1XKSA

The crystal structure of the n-terminal domain of nup133 reveals a beta-propeller fold common to several nucleoporins
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
403
structure length
374
Chain Sequence
ESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSTQAVAVMVATREGSIRYWPSLAGEDTYTEAFVDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHILPQGQGMSDLTLSSVLWDRERSSFYSLTSSNISKWELDDSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWHSADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLYNESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup133
publication title Structural and functional analysis of Nup133 domains reveals modular building blocks of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 87
structure length 374
sequence length 403
ec nomenclature
pdb deposition date 2004-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1xksA00
4QT8A 4NSXA 2PBIB 3I8CA 3I7NA 1XHMA 4ZOVA 4GGAA 1L0QA 2QC5A 2P9IC 3RLMD 3BG1A 3RSEC 2AQ5A 3P4FA 2IURA 3C75H 5TEFA 2XU7A 3GFCA 4GMBA 3SHFA 5GSAA 1Q47A 3DM0A 5EALA 1U2VC 4JSNC 4D0KA 4LGNA 4JXMA 3SJLD 3SVWD 2IUQA 3PXTD 1A0RB 3RN0D 4U7AA 4Y5RD 3I89A 4J8GA 3HFQA 3V9FA 2QXVA 3ZWLB 3DWLC 3L4OD 1P22A 3KRXB 5IGQA 2PM9B 4CI8A 1QNIA 2MTAH 1ERJA 3JZHA 4LG9A 3AH8B 3FRXA 3NVXA 2XL3A 3N0DA 1MDAH 2OVPB 2B5NA 4A08A 1VYHC 1YFQA 4FA4D 4A09B 4QL1A 2IUVA 4OWRA 2O9KA 1MG2A 1PGUA 4IMMA 3SCYA 3IIWA 4J0XA 3I7KA 4G56B 5EM2B 3NVQA 2OVQB 1PI6A 3UVNA 4A11A 2AH0A 3RFHA 5AMSA 5EAPA 2XL2A 2HKMA 3B7FA 3UR4A 3MZLA 1FWXA 3EI3B 3J81g 3SFZA 5B4WA 4CI1A 1PBYB 4CY2A 3V7DB 2OJYA 4A0AB 3IJCA 5EMMB 3SXTD 4JSPC 1R5MA 4JD2C 5HQGA 4O3UB 3PVWB 1OMWB 3EI2B 1SHYB 2H9LA 3BG0A 2H47A 1GP2B 2YBAA 1N6FA 2I0TA 3UVOA 5EAMA 4BUJC 2CN3A 3EWEA 5GMKn 4LG8A 4A0BB 3C99A 2Z2PA 4FA9D 4CY1A 3OL2B 3UVKA 5H17A 4JSXC 2YNOA 5FXYA 2G99A 4E5ZB 4Z8LA 5I5MA 3JAMg 5FKTA 2OVRB 4CZVA 4ZOZA 3KRWB 3IJ0A 3PVUB 5HE3B 4GM3A 5CYKB 4CY3A 2W18A 5FA5B 2P9SC 5THAA 4R7AB 1JMZB 4O1QD 3AFCA 3I2NA 2H13A 2J55H 3VGZA 3JRPA 1XIPA 5TEEA 3MKQA 4H5JA 4PXWA 5FKSA 5C2VB 2H14A 4X60B 3JROA 3I7LA 1GG2B 1K32A 5IGOA 2OK6A 4CC9A 4ERZA 4GQ1A 3JZGA 3PXWD 4FA1D 3RN1D 4JT5C 4CY5A 3EG6A 1B9XA 3DXKC 3I7HA 2HJBA 4GQ2P 4HDJA 3SLED 3EI4A 3N0EA 4L9OA 2Q7QA 5KDOB 3K26A 3MKSB 4GQBB 1U4CA 2Z2NA 4E54A 2AGLA 3F3FA 4J77A 4PC0A 2CNXA 4MK0B 5EARA 2B5LA 3OKWA 3ORVD 3PXSD 4J86A 2P9PC 3VA6A 3FGBA 2AH1A 4PBZA 5A2Qg 3JZNA 5K1CC 3UKUC 4J8BA 4ZN4A 1GOTB 4JT6C 4JSVC 4FA5D 4O3TB 3AL8A 4IA9A 1B9YA 2J57G 4KFMB 4L3GD 2IUPA 3SBPA 5C9ZB 2IWKA 4J84A 4A08B 4CZXA 4UI9R 5HYNB 3RRMC 5CXCA 4TZ4A 4GGCA 1JJUB 2H6QA 3JPXA 2OK4A 4X3EA 5FQDA 4PSWB 5I5IA 3PE7A 3SN6B 2PM6B 3JB9L 4XYIA 3E0CA 4A11B 3IKOA 2UZXB 1N6DA 1XKSA 3GREA 2I0SA 2IAAA 3EU7A 2XYIA 3ULEC 3F3GA 2CE9A 3EMHA 4GGDA 4U1EI 2H9PA 4PNKB 1JMXB 2AGYA 5IT9g 5CXBA 2CO0C 4BH6A 3ODTA 3DXMC 3EI1A 4N14A 4AOWA 1NEXB 2HYEA 2GC7A 2G9AA 3DSMA 5TDHB 1JOFA 2I3TA 4FAVD 2P9KC 3J80g 2B4EA 4PBYA 2AGXA 2Z2OA 2UZYB 4H5IA 5EMLB 3MZKA 4O9DA 3F3PA 1K8KC 5TF2A 2PM7B 2TRCB 2H6NA 4ZOYA 4XEIC 4X63B 4ERQA 4K3JB 4Y7RA 5GXHA 3IJ1A 1RI6A 1TYQC 4D6VA 2GC4A 3CFSB 3AL9A 4YVDA 2I3SA 3UKRC 1MG3A 4XYHA 3FM0A 4J73A 5FKQA 4J87A 4PSXB 3C5MA 2EBSA 5H1MA 4ZOXA 4FWWA 2AGWA 3RFGA 3OW8A 2H9MA 4ESGA 3OKYA 2P9UC 5AJAA 5FLXg 4FAND 3SBRA 2P9LC 3CFVA 3UVLA 4J0WA 3OTTA 4CZYA 3I7PA 2OIZA 2PM9A 4L1QD 4GZ8A 2HJ4A 3EI4B 1SQJA 4BL0A 5AFU3 3OKYB 2HESX 2B5MA 2H9NA 4E54B 3C9CA 1GXRA 4AEZA 3CIKB 3L4MD 2GNQA 3I7OA 4OZUA 4A09A 4A2LA 5FKRA 5I5JA 2CO0A 5C2WB 4J81A 5EM2A 3PSLA 3I8EA 5JWZA 1SQ9A 1OLZA 3K27A 3BWSA 5H14A 4FHLA 4J79A 5IJ7E 4ERYA 4EWRA 3EI3A 3AL8B 5K19A 3IIYA 2H68A 4QRJA 5IJ8E 3SWSD 4X61B 4A0AA 4O45A 4GM9A 5HE0B 5CXCB 5EMKB 1PEVA 3NVNA 1N6EA 3EI2A 3W15A 2YNNA 5HE2B 3SMRA 4L3HD 1NR0A 3RMZD 2I0RA 5GXIA 3SBQA 4A7JA 4FB1D 4A0BA 3UVMA 4CI3A 4I79A 3MMYA 3OL2A 4GM8A 2CE8A 4A2MA 3MXXA 5IC7A 2YNPA 3VH0A 5CXBB 4CI2A 4E5ZA 2H3XA 2BCJB 2IWFA 2CN2A 3PSCB 5EMJB 2AGZA 4J82A 4QQEA 2J56H 5SXMA 3EI1B 3A0FA 1S4UX 3U4YA 2P9NC 3OKTA 2HKRA 4ES0A 4K3ID 2YB8B 5CYKA 3V5WB 5HE1B 2HXCA 1TBGA 2H6KA 4J78A 2YMUA 2BBKH
chains in the Genus database with same CATH superfamily
4QT8A 3NIFA 1K3IA 2PBIB 4NSXA 3EQ9A 4RE6A 3I8CA 3I7NA 1XHMA 1L5GA 4MMXA 4ZOVA 4AX4A 4GGAA 1L0QA 3MUNA 2QC5A 3MUOA 2P9IC 3RLMD 3BG1A 3RSEC 2AQ5A 4AN1A 3P4FA 2IURA 3C75H 5TEFA 2XU7A 3GFCA 4GMBA 3SHFA 5GSAA 1Q47A 3DM0A 2QZPA 5EALA 1U2VC 4JSNC 4WJKA 1C9LA 3ZE2A 4D0KA 4LGNA 4JXMA 3SJLD 3SVWD 2IUQA 3PXTD 3ZE1A 1A0RB 3RN0D 4U7AA 4Y5RD 3I89A 4J8GA 3HFQA 3V9FA 2QXVA 3ZWLB 3DWLC 3L4OD 1P22A 4JHPC 3KRXB 5IGQA 3IULA 2PM9B 3VI3A 4CI8A 1QNIA 2MTAH 1ERJA 3JZHA 4LG9A 3AH8B 1H2XA 3FRXA 3NVXA 2XL3A 3N0DA 1GOGA 1MDAH 2OVPB 2B5NA 4A08A 1VYHC 5M5UA 1YFQA 4FA4D 4A09B 4QL1A 2IUVA 4OWRA 2O9KA 1MG2A 3IUJA 5M61A 1PGUA 4IMMA 3SCYA 3IIWA 4J0XA 3I7KA 4G56B 5EM2B 3NVQA 4AMZA 2OVQB 1PI6A 3UVNA 4A11A 2AH0A 1VE7A 3RFHA 5AMSA 5EAPA 2XL2A 1VZ3A 2HKMA 3B7FA 3KCIA 3GD1I 3UR4A 3MZLA 1FWXA 3EI3B 3J81g 1E8NA 3SFZA 5B4WA 5HDBA 4CI1A 4AMYA 1PBYB 4CY2A 3V7DB 2OJYA 2QR5A 4A0AB 3IJCA 5EMMB 1QFSA 3QI0A 3O4JA 3SXTD 4JSPC 1R5MA 5M5RA 2WQ8A 4JD2C 2EIDA 5HQGA 4WK4A 4O3UB 3PVWB 1OMWB 3EI2B 1SHYB 2H9LA 4O02A 3BG0A 2H47A 2VDKA 1GP2B 3NIGA 2YBAA 1N6FA 2I0TA 5C92A 3UVOA 5EAMA 4RE5A 4BUJC 2CN3A 3EWEA 5GMKn 2VDRA 4LG8A 2VZ1A 3C99A 4A0BB 2Z2PA 1H2ZA 4FA9D 4CY1A 3OL2B 3UVKA 5H17A 4JSXC 1H2YA 3ZDYA 2YNOA 5FXYA 2G99A 2EICA 4E5ZB 4G1MA 4Z8LA 5I5MA 3JAMg 5FKTA 2OVRB 4CZVA 3ZE0A 4ZOZA 3KRWB 3IJ0A 3PVUB 5HE3B 4GM3A 5CYKB 4NBMA 4CY3A 2W18A 5FA5B 4O2WA 3NIDA 3MVDK 1A12A 2P9SC 4R7AB 5THAA 1JMZB 4O1QD 3AFCA 3I2NA 2H13A 2J55H 3VGZA 3JRPA 2VZ3A 1XIPA 5TEEA 3MKQA 4H5JA 4PXWA 5FKSA 4Z7NA 5C2VB 2H14A 3DDUA 4BCBA 4X60B 3JROA 3I7LA 1GG2B 1K32A 5IGOA 2OK6A 4CC9A 4ERZA 4GQ1A 3JZGA 3PXWD 4FA1D 3RN1D 4JT5C 4CY5A 3EG6A 1M1XA 1B9XA 3K72A 3T3PA 2VC2A 5M5VA 3DXKC 3I7HA 2HJBA 4GQ2P 4HDJA 3SLED 3V4VA 1TYEA 4AN0A 3EI4A 3N0EA 4L9OA 2VDLA 2Q7QA 5KDOB 3IVMA 3K26A 3MKSB 1U4CA 2Z2NA 4GQBB 4E54A 2AGLA 3F3FA 4J77A 4PC0A 5C86A 2CNXA 4MK0B 5EARA 2B5LA 3OKWA 4JHNA 3ORVD 2XDWA 3PXSD 4J86A 2P9PC 3VA6A 3FGBA 2AH1A 4PBZA 5A2Qg 1QFMA 3JZNA 5K1CC 3UKUC 4J8BA 1UOQA 3EQ7A 4ZN4A 1GOTB 4JT6C 4JSVC 4FA5D 4O3TB 3AL8A 3IUMA 1B9YA 2J57G 3IUQA 4IA9A 4KFMB 4L3GD 2IUPA 3OF7A 3SBPA 1GOFA 3EQ8A 2IWKA 5C9ZB 3K71A 2VDQA 4QAMA 4J84A 4A08B 4CZXA 4NC4A 4UI9R 2XZGA 3RRMC 5HYNB 1UTCA 5CXCA 4TZ4A 4GGCA 1JJUB 4UM8A 2H6QA 3JPXA 2OK4A 4X3EA 5FQDA 4DNVA 4PSWB 5I5IA 3PE7A 3SN6B 2PM6B 3JB9L 4XYIA 3E0CA 4BCDA 1GOHA 3IKOA 4A11B 2UZXB 1N6DA 5M5SA 1XKSA 4DNWA 3GREA 2I0SA 2IAAA 3EU7A 2XYIA 3ULEC 3F3GA 2CE9A 3EMHA 4GGDA 4U1EI 2EIEA 2H9PA 4PNKB 1JMXB 2AGYA 5IT9g 5CXBA 1E8MA 3QHYB 1T2XA 2CO0C 3IURA 4BH6A 3ODTA 3DXMC 3EI1A 4MMZA 4N14A 4AOWA 1NEXB 2HYEA 2GC7A 2G9AA 3DSMA 5TDHB 5FFOA 1JOFA 2I3TA 4D9SA 1C9IA 4FAVD 1O6FA 2P9KC 3J80g 2VDMA 2B4EA 4PBYA 3FCSA 3GC3B 4UM9A 2AGXA 2VDPA 2Z2OA 2UZYB 4H5IA 5EMLB 3MZKA 4O9DA 3F3PA 1K8KC 3O4HA 5TF2A 2PM7B 2TRCB 4WK0A 2H6NA 4ZOYA 4XEIC 4X63B 4Z7QA 4ERQA 4K3JB 4Y7RA 5E6UA 5GXHA 3IJ1A 1RI6A 1TYQC 4D6VA 2GC4A 3CFSB 3AL9A 4YVDA 2I3SA 3UKRC 1MG3A 3IJEA 4XYHA 3FM0A 4J73A 5FKQA 4J87A 4PSXB 3C5MA 1UOPA 2EBSA 5H1MA 4ZOXA 4G55A 4FWWA 3T3MA 2AGWA 5E6RA 1UOOA 3ZDZA 3RFGA 3OW8A 2H9MA 4ESGA 3OKYA 2P9UC 5AJAA 5FLXg 2HU8A 4FAND 3SBRA 1O6GA 2XE4A 2P9LC 3CFVA 3UVLA 4J0WA 3FCUA 3OTTA 4G1EA 4CZYA 3I7PA 2OIZA 2PM9A 4L1QD 4GZ8A 2HJ4A 3EI4B 4IRZA 4Z7OA 1SQJA 4BL0A 5AFU3 3OKYB 1YR2A 2HESX 2JKXA 5M5TA 2B5MA 1VE6A 2H9NA 4E54B 3C9CA 1GXRA 4AEZA 3CIKB 3L4MD 2GNQA 2HU5A 3I7OA 4OZUA 4A09A 3K6SA 4A2LA 5FKRA 5I5JA 2CO0A 5C2WB 3IUNA 5E6SA 4J81A 3VI4A 5EM2A 3PSLA 3I8EA 5JWZA 1SQ9A 2HU7A 1OLZA 3K27A 3BWSA 5H14A 4FHLA 4J79A 5IJ7E 1E5TA 1JTDB 4ERYA 4EWRA 3EI3A 3AL8B 5K19A 4DNUA 3IIYA 2H68A 4BP8A 1BPOA 4QRJA 5IJ8E 3V4PA 3SWSD 4X61B 2EIBA 4A0AA 4O45A 4GM9A 5HE0B 5CXCB 5EMKB 1PEVA 1H2WA 1I2MB 1N6EA 3NVNA 1JV2A 2BKLA 3EI2A 3W15A 2VDNA 2YNNA 5HE2B 3SMRA 4NAAA 4L3HD 1NR0A 1VZ2A 4WK2A 3RMZD 2I0RA 4MMYA 5GXIA 3SBQA 4A7JA 4FB1D 4A0BA 3UVMA 3O4GA 4CI3A 4I79A 3MMYA 3OL2A 3O4IA 2CE8A 4GM8A 3ZDXA 4A2MA 3MXXA 5IC7A 2YNPA 3VH0A 5CXBB 4CI2A 4E5ZA 2H3XA 2BCJB 2IWFA 2CN2A 3PSCB 1U8CA 5EMJB 2AGZA 4J82A 4QQEA 2J56H 5SXMA 4BP9A 3EI1B 3A0FA 1S4UX 3U4YA 2P9NC 4NENA 3OKTA 4BCCA 2HKRA 4ES0A 4K3ID 2YB8B 5CYKA 3V5WB 4L1MA 5FFGA 5HE1B 2HXCA 1TBGA 2H6KA 4J78A 2YMUA 2BBKH 2VDOA
chains in the Genus database with same CATH topology
4QT8A 4NSXA 2PBIB 3I8CA 3I7NA 1XHMA 4ZOVA 4GGAA 1L0QA 2QC5A 2P9IC 3RLMD 3BG1A 3RSEC 2AQ5A 3P4FA 2IURA 3C75H 5TEFA 2XU7A 3GFCA 4GMBA 3SHFA 5GSAA 1Q47A 3DM0A 5EALA 1U2VC 4JSNC 4D0KA 4LGNA 4JXMA 3SJLD 3SVWD 2IUQA 3PXTD 1A0RB 3RN0D 4U7AA 4Y5RD 3I89A 4J8GA 3HFQA 3V9FA 2QXVA 3ZWLB 3DWLC 3L4OD 1P22A 3KRXB 5IGQA 2PM9B 4CI8A 1QNIA 2MTAH 1ERJA 3JZHA 4LG9A 3AH8B 3FRXA 3NVXA 2XL3A 3N0DA 1MDAH 2OVPB 2B5NA 4A08A 1VYHC 1YFQA 4FA4D 4A09B 4QL1A 2IUVA 4OWRA 2O9KA 1MG2A 1PGUA 4IMMA 3SCYA 3IIWA 4J0XA 3I7KA 4G56B 5EM2B 3NVQA 2OVQB 1PI6A 3UVNA 4A11A 2AH0A 3RFHA 5AMSA 5EAPA 2XL2A 2HKMA 3B7FA 3UR4A 3MZLA 1FWXA 3EI3B 3J81g 3SFZA 5B4WA 4CI1A 1PBYB 4CY2A 3V7DB 2OJYA 4A0AB 3IJCA 5EMMB 3SXTD 4JSPC 1R5MA 4JD2C 5HQGA 4O3UB 3PVWB 1OMWB 3EI2B 1SHYB 2H9LA 3BG0A 2H47A 1GP2B 2YBAA 1N6FA 2I0TA 3UVOA 5EAMA 4BUJC 2CN3A 3EWEA 5GMKn 4LG8A 4A0BB 3C99A 2Z2PA 4FA9D 4CY1A 3OL2B 3UVKA 5H17A 4JSXC 2YNOA 5FXYA 2G99A 4E5ZB 4Z8LA 5I5MA 3JAMg 5FKTA 2OVRB 4CZVA 4ZOZA 3KRWB 3IJ0A 3PVUB 5HE3B 4GM3A 5CYKB 4CY3A 2W18A 5FA5B 2P9SC 5THAA 4R7AB 1JMZB 4O1QD 3AFCA 3I2NA 2H13A 2J55H 3VGZA 3JRPA 1XIPA 5TEEA 3MKQA 4H5JA 4PXWA 5FKSA 5C2VB 2H14A 4X60B 3JROA 3I7LA 1GG2B 1K32A 5IGOA 2OK6A 4CC9A 4ERZA 4GQ1A 3JZGA 3PXWD 4FA1D 3RN1D 4JT5C 4CY5A 3EG6A 1B9XA 3DXKC 3I7HA 2HJBA 4GQ2P 4HDJA 3SLED 3EI4A 3N0EA 4L9OA 2Q7QA 5KDOB 3K26A 3MKSB 4GQBB 1U4CA 2Z2NA 4E54A 2AGLA 3F3FA 4J77A 4PC0A 2CNXA 4MK0B 5EARA 2B5LA 3OKWA 3ORVD 3PXSD 4J86A 2P9PC 3VA6A 3FGBA 2AH1A 4PBZA 5A2Qg 3JZNA 5K1CC 3UKUC 4J8BA 4ZN4A 1GOTB 4JT6C 4JSVC 4FA5D 4O3TB 3AL8A 4IA9A 1B9YA 2J57G 4KFMB 4L3GD 2IUPA 3SBPA 5C9ZB 2IWKA 4J84A 4A08B 4CZXA 4UI9R 5HYNB 3RRMC 5CXCA 4TZ4A 4GGCA 1JJUB 2H6QA 3JPXA 2OK4A 4X3EA 5FQDA 4PSWB 5I5IA 3PE7A 3SN6B 2PM6B 3JB9L 4XYIA 3E0CA 4A11B 3IKOA 2UZXB 1N6DA 1XKSA 3GREA 2I0SA 2IAAA 3EU7A 2XYIA 3ULEC 3F3GA 2CE9A 3EMHA 4GGDA 4U1EI 2H9PA 4PNKB 1JMXB 2AGYA 5IT9g 5CXBA 2CO0C 4BH6A 3ODTA 3DXMC 3EI1A 4N14A 4AOWA 1NEXB 2HYEA 2GC7A 2G9AA 3DSMA 5TDHB 1JOFA 2I3TA 4FAVD 2P9KC 3J80g 2B4EA 4PBYA 2AGXA 2Z2OA 2UZYB 4H5IA 5EMLB 3MZKA 4O9DA 3F3PA 1K8KC 5TF2A 2PM7B 2TRCB 2H6NA 4ZOYA 4XEIC 4X63B 4ERQA 4K3JB 4Y7RA 5GXHA 3IJ1A 1RI6A 1TYQC 4D6VA 2GC4A 3CFSB 3AL9A 4YVDA 2I3SA 3UKRC 1MG3A 4XYHA 3FM0A 4J73A 5FKQA 4J87A 4PSXB 3C5MA 2EBSA 5H1MA 4ZOXA 4FWWA 2AGWA 3RFGA 3OW8A 2H9MA 4ESGA 3OKYA 2P9UC 5AJAA 5FLXg 4FAND 3SBRA 2P9LC 3CFVA 3UVLA 4J0WA 3OTTA 4CZYA 3I7PA 2OIZA 2PM9A 4L1QD 4GZ8A 2HJ4A 3EI4B 1SQJA 4BL0A 5AFU3 3OKYB 2HESX 2B5MA 2H9NA 4E54B 3C9CA 1GXRA 4AEZA 3CIKB 3L4MD 2GNQA 3I7OA 4OZUA 4A09A 4A2LA 5FKRA 5I5JA 2CO0A 5C2WB 4J81A 5EM2A 3PSLA 3I8EA 5JWZA 1SQ9A 1OLZA 3K27A 3BWSA 5H14A 4FHLA 4J79A 5IJ7E 4ERYA 4EWRA 3EI3A 3AL8B 5K19A 3IIYA 2H68A 4QRJA 5IJ8E 3SWSD 4X61B 4A0AA 4O45A 4GM9A 5HE0B 5CXCB 5EMKB 1PEVA 3NVNA 1N6EA 3EI2A 3W15A 2YNNA 5HE2B 3SMRA 4L3HD 1NR0A 3RMZD 2I0RA 5GXIA 3SBQA 4A7JA 4FB1D 4A0BA 3UVMA 4CI3A 4I79A 3MMYA 3OL2A 4GM8A 2CE8A 4A2MA 3MXXA 5IC7A 2YNPA 3VH0A 5CXBB 4CI2A 4E5ZA 2H3XA 2BCJB 2IWFA 2CN2A 3PSCB 5EMJB 2AGZA 4J82A 4QQEA 2J56H 5SXMA 3EI1B 3A0FA 1S4UX 3U4YA 2P9NC 3OKTA 2HKRA 4ES0A 4K3ID 2YB8B 5CYKA 3V5WB 5HE1B 2HXCA 1TBGA 2H6KA 4J78A 2YMUA 2BBKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT8 A;  4NSX A;  2PBI B;  3I8C A;  3I7N A;  1XHM A;  4ZOV A;  4GGA A;  1L0Q A;  2QC5 A;  2P9I C;  3RLM D;  3BG1 A;  3RSE C;  2AQ5 A;  3P4F A;  2IUR A;  3C75 H;  5TEF A;  2XU7 A;  3GFC A;  4GMB A;  3SHF A;  5GSA A;  1Q47 A;  3DM0 A;  5EAL A;  1U2V C;  4JSN C;  4D0K A;  4LGN A;  4JXM A;  3SJL D;  3SVW D;  2IUQ A;  3PXT D;  1A0R B;  3RN0 D;  4U7A A;  4Y5R D;  3I89 A;  4J8G A;  3HFQ A;  3V9F A;  2QXV A;  3ZWL B;  3DWL C;  3L4O D;  1P22 A;  3KRX B;  5IGQ A;  2PM9 B;  4CI8 A;  1QNI A;  2MTA H;  1ERJ A;  3JZH A;  4LG9 A;  3AH8 B;  3FRX A;  3NVX A;  2XL3 A;  3N0D A;  1MDA H;  2OVP B;  2B5N A;  4A08 A;  1VYH C;  1YFQ A;  4FA4 D;  4A09 B;  4QL1 A;  2IUV A;  4OWR A;  2O9K A;  1MG2 A;  1PGU A;  4IMM A;  3SCY A;  3IIW A;  4J0X A;  3I7K A;  4G56 B;  5EM2 B;  3NVQ A;  2OVQ B;  1PI6 A;  3UVN A;  4A11 A;  2AH0 A;  3RFH A;  5AMS A;  5EAP A;  2XL2 A;  2HKM A;  3B7F A;  3UR4 A;  3MZL A;  1FWX A;  3EI3 B;  3J81 g;  3SFZ A;  5B4W A;  4CI1 A;  1PBY B;  4CY2 A;  3V7D B;  2OJY A;  4A0A B;  3IJC A;  5EMM B;  3SXT D;  4JSP C;  1R5M A;  4JD2 C;  5HQG A;  4O3U B;  3PVW B;  1OMW B;  3EI2 B;  1SHY B;  2H9L A;  3BG0 A;  2H47 A;  1GP2 B;  2YBA A;  1N6F A;  2I0T A;  3UVO A;  5EAM A;  4BUJ C;  2CN3 A;  3EWE A;  5GMK n;  4LG8 A;  4A0B B;  3C99 A;  2Z2P A;  4FA9 D;  4CY1 A;  3OL2 B;  3UVK A;  5H17 A;  4JSX C;  2YNO A;  5FXY A;  2G99 A;  4E5Z B;  4Z8L A;  5I5M A;  3JAM g;  5FKT A;  2OVR B;  4CZV A;  4ZOZ A;  3KRW B;  3IJ0 A;  3PVU B;  5HE3 B;  4GM3 A;  5CYK B;  4CY3 A;  2W18 A;  5FA5 B;  2P9S C;  5THA A;  4R7A B;  1JMZ B;  4O1Q D;  3AFC A;  3I2N A;  2H13 A;  2J55 H;  3VGZ A;  3JRP A;  1XIP A;  5TEE A;  3MKQ A;  4H5J A;  4PXW A;  5FKS A;  5C2V B;  2H14 A;  4X60 B;  3JRO A;  3I7L A;  1GG2 B;  1K32 A;  5IGO A;  2OK6 A;  4CC9 A;  4ERZ A;  4GQ1 A;  3JZG A;  3PXW D;  4FA1 D;  3RN1 D;  4JT5 C;  4CY5 A;  3EG6 A;  1B9X A;  3DXK C;  3I7H A;  2HJB A;  4GQ2 P;  4HDJ A;  3SLE D;  3EI4 A;  3N0E A;  4L9O A;  2Q7Q A;  5KDO B;  3K26 A;  3MKS B;  4GQB B;  1U4C A;  2Z2N A;  4E54 A;  2AGL A;  3F3F A;  4J77 A;  4PC0 A;  2CNX A;  4MK0 B;  5EAR A;  2B5L A;  3OKW A;  3ORV D;  3PXS D;  4J86 A;  2P9P C;  3VA6 A;  3FGB A;  2AH1 A;  4PBZ A;  5A2Q g;  3JZN A;  5K1C C;  3UKU C;  4J8B A;  4ZN4 A;  1GOT B;  4JT6 C;  4JSV C;  4FA5 D;  4O3T B;  3AL8 A;  4IA9 A;  1B9Y A;  2J57 G;  4KFM B;  4L3G D;  2IUP A;  3SBP A;  5C9Z B;  2IWK A;  4J84 A;  4A08 B;  4CZX A;  4UI9 R;  5HYN B;  3RRM C;  5CXC A;  4TZ4 A;  4GGC A;  1JJU B;  2H6Q A;  3JPX A;  2OK4 A;  4X3E A;  5FQD A;  4PSW B;  5I5I A;  3PE7 A;  3SN6 B;  2PM6 B;  3JB9 L;  4XYI A;  3E0C A;  4A11 B;  3IKO A;  2UZX B;  1N6D A;  1XKS A;  3GRE A;  2I0S A;  2IAA A;  3EU7 A;  2XYI A;  3ULE C;  3F3G A;  2CE9 A;  3EMH A;  4GGD A;  4U1E I;  2H9P A;  4PNK B;  1JMX B;  2AGY A;  5IT9 g;  5CXB A;  2CO0 C;  4BH6 A;  3ODT A;  3DXM C;  3EI1 A;  4N14 A;  4AOW A;  1NEX B;  2HYE A;  2GC7 A;  2G9A A;  3DSM A;  5TDH B;  1JOF A;  2I3T A;  4FAV D;  2P9K C;  3J80 g;  2B4E A;  4PBY A;  2AGX A;  2Z2O A;  2UZY B;  4H5I A;  5EML B;  3MZK A;  4O9D A;  3F3P A;  1K8K C;  5TF2 A;  2PM7 B;  2TRC B;  2H6N A;  4ZOY A;  4XEI C;  4X63 B;  4ERQ A;  4K3J B;  4Y7R A;  5GXH A;  3IJ1 A;  1RI6 A;  1TYQ C;  4D6V A;  2GC4 A;  3CFS B;  3AL9 A;  4YVD A;  2I3S A;  3UKR C;  1MG3 A;  4XYH A;  3FM0 A;  4J73 A;  5FKQ A;  4J87 A;  4PSX B;  3C5M A;  2EBS A;  5H1M A;  4ZOX A;  4FWW A;  2AGW A;  3RFG A;  3OW8 A;  2H9M A;  4ESG A;  3OKY A;  2P9U C;  5AJA A;  5FLX g;  4FAN D;  3SBR A;  2P9L C;  3CFV A;  3UVL A;  4J0W A;  3OTT A;  4CZY A;  3I7P A;  2OIZ A;  2PM9 A;  4L1Q D;  4GZ8 A;  2HJ4 A;  3EI4 B;  1SQJ A;  4BL0 A;  5AFU 3;  3OKY B;  2HES X;  2B5M A;  2H9N A;  4E54 B;  3C9C A;  1GXR A;  4AEZ A;  3CIK B;  3L4M D;  2GNQ A;  3I7O A;  4OZU A;  4A09 A;  4A2L A;  5FKR A;  5I5J A;  2CO0 A;  5C2W B;  4J81 A;  5EM2 A;  3PSL A;  3I8E A;  5JWZ A;  1SQ9 A;  1OLZ A;  3K27 A;  3BWS A;  5H14 A;  4FHL A;  4J79 A;  5IJ7 E;  4ERY A;  4EWR A;  3EI3 A;  3AL8 B;  5K19 A;  3IIY A;  2H68 A;  4QRJ A;  5IJ8 E;  3SWS D;  4X61 B;  4A0A A;  4O45 A;  4GM9 A;  5HE0 B;  5CXC B;  5EMK B;  1PEV A;  3NVN A;  1N6E A;  3EI2 A;  3W15 A;  2YNN A;  5HE2 B;  3SMR A;  4L3H D;  1NR0 A;  3RMZ D;  2I0R A;  5GXI A;  3SBQ A;  4A7J A;  4FB1 D;  4A0B A;  3UVM A;  4CI3 A;  4I79 A;  3MMY A;  3OL2 A;  4GM8 A;  2CE8 A;  4A2M A;  3MXX A;  5IC7 A;  2YNP A;  3VH0 A;  5CXB B;  4CI2 A;  4E5Z A;  2H3X A;  2BCJ B;  2IWF A;  2CN2 A;  3PSC B;  5EMJ B;  2AGZ A;  4J82 A;  4QQE A;  2J56 H;  5SXM A;  3EI1 B;  3A0F A;  1S4U X;  3U4Y A;  2P9N C;  3OKT A;  2HKR A;  4ES0 A;  4K3I D;  2YB8 B;  5CYK A;  3V5W B;  5HE1 B;  2HXC A;  1TBG A;  2H6K A;  4J78 A;  2YMU A;  2BBK H; 
#chains in the Genus database with same CATH topology
 4QT8 A;  3NIF A;  1K3I A;  2PBI B;  4NSX A;  3EQ9 A;  4RE6 A;  3I8C A;  3I7N A;  1XHM A;  1L5G A;  4MMX A;  4ZOV A;  4AX4 A;  4GGA A;  1L0Q A;  3MUN A;  2QC5 A;  3MUO A;  2P9I C;  3RLM D;  3BG1 A;  3RSE C;  2AQ5 A;  4AN1 A;  3P4F A;  2IUR A;  3C75 H;  5TEF A;  2XU7 A;  3GFC A;  4GMB A;  3SHF A;  5GSA A;  1Q47 A;  3DM0 A;  2QZP A;  5EAL A;  1U2V C;  4JSN C;  4WJK A;  1C9L A;  3ZE2 A;  4D0K A;  4LGN A;  4JXM A;  3SJL D;  3SVW D;  2IUQ A;  3PXT D;  3ZE1 A;  1A0R B;  3RN0 D;  4U7A A;  4Y5R D;  3I89 A;  4J8G A;  3HFQ A;  3V9F A;  2QXV A;  3ZWL B;  3DWL C;  3L4O D;  1P22 A;  4JHP C;  3KRX B;  5IGQ A;  3IUL A;  2PM9 B;  3VI3 A;  4CI8 A;  1QNI A;  2MTA H;  1ERJ A;  3JZH A;  4LG9 A;  3AH8 B;  1H2X A;  3FRX A;  3NVX A;  2XL3 A;  3N0D A;  1GOG A;  1MDA H;  2OVP B;  2B5N A;  4A08 A;  1VYH C;  5M5U A;  1YFQ A;  4FA4 D;  4A09 B;  4QL1 A;  2IUV A;  4OWR A;  2O9K A;  1MG2 A;  3IUJ A;  5M61 A;  1PGU A;  4IMM A;  3SCY A;  3IIW A;  4J0X A;  3I7K A;  4G56 B;  5EM2 B;  3NVQ A;  4AMZ A;  2OVQ B;  1PI6 A;  3UVN A;  4A11 A;  2AH0 A;  1VE7 A;  3RFH A;  5AMS A;  5EAP A;  2XL2 A;  1VZ3 A;  2HKM A;  3B7F A;  3KCI A;  3GD1 I;  3UR4 A;  3MZL A;  1FWX A;  3EI3 B;  3J81 g;  1E8N A;  3SFZ A;  5B4W A;  5HDB A;  4CI1 A;  4AMY A;  1PBY B;  4CY2 A;  3V7D B;  2OJY A;  2QR5 A;  4A0A B;  3IJC A;  5EMM B;  1QFS A;  3QI0 A;  3O4J A;  3SXT D;  4JSP C;  1R5M A;  5M5R A;  2WQ8 A;  4JD2 C;  2EID A;  5HQG A;  4WK4 A;  4O3U B;  3PVW B;  1OMW B;  3EI2 B;  1SHY B;  2H9L A;  4O02 A;  3BG0 A;  2H47 A;  2VDK A;  1GP2 B;  3NIG A;  2YBA A;  1N6F A;  2I0T A;  5C92 A;  3UVO A;  5EAM A;  4RE5 A;  4BUJ C;  2CN3 A;  3EWE A;  5GMK n;  2VDR A;  4LG8 A;  2VZ1 A;  3C99 A;  4A0B B;  2Z2P A;  1H2Z A;  4FA9 D;  4CY1 A;  3OL2 B;  3UVK A;  5H17 A;  4JSX C;  1H2Y A;  3ZDY A;  2YNO A;  5FXY A;  2G99 A;  2EIC A;  4E5Z B;  4G1M A;  4Z8L A;  5I5M A;  3JAM g;  5FKT A;  2OVR B;  4CZV A;  3ZE0 A;  4ZOZ A;  3KRW B;  3IJ0 A;  3PVU B;  5HE3 B;  4GM3 A;  5CYK B;  4NBM A;  4CY3 A;  2W18 A;  5FA5 B;  4O2W A;  3NID A;  3MVD K;  1A12 A;  2P9S C;  4R7A B;  5THA A;  1JMZ B;  4O1Q D;  3AFC A;  3I2N A;  2H13 A;  2J55 H;  3VGZ A;  3JRP A;  2VZ3 A;  1XIP A;  5TEE A;  3MKQ A;  4H5J A;  4PXW A;  5FKS A;  4Z7N A;  5C2V B;  2H14 A;  3DDU A;  4BCB A;  4X60 B;  3JRO A;  3I7L A;  1GG2 B;  1K32 A;  5IGO A;  2OK6 A;  4CC9 A;  4ERZ A;  4GQ1 A;  3JZG A;  3PXW D;  4FA1 D;  3RN1 D;  4JT5 C;  4CY5 A;  3EG6 A;  1M1X A;  1B9X A;  3K72 A;  3T3P A;  2VC2 A;  5M5V A;  3DXK C;  3I7H A;  2HJB A;  4GQ2 P;  4HDJ A;  3SLE D;  3V4V A;  1TYE A;  4AN0 A;  3EI4 A;  3N0E A;  4L9O A;  2VDL A;  2Q7Q A;  5KDO B;  3IVM A;  3K26 A;  3MKS B;  1U4C A;  2Z2N A;  4GQB B;  4E54 A;  2AGL A;  3F3F A;  4J77 A;  4PC0 A;  5C86 A;  2CNX A;  4MK0 B;  5EAR A;  2B5L A;  3OKW A;  4JHN A;  3ORV D;  2XDW A;  3PXS D;  4J86 A;  2P9P C;  3VA6 A;  3FGB A;  2AH1 A;  4PBZ A;  5A2Q g;  1QFM A;  3JZN A;  5K1C C;  3UKU C;  4J8B A;  1UOQ A;  3EQ7 A;  4ZN4 A;  1GOT B;  4JT6 C;  4JSV C;  4FA5 D;  4O3T B;  3AL8 A;  3IUM A;  1B9Y A;  2J57 G;  3IUQ A;  4IA9 A;  4KFM B;  4L3G D;  2IUP A;  3OF7 A;  3SBP A;  1GOF A;  3EQ8 A;  2IWK A;  5C9Z B;  3K71 A;  2VDQ A;  4QAM A;  4J84 A;  4A08 B;  4CZX A;  4NC4 A;  4UI9 R;  2XZG A;  3RRM C;  5HYN B;  1UTC A;  5CXC A;  4TZ4 A;  4GGC A;  1JJU B;  4UM8 A;  2H6Q A;  3JPX A;  2OK4 A;  4X3E A;  5FQD A;  4DNV A;  4PSW B;  5I5I A;  3PE7 A;  3SN6 B;  2PM6 B;  3JB9 L;  4XYI A;  3E0C A;  4BCD A;  1GOH A;  3IKO A;  4A11 B;  2UZX B;  1N6D A;  5M5S A;  1XKS A;  4DNW A;  3GRE A;  2I0S A;  2IAA A;  3EU7 A;  2XYI A;  3ULE C;  3F3G A;  2CE9 A;  3EMH A;  4GGD A;  4U1E I;  2EIE A;  2H9P A;  4PNK B;  1JMX B;  2AGY A;  5IT9 g;  5CXB A;  1E8M A;  3QHY B;  1T2X A;  2CO0 C;  3IUR A;  4BH6 A;  3ODT A;  3DXM C;  3EI1 A;  4MMZ A;  4N14 A;  4AOW A;  1NEX B;  2HYE A;  2GC7 A;  2G9A A;  3DSM A;  5TDH B;  5FFO A;  1JOF A;  2I3T A;  4D9S A;  1C9I A;  4FAV D;  1O6F A;  2P9K C;  3J80 g;  2VDM A;  2B4E A;  4PBY A;  3FCS A;  3GC3 B;  4UM9 A;  2AGX A;  2VDP A;  2Z2O A;  2UZY B;  4H5I A;  5EML B;  3MZK A;  4O9D A;  3F3P A;  1K8K C;  3O4H A;  5TF2 A;  2PM7 B;  2TRC B;  4WK0 A;  2H6N A;  4ZOY A;  4XEI C;  4X63 B;  4Z7Q A;  4ERQ A;  4K3J B;  4Y7R A;  5E6U A;  5GXH A;  3IJ1 A;  1RI6 A;  1TYQ C;  4D6V A;  2GC4 A;  3CFS B;  3AL9 A;  4YVD A;  2I3S A;  3UKR C;  1MG3 A;  3IJE A;  4XYH A;  3FM0 A;  4J73 A;  5FKQ A;  4J87 A;  4PSX B;  3C5M A;  1UOP A;  2EBS A;  5H1M A;  4ZOX A;  4G55 A;  4FWW A;  3T3M A;  2AGW A;  5E6R A;  1UOO A;  3ZDZ A;  3RFG A;  3OW8 A;  2H9M A;  4ESG A;  3OKY A;  2P9U C;  5AJA A;  5FLX g;  2HU8 A;  4FAN D;  3SBR A;  1O6G A;  2XE4 A;  2P9L C;  3CFV A;  3UVL A;  4J0W A;  3FCU A;  3OTT A;  4G1E A;  4CZY A;  3I7P A;  2OIZ A;  2PM9 A;  4L1Q D;  4GZ8 A;  2HJ4 A;  3EI4 B;  4IRZ A;  4Z7O A;  1SQJ A;  4BL0 A;  5AFU 3;  3OKY B;  1YR2 A;  2HES X;  2JKX A;  5M5T A;  2B5M A;  1VE6 A;  2H9N A;  4E54 B;  3C9C A;  1GXR A;  4AEZ A;  3CIK B;  3L4M D;  2GNQ A;  2HU5 A;  3I7O A;  4OZU A;  4A09 A;  3K6S A;  4A2L A;  5FKR A;  5I5J A;  2CO0 A;  5C2W B;  3IUN A;  5E6S A;  4J81 A;  3VI4 A;  5EM2 A;  3PSL A;  3I8E A;  5JWZ A;  1SQ9 A;  2HU7 A;  1OLZ A;  3K27 A;  3BWS A;  5H14 A;  4FHL A;  4J79 A;  5IJ7 E;  1E5T A;  1JTD B;  4ERY A;  4EWR A;  3EI3 A;  3AL8 B;  5K19 A;  4DNU A;  3IIY A;  2H68 A;  4BP8 A;  1BPO A;  4QRJ A;  5IJ8 E;  3V4P A;  3SWS D;  4X61 B;  2EIB A;  4A0A A;  4O45 A;  4GM9 A;  5HE0 B;  5CXC B;  5EMK B;  1PEV A;  1H2W A;  1I2M B;  1N6E A;  3NVN A;  1JV2 A;  2BKL A;  3EI2 A;  3W15 A;  2VDN A;  2YNN A;  5HE2 B;  3SMR A;  4NAA A;  4L3H D;  1NR0 A;  1VZ2 A;  4WK2 A;  3RMZ D;  2I0R A;  4MMY A;  5GXI A;  3SBQ A;  4A7J A;  4FB1 D;  4A0B A;  3UVM A;  3O4G A;  4CI3 A;  4I79 A;  3MMY A;  3OL2 A;  3O4I A;  2CE8 A;  4GM8 A;  3ZDX A;  4A2M A;  3MXX A;  5IC7 A;  2YNP A;  3VH0 A;  5CXB B;  4CI2 A;  4E5Z A;  2H3X A;  2BCJ B;  2IWF A;  2CN2 A;  3PSC B;  1U8C A;  5EMJ B;  2AGZ A;  4J82 A;  4QQE A;  2J56 H;  5SXM A;  4BP9 A;  3EI1 B;  3A0F A;  1S4U X;  3U4Y A;  2P9N C;  4NEN A;  3OKT A;  4BCC A;  2HKR A;  4ES0 A;  4K3I D;  2YB8 B;  5CYK A;  3V5W B;  4L1M A;  5FFG A;  5HE1 B;  2HXC A;  1TBG A;  2H6K A;  4J78 A;  2YMU A;  2BBK H;  2VDO A; 
#chains in the Genus database with same CATH homology
 4QT8 A;  4NSX A;  2PBI B;  3I8C A;  3I7N A;  1XHM A;  4ZOV A;  4GGA A;  1L0Q A;  2QC5 A;  2P9I C;  3RLM D;  3BG1 A;  3RSE C;  2AQ5 A;  3P4F A;  2IUR A;  3C75 H;  5TEF A;  2XU7 A;  3GFC A;  4GMB A;  3SHF A;  5GSA A;  1Q47 A;  3DM0 A;  5EAL A;  1U2V C;  4JSN C;  4D0K A;  4LGN A;  4JXM A;  3SJL D;  3SVW D;  2IUQ A;  3PXT D;  1A0R B;  3RN0 D;  4U7A A;  4Y5R D;  3I89 A;  4J8G A;  3HFQ A;  3V9F A;  2QXV A;  3ZWL B;  3DWL C;  3L4O D;  1P22 A;  3KRX B;  5IGQ A;  2PM9 B;  4CI8 A;  1QNI A;  2MTA H;  1ERJ A;  3JZH A;  4LG9 A;  3AH8 B;  3FRX A;  3NVX A;  2XL3 A;  3N0D A;  1MDA H;  2OVP B;  2B5N A;  4A08 A;  1VYH C;  1YFQ A;  4FA4 D;  4A09 B;  4QL1 A;  2IUV A;  4OWR A;  2O9K A;  1MG2 A;  1PGU A;  4IMM A;  3SCY A;  3IIW A;  4J0X A;  3I7K A;  4G56 B;  5EM2 B;  3NVQ A;  2OVQ B;  1PI6 A;  3UVN A;  4A11 A;  2AH0 A;  3RFH A;  5AMS A;  5EAP A;  2XL2 A;  2HKM A;  3B7F A;  3UR4 A;  3MZL A;  1FWX A;  3EI3 B;  3J81 g;  3SFZ A;  5B4W A;  4CI1 A;  1PBY B;  4CY2 A;  3V7D B;  2OJY A;  4A0A B;  3IJC A;  5EMM B;  3SXT D;  4JSP C;  1R5M A;  4JD2 C;  5HQG A;  4O3U B;  3PVW B;  1OMW B;  3EI2 B;  1SHY B;  2H9L A;  3BG0 A;  2H47 A;  1GP2 B;  2YBA A;  1N6F A;  2I0T A;  3UVO A;  5EAM A;  4BUJ C;  2CN3 A;  3EWE A;  5GMK n;  4LG8 A;  4A0B B;  3C99 A;  2Z2P A;  4FA9 D;  4CY1 A;  3OL2 B;  3UVK A;  5H17 A;  4JSX C;  2YNO A;  5FXY A;  2G99 A;  4E5Z B;  4Z8L A;  5I5M A;  3JAM g;  5FKT A;  2OVR B;  4CZV A;  4ZOZ A;  3KRW B;  3IJ0 A;  3PVU B;  5HE3 B;  4GM3 A;  5CYK B;  4CY3 A;  2W18 A;  5FA5 B;  2P9S C;  5THA A;  4R7A B;  1JMZ B;  4O1Q D;  3AFC A;  3I2N A;  2H13 A;  2J55 H;  3VGZ A;  3JRP A;  1XIP A;  5TEE A;  3MKQ A;  4H5J A;  4PXW A;  5FKS A;  5C2V B;  2H14 A;  4X60 B;  3JRO A;  3I7L A;  1GG2 B;  1K32 A;  5IGO A;  2OK6 A;  4CC9 A;  4ERZ A;  4GQ1 A;  3JZG A;  3PXW D;  4FA1 D;  3RN1 D;  4JT5 C;  4CY5 A;  3EG6 A;  1B9X A;  3DXK C;  3I7H A;  2HJB A;  4GQ2 P;  4HDJ A;  3SLE D;  3EI4 A;  3N0E A;  4L9O A;  2Q7Q A;  5KDO B;  3K26 A;  3MKS B;  4GQB B;  1U4C A;  2Z2N A;  4E54 A;  2AGL A;  3F3F A;  4J77 A;  4PC0 A;  2CNX A;  4MK0 B;  5EAR A;  2B5L A;  3OKW A;  3ORV D;  3PXS D;  4J86 A;  2P9P C;  3VA6 A;  3FGB A;  2AH1 A;  4PBZ A;  5A2Q g;  3JZN A;  5K1C C;  3UKU C;  4J8B A;  4ZN4 A;  1GOT B;  4JT6 C;  4JSV C;  4FA5 D;  4O3T B;  3AL8 A;  4IA9 A;  1B9Y A;  2J57 G;  4KFM B;  4L3G D;  2IUP A;  3SBP A;  5C9Z B;  2IWK A;  4J84 A;  4A08 B;  4CZX A;  4UI9 R;  5HYN B;  3RRM C;  5CXC A;  4TZ4 A;  4GGC A;  1JJU B;  2H6Q A;  3JPX A;  2OK4 A;  4X3E A;  5FQD A;  4PSW B;  5I5I A;  3PE7 A;  3SN6 B;  2PM6 B;  3JB9 L;  4XYI A;  3E0C A;  4A11 B;  3IKO A;  2UZX B;  1N6D A;  1XKS A;  3GRE A;  2I0S A;  2IAA A;  3EU7 A;  2XYI A;  3ULE C;  3F3G A;  2CE9 A;  3EMH A;  4GGD A;  4U1E I;  2H9P A;  4PNK B;  1JMX B;  2AGY A;  5IT9 g;  5CXB A;  2CO0 C;  4BH6 A;  3ODT A;  3DXM C;  3EI1 A;  4N14 A;  4AOW A;  1NEX B;  2HYE A;  2GC7 A;  2G9A A;  3DSM A;  5TDH B;  1JOF A;  2I3T A;  4FAV D;  2P9K C;  3J80 g;  2B4E A;  4PBY A;  2AGX A;  2Z2O A;  2UZY B;  4H5I A;  5EML B;  3MZK A;  4O9D A;  3F3P A;  1K8K C;  5TF2 A;  2PM7 B;  2TRC B;  2H6N A;  4ZOY A;  4XEI C;  4X63 B;  4ERQ A;  4K3J B;  4Y7R A;  5GXH A;  3IJ1 A;  1RI6 A;  1TYQ C;  4D6V A;  2GC4 A;  3CFS B;  3AL9 A;  4YVD A;  2I3S A;  3UKR C;  1MG3 A;  4XYH A;  3FM0 A;  4J73 A;  5FKQ A;  4J87 A;  4PSX B;  3C5M A;  2EBS A;  5H1M A;  4ZOX A;  4FWW A;  2AGW A;  3RFG A;  3OW8 A;  2H9M A;  4ESG A;  3OKY A;  2P9U C;  5AJA A;  5FLX g;  4FAN D;  3SBR A;  2P9L C;  3CFV A;  3UVL A;  4J0W A;  3OTT A;  4CZY A;  3I7P A;  2OIZ A;  2PM9 A;  4L1Q D;  4GZ8 A;  2HJ4 A;  3EI4 B;  1SQJ A;  4BL0 A;  5AFU 3;  3OKY B;  2HES X;  2B5M A;  2H9N A;  4E54 B;  3C9C A;  1GXR A;  4AEZ A;  3CIK B;  3L4M D;  2GNQ A;  3I7O A;  4OZU A;  4A09 A;  4A2L A;  5FKR A;  5I5J A;  2CO0 A;  5C2W B;  4J81 A;  5EM2 A;  3PSL A;  3I8E A;  5JWZ A;  1SQ9 A;  1OLZ A;  3K27 A;  3BWS A;  5H14 A;  4FHL A;  4J79 A;  5IJ7 E;  4ERY A;  4EWR A;  3EI3 A;  3AL8 B;  5K19 A;  3IIY A;  2H68 A;  4QRJ A;  5IJ8 E;  3SWS D;  4X61 B;  4A0A A;  4O45 A;  4GM9 A;  5HE0 B;  5CXC B;  5EMK B;  1PEV A;  3NVN A;  1N6E A;  3EI2 A;  3W15 A;  2YNN A;  5HE2 B;  3SMR A;  4L3H D;  1NR0 A;  3RMZ D;  2I0R A;  5GXI A;  3SBQ A;  4A7J A;  4FB1 D;  4A0B A;  3UVM A;  4CI3 A;  4I79 A;  3MMY A;  3OL2 A;  4GM8 A;  2CE8 A;  4A2M A;  3MXX A;  5IC7 A;  2YNP A;  3VH0 A;  5CXB B;  4CI2 A;  4E5Z A;  2H3X A;  2BCJ B;  2IWF A;  2CN2 A;  3PSC B;  5EMJ B;  2AGZ A;  4J82 A;  4QQE A;  2J56 H;  5SXM A;  3EI1 B;  3A0F A;  1S4U X;  3U4Y A;  2P9N C;  3OKT A;  2HKR A;  4ES0 A;  4K3I D;  2YB8 B;  5CYK A;  3V5W B;  5HE1 B;  2HXC A;  1TBG A;  2H6K A;  4J78 A;  2YMU A;  2BBK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...