1XKAL

Factor xa complexed with a synthetic inhibitor fx-2212a,(2s)-(3'-amidino-3-biphenylyl)-5-(4-pyridylamino)pentanoic acid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
90
Chain Sequence
QCETSPCQNQGKCKGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for chemical inhibition of human blood coagulation factor Xa.
pubmed doi rcsb
molecule tags Blood coagulation factor
molecule keywords BLOOD COAGULATION FACTOR XA
total genus 14
structure length 90
sequence length 91
ec nomenclature ec 3.4.21.6: Coagulation factor Xa.
pdb deposition date 1998-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1xkaL02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1xkaL01
3HO4A 1PGEA 1JV2B 3ENSA 4JZFL 1QFKL 3TK5B 2BZ6L 5COXA 1V3XB 2PUQL 4Y76B 1HT5A 4NA9L 4OTJA 5L30L 1TPGA 1NQLB 2KB9A 3V64C 4Z0LA 4XL1A 4CUFA 1P9JA 3FCSB 3N8YA 1NFWB 1CX2A 1EZQB 1Z6CA 1EPGA 1YUGA 3KCGL 1N7DA 4O02B 1EMNA 4LORA 4XBMA 1FE2A 4MMZB 1UZJA 1FF7A 4LMFA 1WHFA 1ZAQA 4G1MB 3CA7A 1CQEA 2Y7ZB 2Y7XB 2D1JB 3CENL 1L3YA 4ZH8B 4Y7AB 4ZXYL 2Y5HL 2J4IB 1EAIC 3GCXE 1IOEL 4ZXXL 1K37A 1CCVA 3SOQA 4D0FA 1U67A 5K0HB 3RR3A 4OTYA 1EQHA 4JYUL 1DDXA 4X8SL 1MOXC 5IKVA 5F19A 2K2SB 1G1TA 2W3KB 1FAKL 2P3UA 3NJPC 5L2YL 5IKRA 4Y6DB 5CKNA 2XBXL 4CUDA 1EGFA 1M1XB 1TOZA 2VWNL 2FLBL 1HREA 2WPME 1UZQA 2P16L 3N8WB 1OB1C 3HS6A 3M37L 1CVWL 3PGHA 1G1RA 5IKTA 4Z6AL 3C9AC 1MQ5L 2EI7B 2FZZL 4YT6L 1ATAA 3GCWE 2VWLL 1U8CB 4O1ZA 1IJQA 1KIGL 3LN0A 3OLUA 3F1SB 1Q4GA 2DDUA 3FFGL 2BQWA 3NTGA 4Y7BB 1FFMA 1SZBA 1XFEA 1UZKA 2XBWL 3F6UL 3HO5A 1G2MB 1ATEA 3NTBA 1NZIA 1LPZA 5JBAE 2JKHL 1HX2A 2BO2A 3POYA 1LPKA 1UZPA 1BF9A 4BXSA 2Y5GL 1J9CL 2BQ7A 2RHPA 3ASIA 1IGZA 3SOVA 4JYVL 2J95B 5CISA 3TGFA 3R05A 1G2LB 1B9WA 1COUA 1APQA 2J34B 2J2UB 2XC4L 3QH0A 2BOXA 3KQBL 3BT1A 2VJ3A 4X8UL 3TH3L 1NPEB 2J38B 1PFXL 4M10A 1IVOC 1YGCL 2VWMK 5FDQA 1XKBA 1A3PA 1JBUL 3LIWB 3NT1A 3FBYA 3BT2A 1W8BL 4JZDL 2W26B 3N8ZA 1IGXA 4D0EA 2I9AA 4A7IA 2CJIB 3EGFA 3HS7A 1KLJL 5JBBE 2P93L 1CCFA 2XBVL 2AYLA 3TBDA 2W2OE 4AQTA 1IQML 1PRHA 1RFNB 4X8VL 4CSYA 1Z6EL 3N8XA 2KV4A 2MHPA 2W3IB 1LPGA 1IP0A 2FD6A 3KQCL 2FLRL 1FJSL 3M36L 3ELAL 3U73A 5EGMB 2W86A 4MMXB 1PXXA 2BMGA 3LC5B 2I9BA 1F0RB 1DX5I 4JZEL 2MGPA 4RRYA 2P3FN 1IQKL 3N8VA 3KK6A 1YUKB 4YT7L 1XDTR 2P28B 2M74A 1HAEA 2RA0L 2VVCK 2ADXA 1HZ8A 1EMOA 5I46L 1ADXA 1IQFL 1FAXL 2WPIE 1HJ7A 1IQEL 1XKAL 2VH0B 1EQGA 1W7XL 1FSBA 5L2ZL 2W2QE 4BTIA 5CKMA 4PH9A 1HCGB 1LQDA 4NGAL 2WYGB 2OYUP 2WYJB 1HRFA 1KSNB 3IJEB 3K9XA 1TLEA 1URKA 1EPHA 1PTHA 2BQ6A 1CVUA 5F1AA 2Y82B 1HT8A 1O5DL 2Q1JB 1EPJA 4TGFA 3CS7L 2TGFA 3QCWA 4ISHL 3LAQA 3SOBB 2UWPB 2J94B 4E1GA 2XC0L 2FLGA 1HAFA 5JBCE 5JB9E 2VWOL 4YZUB 4D90A 1F0SB 4FM5A 4RRWA 2P26A 1NFYB 3BPSE 3N8WA 4BDWA 4BTTA 1IQLL 4C16A 1EPIA 2Y80B 5JVYA 3OLTA 3ZYJB 1NFXB 5KIRA 5KN5C 4M11A 1IQHL 2W2PE 4CUEA 3Q7DA 2UWOB 1P0SL 2P95L 2WG3C 3ZYIB 5JW1A 2EI6B 1AUTL 1GK5A 2VVUL 3MQEA 3GISX 2PR3B 2YGPA 4BTUA 4ISIL 3U7UG 3KRKA 2P3TA 2MGRA 2WFTA 2EI8B 1ATBA 2OYEP 2BOKL 3QMOA 2W2ME 5E8DA 1WHEA 1N1IA 2P94L 1KLIL 1ATDA 2H9EL 3LTFB 3TK6B 3SW2A 1APOA 2VVVL 3CFWA 4COXA 1WU1B 4Y79B 2WPJE 6COXA 1IQNL 2KL7A 2RNLA 3KQDL 3TZIA 3LN1A 1G1SA 3LTGD 3Q3KB 2YGOA 5JVZA 3MDLA 2WPHE 2K2TA 2NPRA 1I0UA 2GD4A 3DEMA 1IQJL 1F7EA 1DQBA 4BXWA 4ZHAB 3KL6B 1KLOA 5IKQA 2P3FL 2F9BL 4BDXA 3HO3A 3LC3B 4ZAEB 1K36A 2Y5FL 3HS5A 1DVAL 4X8TL 1MQ6L 1EBVA 3ZYGA 3HPTA 1YO8A 4RRXA 4Y71B 3P5BL 2BOUA 2WPKE 2W2NE 3H5CB 1YUFA 1X7AL 1IOXA 4MMYB 2VH6B 2Y81B 1IQIL 1DIYA 4RUTA 4Z0KB 2G00L 4RS0A 1CEJA 2PHBB 3V65B 1F7MA 3KQEL 4XLWA 1JL9A 1NT0A 5CKQA 2BOHA 1LMJA 2XC5L 2B7DL 5JB8E 1L5GB 4NG9L 1G1QA 1NFUB 4RRZA 2Y38A 2XBYL 2WFXB 2UWLB 3N8YB 1C5MF 2WPLE 3IITB 1IQGL 2WG4B
chains in the Genus database with same CATH superfamily
3HO4A 1PGEA 1JV2B 3ENSA 4JZFL 1QFKL 3TK5B 2BZ6L 4A94C 5COXA 1V3XB 2PUQL 4Y76B 1V1IA 1HT5A 4NA9L 4OTJA 5L30L 1TPGA 1NQLB 2KB9A 4GU4A 3V64C 4Z0LA 4XL1A 4CUFA 1P9JA 3FCSB 3N8YA 1NFWB 1CX2A 1EZQB 1Z6CA 1EPGA 1YUGA 3KCGL 1N7DA 4O02B 1EMNA 4LORA 4XBMA 1FE2A 4MMZB 1UZJA 1FF7A 4LMFA 1WHFA 1ZAQA 4G1MB 3CA7A 1CQEA 2Y7ZB 2Y7XB 2D1JB 3CENL 1L3YA 4ZH8B 4Y7AB 4ZXYL 2Y5HL 2J4IB 1EAIC 3GCXE 1IOEL 4ZXXL 1K37A 1CCVA 3SOQA 4D0FA 1U67A 5K0HB 3RR3A 4OTYA 1EQHA 4JYUL 1DDXA 4X8SL 1MOXC 5IKVA 5F19A 2K2SB 1G1TA 2W3KB 1FAKL 2P3UA 3NJPC 5L2YL 5IKRA 4Y6DB 5CKNA 2XBXL 4CUDA 1EGFA 1M1XB 1TOZA 2BT8A 2VWNL 2FLBL 1HREA 2WPME 1UZQA 2P16L 3N8WB 1OB1C 3HS6A 3M37L 1CVWL 3PGHA 1G1RA 5IKTA 4Z6AL 3C9AC 1MQ5L 2EI7B 2FZZL 4YT6L 1ATAA 3GCWE 2VWLL 1U8CB 1IJQA 1KIGL 4O1ZA 3LN0A 3OLUA 3F1SB 1Q4GA 2DDUA 3FFGL 2BQWA 3NTGA 4Y7BB 1FFMA 1SZBA 1XFEA 1UZKA 2XBWL 3F6UL 2HORA 1QIUA 3HO5A 1G2MB 1ATEA 3NTBA 1NZIA 1LPZA 5JBAE 2HOXA 2JKHL 1HX2A 2BO2A 3POYA 1LPKA 1UZPA 1BF9A 4BXSA 2Y5GL 1J9CL 2BQ7A 2RHPA 3ASIA 1IGZA 3SOVA 4JYVL 2J95B 5CISA 3TGFA 3R05A 1LK9A 1G2LB 1B9WA 1COUA 1APQA 2J34B 2J2UB 2XC4L 3QH0A 2BOXA 3KQBL 3BT1A 2VJ3A 4X8UL 3TH3L 1NPEB 2J38B 1PFXL 4M10A 1IVOC 1YGCL 2JJLA 2VWMK 5FDQA 1XKBA 1A3PA 1JBUL 3LIWB 3NT1A 3FBYA 3BT2A 1W8BL 4JZDL 2W26B 3N8ZA 1IGXA 4D0EA 2I9AA 4A7IA 2CJIB 3EGFA 3HS7A 1KLJL 5JBBE 2P93L 1CCFA 2XBVL 2AYLA 3TBDA 2W2OE 4AQTA 1IQML 1PRHA 1RFNB 4X8VL 4CSYA 1Z6EL 3N8XA 2KV4A 2MHPA 2W3IB 1LPGA 1IP0A 2FD6A 3KQCL 2FLRL 2BSFA 2VRSA 1FJSL 3M36L 3ELAL 3U73A 5EGMB 2W86A 4MMXB 1PXXA 2BMGA 3LC5B 2I9BA 1F0RB 1DX5I 4JZEL 2H9EC 2MGPA 4RRYA 2P3FN 1IQKL 3N8VA 3KK6A 2YGQA 1YUKB 4YT7L 1XDTR 2P28B 2M74A 1HAEA 2RA0L 2VVCK 2ADXA 1HZ8A 1EMOA 5I46L 1ADXA 1IQFL 1FAXL 2WPIE 1HJ7A 1IQEL 1XKAL 2VH0B 1EQGA 2BT7A 1W7XL 1FSBA 5L2ZL 2W2QE 4BTIA 5CKMA 4PH9A 1HCGB 1LQDA 4NGAL 2WYGB 2OYUP 2WYJB 1HRFA 1KSNB 3IJEB 3K9XA 1TLEA 1URKA 1EPHA 1PTHA 2BQ6A 1CVUA 5F1AA 2Y82B 1HT8A 1O5DL 2Q1JB 1EPJA 4TGFA 3CS7L 2TGFA 3QCWA 4ISHL 3LAQA 3SOBB 2UWPB 2J94B 4E1GA 2XC0L 2FLGA 1HAFA 5JBCE 5JB9E 2VWOL 4YZUB 4D90A 1F0SB 4FM5A 4RRWA 2P26A 1NFYB 3BPSE 3N8WA 4BDWA 4BTTA 1IQLL 4C16A 1EPIA 2Y80B 5JVYA 2KNIA 3OLTA 3ZYJB 1NFXB 5KIRA 5KN5C 4M11A 1IQHL 1KKEA 2W2PE 4CUEA 3Q7DA 2UWOB 1P0SL 2P95L 2WG3C 3ZYIB 5JW1A 2EI6B 1AUTL 1GK5A 2VVUL 3MQEA 3GISX 2PR3B 2YGPA 4BTUA 4ISIL 3U7UG 3KRKA 2P3TA 2MGRA 2WFTA 2EI8B 1ATBA 2OYEP 2BOKL 3QMOA 2W2ME 5E8DA 1WHEA 1N1IA 2P94L 2WZPP 1KLIL 1ATDA 2H9EL 3LTFB 3TK6B 3SW2A 1APOA 2VVVL 3CFWA 1V1HA 4COXA 1WU1B 4Y79B 2WPJE 6COXA 1IQNL 2KL7A 2RNLA 3KQDL 3TZIA 3LN1A 1G1SA 3LTGD 3Q3KB 2YGOA 5JVZA 3MDLA 2WPHE 2K2TA 2NPRA 1I0UA 2GD4A 3DEMA 1IQJL 1F7EA 4GU3A 1DQBA 4BXWA 4ZHAB 3KL6B 1KLOA 5IKQA 2P3FL 2F9BL 4BDXA 3HO3A 3LC3B 4ZAEB 1LMMA 1K36A 2Y5FL 3HS5A 1DVAL 4X8TL 1MQ6L 1EBVA 3ZYGA 3HPTA 1YO8A 4RRXA 4Y71B 3P5BL 2BOUA 2WPKE 2W2NE 3H5CB 1YUFA 1X7AL 1IOXA 4MMYB 2VH6B 2Y81B 1IQIL 1DIYA 4RUTA 4Z0KB 2G00L 4RS0A 1CEJA 2PHBB 3V65B 1F7MA 3KQEL 4XLWA 1JL9A 1NT0A 5CKQA 2BOHA 1LMJA 2XC5L 2B7DL 5JB8E 1L5GB 4NG9L 3S6XA 1G1QA 1NFUB 4RRZA 2Y38A 2XBYL 2WFXB 2UWLB 3N8YB 1C5MF 2WPLE 3IITB 1IQGL 2WG4B
chains in the Genus database with same CATH topology
3HO4A 1PGEA 1JV2B 3ENSA 4JZFL 1QFKL 3TK5B 2BZ6L 4A94C 5COXA 1V3XB 2PUQL 4Y76B 1HT5A 4NA9L 4OTJA 5L30L 1TPGA 1NQLB 2KB9A 3V64C 4Z0LA 4XL1A 4CUFA 1P9JA 3FCSB 3N8YA 1NFWB 1CX2A 1EZQB 1Z6CA 1EPGA 1YUGA 3KCGL 1N7DA 4O02B 1EMNA 4LORA 4XBMA 1FE2A 4MMZB 1UZJA 1FF7A 4LMFA 1WHFA 1ZAQA 4G1MB 3CA7A 1CQEA 2Y7ZB 2Y7XB 2D1JB 3CENL 1L3YA 4ZH8B 4Y7AB 4ZXYL 2Y5HL 2J4IB 1EAIC 3GCXE 1IOEL 4ZXXL 1K37A 1CCVA 3SOQA 4D0FA 1U67A 5K0HB 3RR3A 4OTYA 1EQHA 4JYUL 1DDXA 4X8SL 1MOXC 5IKVA 5F19A 2K2SB 1G1TA 2W3KB 1FAKL 2P3UA 3NJPC 5L2YL 5IKRA 4Y6DB 5CKNA 2XBXL 4CUDA 1EGFA 1M1XB 1TOZA 2VWNL 2FLBL 1HREA 2WPME 1UZQA 2P16L 3N8WB 1OB1C 3HS6A 3M37L 1CVWL 3PGHA 1G1RA 5IKTA 4Z6AL 3C9AC 1MQ5L 2EI7B 2FZZL 4YT6L 1ATAA 3GCWE 2VWLL 1U8CB 1IJQA 1KIGL 4O1ZA 3LN0A 3OLUA 3F1SB 1Q4GA 2DDUA 3FFGL 2BQWA 3NTGA 4Y7BB 1FFMA 1SZBA 1XFEA 1UZKA 2XBWL 3F6UL 3HO5A 1G2MB 1ATEA 3NTBA 1NZIA 1LPZA 5JBAE 2JKHL 1HX2A 2BO2A 3POYA 1LPKA 1UZPA 1BF9A 4BXSA 2Y5GL 1J9CL 2BQ7A 2RHPA 3ASIA 1IGZA 3SOVA 4JYVL 2J95B 5CISA 3TGFA 3R05A 1G2LB 1B9WA 1COUA 1APQA 2J34B 2J2UB 2XC4L 3QH0A 2BOXA 3KQBL 3BT1A 2VJ3A 4X8UL 3TH3L 1NPEB 2J38B 1PFXL 4M10A 1IVOC 1YGCL 2VWMK 5FDQA 1XKBA 1A3PA 1JBUL 3LIWB 3NT1A 3FBYA 3BT2A 1W8BL 4JZDL 2W26B 3N8ZA 1IGXA 4D0EA 2I9AA 4A7IA 2CJIB 3EGFA 3HS7A 1KLJL 5JBBE 2P93L 1CCFA 2XBVL 2AYLA 3TBDA 2W2OE 4AQTA 1IQML 1PRHA 1RFNB 4X8VL 4CSYA 1Z6EL 3N8XA 2KV4A 2MHPA 2W3IB 1LPGA 1IP0A 2FD6A 3KQCL 2FLRL 1FJSL 3M36L 3ELAL 3U73A 5EGMB 2W86A 4MMXB 1PXXA 2BMGA 3LC5B 2I9BA 1F0RB 1DX5I 4JZEL 2H9EC 2MGPA 4RRYA 2P3FN 1IQKL 3N8VA 3KK6A 2YGQA 1YUKB 4YT7L 1XDTR 2P28B 2M74A 1HAEA 2RA0L 2VVCK 2ADXA 1HZ8A 1EMOA 5I46L 1ADXA 1IQFL 1FAXL 2WPIE 1HJ7A 1IQEL 1XKAL 2VH0B 1EQGA 1W7XL 1FSBA 5L2ZL 2W2QE 4BTIA 5CKMA 4PH9A 1HCGB 1LQDA 4NGAL 2WYGB 2OYUP 2WYJB 1HRFA 1KSNB 3IJEB 3K9XA 1TLEA 1URKA 1EPHA 1PTHA 2BQ6A 1CVUA 5F1AA 2Y82B 1HT8A 1O5DL 2Q1JB 1EPJA 4TGFA 3CS7L 2TGFA 3QCWA 4ISHL 3LAQA 3SOBB 2UWPB 2J94B 4E1GA 2XC0L 2FLGA 1HAFA 5JBCE 5JB9E 2VWOL 4YZUB 4D90A 1F0SB 4FM5A 4RRWA 2P26A 1NFYB 3BPSE 3N8WA 4BDWA 4BTTA 1IQLL 4C16A 1EPIA 2Y80B 5JVYA 2KNIA 3OLTA 3ZYJB 1NFXB 5KIRA 5KN5C 4M11A 1IQHL 2W2PE 4CUEA 3Q7DA 2UWOB 1P0SL 2P95L 2WG3C 3ZYIB 5JW1A 2EI6B 1AUTL 1GK5A 2VVUL 3MQEA 3GISX 2PR3B 2YGPA 4BTUA 4ISIL 3U7UG 3KRKA 2P3TA 2MGRA 2WFTA 2EI8B 1ATBA 2OYEP 2BOKL 3QMOA 2W2ME 5E8DA 1WHEA 1N1IA 2P94L 2WZPP 1KLIL 1ATDA 2H9EL 3LTFB 3TK6B 3SW2A 1APOA 2VVVL 3CFWA 4COXA 1WU1B 4Y79B 2WPJE 6COXA 1IQNL 2KL7A 2RNLA 3KQDL 3TZIA 3LN1A 1G1SA 3LTGD 3Q3KB 2YGOA 5JVZA 3MDLA 2WPHE 2K2TA 2NPRA 1I0UA 2GD4A 3DEMA 1IQJL 1F7EA 1DQBA 4BXWA 4ZHAB 3KL6B 1KLOA 5IKQA 2P3FL 2F9BL 4BDXA 3HO3A 3LC3B 4ZAEB 1LMMA 1K36A 2Y5FL 3HS5A 1DVAL 4X8TL 1MQ6L 1EBVA 3ZYGA 3HPTA 1YO8A 4RRXA 4Y71B 3P5BL 2BOUA 2WPKE 2W2NE 3H5CB 1YUFA 1X7AL 1IOXA 4MMYB 2VH6B 2Y81B 1IQIL 1DIYA 4RUTA 4Z0KB 2G00L 4RS0A 1CEJA 2PHBB 3V65B 1F7MA 3KQEL 4XLWA 1JL9A 1NT0A 5CKQA 2BOHA 1LMJA 2XC5L 2B7DL 5JB8E 1L5GB 4NG9L 3S6XA 1G1QA 1NFUB 4RRZA 2Y38A 2XBYL 2WFXB 2UWLB 3N8YB 1C5MF 2WPLE 3IITB 1IQGL 2WG4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HO4 A;  1PGE A;  1JV2 B;  3ENS A;  4JZF L;  1QFK L;  3TK5 B;  2BZ6 L;  5COX A;  1V3X B;  2PUQ L;  4Y76 B;  1HT5 A;  4NA9 L;  4OTJ A;  5L30 L;  1TPG A;  1NQL B;  2KB9 A;  3V64 C;  4Z0L A;  4XL1 A;  4CUF A;  1P9J A;  3FCS B;  3N8Y A;  1NFW B;  1CX2 A;  1EZQ B;  1Z6C A;  1EPG A;  1YUG A;  3KCG L;  1N7D A;  4O02 B;  1EMN A;  4LOR A;  4XBM A;  1FE2 A;  4MMZ B;  1UZJ A;  1FF7 A;  4LMF A;  1WHF A;  1ZAQ A;  4G1M B;  3CA7 A;  1CQE A;  2Y7Z B;  2Y7X B;  2D1J B;  3CEN L;  1L3Y A;  4ZH8 B;  4Y7A B;  4ZXY L;  2Y5H L;  2J4I B;  1EAI C;  3GCX E;  1IOE L;  4ZXX L;  1K37 A;  1CCV A;  3SOQ A;  4D0F A;  1U67 A;  5K0H B;  3RR3 A;  4OTY A;  1EQH A;  4JYU L;  1DDX A;  4X8S L;  1MOX C;  5IKV A;  5F19 A;  2K2S B;  1G1T A;  2W3K B;  1FAK L;  2P3U A;  3NJP C;  5L2Y L;  5IKR A;  4Y6D B;  5CKN A;  2XBX L;  4CUD A;  1EGF A;  1M1X B;  1TOZ A;  2VWN L;  2FLB L;  1HRE A;  2WPM E;  1UZQ A;  2P16 L;  3N8W B;  1OB1 C;  3HS6 A;  3M37 L;  1CVW L;  3PGH A;  1G1R A;  5IKT A;  4Z6A L;  3C9A C;  1MQ5 L;  2EI7 B;  2FZZ L;  4YT6 L;  1ATA A;  3GCW E;  2VWL L;  1U8C B;  4O1Z A;  1IJQ A;  1KIG L;  3LN0 A;  3OLU A;  3F1S B;  1Q4G A;  2DDU A;  3FFG L;  2BQW A;  3NTG A;  4Y7B B;  1FFM A;  1SZB A;  1XFE A;  1UZK A;  2XBW L;  3F6U L;  3HO5 A;  1G2M B;  1ATE A;  3NTB A;  1NZI A;  1LPZ A;  5JBA E;  2JKH L;  1HX2 A;  2BO2 A;  3POY A;  1LPK A;  1UZP A;  1BF9 A;  4BXS A;  2Y5G L;  1J9C L;  2BQ7 A;  2RHP A;  3ASI A;  1IGZ A;  3SOV A;  4JYV L;  2J95 B;  5CIS A;  3TGF A;  3R05 A;  1G2L B;  1B9W A;  1COU A;  1APQ A;  2J34 B;  2J2U B;  2XC4 L;  3QH0 A;  2BOX A;  3KQB L;  3BT1 A;  2VJ3 A;  4X8U L;  3TH3 L;  1NPE B;  2J38 B;  1PFX L;  4M10 A;  1IVO C;  1YGC L;  2VWM K;  5FDQ A;  1XKB A;  1A3P A;  1JBU L;  3LIW B;  3NT1 A;  3FBY A;  3BT2 A;  1W8B L;  4JZD L;  2W26 B;  3N8Z A;  1IGX A;  4D0E A;  2I9A A;  4A7I A;  2CJI B;  3EGF A;  3HS7 A;  1KLJ L;  5JBB E;  2P93 L;  1CCF A;  2XBV L;  2AYL A;  3TBD A;  2W2O E;  4AQT A;  1IQM L;  1PRH A;  1RFN B;  4X8V L;  4CSY A;  1Z6E L;  3N8X A;  2KV4 A;  2MHP A;  2W3I B;  1LPG A;  1IP0 A;  2FD6 A;  3KQC L;  2FLR L;  1FJS L;  3M36 L;  3ELA L;  3U73 A;  5EGM B;  2W86 A;  4MMX B;  1PXX A;  2BMG A;  3LC5 B;  2I9B A;  1F0R B;  1DX5 I;  4JZE L;  2MGP A;  4RRY A;  2P3F N;  1IQK L;  3N8V A;  3KK6 A;  1YUK B;  4YT7 L;  1XDT R;  2P28 B;  2M74 A;  1HAE A;  2RA0 L;  2VVC K;  2ADX A;  1HZ8 A;  1EMO A;  5I46 L;  1ADX A;  1IQF L;  1FAX L;  2WPI E;  1HJ7 A;  1IQE L;  1XKA L;  2VH0 B;  1EQG A;  1W7X L;  1FSB A;  5L2Z L;  2W2Q E;  4BTI A;  5CKM A;  4PH9 A;  1HCG B;  1LQD A;  4NGA L;  2WYG B;  2OYU P;  2WYJ B;  1HRF A;  1KSN B;  3IJE B;  3K9X A;  1TLE A;  1URK A;  1EPH A;  1PTH A;  2BQ6 A;  1CVU A;  5F1A A;  2Y82 B;  1HT8 A;  1O5D L;  2Q1J B;  1EPJ A;  4TGF A;  3CS7 L;  2TGF A;  3QCW A;  4ISH L;  3LAQ A;  3SOB B;  2UWP B;  2J94 B;  4E1G A;  2XC0 L;  2FLG A;  1HAF A;  5JBC E;  5JB9 E;  2VWO L;  4YZU B;  4D90 A;  1F0S B;  4FM5 A;  4RRW A;  2P26 A;  1NFY B;  3BPS E;  3N8W A;  4BDW A;  4BTT A;  1IQL L;  4C16 A;  1EPI A;  2Y80 B;  5JVY A;  3OLT A;  3ZYJ B;  1NFX B;  5KIR A;  5KN5 C;  4M11 A;  1IQH L;  2W2P E;  4CUE A;  3Q7D A;  2UWO B;  1P0S L;  2P95 L;  2WG3 C;  3ZYI B;  5JW1 A;  2EI6 B;  1AUT L;  1GK5 A;  2VVU L;  3MQE A;  3GIS X;  2PR3 B;  2YGP A;  4BTU A;  4ISI L;  3U7U G;  3KRK A;  2P3T A;  2MGR A;  2WFT A;  2EI8 B;  1ATB A;  2OYE P;  2BOK L;  3QMO A;  2W2M E;  5E8D A;  1WHE A;  1N1I A;  2P94 L;  1KLI L;  1ATD A;  2H9E L;  3LTF B;  3TK6 B;  3SW2 A;  1APO A;  2VVV L;  3CFW A;  4COX A;  1WU1 B;  4Y79 B;  2WPJ E;  6COX A;  1IQN L;  2KL7 A;  2RNL A;  3KQD L;  3TZI A;  3LN1 A;  1G1S A;  3LTG D;  3Q3K B;  2YGO A;  5JVZ A;  3MDL A;  2WPH E;  2K2T A;  2NPR A;  1I0U A;  2GD4 A;  3DEM A;  1IQJ L;  1F7E A;  1DQB A;  4BXW A;  4ZHA B;  3KL6 B;  1KLO A;  5IKQ A;  2P3F L;  2F9B L;  4BDX A;  3HO3 A;  3LC3 B;  4ZAE B;  1K36 A;  2Y5F L;  3HS5 A;  1DVA L;  4X8T L;  1MQ6 L;  1EBV A;  3ZYG A;  3HPT A;  1YO8 A;  4RRX A;  4Y71 B;  3P5B L;  2BOU A;  2WPK E;  2W2N E;  3H5C B;  1YUF A;  1X7A L;  1IOX A;  4MMY B;  2VH6 B;  2Y81 B;  1IQI L;  1DIY A;  4RUT A;  4Z0K B;  2G00 L;  4RS0 A;  1CEJ A;  2PHB B;  3V65 B;  1F7M A;  3KQE L;  4XLW A;  1JL9 A;  1NT0 A;  5CKQ A;  2BOH A;  1LMJ A;  2XC5 L;  2B7D L;  5JB8 E;  1L5G B;  4NG9 L;  1G1Q A;  1NFU B;  4RRZ A;  2Y38 A;  2XBY L;  2WFX B;  2UWL B;  3N8Y B;  1C5M F;  2WPL E;  3IIT B;  1IQG L;  2WG4 B; 
#chains in the Genus database with same CATH topology
 3HO4 A;  1PGE A;  1JV2 B;  3ENS A;  4JZF L;  1QFK L;  3TK5 B;  2BZ6 L;  4A94 C;  5COX A;  1V3X B;  2PUQ L;  4Y76 B;  1V1I A;  1HT5 A;  4NA9 L;  4OTJ A;  5L30 L;  1TPG A;  1NQL B;  2KB9 A;  4GU4 A;  3V64 C;  4Z0L A;  4XL1 A;  4CUF A;  1P9J A;  3FCS B;  3N8Y A;  1NFW B;  1CX2 A;  1EZQ B;  1Z6C A;  1EPG A;  1YUG A;  3KCG L;  1N7D A;  4O02 B;  1EMN A;  4LOR A;  4XBM A;  1FE2 A;  4MMZ B;  1UZJ A;  1FF7 A;  4LMF A;  1WHF A;  1ZAQ A;  4G1M B;  3CA7 A;  1CQE A;  2Y7Z B;  2Y7X B;  2D1J B;  3CEN L;  1L3Y A;  4ZH8 B;  4Y7A B;  4ZXY L;  2Y5H L;  2J4I B;  1EAI C;  3GCX E;  1IOE L;  4ZXX L;  1K37 A;  1CCV A;  3SOQ A;  4D0F A;  1U67 A;  5K0H B;  3RR3 A;  4OTY A;  1EQH A;  4JYU L;  1DDX A;  4X8S L;  1MOX C;  5IKV A;  5F19 A;  2K2S B;  1G1T A;  2W3K B;  1FAK L;  2P3U A;  3NJP C;  5L2Y L;  5IKR A;  4Y6D B;  5CKN A;  2XBX L;  4CUD A;  1EGF A;  1M1X B;  1TOZ A;  2BT8 A;  2VWN L;  2FLB L;  1HRE A;  2WPM E;  1UZQ A;  2P16 L;  3N8W B;  1OB1 C;  3HS6 A;  3M37 L;  1CVW L;  3PGH A;  1G1R A;  5IKT A;  4Z6A L;  3C9A C;  1MQ5 L;  2EI7 B;  2FZZ L;  4YT6 L;  1ATA A;  3GCW E;  2VWL L;  1U8C B;  1IJQ A;  1KIG L;  4O1Z A;  3LN0 A;  3OLU A;  3F1S B;  1Q4G A;  2DDU A;  3FFG L;  2BQW A;  3NTG A;  4Y7B B;  1FFM A;  1SZB A;  1XFE A;  1UZK A;  2XBW L;  3F6U L;  2HOR A;  1QIU A;  3HO5 A;  1G2M B;  1ATE A;  3NTB A;  1NZI A;  1LPZ A;  5JBA E;  2HOX A;  2JKH L;  1HX2 A;  2BO2 A;  3POY A;  1LPK A;  1UZP A;  1BF9 A;  4BXS A;  2Y5G L;  1J9C L;  2BQ7 A;  2RHP A;  3ASI A;  1IGZ A;  3SOV A;  4JYV L;  2J95 B;  5CIS A;  3TGF A;  3R05 A;  1LK9 A;  1G2L B;  1B9W A;  1COU A;  1APQ A;  2J34 B;  2J2U B;  2XC4 L;  3QH0 A;  2BOX A;  3KQB L;  3BT1 A;  2VJ3 A;  4X8U L;  3TH3 L;  1NPE B;  2J38 B;  1PFX L;  4M10 A;  1IVO C;  1YGC L;  2JJL A;  2VWM K;  5FDQ A;  1XKB A;  1A3P A;  1JBU L;  3LIW B;  3NT1 A;  3FBY A;  3BT2 A;  1W8B L;  4JZD L;  2W26 B;  3N8Z A;  1IGX A;  4D0E A;  2I9A A;  4A7I A;  2CJI B;  3EGF A;  3HS7 A;  1KLJ L;  5JBB E;  2P93 L;  1CCF A;  2XBV L;  2AYL A;  3TBD A;  2W2O E;  4AQT A;  1IQM L;  1PRH A;  1RFN B;  4X8V L;  4CSY A;  1Z6E L;  3N8X A;  2KV4 A;  2MHP A;  2W3I B;  1LPG A;  1IP0 A;  2FD6 A;  3KQC L;  2FLR L;  2BSF A;  2VRS A;  1FJS L;  3M36 L;  3ELA L;  3U73 A;  5EGM B;  2W86 A;  4MMX B;  1PXX A;  2BMG A;  3LC5 B;  2I9B A;  1F0R B;  1DX5 I;  4JZE L;  2H9E C;  2MGP A;  4RRY A;  2P3F N;  1IQK L;  3N8V A;  3KK6 A;  2YGQ A;  1YUK B;  4YT7 L;  1XDT R;  2P28 B;  2M74 A;  1HAE A;  2RA0 L;  2VVC K;  2ADX A;  1HZ8 A;  1EMO A;  5I46 L;  1ADX A;  1IQF L;  1FAX L;  2WPI E;  1HJ7 A;  1IQE L;  1XKA L;  2VH0 B;  1EQG A;  2BT7 A;  1W7X L;  1FSB A;  5L2Z L;  2W2Q E;  4BTI A;  5CKM A;  4PH9 A;  1HCG B;  1LQD A;  4NGA L;  2WYG B;  2OYU P;  2WYJ B;  1HRF A;  1KSN B;  3IJE B;  3K9X A;  1TLE A;  1URK A;  1EPH A;  1PTH A;  2BQ6 A;  1CVU A;  5F1A A;  2Y82 B;  1HT8 A;  1O5D L;  2Q1J B;  1EPJ A;  4TGF A;  3CS7 L;  2TGF A;  3QCW A;  4ISH L;  3LAQ A;  3SOB B;  2UWP B;  2J94 B;  4E1G A;  2XC0 L;  2FLG A;  1HAF A;  5JBC E;  5JB9 E;  2VWO L;  4YZU B;  4D90 A;  1F0S B;  4FM5 A;  4RRW A;  2P26 A;  1NFY B;  3BPS E;  3N8W A;  4BDW A;  4BTT A;  1IQL L;  4C16 A;  1EPI A;  2Y80 B;  5JVY A;  2KNI A;  3OLT A;  3ZYJ B;  1NFX B;  5KIR A;  5KN5 C;  4M11 A;  1IQH L;  1KKE A;  2W2P E;  4CUE A;  3Q7D A;  2UWO B;  1P0S L;  2P95 L;  2WG3 C;  3ZYI B;  5JW1 A;  2EI6 B;  1AUT L;  1GK5 A;  2VVU L;  3MQE A;  3GIS X;  2PR3 B;  2YGP A;  4BTU A;  4ISI L;  3U7U G;  3KRK A;  2P3T A;  2MGR A;  2WFT A;  2EI8 B;  1ATB A;  2OYE P;  2BOK L;  3QMO A;  2W2M E;  5E8D A;  1WHE A;  1N1I A;  2P94 L;  2WZP P;  1KLI L;  1ATD A;  2H9E L;  3LTF B;  3TK6 B;  3SW2 A;  1APO A;  2VVV L;  3CFW A;  1V1H A;  4COX A;  1WU1 B;  4Y79 B;  2WPJ E;  6COX A;  1IQN L;  2KL7 A;  2RNL A;  3KQD L;  3TZI A;  3LN1 A;  1G1S A;  3LTG D;  3Q3K B;  2YGO A;  5JVZ A;  3MDL A;  2WPH E;  2K2T A;  2NPR A;  1I0U A;  2GD4 A;  3DEM A;  1IQJ L;  1F7E A;  4GU3 A;  1DQB A;  4BXW A;  4ZHA B;  3KL6 B;  1KLO A;  5IKQ A;  2P3F L;  2F9B L;  4BDX A;  3HO3 A;  3LC3 B;  4ZAE B;  1LMM A;  1K36 A;  2Y5F L;  3HS5 A;  1DVA L;  4X8T L;  1MQ6 L;  1EBV A;  3ZYG A;  3HPT A;  1YO8 A;  4RRX A;  4Y71 B;  3P5B L;  2BOU A;  2WPK E;  2W2N E;  3H5C B;  1YUF A;  1X7A L;  1IOX A;  4MMY B;  2VH6 B;  2Y81 B;  1IQI L;  1DIY A;  4RUT A;  4Z0K B;  2G00 L;  4RS0 A;  1CEJ A;  2PHB B;  3V65 B;  1F7M A;  3KQE L;  4XLW A;  1JL9 A;  1NT0 A;  5CKQ A;  2BOH A;  1LMJ A;  2XC5 L;  2B7D L;  5JB8 E;  1L5G B;  4NG9 L;  3S6X A;  1G1Q A;  1NFU B;  4RRZ A;  2Y38 A;  2XBY L;  2WFX B;  2UWL B;  3N8Y B;  1C5M F;  2WPL E;  3IIT B;  1IQG L;  2WG4 B; 
#chains in the Genus database with same CATH homology
 3HO4 A;  1PGE A;  1JV2 B;  3ENS A;  4JZF L;  1QFK L;  3TK5 B;  2BZ6 L;  4A94 C;  5COX A;  1V3X B;  2PUQ L;  4Y76 B;  1HT5 A;  4NA9 L;  4OTJ A;  5L30 L;  1TPG A;  1NQL B;  2KB9 A;  3V64 C;  4Z0L A;  4XL1 A;  4CUF A;  1P9J A;  3FCS B;  3N8Y A;  1NFW B;  1CX2 A;  1EZQ B;  1Z6C A;  1EPG A;  1YUG A;  3KCG L;  1N7D A;  4O02 B;  1EMN A;  4LOR A;  4XBM A;  1FE2 A;  4MMZ B;  1UZJ A;  1FF7 A;  4LMF A;  1WHF A;  1ZAQ A;  4G1M B;  3CA7 A;  1CQE A;  2Y7Z B;  2Y7X B;  2D1J B;  3CEN L;  1L3Y A;  4ZH8 B;  4Y7A B;  4ZXY L;  2Y5H L;  2J4I B;  1EAI C;  3GCX E;  1IOE L;  4ZXX L;  1K37 A;  1CCV A;  3SOQ A;  4D0F A;  1U67 A;  5K0H B;  3RR3 A;  4OTY A;  1EQH A;  4JYU L;  1DDX A;  4X8S L;  1MOX C;  5IKV A;  5F19 A;  2K2S B;  1G1T A;  2W3K B;  1FAK L;  2P3U A;  3NJP C;  5L2Y L;  5IKR A;  4Y6D B;  5CKN A;  2XBX L;  4CUD A;  1EGF A;  1M1X B;  1TOZ A;  2VWN L;  2FLB L;  1HRE A;  2WPM E;  1UZQ A;  2P16 L;  3N8W B;  1OB1 C;  3HS6 A;  3M37 L;  1CVW L;  3PGH A;  1G1R A;  5IKT A;  4Z6A L;  3C9A C;  1MQ5 L;  2EI7 B;  2FZZ L;  4YT6 L;  1ATA A;  3GCW E;  2VWL L;  1U8C B;  1IJQ A;  1KIG L;  4O1Z A;  3LN0 A;  3OLU A;  3F1S B;  1Q4G A;  2DDU A;  3FFG L;  2BQW A;  3NTG A;  4Y7B B;  1FFM A;  1SZB A;  1XFE A;  1UZK A;  2XBW L;  3F6U L;  3HO5 A;  1G2M B;  1ATE A;  3NTB A;  1NZI A;  1LPZ A;  5JBA E;  2JKH L;  1HX2 A;  2BO2 A;  3POY A;  1LPK A;  1UZP A;  1BF9 A;  4BXS A;  2Y5G L;  1J9C L;  2BQ7 A;  2RHP A;  3ASI A;  1IGZ A;  3SOV A;  4JYV L;  2J95 B;  5CIS A;  3TGF A;  3R05 A;  1G2L B;  1B9W A;  1COU A;  1APQ A;  2J34 B;  2J2U B;  2XC4 L;  3QH0 A;  2BOX A;  3KQB L;  3BT1 A;  2VJ3 A;  4X8U L;  3TH3 L;  1NPE B;  2J38 B;  1PFX L;  4M10 A;  1IVO C;  1YGC L;  2VWM K;  5FDQ A;  1XKB A;  1A3P A;  1JBU L;  3LIW B;  3NT1 A;  3FBY A;  3BT2 A;  1W8B L;  4JZD L;  2W26 B;  3N8Z A;  1IGX A;  4D0E A;  2I9A A;  4A7I A;  2CJI B;  3EGF A;  3HS7 A;  1KLJ L;  5JBB E;  2P93 L;  1CCF A;  2XBV L;  2AYL A;  3TBD A;  2W2O E;  4AQT A;  1IQM L;  1PRH A;  1RFN B;  4X8V L;  4CSY A;  1Z6E L;  3N8X A;  2KV4 A;  2MHP A;  2W3I B;  1LPG A;  1IP0 A;  2FD6 A;  3KQC L;  2FLR L;  1FJS L;  3M36 L;  3ELA L;  3U73 A;  5EGM B;  2W86 A;  4MMX B;  1PXX A;  2BMG A;  3LC5 B;  2I9B A;  1F0R B;  1DX5 I;  4JZE L;  2H9E C;  2MGP A;  4RRY A;  2P3F N;  1IQK L;  3N8V A;  3KK6 A;  2YGQ A;  1YUK B;  4YT7 L;  1XDT R;  2P28 B;  2M74 A;  1HAE A;  2RA0 L;  2VVC K;  2ADX A;  1HZ8 A;  1EMO A;  5I46 L;  1ADX A;  1IQF L;  1FAX L;  2WPI E;  1HJ7 A;  1IQE L;  1XKA L;  2VH0 B;  1EQG A;  1W7X L;  1FSB A;  5L2Z L;  2W2Q E;  4BTI A;  5CKM A;  4PH9 A;  1HCG B;  1LQD A;  4NGA L;  2WYG B;  2OYU P;  2WYJ B;  1HRF A;  1KSN B;  3IJE B;  3K9X A;  1TLE A;  1URK A;  1EPH A;  1PTH A;  2BQ6 A;  1CVU A;  5F1A A;  2Y82 B;  1HT8 A;  1O5D L;  2Q1J B;  1EPJ A;  4TGF A;  3CS7 L;  2TGF A;  3QCW A;  4ISH L;  3LAQ A;  3SOB B;  2UWP B;  2J94 B;  4E1G A;  2XC0 L;  2FLG A;  1HAF A;  5JBC E;  5JB9 E;  2VWO L;  4YZU B;  4D90 A;  1F0S B;  4FM5 A;  4RRW A;  2P26 A;  1NFY B;  3BPS E;  3N8W A;  4BDW A;  4BTT A;  1IQL L;  4C16 A;  1EPI A;  2Y80 B;  5JVY A;  2KNI A;  3OLT A;  3ZYJ B;  1NFX B;  5KIR A;  5KN5 C;  4M11 A;  1IQH L;  2W2P E;  4CUE A;  3Q7D A;  2UWO B;  1P0S L;  2P95 L;  2WG3 C;  3ZYI B;  5JW1 A;  2EI6 B;  1AUT L;  1GK5 A;  2VVU L;  3MQE A;  3GIS X;  2PR3 B;  2YGP A;  4BTU A;  4ISI L;  3U7U G;  3KRK A;  2P3T A;  2MGR A;  2WFT A;  2EI8 B;  1ATB A;  2OYE P;  2BOK L;  3QMO A;  2W2M E;  5E8D A;  1WHE A;  1N1I A;  2P94 L;  2WZP P;  1KLI L;  1ATD A;  2H9E L;  3LTF B;  3TK6 B;  3SW2 A;  1APO A;  2VVV L;  3CFW A;  4COX A;  1WU1 B;  4Y79 B;  2WPJ E;  6COX A;  1IQN L;  2KL7 A;  2RNL A;  3KQD L;  3TZI A;  3LN1 A;  1G1S A;  3LTG D;  3Q3K B;  2YGO A;  5JVZ A;  3MDL A;  2WPH E;  2K2T A;  2NPR A;  1I0U A;  2GD4 A;  3DEM A;  1IQJ L;  1F7E A;  1DQB A;  4BXW A;  4ZHA B;  3KL6 B;  1KLO A;  5IKQ A;  2P3F L;  2F9B L;  4BDX A;  3HO3 A;  3LC3 B;  4ZAE B;  1LMM A;  1K36 A;  2Y5F L;  3HS5 A;  1DVA L;  4X8T L;  1MQ6 L;  1EBV A;  3ZYG A;  3HPT A;  1YO8 A;  4RRX A;  4Y71 B;  3P5B L;  2BOU A;  2WPK E;  2W2N E;  3H5C B;  1YUF A;  1X7A L;  1IOX A;  4MMY B;  2VH6 B;  2Y81 B;  1IQI L;  1DIY A;  4RUT A;  4Z0K B;  2G00 L;  4RS0 A;  1CEJ A;  2PHB B;  3V65 B;  1F7M A;  3KQE L;  4XLW A;  1JL9 A;  1NT0 A;  5CKQ A;  2BOH A;  1LMJ A;  2XC5 L;  2B7D L;  5JB8 E;  1L5G B;  4NG9 L;  3S6X A;  1G1Q A;  1NFU B;  4RRZ A;  2Y38 A;  2XBY L;  2WFX B;  2UWL B;  3N8Y B;  1C5M F;  2WPL E;  3IIT B;  1IQG L;  2WG4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...