA 4HAWA 1EFUA 2HV8A 2XITA 3CW2A 3RRNA 4C7OB 2GA8A 1QHYA 4TQUS 4KLZA 4HI0E 4LHWA 2WPDD 4OJQA 2KSQA 4D0GA 2WTUA 4EQ6B 121PA 3UG7A 4NP6A 2UZ3A 4CT4B 1BYIA 2QMUA 3FOZA 2E1RA 4RFSB 1I2MA 2IYQA 3UATA 3TUZC 1Z47A 2ZRKA 1VTKA 4JBWA 2JGNA 5B2ZA 2ZVQX 1ZC3A 1TF5A 3F3YA 1XPOA 1NMXA 4DRZA 4HDOB 1KSFX 1G17A 3WMGA 1ESMA 1XPUA 2JDIA 2GJ9A 3TUJC 4OHVA 1P2UA 2QL6A 2OLKA 2PCJA 4LK2A 4NU0A 1OHHA 2KBEA 3O8DA 3L2OB 4MRRA 4TQ9A 5CJPA 1PJRA 3BRWD 1I4TD 3N2IA 4RD2A 3NXSA 5EXTA 1FMLA 3W5IA 3TIFA 5KDDA 3F0TA 1EWRA 1F2UB 1G291 4V02A 3X2SA 8OHMA 3WYGA 4TTPA 1V43A 2HJGA 4R2IA 3W3ZB 4O0MA 1EG7A 2R9VA 4V0LA 1CRPA 2A78A 2WJGA 1UKEA 3RYTC 1G8PA 4HDQB 1X8KA 5TDHA 5DLQC 2AXPA 3VX3A 2IF2A 3SFVA 4E22A 5EUQB 3HPQA 3AVPA 3QJYA 3CM0A 2G1JA 4LV6A 3GLGA 2BBTA 1QHNA 2HEIA 1X86B 1G7TA 4GSYA 4YONB 5EE9A 2O8EA 1JI0A 2VSFA 2FNAA 2B7BA 4DIEA 3KJIA 2ZRBA 4Z54A 5E7JA 2IYLD 3PEVA 1CEEA 1RKBA 3PENA 4QGFA 3A1SA 3WRYC 2QQ0A 1OXSC 1NNEA 1M1YE 4F4JA 3SNHA 4ZI2A 4PAMA 4LBWA 4DUGD 1ZD8A 3CWQA 4TSFD 3EXAA 5AUQA 3THOA 2O8EB 5FI1B 3LX8A 4PQYA 3NEJA 4TQAA 4KAXA 3ICEA 1VYUA 4HB4A 2QM8A 2Z83A 5TARA 1OF1A 1FMJA 2BDTA 4Z8YA 2IYUA 5C1BA 1KMHA 4ZDJA 1E9EA 4MGZR 2FDCA 2WKPA 1MH1A 3W5JA 3RC8A 4ESHA 2ONJA 4PAOA 2SHKA 3FPAA 4JVLA 3IIMA 3AVQA 2ZJYA 3CNLA 1XB2A 3SJZA 2RGCA 2ZU0C 1MOZA 3TQCA 4GZLA 4IFBA 5KHOC 4JT2A 4QRHA 3EZ2A 1X6VA 2JASA 4D4KA 3TMKA 2WSMA 4DBLC 1HEIA 1CR2A 2KWIA 2O0JA 2FFAA 4FWIB 4EQ6A 3VKGA 4M53A 4DJTA 3GLIE 4OHYA 1OB5A 2QROA 3KXIA 3AKEA 3A1TA 4DVGA 2ZI9A 4EJSA 4D4LA 3B60A 1U99A 1LFDB 2ZXUA 3LRPA 3BS4A 1Z6AA 2OCPA 5DH9A 4O2LA 2LCFA 3Q85A 2NMVA 1CR4A 1KMQA 3AP3A 1GP2A 4A6XA 2GKSA 3BIFA 3RRMA 3ZVRA 4MYHA 4BLSA 2BM1A 4XVRA 1AGRA 3QE0A 4BRUA 4HZUB 2ZR9A 2ZYWX 3NVAA 1R0ZA 1YRBA 1LNZA 3ADDA 5DYGA 5FBWB 4V03A 4LYAA 4MGYR 4DB2A 4IVRA 1RJ9A 1E9RA 4NE2A 4PANA 2H17A 1XMJA 5E7MA 5CDFA 4WA7A 3EPHA 3NWJA 4D81A 4KBFA 2JLQA 1BIFA 2ERYA 1GRNA 3R8FA 1VHLA 3B6EA 1QHHA 1P7CA 4Q9HA 4Q00A 3BORA 4A1FA 1G8GA 3I3SR 2QPTA 4KU4A 3K9NA 1ODFA 5CB6A 4HLQB 3GJ4A 3FE2A 4JMPA 1XCPA 2OBNA 4E03A 4D2IA 2YV5A 3LDAA 3UMRA 1F2TA 3GLFB 2VH5R 3KB2A 2G83A 4TL8A 5SZIA 5BN3A 5JI3E 1QRAA 4URXR 2FX3A 1FP6A 2DR3A 3EWAA 5G3ZA 3QPVA 1E3MA 4JLVA 1HQYE 3DDCA 3AKCA 1C9KA 4IFEA 3K9HA 1NN5A 2B8WA 2GVZC 4FMBB 4ZDWA 4CEIA 1GRRA 2A2ZA 3NBXX 2B92A 4PX9A 1AM4D 2O8FA 3NBYC 3OHMA 4RCZA 1IN4A 2PBRA 4PZYA 1E2EA 2JJ1A 4TT3D 1ZP6A 4ERNA 5C2JB 1E1QA 1EFRA 2P3SA 1VMAA 2CDNA 1D2NA 1EX6A 1G3MA 3PUVA 4GT1A 4JVSB 2ZSFA 3WMEA 4GBMA 2ZRMA 3K70D 1F3OA 1PV4A 4PSKA 4DHEA 1XBTA 1T5LA 1TMKA 2YVUA 4A92A 1N6OA 2XTZA 3BBPA 5AJZA 4A0HA 2HF8A 3TSWA 1NY6A 2O8FB 3EZ9A 4BGDA 1N0UA 4A8JC 4U00A 3KQHA 4NCKA 2QE7D 1MRNA 3FYHA 1NBMA 2EYUA 3CKLA 3CR7A 4FCWA 1S9HA 1IY2A 2JEOA 3AF4A 3DMDA 3LXXA 1PLJA 4HAZA 3HYRA 1OB2A 1AS0A 2OO7A 5KSZA 1FTSA 1TNDA 2VA8A 5C46F 2O8CA 221PA 1Z07A 1OPXA 1Y3AA 4OJKA 2G1KA 5H8WA 3ADKA 1L8QA 4HAVA 4CEIB 1MO6A 2CL6X 2GEDA 1KI6B 2QTVB 2DBYA 2NO9A 3A8TA 5JS8A 5BXQC 4KITB 1IJFA 4Q19A 1L7VC 3GLFE 1GL6A 3UWKA 1J8YF 3GFPA 1QHSA 1NSTA 4OL0A 4NYJQ 3U3MA 2DFKB 2XJ9A 4XVQA 1E0JA 3BB4A 3QKSB 5CJ2A 5JJKA 2F7SA 4LJ9A 4C0SA 3QIAA 3W9YA 3FFBA 5HZKA 1Z0DA 1NLYA 1NKTA 3O8CA 5C4GB 5JEDA 3U7GA 1U9IC 3C15C 5DISB 5EE3A 3AVXA 2DFTA 5AUPB 3ZQ6A 3U3OA 1VYTA 4JLJA 5LPNA 2IF0A 2PL3A 4JVMA 4M22A 4KYUA 3SZRA 2ZUCA 2VP9A 1XTIA 3KUDA 4PQRA 4OK3A 3QKRA 4B3FX 5KPJA 1R4AA 4MA4A 3I62A 4BLTA 4YMWA 1PUJA 4G0NA 4V0ME 4TMXA 4DIDA 4JIMA 5EJEA 1N0VC 2JJ2D 3IILA 3L0IB 1H8HD 2FZLA 3R9IA 1T91A 2JLUA 1W4CA 3L0PA 1Q12A 1AJEA 2ORIA 3RDPA 3IDQA 3VKHA 3U3RA 5F9HA 3SYNA 4LC1A 3C5CA 1MR3F 1CXZA 2RB4A 3K0FB 3PEUA 2R6GA 4JKYA 1ZM4A 4BZPA 4JLOA 1OXTA 4OI2A 2ZVPX 3B2EA 3ZQJA 3IIJA 1FL9A 2CLDX 3AEZA 1GNPA 2BMFA 4HZIA 5FOTA 3T34A 4TMKA 5DHAA 4MUBA 2R8RA 4M1YA 4E07A 4Q7LA 1PVOA 1ZJ6A 1BO6A 1AQUA 1G20E 3QI2A 5D3QA 5G3YA 4JT4A 3AUYA 1J90A 2C9OA 1UADA 2F43A 4PC1A 3FB4A 4DZZA 3AVWA 2XNDD 1Z63A 2VP2A 2ZAMA 1GUAA 4URWR 4AYXA 3PJRA 3B1VA 2ZRDA 4I81A 2C5LA 4CEHA 1ZAKA 1OKKA 1U8YA 5M04A 3JVUA 4B3BA 3KKNA 3WNCA 2N1BA 4HLUA 5B57C 1N0WA 1UDWA 2IYYA 1EFHA 3EPJA 1VDZA 2G6BA 1KGDA 4ABYA 4KFTA 1FTNA 3K9GA 3RAPR 3LAWA 2PX3A 4QGAA 3CX8A 5A5GA 1TQDA 4IXMA 4RY2A 4C2UA 1NN1A 1ETUA 2P5SA 1ANKA 4D80A 4ZDIA 4CDGA 4Q4HB 4TYNA 4I1OA 5FPSA 4RJLA 5AUNB 1VPLA 5UKDA 2ZJAA 2R44A 3ZYCA 1NLFA 2A7QA 4FINA 4RZXA 3U7HB 4IOJA 4LOAA 4NCIA 3PV0A 3C14C 1EESA 1W2HA 1UEJA 2ZJ8A 2A5GA 1O87A 1E0AA 4E09A 4A0FA 2QU8A 1I4LD 2PEYA 4D4JA 2EWWA 4ZKDA 4BFSA 5H70A 4BQSA 2L0XA 5CIWA 1WCV1 2PEZA 2XX3A 2QY9A 1RJ9B 1SVLA 4PSAA 1E94E 4PFSA 4QHSA 2RHMA 2MSEB 2VPPA 2AWNA 3QKRB 2CEAA 4IEIA 3I72A 1A2BA 4LHXA 4OQLA 5G40A 1R2QA 3AVYA 4GL2A 1ZUIA 3SHFA 4M21A 3D31A 2DPXA 1CULC 3KDSE 4NCJA 3LX5A 1PLKA 4KYIB 4QXAA 5GJCA 4ZI3A 2LWIA 4B3CA 3BH7A 4F91B 4TZ0A 2C9YA 1V5WA 2O0HA 4K81B 1E2GA 4C0KA 1OH5A 4CEJA 4OHXA 4DCNA 2CLCX 2WAYA 4JYCA 4FXPA 4EJSB 3I1FA 1XZPA 4EPVA 1F60A 2KI5A 4IDNA 5B30A 3RVBA 2VEDA 2OE2A 1P9NA 3GJ7A 4EPTA 2DWQA 1AS3A 4YMTA 1G16A 3Q3JB 4CW7A 2O8BB 2OBMA 1MT0A 4LYFA 1ONBA 3BE4A 3VFDA 4KFUA 3NBFA 1P62B 4TSFA 3T12A 1HYQA 4NCHA 5L3SA 4PC3A 2A5DA 2ZPTX 3W90A 2W6IA 1RRGA 5JWHA 4C0BA 2J7KA 5A0FA 3ZGXA 1AKYA 2QGNA 4N1AA 4GOKA 3QBTA 1Z83A 1RRPA 1UBCA 4AK9A 2BJVA 1W0JA 4LPSA 2GNOA 1E1QD 1Z3IX 4YXWD 1U81A 4QNMA 4A0RA 2GJKA 2X19A 4OYHA 2WWGA 2AL7A 2JLSA 4NKRA 1S4QA 2ZE6A 3HR7A 1KK3A 1MABB 4OK5A 4URZR 1D8TA 2C99A 2BKEA 3K53A 2VSXA 3R9XA 1P72A 4I1UA 3AVUA 2FN4A 1CJUC 3DPUA 4F7WA 2CL0X 3GLGE 4BFUA 4L5BA 4Q7MB 5CK4A 3UMSA 3ETLA 3GFTA 3DHWC 2W0SA 3ZJYA 1KO4A 2EFCB 1G4UR 4NYIQ 5EZ5A 2CK3A 3T1VA 5HE9A 2JA1A 3LQRA 1ZC4A 4G1UC 3B82A 4N3NA 2WM9B 4BFTA 2H8KA 1NVWQ 3ECCA 4KI0A 2WSSD 3N2EA 5DE3A 3AV0B 4PHTA 1U8ZA 3BAFA 3O8BA 2Z4RA 4C2TA 4M1KA 4BE7B 1BMFD 3KB1A 5HTKA 4G3XA 5A4JA 1QBKC 1G8YA 2R6FA 2VHUA 2GCNA 3KQNA 1CJKC 3LVRE 1Q3TA 4GP6A 4GZMA 4JL8A 1DAMA 1GRQA 3GJ5A 2BMJA 5FOUA 3OFND 3GJ6A 4PO1A 2N46A 2QGZA 3WP1B 1GVNB 3G5UA 4HEJA 4M1SA 3X1XA 1DAIA 2XEXA 4B2IA 4HYYA 2X8AA 4LJ8A 1P2VA 3VU9A 4B47A 2W2XA 2AD1A 1TU3A 4L4UA 3KQUA 4IJMA 1JJ7A 1LS1A 2ZSBA 2ASEA 1UPTA 1LF5A 4QOSA 1W4RA 1JEDA 1MO4A 3SJAA 1IM2A 4JLAA 3CX7A 5FOSA 3P1JA 3CUEF 2VLIA 1SULA 1WA5A 3L8YA 3QF7A 1T8UA 2EFEB 1VG1A 1E1RA 1X1RA 2QORA 2D4HA 4RD4A 3KJHA 5FUYA 1T3LA 4QBIA 3SI7A 4PPNA 2W0MA 3HU3A 4P4UA 3K0FA 3QBVA 5G53C 3EASA 1D9XA 3VNUA 1E2HA 4BFVA 1A1VA 1P9RA 3REFA 4L9SA 1Z8FA 4V0NA 2JAQA 2CXXA 4XSHA 1KSHA 3WXMA 3EARA 5JSZA 3GJ3A 3GPLA 3ONWA 5GJVC 3IUYA 2RGDA 5HR5A 1Z6GA 3ZVMA 2F9MA 3U7EB 2NOAA 1NN3A 1HQCA 2MMCA 4WW0A 4DEYA 3DL0A 5BYJA 4UXHA 4W5HA 1KK2A 4WIAA 3CPEA 1E69A 1A82A 4QL3A 2J0UA 4Y0VA
chains in the Genus database with same CATH superfamily
1A5AB 3MWDA 1H2RS 1S5PA 4XLTA 2IP4A 3I9V1 4R9VA 1RI1A 2BFNA 2F8MA 2HSEA 3CUKA 2F3PA 5DGTA 4RD3A 4X6LA 5AP9A 5WRFA 4XH9B 2OGTA 3UB4A 4BMZA 4HYQA 1DCMA 1CLUA 5HF6A 3TMAA 4MA0A 3QHPA 5E0KB 4QOEA 3WVNA 1OFTA 4PO3X 1DXHA 3OX4A 5E4JA 5K3OA 3CH6A 2ZJBA 4JBXA 5CNJA 4RC9A 2ZANA 1ST3A 2XE8A 2PK3A 4I9NA 4KJZA 4CYMA 4BEVA 2NP7A 5GY7A 3V8VA 1ZVQA 2ZIXA 4UCQA 3PC2A 4MDFA 5M5BA 4JUFA 4KODA 4ZPJA 3M0EA 3QKSA 4KXXA 3BH6A 4FOPA 1ZGHA 1BGXT 2CXPA 3KZMA 3N0VA 3PVZA 1N7GA 4X7BA 3B2NA 5DBHX 1BOOA 5LIPA 5FLXA 3IP7A 4LE1A 1TD9A 1IB0A 1GAJA 1JV2B 1T8TA 2OBFA 4LHYA 1EHCA 3K8OE 4V0KA 1N1GA 2J3LA 1UWCA 2LUOA 3WLQA 2FSSA 5FWXB 3V7YA 5DVZA 1KAQA 1V37A 4GPZA 1YRAA 4PQFA 3RC3A 5K8VA 1VRCA 1EUQA 3RSFA 5GVSA 1N6LA 2WLTA 1J33A 2WPDA 1KNXA 2CL7X 2P2LA 4D8TA 4YRRA 1JIVA 4N4AA 1Z5PA 1GGEA 2JFGA 1OLSB 3S8YA 3IUJA 1KOFA 3WG9A 4R2XA 2HUPA 4RETA 1XDGA 1C9JA 1K0FA 3GRUA 3P4YA 4G5SA 2Q4RA 3IEMA 4FMCF 1XDSA 2CWDA 5C5IA 5AFSA 3QEJA 1US8B 4RJ2A 5FFMA 1X9GA 3THWB 1Q0SA 4OQNA 4O4JA 1ZJ5A 3OTIA 4IIJF 4TRNA 2O3SA 1SVWA 2HHJA 1JJIA 3C3PA 3CF4A 4GP7A 3I52A 1TF2A 4N18A 3KQSA 4CMAA 1TX4B 1MQSA 2GBFA 3H86A 3HEMA 1W59A 3QV2A 3R0QA 4RNCA 5AXAA 4ZV4A 3THWA 1G2OA 1P2BA 4J0HA 2WPNA 3Q7IA 2ECOA 1G8AA 2RSLA 5B58C 5F1KA 1OJLA 4JC5A 3G89A 2DWOA 3WIOA 1LY1A 4BAGA 1WULS 3IE0A 1WIWA 2Y1LA 3CTPA 3CH4B 5F4ZA 5GADl 4PY2A 3BTUA 4L51A 5DYWA 1PWHA 3KB8A 1X3SA 3FUXA 3VUEA 1GRCA 3B1XA 2X42A 4C1BA 2FG7C 1CDEA 1YGPA 2XUJA 4UQOA 4WT7A 5FX2A 1JEJA 2YV4A 1XJ0A 1R6BX 3G0OA 3GLKA 4O2BA 1V6AA 4AZTA 4DA4A 1GUDA 2W71A 3EFOA 2H00A 3K16A 2RAVA 4N8EA 5EUBA 4ARSA 2HL6A 4NL4H 2G28A 4OUKX 3HBLA 3W5CA 1B6GA 2GEFA 4LSWA 1Y9DA 4V1CB 1ZINA 2W8BB 3BH0A 4NH0A 1GD1O 4Q7EA 4C6HA 4DDUA 1N1MA 3DEJA 4MTCA 4RHFA 3VO2A 1X14A 4OHMA 4TTSA 2J3EA 3G9QA 2G1PA 2GF0A 1K98A 1PL7A 5K0TA 5L3RA 2TMKA 3I4LA 1P9OA 5IAGA 1S0UA 1G5PA 3A6ZA 3BEDA 4Q1CA 3K5WA 3OWOA 1P4RA 1VYHA 2EP5A 3H1AA 4A73A 1W9HA 1CJMA 1ZGJA 3FFAA 3HKDA 4KQWA 5HIIA 4BNTA 3D64A 3HWX1 2OMKA 3EXEA 2WQ7A 4NNJA 1QWOA 1D0VA 3FM9A 1V25A 4HAXA 3L6OO 1DJPA 3VH4A 3MYYA 2DJ5A 4IOLA 1QIFA 4OJMX 1FJXA 2QN6A 2VHEA 4Z3OA 2JATA 5JYDA 3EXHB 3TH5A 5B3LA 2PMFA 3AFNA 5E4YA 3GVPA 1LV8A 5EQTA 1XKTA 3DV0A 3BFJA 5IJXA 2IWHA 5KOYA 2V6FA 2IW3A 3LCCA 5IUJC 4L75A 1RYDA 5DRTA 2R5FA 3VYWA 3FPFA 3H5VA 3PC7A 4H31A 1B8NA 1SU6A 2GBLC 4BRZA 1SGWA 2NGRA 3UXHA 1GSIA 5J4YA 4DTIA 5M34A 1RT9A 2IS4A 1KDRA 4ZREA 1IUPA 4PAQA 1NSYA 2PT5A 3MT8A 2X23A 1NUSA 4F9EA 2JIZA 1AVTA 4XXHA 2F8TA 1UKBA 3GZNB 4LZPA 1SXGA 4CMCA 3SC2B 2FPPA 5EGNA 2ZT8A 2FN8A 5I9BA 1EXDA 2PRSA 2REQB 1P2SA 4V24A 5C80A 5I9IA 2GAJA 2CUTA 3MB5A 3PX3A 3I28A 2I2WA 1W94A 2PZGA 2Q21A 3OFSA 4GNRA 4URUR 3GFOA 1A9XA 1NJSA 1VLVA 5JBNA 3ICOA 5KOJA 4WNAB 3DDOA 1T9BA 4WFJA 1OU0A 3TSYA 4BRWA 1TAQA 2PUEA 1J1ZA 1X1AA 2GVNA 3HBJA 1YFLA 5E3HA 3ZLTA 2PQMA 3I2IA 5IKPA 2D62A 4CIYA 3ZQUA 1AA6A 1QX4A 4YLGA 1GTG1 3E3MA 1YMQA 4GMDA 2JAUA 9ATCA 4B80A 1IL0A 1EK1A 1XLTA 1T5HX 2KLHA 3KSMA 5FNVA 3TRJA 3WHLA 3WYFA 4FHZA 4BLRA 3PYXA 5J2UF 1EJ0A 2C5HA 4YYEA 3ZE0B 1XFAA 3HV0A 2V4UA 1U6JA 4XDYA 4YRTA 4I55B 3PPVA 1M76A 2DFLA 2WZQA 3STWA 1VHTA 2FSGA 2N42A 3UMGA 2BN4A 2G3YA 1JFRA 2VDPB 3JD2A 4HGRA 2Y77A 1XZJA 4NJEA 1WZIA 5ALZA 1P74A 2H18A 1HK7A 3F6RA 2YOHA 3VOAA 4D3FA 3F8TA 1E96A 4D9BA 2WIFA 1YVEI 3Q8WA 1PW5A 1ZD1A 3JALB 3AV3A 2AEFA 4DVJA 5HP4A 1JH9A 1IZ9A 4UCFA 5DXJA 4H7KA 4WECA 1L5LA 3W04A 4CUKA 2AJBA 4FN4A 4LRTB 6YASA 1C9DB 1P0PA 5D84A 3AR9A 1L4NA 3I9OA 2GXUA 1YJBA 1NWHA 1V26A 2E4ZA 2K2WA 2VAXA 2YMLA 2YTZA 3ICVA 3KYCA 3OE1A 4LBVA 1EAYA 3L7DA 2W42A 2DBQA 3ZXXA 1AZLA 1YC5A 1XE3A 1S2NA 4FFLA 4CRWB 5JCXA 2GPYA 4WXEA 3DZCA 2H7CA 1R10A 2QTMA 2WU4A 5BQFA 3SS8A 5JAOA 1R0YA 4MRNA 4MX8A 2A0UA 2ABWA 4WKOA 3UWOA 4M1MA 3F8WA 1YBHA 2A59A 4OMDA 2PKRA 4PC2A 4YLEA 3CVOA 2GWHA 4BNMA 4RZSA 5JCOC 4WOPA 2R7LA 3KS9A 4W5JA 5IS2A 3R74A 1WZ2A 1TVKB 2HXSA 3UF0A 1GY8A 4LXUA 3TL6A 5CPFA 4BBAA 3EWSA 4X44A 2VKTA 4NG5A 5E8JA 1II9A 5FBQB 3H0EA 2G17A 4UJ5A 1NUPA 2P8SA 4KEAA 3OY2A 3VVMA 1QV9A 5FPTA 4NU8X 4XRGA 1QWSA 3ZH9B 2ONYA 3UMMA 2VVTA 4FZJA 4K9SA 2FFRA 3DBHB 5FBZA 3N3AC 3PQDA 1DIHA 3TLGB 2GCEA 4P93A 2ODTX 2JCSA 3N2GA 5AKLA 2ZYTX 1Z18A 4X9XA 2D5CA 2VF5X 1O95A 3DMNA 1VSUA 3H2IA 4FWTA 3PHBE 3QVWA 4BO7A 3X1ZA 4D0NA 5ALEA 3EEFA 1TADA 5BR7A 3HCNA 1CF4A 2I3DA 4IXWA 1JALA 2WE7A 2Q2VA 4PTZA 2R7NA 2WZBA 1DJMA 2C4MA 1AS2A 2C8LA 4ZRNA 3ZD6A 4HWRA 1ORRA 3BTVA 4C1NA 1JHQA 1ID1A 3SQLA 3PUHA 3H5NA 5C0OE 3IBCA 3EIHA 3HVHA 1G2PA 1UC4B 1E9BA 4PYIA 5DDIP 5TXGA 4BZXA 1VSVA 3GRZA 3NAZA 1ZCBA 2JARA 1KL7A 1B0AA 1HLDA 1L5YA 2X2EA 5HBGA 1MAWA 1DELA 1W44A 3H1BA 1SCUB 1SXJA 4FNOA 4LKRA 1C4XA 4KIGA 3GPBA 2FEWB 4UTZA 1B3BA 5D7NA 3HBAA 1GO2A 1Y8CA 2DX7A 5K4AA 3SLRA 1VFPA 5I7RA 1JHVA 5A62A 3DD1A 5BYAA 1ZMOA 1X8XA 4AQYB 1XRNA 1U04A 2FW8A 3KKLA 5GM2A 3TCKA 3M6MD 3SN6A 2MR5A 2ZAYA 5U9CA 4R5MA 1SA0B 2AFHE 4TQGA 3K0HA 2J0SA 2DXIA 2DFDA 1UZLA 2ZSUA 3ZGVA 5C4MA 3G49A 1NJ6A 3ENWA 3OEHD 3SR3A 4C7JA 4ZICA 2ZTUA 2C07A 1N2CE 3BDAA 5L40A 2VDKB 5EWJB 3SYLA 1FDVA 5JPCA 1QHIA 1CWUA 3KV1A 4KQ2A 1UC9A 2VJKA 4RZQA 4HRAA 3P27A 2UVPB 2WHQA 4P35A 4M54A 3HFSA 5DMXA 3WLEA 4QEZA 3KHUA 5J23A 1DE0A 2IP1A 4YRMA 1J8VA 3I6ZA 4PC7A 2R66A 2IYRA 4OHUA 5ALNA 4LZWA 2BCJQ 1HWYA 1MC1A 2GBPA 1YVUA 3AINA 4CHGA 3WYDA 5FB3A 2QYTA 1EG2A 2PRIA 4NNPA 1GLGA 4HNHA 4ZI7F 4YUYA 2OQ2A 2V7XA 4CIDA 5ED0A 1JEOA 3ZJ5A 1WUYA 3EQ7A 4MGHA 3WKCA 1OXKB 1Q95A 3DO8A 1G9TA 2BOVA 1RYNA 2H07A 2MINB 2YWBA 1M0SA 2ORVA 1JQBA 1E3WB 2JS7A 2PT6A 2CN1A 1PYDA 2H3HA 2JD2A 2OL4A 1H1TA 2ACWA 2WWFA 2IUEA 1ONSA 4I4NA 3LVQE 1LPAB 3ERCA 3RASA 1E2FA 4BMVA 4AFNA 3H42B 2AQ8A 4PZUA 3SHTA 3DTVD 3WK7A 2BD0A 2HMTA 3OI7A 3NT4A 3GLHE 4OATA 1EFDN 4H15A 4BMDA 3DYIA 2XQKA 3DEAA 3O8OB 1C1XB 4Q4AA 3T7AA 1OTYA 1EM8B 2OCBA 3L93A 5IJ0A 5A6SA 1SU8A 3SSMA 1YB5A 2O8DB 3D8BA 5AVOA 3MXOA 2ZSAA 3FOEC 1NW5A 3DW1X 5JWOA 1XKXA 4TT3A 4B44A 2O5EA 4PQEA 3LQ4A 1I4DD 1LSUA 1IXRC 4B6PA 1QQBA 4NLLA 1C0PA 3OM0A 2WMYA 3IXQA 2XMCA 3JVVA 3UC9A 1WMFA 4WZZA 4FFBA 1CR1A 5AKKA 4ZHQF 4I66A 5HKBA 3B1WA 4HQLA 3AHEA 5FR1A 2IS6A 2J9RA 3T9AA 2FE4A 3TQIA 2G40A 5IWCA 3U60B 3L92A 4IIGA 2FPMA 3RS0A 1MH9A 3GPDG 3BTOA 5LDDC 2FZVA 4PGMA 4S0XA 1KDVA 3CPHA 1RPNA 3OPVA 4HRXA 1SCIA 2YINC 4HX9A 1HT1E 1H2WA 4IHJB 5KTYA 1JB9A 1KYTA 4K6OA 5JISA 4PHGA 2K7FA 2AA3A 2XA1A 3UJHA 2FR8C 3RTBA 4DLTA 4F4FA 2BBWA 1TPYA 4MKHA 5CW2A 1DIBA 2QK4A 3KJQA 3ZHUA 2QYSA 3PR3A 2FZKA 1NZDA 4MV5A 1S1CA 2AR7A 4A91A 3WIEA 2NW6A 2JG3A 1YZLA 2I2AA 2QS9A 2O8VA 1QZZA 5IRCD 2GN6A 4Z0TA 2BEVB 4MAAA 4YDSA 1A9PA 4KO3S 2QW1A 3D1LA 1DC4A 1J8MF 3KSZO 1UKAA 2G08A 5HCIA 3IX7A 1XHEA 2Q5HA 3PQ3A 1NW7A 2E5FA 2J45A 3T7TA 2VWHA 5IZCC 5C52B 2LXNA 2PH7A 4ECEA 3A2NA 3NP7A 3HZHA 2OFXA 1NE7A 3D1JA 3PUKA 4YXFA 2DETA 1OASA 3H19A 1F0KA 3BGIA 5E9JA 1POWA 1RWPA 1N2CA 1JT2A 2BHRA 3NHPA 1PI3A 1OXUA 1E6MA 4NV0A 1DKRA 3ZJVA 2CCKA 2D2EA 2XPCA 3C6QA 3OH8A 2PSDA 5KYYB 2A84A 4X1IB 4B33A 1F8UA 2BE9A 3IUQA 4UXIA 5DIZA 1FZTA 2JVKA 3OAAD 2OQRA 3VJLA 2ZI6A 4NF2A 3BD7A 3EMDA 3R7BA 2EX1A 2VP3A 4PYOA 4LSMA 2DTXA 1YB1A 2QGFA 1TZBA 4K87A 3CMMA 1JPJA 3FETA 3ZWPA 1JEYA 3LDGA 3IP8A 2B5VA 4K2HA 2D3TA 5T7BA 3FUTA 1JG1A 2O3QA 4KSYA 5DI3B 3E3AA 1Z8NA 3NHRA 1CQIA 2PFSA 2C2XA 4MOWA 1QP4A 1K9SA 3E5HA 4GH5A 1LNQA 5AJXA 1A0OA 2Y1XA 1QIGA 3W7BA 4AX4A 1P6UA 1JJVA 3BHNA 3K73O 2YRWA 3JRNA 3ZCUA 1M34E 5EKSA 4BNGA 1J9ZA 2FV8A 4MRPA 2P4SA 1P2DA 5J2TF 1A8IA 2NO1A 3KUUA 3NV9A 4KO4S 4NX2A 2NTYC 2RKWA 3A7EA 2J4CA 2QA5A 4JUIA 1GU0A 3KQOA 2WF7A 4DMKA 3DA8A 4RDIA 3OEYA 1LQTA 1ACLA 2AVNA 2V7WA 1GTL1 1RJDA 2F8SA 4R2HA 2VPIA 4QT4A 3GYBA 4OV6B 1KE2A 3GMIA 3EVTA 5HK9A 4W5NA 5CITA 3IC5A 3PRKE 4CBVA 4KVAA 1Q21A 1XX6A 2JIPA 1RYHA 4OMUA 1F1JA 1ZOPA 1BG6A 1KZ9A 3DNFA 3HNOA 1N9KA 2Q6IA 4BGEA 1Q7TA 4C2BA 1T10A 1L2TA 3B9QA 1J25A 3I5XA 1M2OA 3K9LA 1JG4A 1QHXA 1Z08A 3NYRA 2JHAA 5CVDA 3PFFA 4CCAA 2QZ9A 1E79A 1I1NA 1RAHA 3TK1A 2ON6A 2FUNB 1O94D 3ADPA 5FAXA 3RF6A 3JWPA 1B0PA 2FMHA 1SJ9A 2A5LA 5LBTA 4EJ0A 1C7QA 5A4MS 4MQFB 1FNNA 2X3UA 3DE3X 2PBZA 2E85A 3M83A 3UMCA 4F04A 3U4GA 3CX3A 3FHLA 4TMTA 3UGKA 4A36A 4ZMRA 3PYMA 2NUAB 2Y2VA 1P4GA 1R5BA 3AU9A 3TECE 3H84A 4RJIA 3LTNC 1MG5A 2GZ1A 3HCWA 3C3YA 3LUKA 1BXGB 5BW6B 5A3JA 2AHOA 2NSYA 2VHJA 5LZ5A 1PAUA 1SUSA 1YQWA 4LBZA 5C5CA 1C7RA 4RHCA 1DPFA 3NHZA 3PG5A 1EH5A 1Q83A 3LUAA 4N12A 5BN4A 2XVZA 3AZPA 5FTWA 3Q2IA 2NLOA 3OZSA 4BGVA 4QECA 3FFTA 5LR6A 2EZTA 3CF2A 4S1WA 4JDUA 4FMDB 1CDDA 4I19A 4YNBA 3A9TA 4G8JA 1P2TA 4AY6A 4H7IA 4RKYA 2XW6A 4FDUA 4K03A 5L3VA 3PC8C 2AXQA 3TTTA 3JQ7A 3T5CA 4BO9A 4YCLA 4HTFA 3PNVA 5F3RA 4BKQA 1V16A 3N8HA 5IBRA 1UBKS 4E2ZA 3VC1A 2A0KA 1SZPA 3GD7A 3VHRA 1DQPA 4D96A 5I9NA 3QYJA 3H4MA 2ZJFA 1I3KA 3DC2A 4JFAA 4OMCA 3ZHCA 2W9XA 3C6XA 4G9GA 5CU7A 1NJ5A 5J9FA 5EJ9A 2IYWA 5DEIA 4F92B 5KTOA 2PSFA 4C0QC 2DR2A 1QZXA 3OIVA 4WJKB 3UWPA 3Q15C 1T9AA 4BQEA 3GRAA 3TLJA 4S0ZA 2EDAA 4J91A 3V1LA 4HEA6 3AGPA 4P4NA 1IZ0A 2XMSA 1JMYA 3ASUA 1PK9A 3OZRA 3DE7X 2CLOB 4LDRA 1GPMA 1AA9A 4D42A 4A8HA 1X7YB 2FPPB 2NQ2C 3PD7A 1KYXA 3QWFA 3M4XA 4N6NA 1U7WA 3EVEA 4FZ5A 4WCDA 3U4IA 4HDKA 2Y0PA 5K9ZA 2OC4A 2C9DA 1M74A 2JFHA 4ND2A 5FF9A 4PG8A 3IO5A 3V2IA 1USGA 4XD2A 2PJDA 1QMPA 3NHYA 2WWRA 1L5FA 3GELA 1T2UA 4J16C 1I1QB 2WY2D 4P7FA 2QZZA 4G67A 3ZU2A 5E7IA 3ICCA 5L3QB 1W36B 1Z0UA 3JQFA 1Q1GA 3JQQA 1EHIA 2ZAIA 3NPMA 1GKIA 3UK1A 1HC7A 2W6ZA 3Q9LA 1E20A 2PFGA 3ACDA 3NHJA 4KFSA 1Y7TA 1YIDA 4P7GA 4B0OA 4RH3A 1Y81A 1HNZB 3F96A 5IG2A 5EIFA 3DTVB 4U2BA 4A27A 1W1WA 4DNFA 5DHQA 1S2IA 2DECA 1EVZA 3DYVA 2F9LA 2QRPA 5CJJA 4CQMA 1VHQA 2GD1O 1VGVA 2F6RA 3B7PA 3FYUA 3GIDA 4KN9S 1CBUA 2HA5A 2J0EA 3IESA 3OA2A 4Y3UA 4DBZA 5AVSA 5CIQA 5HQ3B 1CUFA 4IFTA 4JEIA 4QATA 3TG8A 4FOTA 1DUVG 5JJIA 1JEQA 3R76A 2FOXA 2J33A 3JQ7B 3NEPX 2H65A 3PQFA 2JIMA 4YJ3F 4J1NA 2BEWB 1M72A 2OV1A 3ICWA 2IKQA 4PSUA 1U02A 4PYRA 5EESA 2MSWA 2GZ3A 4P58A 3KHKA 1AGXA 2FAXA 3KR0A 1U8CB 1UXGA 4UUPA 4BV9A 3QVGB 2ZQZA 5K51A 4PRZA 4DDMA 4JYPA 2Y4OA 1G5HA 3L40A 3GLIB 3QV1A 2X8LA 1QX3A 2SECE 2Z6UA 3SIXA 3PK0A 5KSOA 2IWRA 1MV8A 5FTLA 2XECA 3BD9A 2CMFA 3JRXA 1FZQA 1P60A 4IZOA 1UKZA 2FPGA 3KT8A 4RVGA 4RYDA 4BKMA 3RYCA 3LNTA 1SHKA 2FWRA 3E9EA 1OFUX 1KI4A 3RUPA 3BX1A 3QVXA 3LU1A 4M86A 3BREA 3VSEA 3FNGA 4DCCA 2YJ3A 1BH2A 5E1BA 2P35A 1C50A 3HJTA 5T8KC 1JTFA 3ZKWA 4B5LA 3DLIA 2QDKA 3D0KA 1C3VA 3MK31 3OQ1A 1CVIA 1C14A 2C42A 1SUCA 4MRMB 3R7DA 3O6VA 2C20A 1Z0AA 2ODPA 1IE3A 3QEOA 4DLLA 1R5OA 3V33A 4AECA 1R6DA 3DCYA 3F9RA 4OHPA 3UMJA 1KO1A 3U19A 1PG2A 1PQPA 2PGNA 4H3SA 4QBTA 1N0HA 1A4IA 1EFVA 1SKYB 1BGWA 1F8XA 1F12A 3RE1A 3CXUA 4AIRA 4B34A 3GBSA 4O4LF 4B81A 1IUNA 5CAEB 2W2LD 4CM4B 4EMBA 7MHTA 4X90A 3W06A 2W2NA 2MYTA 3ET4A 4ISCA 4JJEA 4AROA 1WXHA 3L0CA 3ZWKA 1FYEA 1SG6A 5CBPB 1AU9A 4NBKA 4BEBA 4WGGA 2ZYGA 3LP8A 5E6RB 1D03A 3DVAA 2YVLA 3MJSA 4UHEA 2EJWA 1U6KA 3P9XA 1H8EA 2MT9A 1OHHD 3Q8XB 3D3WA 3L6CA 3W4JA 1NBWB 2R6ZA 4HB3A 2XOKA 4EO9A 3TSAA 1WPQA 1OLXA 4JL6A 3QQ5A 2VEOA 5BSTA 3OG9A 4IS2A 1HGXA 2FJ0A 4RACA 5TMPA 3V8PA 1QCCA 2PMEA 1EK6A 2VJMB 3P0RA 3GLSA 1MTZA 5AJHA 1P6QA 4ZRDA 1J22A 2CBGA 2M6RA 3W6UA 2ZJ5A 4UTPA 3CRQA 3UV3A 3K70C 1OFUA 2XYQA 3OP1A 5LQDA 5DYIA 3SXJA 1LI5A 1W25A 2P77A 4TL7A 3LW8A 4QE3A 3QEKA 3Q12A 1MVNA 2TSYB 4PG6A 1AV7A 4MAMA 1ODJA 1SC3A 4LI0A 4MWSA 3RKUA 4DMMA 4LJ7A 1FFEA 2B61A 1TM3E 3E9QA 4IQ8A 5CH8A 4E31A 1YBVA 3SHOA 3NJRA 1HL3A 3D4NA 1T8YA 2WIBA 2G4LA 2CXNA 1R4MA 4YRAA 5D2CA 1E1YA 5JWRA 1P81A 3OETA 3WMWA 1QYDA 1WXQA 2C03A 3WWEA 3H0CA 2QTGA 2P2SA 2RBGA 1XXHB 5D3KA 5LBIA 4DRXA 1I1OA 1UPXA 2XB6A 2P9JA 4PNZA 3EGWA 1FNMA 1YDWA 2GEKA 3QM1A 1GZ4A 2Y9PB 2HGSA 1YUMA 1RZUA 1SKYE 3DV9A 4OY3A 4AP9A 2V98A 4J7XA 4ETMA 4X1OA 3K0CC 4GRAA 3VUFA 1GHTA 1ZQ9A 5JRZA 1EZZA 2VHWA 1TCCA 1SXHA 2FPRA 3IMEA 4OXNA 4UE6A 5A9TA 1RC8A 2XF2A 1FDIA 4JELA 2F3RA 4NEQA 4BEJA 2HMWA 2IEIA 1RWQA 4TMWA 2BBSA 2W93A 3FKSD 4C03A 4HJRA 1EIZA 1XTSA 2VQDA 3DDUA 3OX3A 5GV7A 1HKHA 4CV2A 1A04A 3A6LA 3UXMA 3WB1A 4BO6A 2C54A 4U6NA 2Z6AA 2PD6A 4FX5A 3LGSA 2HRRA 1QTQA 1KAOA 3FNRA 1OH8A 2FVYA 2NZ8A 3TTXA 2COKA 4AJOA 4FFNA 1WMSA 2WHPA 3HR8A 1RYYA 3SQDA 3GRKA 1XWIA 1G55A 4F3RA 2HNAA 1NVBA 1JILA 2P8JA 4G5OA 5DNAA 5F23A 1EINA 4INJA 1DXYA 1I2CA 1JSZA 1RYMA 3F7OA 1W85A 2Q4OA 2WBLC 3VGPA 1IBKB 3VR2A 3L0YA 3UWDA 4TVSA 4MUEA 3IL2A 2GK4A 2BM8A 4R8RA 3BBLA 4BMNA 1OREA 1SKMA 1TL7C 3HKBB 4B35A 3QTTA 2FLWA 5AW0A 3PE3A 3RW9A 1RRVA 1NAHA 4JXXA 1PEYA 2ZWPA 3NTOA 1INLA 1XI2A 2CXQA 2ZDQA 1L4GA 1BRTA 3AFHA 3B1ZA 3H8WA 4QDOA 4RD1A 4RHYA 2QIPA 4V2IA 4Y2SA 5B7QA 4ER6A 3R5HA 1XVVA 1ZLXA 1MMFB 3M6FA 2QVLA 3KUKA 3FOWA 3GDGA 3L1HA 1LSJA 1R0XA 2PZ8A 1Y1LA 4QTUB 1JLKA 3TFQA 4CTOA 1NMQA 1V4NA 2B4KA 2X1VA 1NQTA 3A1UA 3ASYA 4MGEA 2FPIA 5FPQA 5DNVA 1MRSA 2JVIA 2O7VA 3W6ZA 1I5EA 1T1IA 2PKQO 5HPYB 3W2HA 3DH0A 4FCTA 5KNCH 3PX7A 2PO5A 1NDQA 5D1NA 4UNNA 1N3BA 1JAZA 4A2WA 4JI4B 3A28A 3F8SA 1LRKA 1AY0A 1T36A 2NAPA 1XKLA 2OILA 4HWPA 2JIOA 1JQJC 3W6NA 3T15A 4EVRA 4WLVA 3UG6A 2CNWA 3BMXA 3ESRA 4OO3A 1GGFA 4WCFB 4MVJF 3DOUA 1Z4MA 3RVQA 5DBFA 4B7UA 7MDHA 5K7SA 5LZ9A 3P20A 2PX2A 3P0IA 4WEOA 1Y5MA 2ONCA 4DA7A 3NW9A 4WVFA 4UFPA 4UQLA 2YFKA 1YMVA 3STVA 2GTPA 5F1YA 2XHZA 4BOYA 5JVDA 1GCUA 3OLYA 9LDBA 2QTTA 3D3WB 3FPGA 3O4JA 5FBLB 2UUOA 5DTIA 3M6LA 1U1DA 4ZYXA 3MTDA 2MTBA 4ND3A 1YR9A 2VZ8A 1GKKA 1D5WA 2HDNB 2VBGA 3L3BA 3RFVA 4ZTZB 2CEKA 1W8DA 3RAJA 3W8DA 2V6BA 4ZCLA 3GGCA 1KERA 4ZYUA 4BP1A 1CUVA 2VRCD 2OAQ1 3LVFO 4LVCA 1T6YA 2C98A 2CLSA 1UP6A 3F78A 4C5AA 2R5NA 1T2AA 4L50A 3KFXA 2ZPAA 1JKIA 1DRKA 1FRNA 4D1YA 4D98A 4K8RB 3LQQA 1JFLA 5ICFA 3DMRA 3R1IA 4HPXB 4AXBA 3CCBA 3O47A 4IO0A 3ROKA 1IBCA 4YRPA 1IRXA 4JSYA 1GJRA 5JNWA 3USCS 3ELUA 1V8ZA 2Q4EA 2IX9A 4IUBS 6Q21A 5KCMA 3P5BA 3ZKWB 2E4WA 3Q0TA 5DT9A 4ZV9A 2C2OA 3GVXA 4H3HB 4BDSA 5A9SB 1OW3B 3QG5A 4B3RB 5LCXA 1Q44A 4C21A 1LZLA 3UBMA 2VNAA 4N03A 1DEKA 1YR2A 4URYR 3R2JA 1OC2A 3KVNA 5EE1A 1I5OA 4YMSA 3L41A 1SCQA 1HLPA 4N39A 2ZB2A 1DRUA 1KI8A 2HPVA 4Z99A 1B16A 2NSHA 2VFAA 3KPVA 3N59A 3CF0A 3IBGA 1X7DA 4Y2HA 2BMAA 1CUHA 2W5UA 5F78A 5T5QA 2W2VA 1T8RA 1RAIA 3TBFA 4DMHA 3WAJA 2FY8A 3AZQA 3GJYA 3NGLA 4E12A 1BXRB 3ND5A 1XLWA 2YYZA 3I0NA 4QYSA 3DLAA 1GQSA 5DGCA 3U3KA 1C3EA 1QKJA 1CUDA 3K1TA 2LNDA 1TJ3A 3A04A 3CG4A 5AM5A 1OA0A 4YRIA 1VBKA 2NZXA 5ITWA 2AG6A 3K2EA 2QD5A 4N9QA 4I9UA 5B5SA 2ZRNA 2PGXA 1A2OA 1Z38A 4M8NE 4PXAA 5FQOA 5BN3B 4INPA 2CSXA 2OAEA 4UEJA 5BV1A 3DLBA 5BSRA 2H1LA 1Y0BA 2OLJA 3UKDA 5AUOB 2HADA 4XLZA 4DQKA 1THZA 2ZYRA 5LMNB 2QMEA 2Y6VA 1CY1A 2NIPA 5D01A 3C6KA 1SWVA 3A6FA 3KTAB 1UANA 2GARA 2G8NA 3E8MA 5F2EA 5D86A 4IEEA 3UKOA 2IYVA 4ZVKA 2H4YA 2IZ7A 2V6JA 2X40A 2YFQA 5FPPA 4P3OA 4AY4A 1QFYA 1E2QA 2PU7A 3K3PA 2CW5A 2HF7A 2AR0A 2Z3VA 4PTYA 3GX1A 4JA0A 2XDYA 4KQJA 3HXKA 3CUUA 4ZVLA 3TO5A 1UMDA 2IOFK 4QAQA 3F98A 4ZIRB 1SIBE 1BA3A 3A6KA 2LRHA 4L6CA 1L4MA 3PXUA 4WOBA 1OE0A 2JLAA 1HOXA 2GEVA 3IPLA 3X1WA 5IDQA 4NH4A 4QU9A 3PGMA 1E1KA 4MEJA 2QRZA 2VZEA 3BWCA 1YR8A 4WCFA 4DKXA 3UXEA 3RF7A 3G2MA 3EC7A 4DSNA 1JAHA 2EFYA 1K3UB 1JDJA 2IS1A 2I5PO 1RYFA 3LBNA 3UK7A 5CD9A 2OUKA 1IIRA 3AK4A 3MTEA 3VO1A 1XZCA 1N0IA 1DQNA 3A05A 1OI4A 3B85A 2VPWA 3C48A 3R09A 4FYJA 4O29A 4TV8F 5J59A 3RRXA 3GLHA 4EARA 1L3IA 4Q21A 1KI3A 1O8BA 4H3VA 4RK4A 3VZPA 3GLUA 4P4SB 2A67A 4KIWA 2AFVA 1D2EA 3QU2A 4OKSA 1E3DA 1F0YA 1YQGA 3V8MA 3ZZTA 3B5JA 1AMOA 3V80A 1NE2A 3LBYA 4FK8A 2O1EA 1N78A 1TO1E 3KXLA 3JY6A 1ZOIA 1PK7A 1WCYA 4PZAA 8LDHA 1PHRA 1B43A 1J09A 1E1LA 3ENQA 2BFFA 3RHFA 3VSBA 1ZN8A 2Z5FA 1KBQA 3SQXA 4JJZA 4JIGA 5DX8A 5TQ2A 5ALFA 3T3HA 4AF8A 4W1PA 3MWGA 2QN3A 2H06A 4MB2A 4MDHA 1JX6A 1ZL2A 2V7QD 3JD0A 5DCYA 4AUEA 4X8LA 4BWFB 1H6BA 3L8HA 1CRQA 2PFKA 2C83A 2RGEA 5TMEA 3U31A 2VKQA 2ZUDA 1XDWA 3MRTA 2NZVG 2JFUA 2HBRA 5KSPA 3R5TA 2BUAA 3QLVC 1VL5A 3FGOA 3OE5A 5B3AA 5L6LB 1SELA 2Q1YA 4RTSA 1YZNA 4RF5A 3H1FA 1VL6A 2JJ1D 4F6RB 2KJQA 5LLDA 4FCVA 5TMBA 4ACBA 1ZN7A 2C2BA 2DLNA 1QVZA 2Q7OE 4GQIA 1ARZA 1Y3DE 2ZB7A 1GN8A 1EA7A 2EGUA 2O05A 4MW7A 1SVOA 4G5YA 4REOA 1NU8A 2G1UA 1UXOA 2IOQA 3BQNB 4NENA 3ZOKA 4BB0A 2Y1CA 3OHPA 3AJDA 5FPKA 1DKLA 2Y66A 3HY3A 4PLHA 4RD6A 2YWFA 1LB1B 2QVXX 3K8ZA 4OLJA 1YXMA 3ZV5A 2HIGA 2R97A 3EA5A 2GEBA 5JO9A 1JWBB 3D4BA 4PIVA 4REMA 4RH1A 4YFYA 5SZJA 3T0FA 1WXDA 4B3JA 4IXDA 2A7XA 2B21A 4AQDA 4DJAA 5BMVB 4Z0PA 5BVGB 3BERA 2WSIA 2XMRA 3KOMA 2R5WA 1LV7A 2CVPA 4H7PA 1BDHA 2A1UB 1Y7LA 3DBHA 1B74A 2D74A 3QLJA 2BYTA 1OYOA 4GQAA 2BT4A 3FYUB 2FZWA 4TM8A 2FK7A 4ER5A 3FCAA 3F74A 1MX5A 1WQ1R 1VI5A 4E51A 3IQIX 1X7XA 1YZTA 3MJHA 5M3BA 2YASA 1H3EA 1ZITA 4DCGA 2Q62A 4L5JA 1Q57A 2C5BA 4LJSA 3LY9A 5JQGB 4J7AA 3KQKA 4UFOA 2V6IA 2QX7A 5J5AA 2MR6A 4KO2S 4X66B 1QGDA 4OI4A 4CZ2A 1QBGA 2AD5A 1G8FA 2AX3A 2X2OA 1L4YA 3CUSA 1VPEA 1JL3A 3P9ZA 3TCNA 1U7UA 2GB4A 3OOHA 2WSSA 3TINA 1VCNA 1CEYA 1Q5PA 2Q0XA 3LQFA 3BWDD 2H4XA 4JU9A 4FOLA 2IFTA 4PLTA 2FGJA 3MWLA 1G8SA 3W8EA 4IMRA 3N8GA 3VC7A 5JNRA 1ZSVA 3Q0EA 4IDQA 1FVXA 1U8AA 2QXYA 3TQQA 4GLLA 2NU7B 1C1HA 3CISA 5M2QA 3OQIA 3AJ8A 3SU8A 1DX6A 3SIRA 1BSVA 5F73A 3L8MA 1JF8A 2HD4A 1JQKA 2R1ZA 4ML3A 1A27A 2V59A 3E35A 3FDZA 4IOKA 2VXBA 3NH9A 4OM7A 1DZIA 4UUAA 4CXMA 1U2DC 2XUIA 1E62A 1ZIPA 1XZMA 4UBIA 3RLFA 3WO1A 2QN8A 4ZEVA 3GARA 1RM5A 5THXA 1RKUA 2VN8A 5F2NA 2EKBA 4G0WA 4GM1A 3OCZA 1KEEB 5B3JC 4GAEA 3PDHA 1J8QA 1NW8A 2EKPA 3DE1X 2HLNA 5FORA 1HNNA 3DTVA 2CNKA 4B32A 4YYZA 1XJQA 1W36D 3E82A 2QUJA 4BJ5A 4OXYA 1M6YA 1I7NA 3AOEC 3KALA 4MP8A 4E11A 3H4VA 2IZ1A 1Z0JA 1QYXA 3FVRA 5EJAA 1UOOA 4B7XA 1TYCA 4JAVC 4HNQA 4ISBA 4WI1A 3KOXA 4RSMA 4V0RA 1NJ2A 3IAM1 3OE4A 4XOIA 4P6VF 1RU3A 1ZL0A 4P92A 2XJ4A 1TM4E 4FEAA 4QULA 4G1EB 4ZT4A 1JW9B 4EITA 4Y1RA 2W6QA 3P0EA 3OPNA 4B84A 3EH2A 2BELA 3T7EA 1VIYA 2UVDA 3Q7QA 4QDZA 3OKCA 3ZV6A 4BFYA 1TUGA 4KXMA 4M0FA 3H9GA 1Y37A 2NQTA 4NDZA 3SZLA 1IFXA 1N9ZA 2AYYA 3DB1A 2OTCA 1E0DA 3CZ4A 3GOQA 3N7UA 2J07A 4MQLA 2Q3JA 3I45A 1N77A 5ICEA 4QSHA 1N6NA 3IB3A 3EK2A 3PXAA 1ADBA 5KX5A 4AKIA 1Y80A 1V3UA 4F6RA 3UANA 4LQDA 1BFKA 1E92A 1UJ2A 2GCIA 1J42A 1P61B 2XB8A 3CTMA 4UMEA 4CCWA 1ZEMA 2FSPA 3MCVA 4XIGS 1JLSA 1G9XA 1YOBA