1XKSA

The crystal structure of the n-terminal domain of nup133 reveals a beta-propeller fold common to several nucleoporins
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
403
structure length
374
Chain Sequence
ESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSTQAVAVMVATREGSIRYWPSLAGEDTYTEAFVDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHILPQGQGMSDLTLSSVLWDRERSSFYSLTSSNISKWELDDSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWHSADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLYNESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup133
publication title Structural and functional analysis of Nup133 domains reveals modular building blocks of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 87
structure length 374
sequence length 403
ec nomenclature
pdb deposition date 2004-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1xksA00
3VA6A 3OL2B 5IT9g 4X61B 4E5ZA 5K1CC 4ZOXA 2I0RA 4CI3A 4H5IA 4O9DA 2P9NC 5THAA 3K26A 4CY2A 4TZ4A 3SLED 5EMLB 3SBRA 1XHMA 3C9CA 2IWKA 5IJ7E 4E54A 4ZOZA 3PXSD 2YNPA 3UVOA 4PNKB 3IKOA 5EALA 4FA1D 3SVWD 3NVNA 1SQ9A 5HE0B 2AGYA 1A0RB 4CZXA 2HXCA 3I7KA 3RFGA 3UVLA 3IJ0A 1N6EA 2H6NA 1S4UX 5TDHB 3JZGA 3I89A 3JROA 5FKQA 4A11B 2PM6B 5H14A 2HJBA 2GC4A 3KRWB 2YB8B 3PSLA 4A08A 2BCJB 2EBSA 5CXBA 3JZNA 3SMRA 4Z8LA 4CY5A 3E0CA 3A0FA 3ZWLB 2IUQA 5EM2B 3ORVD 2Z2OA 3UR4A 1JMZB 1RI6A 4GZ8A 3RLMD 2HESX 3JB9L 1GOTB 2GC7A 3ULEC 1PGUA 4D6VA 3OL2A 4GQ1A 4Y5RD 2IUPA 2H14A 2OJYA 4O1QD 4A0AB 4JSNC 3UVNA 4PBYA 4X3EA 4R7AB 2G99A 2H9NA 4CI8A 2B4EA 2TRCB 4H5JA 3FGBA 1JOFA 5FKTA 3SCYA 4PBZA 4CY1A 3L4OD 1OMWB 4LG8A 3EI1B 2AGZA 3AL8A 4J86A 1MG3A 4FAVD 4A2MA 5GXIA 4ERYA 3EI2B 3V7DB 1TBGA 2J55H 1QNIA 4A0BB 2H9MA 3I2NA 4J73A 4D0KA 5EMMB 3B7FA 1B9YA 3K27A 4A11A 3UKRC 3GREA 4YVDA 5IJ8E 3JPXA 4HDJA 5HE3B 1K8KC 3PVWB 3OKYB 4IMMA 5C2WB 4N14A 2CO0A 4O3UB 2YMUA 3SBQA 1Q47A 3BWSA 3CFVA 3AFCA 1SHYB 5K19A 5GMKn 2AH1A 4A0AA 5CXCB 3EI3B 3DXKC 5H1MA 3SBPA 4FB1D 1MG2A 3I7OA 4K3JB 2B5NA 1U4CA 1GG2B 2O9KA 3EI4B 3EU7A 1NR0A 3RFHA 4GGDA 3J81g 3IJCA 4PSWB 3SFZA 4ERQA 5B4WA 2I0SA 4ERZA 4A09A 5C9ZB 3HFQA 3EI1A 4X60B 1R5MA 4QT8A 2GNQA 2OVPB 2OIZA 3OW8A 4GGAA 3FRXA 2MTAH 2AH0A 4A2LA 5AJAA 1VYHC 2IWFA 3PVUB 4LG9A 4OZUA 2I3SA 4QQEA 4BH6A 4A7JA 2PM7B 2H6KA 2CN3A 2IAAA 3AL9A 3OKYA 3CIKB 4JT5C 4FA4D 3EG6A 3RMZD 2AGWA 4J79A 2H6QA 3SJLD 3OKWA 1P22A 5CXCA 1JJUB 2OVRB 4JXMA 2OK4A 4ES0A 2P9SC 2PBIB 1N6DA 3V5WB 5FXYA 3DSMA 5EARA 3MZKA 3SHFA 2XL3A 2P9KC 4JSPC 1JMXB 4J84A 5C2VB 3DXMC 5FLXg 4QL1A 2H47A 5CYKB 2H9PA 2QC5A 2YNNA 2AQ5A 3RN1D 4E5ZB 2CNXA 5HYNB 4CC9A 2BBKH 4K3ID 4CI2A 3EMHA 4FWWA 4ZOVA 4J8BA 1NEXB 2H3XA 3BG0A 1L0QA 4GM3A 4KFMB 4PXWA 2AGXA 3ODTA 2CE8A 2CN2A 4ZN4A 4FAND 2P9UC 3J80g 4AEZA 3CFSB 5FKSA 2QXVA 5JWZA 2XYIA 5HE1B 5FA5B 3N0DA 4MK0B 4GQ2P 5EM2A 3IJ1A 1SQJA 3F3FA 5IGOA 4IA9A 3AH8B 3I8CA 5H17A 2HYEA 3W15A 4PSXB 3PXTD 5EAPA 3SN6B 2IUVA 2OK6A 2G9AA 3P4FA 3VH0A 3UKUC 2XL2A 5CXBB 2Z2NA 4NSXA 2J57G 4XYIA 2HJ4A 4O45A 1XKSA 4GM8A 4X63B 5CYKA 3RSEC 3N0EA 1GP2B 2HKMA 3I7NA 5GSAA 1TYQC 4CZVA 5KDOB 4XEIC 3JAMg 3PE7A 5TF2A 2Q7QA 2CO0C 2OVQB 4GQBB 5GXHA 2B5MA 4JSXC 3EI2A 4EWRA 4A0BA 5HE2B 2XU7A 5EMKB 2CE9A 1FWXA 4J8GA 4ESGA 5FQDA 3PXWD 4J81A 4Y7RA 4GM9A 4U7AA 5I5IA 3L4MD 3AL8B 5SXMA 3EWEA 2P9IC 5TEFA 3JZHA 2UZXB 5IC7A 1ERJA 5I5JA 4LGNA 4U1EI 5TEEA 2P9LC 4J78A 3UVMA 4G56B 4CI1A 3KRXB 1YFQA 5FKRA 3MXXA 1K32A 2HKRA 2PM9B 4FA5D 1PI6A 3BG1A 4J0WA 4AOWA 3EI3A 1N6FA 5IGQA 2H9LA 2Z2PA 4JD2C 3OTTA 3MKSB 3DM0A 3EI4A 3I8EA 4L3HD 4QRJA 4ZOYA 5I5MA 4JSVC 1B9XA 5AMSA 3C75H 4JT6C 5EAMA 3NVXA 3V9FA 3FM0A 4PC0A 2AGLA 3JRPA 3F3PA 1MDAH 1U2VC 2IURA 2YBAA 4OWRA 4CY3A 3UVKA 1PBYB 3IIWA 3OKTA 3VGZA 3I7PA 3MKQA 2YNOA 4I79A 4CZYA 3GFCA 4FA9D 4J0XA 4FHLA 4XYHA 3RN0D 4L3GD 3SXTD 4J87A 3MZLA 1GXRA 4A09B 4L1QD 3C99A 2B5LA 4E54B 5HQGA 4O3TB 4L9OA 3NVQA 4BL0A 5EMJB 2H68A 3RRMC 1OLZA 2H13A 3IIYA 4GMBA 2W18A 1XIPA 5AFU3 3PSCB 4BUJC 4UI9R 3SWSD 2I3TA 2PM9A 3U4YA 3F3GA 2P9PC 3MMYA 4J77A 2J56H 4J82A 4A08B 3DWLC 1PEVA 3I7LA 5A2Qg 2I0TA 3C5MA 4GGCA 2UZYB 3I7HA
chains in the Genus database with same CATH superfamily
1VE7A 3VA6A 3ZE0A 5M61A 3OL2B 4WK0A 5IT9g 4X61B 4D9SA 4E5ZA 1UTCA 5K1CC 4ZOXA 2I0RA 4CI3A 4H5IA 4DNWA 4O9DA 2P9NC 5THAA 3K26A 1T2XA 4CY2A 3V4VA 4TZ4A 3SLED 5EMLB 3SBRA 1XHMA 3C9CA 2IWKA 5IJ7E 4E54A 4ZOZA 3PXSD 2YNPA 3UVOA 4PNKB 3IKOA 3ZDZA 5EALA 4FA1D 3SVWD 3NVNA 1SQ9A 5HE0B 2AGYA 1A0RB 4G1EA 4CZXA 2HXCA 3I7KA 4NC4A 3RFGA 3UVLA 3IJ0A 4NBMA 1N6EA 2H6NA 1S4UX 4AN1A 5TDHB 3JZGA 1GOGA 3I89A 3JROA 5FKQA 4A11B 2PM6B 4BCBA 5H14A 2HJBA 4UM8A 2GC4A 3IURA 3KRWB 5E6SA 2YB8B 3PSLA 4A08A 2BCJB 2EBSA 5CXBA 1VZ2A 4WK2A 3JZNA 3SMRA 4Z8LA 4WJKA 4CY5A 3E0CA 3A0FA 1L5GA 3ZWLB 2IUQA 4G1MA 3ORVD 5EM2B 2Z2OA 3UR4A 2VDOA 1JMZB 1RI6A 4GZ8A 3RLMD 2HESX 4BCCA 3JB9L 1GOTB 2GC7A 3ULEC 2XDWA 1PGUA 4D6VA 3OL2A 4GQ1A 4Y5RD 2IUPA 2H14A 2OJYA 4O1QD 4A0AB 4JSNC 4O2WA 3UVNA 2VDQA 1H2ZA 4PBYA 2VDMA 4X3EA 4R7AB 3K6SA 2G99A 2H9NA 4CI8A 2B4EA 2TRCB 4H5JA 3FGBA 1JOFA 5FKTA 2EIEA 3SCYA 4PBZA 4CY1A 1C9LA 3L4OD 1OMWB 1BPOA 4LG8A 4DNVA 3EI1B 2AGZA 3AL8A 3ZDYA 3IUNA 4J86A 1MG3A 4FAVD 3O4JA 4NAAA 4A2MA 5GXIA 4ERYA 4Z7NA 3EI2B 4BP8A 3V7DB 1TBGA 2J55H 1QNIA 4A0BB 2H9MA 3I2NA 4J73A 4JHPC 4D0KA 4RE5A 5EMMB 3B7FA 1B9YA 3K27A 4A11A 3UKRC 3GREA 1YR2A 4YVDA 3MUNA 4L1MA 5IJ8E 3JPXA 4HDJA 5HE3B 1K8KC 3PVWB 3KCIA 2XZGA 3OKYB 4IMMA 2VC2A 5C2WB 4N14A 2CO0A 4O3UB 2VDKA 4AMYA 2YMUA 3SBQA 1Q47A 3BWSA 3CFVA 4Z7OA 1E8NA 3AFCA 1SHYB 5K19A 5GMKn 3FCUA 4AX4A 2AH1A 4A0AA 5CXCB 3EI3B 3DXKC 5H1MA 3SBPA 4FB1D 1MG2A 3I7OA 4K3JB 2B5NA 1U4CA 1GG2B 2O9KA 3EI4B 3EU7A 3O4HA 1NR0A 3RFHA 4GGDA 3J81g 4G55A 4AMZA 3IJCA 4PSWB 1E8MA 2BKLA 3SFZA 4ERQA 5B4WA 2I0SA 3ZDXA 4ERZA 4A09A 5C9ZB 3HFQA 3EI1A 1I2MB 1UOOA 2JKXA 4X60B 4MMZA 1R5MA 4QT8A 2GNQA 2OVPB 2OIZA 3OW8A 4GGAA 3FRXA 2MTAH 2AH0A 4A2LA 5AJAA 1VYHC 2IWFA 1H2XA 3PVUB 1E5TA 4LG9A 5M5RA 4IRZA 4OZUA 4JHNA 2I3SA 4QQEA 4BH6A 4RE6A 4A7JA 2PM7B 2H6KA 2CN3A 2IAAA 1UOQA 3AL9A 3K71A 1M1XA 3OKYA 3CIKB 4JT5C 3O4GA 1O6FA 4FA4D 3EG6A 3RMZD 2AGWA 4J79A 2HU8A 2H6QA 4NENA 3IUQA 3OKWA 3SJLD 2VDPA 3VI3A 3VI4A 1P22A 5CXCA 1JJUB 2OVRB 4JXMA 1JTDB 2OK4A 4ES0A 2P9SC 2PBIB 1N6DA 3V5WB 5FXYA 1QFSA 3DSMA 5EARA 3MZKA 3SHFA 2EICA 2XL3A 2P9KC 4JSPC 2EIBA 1JMXB 4J84A 5C2VB 3DXMC 4QAMA 3EQ9A 5FLXg 4QL1A 3T3MA 2H47A 1C9IA 5CYKB 2H9PA 5E6RA 2QC5A 2YNNA 2AQ5A 5E6UA 1JV2A 1O6GA 3RN1D 4E5ZB 2CNXA 5HYNB 4CC9A 2BBKH 4K3ID 4CI2A 3EMHA 1H2YA 4FWWA 4ZOVA 4J8BA 1NEXB 3MVDK 3MUOA 2H3XA 3BG0A 1L0QA 4GM3A 4KFMB 4PXWA 2AGXA 1TYEA 3ODTA 2CE8A 2CN2A 4ZN4A 2QR5A 4FAND 2P9UC 3IUJA 3J80g 3OF7A 4AEZA 3CFSB 5FFGA 2EIDA 5FKSA 2QXVA 2VDLA 2XYIA 4O02A 2HU7A 5JWZA 3NIFA 3V4PA 3GD1I 5HE1B 5FA5B 3N0DA 4MK0B 4GQ2P 5EM2A 3IJ1A 2VDRA 1GOFA 1SQJA 3F3FA 5IGOA 4IA9A 2XE4A 3AH8B 3I8CA 5H17A 2HYEA 2QZPA 3W15A 4PSXB 3PXTD 5EAPA 1U8CA 1UOPA 3SN6B 2IUVA 2OK6A 2G9AA 3P4FA 3VH0A 3UKUC 2XL2A 5CXBB 4DNUA 2Z2NA 4NSXA 2J57G 4XYIA 1VE6A 2HJ4A 5M5SA 2WQ8A 4O45A 4AN0A 1XKSA 3GC3B 5M5VA 4GM8A 4X63B 5CYKA 3RSEC 3N0EA 1GP2B 2HKMA 3I7NA 5GSAA 5M5UA 1TYQC 3O4IA 4CZVA 5KDOB 4XEIC 3JAMg 3PE7A 5TF2A 2Q7QA 2CO0C 2OVQB 4GQBB 5GXHA 2B5MA 4JSXC 1QFMA 3EI2A 4EWRA 4A0BA 5HE2B 2XU7A 5EMKB 2CE9A 1FWXA 4J8GA 4ESGA 5FQDA 3PXWD 5HDBA 5C92A 1VZ3A 4J81A 4Y7RA 4GM9A 4U7AA 5I5IA 4MMXA 4MMYA 3L4MD 4BCDA 3AL8B 3IVMA 5SXMA 3EWEA 2P9IC 5TEFA 3JZHA 3EQ7A 2UZXB 5IC7A 1ERJA 5I5JA 4LGNA 4U1EI 5TEEA 2P9LC 4J78A 3UVMA 4G56B 4CI1A 3KRXB 1YFQA 5FKRA 3MXXA 1K32A 2HKRA 2PM9B 4FA5D 1PI6A 3BG1A 4J0WA 4AOWA 3EI3A 3EQ8A 4BP9A 1GOHA 3ZE1A 1H2WA 1N6FA 5IGQA 2H9LA 2Z2PA 4JD2C 3OTTA 3MKSB 3DM0A 3EI4A 3I8EA 4L3HD 4QRJA 4ZOYA 5I5MA 3QHYB 4JSVC 1B9XA 3T3PA 5AMSA 3C75H 4JT6C 5EAMA 3NVXA 3V9FA 3FM0A 3ZE2A 4PC0A 2AGLA 3JRPA 3F3PA 1MDAH 1U2VC 2IURA 2YBAA 4OWRA 4CY3A 3IULA 3UVKA 1PBYB 3IIWA 1K3IA 3OKTA 3I7PA 3MKQA 3VGZA 2YNOA 3QI0A 4I79A 4CZYA 2VZ3A 3GFCA 4FA9D 4WK4A 4J0XA 5M5TA 4FHLA 4XYHA 2VDNA 3RN0D 4L3GD 3SXTD 3MZLA 4J87A 1GXRA 4A09B 4L1QD 3C99A 2B5LA 3NIDA 4E54B 5HQGA 4O3TB 4L9OA 3NVQA 4BL0A 5EMJB 2H68A 3RRMC 1OLZA 2H13A 3IIYA 3IJEA 4GMBA 2W18A 1XIPA 3NIGA 5AFU3 3PSCB 4BUJC 4UI9R 3SWSD 2I3TA 2PM9A 3U4YA 3F3GA 2P9PC 1A12A 3K72A 4Z7QA 3MMYA 2VZ1A 4J77A 5C86A 2J56H 4J82A 3IUMA 5FFOA 4A08B 4UM9A 3DWLC 1PEVA 3I7LA 5A2Qg 2I0TA 3C5MA 3DDUA 4GGCA 2UZYB 2HU5A 3I7HA 3FCSA
chains in the Genus database with same CATH topology
3VA6A 3OL2B 5IT9g 4X61B 4E5ZA 5K1CC 4ZOXA 2I0RA 4CI3A 4H5IA 4O9DA 2P9NC 5THAA 3K26A 4CY2A 4TZ4A 3SLED 5EMLB 3SBRA 1XHMA 3C9CA 2IWKA 5IJ7E 4E54A 4ZOZA 3PXSD 2YNPA 3UVOA 4PNKB 3IKOA 5EALA 4FA1D 3SVWD 3NVNA 1SQ9A 5HE0B 2AGYA 1A0RB 4CZXA 2HXCA 3I7KA 3RFGA 3UVLA 3IJ0A 1N6EA 2H6NA 1S4UX 5TDHB 3JZGA 3I89A 3JROA 5FKQA 4A11B 2PM6B 5H14A 2HJBA 2GC4A 3KRWB 2YB8B 3PSLA 4A08A 2BCJB 2EBSA 5CXBA 3JZNA 3SMRA 4Z8LA 4CY5A 3E0CA 3A0FA 3ZWLB 2IUQA 5EM2B 3ORVD 2Z2OA 3UR4A 1JMZB 1RI6A 4GZ8A 3RLMD 2HESX 3JB9L 1GOTB 2GC7A 3ULEC 1PGUA 4D6VA 3OL2A 4GQ1A 4Y5RD 2IUPA 2H14A 2OJYA 4O1QD 4A0AB 4JSNC 3UVNA 4PBYA 4X3EA 4R7AB 2G99A 2H9NA 4CI8A 2B4EA 2TRCB 4H5JA 3FGBA 1JOFA 5FKTA 3SCYA 4PBZA 4CY1A 3L4OD 1OMWB 4LG8A 3EI1B 2AGZA 3AL8A 4J86A 1MG3A 4FAVD 4A2MA 5GXIA 4ERYA 3EI2B 3V7DB 1TBGA 2J55H 1QNIA 4A0BB 2H9MA 3I2NA 4J73A 4D0KA 5EMMB 3B7FA 1B9YA 3K27A 4A11A 3UKRC 3GREA 4YVDA 5IJ8E 3JPXA 4HDJA 5HE3B 1K8KC 3PVWB 3OKYB 4IMMA 5C2WB 4N14A 2CO0A 4O3UB 2YMUA 3SBQA 1Q47A 3BWSA 3CFVA 3AFCA 1SHYB 5K19A 5GMKn 2AH1A 4A0AA 5CXCB 3EI3B 3DXKC 5H1MA 3SBPA 4FB1D 1MG2A 3I7OA 4K3JB 2B5NA 1U4CA 1GG2B 2O9KA 3EI4B 3EU7A 1NR0A 3RFHA 4GGDA 3J81g 3IJCA 4PSWB 3SFZA 4ERQA 5B4WA 2I0SA 4ERZA 4A09A 5C9ZB 3HFQA 3EI1A 4X60B 1R5MA 4QT8A 2GNQA 2OVPB 2OIZA 3OW8A 4GGAA 3FRXA 2MTAH 2AH0A 4A2LA 5AJAA 1VYHC 2IWFA 3PVUB 4LG9A 4OZUA 2I3SA 4QQEA 4BH6A 4A7JA 2PM7B 2H6KA 2CN3A 2IAAA 3AL9A 3OKYA 3CIKB 4JT5C 4FA4D 3EG6A 3RMZD 2AGWA 4J79A 2H6QA 3SJLD 3OKWA 1P22A 5CXCA 1JJUB 2OVRB 4JXMA 2OK4A 4ES0A 2P9SC 2PBIB 1N6DA 3V5WB 5FXYA 3DSMA 5EARA 3MZKA 3SHFA 2XL3A 2P9KC 4JSPC 1JMXB 4J84A 5C2VB 3DXMC 5FLXg 4QL1A 2H47A 5CYKB 2H9PA 2QC5A 2YNNA 2AQ5A 3RN1D 4E5ZB 2CNXA 5HYNB 4CC9A 2BBKH 4K3ID 4CI2A 3EMHA 4FWWA 4ZOVA 4J8BA 1NEXB 2H3XA 3BG0A 1L0QA 4GM3A 4KFMB 4PXWA 2AGXA 3ODTA 2CE8A 2CN2A 4ZN4A 4FAND 2P9UC 3J80g 4AEZA 3CFSB 5FKSA 2QXVA 5JWZA 2XYIA 5HE1B 5FA5B 3N0DA 4MK0B 4GQ2P 5EM2A 3IJ1A 1SQJA 3F3FA 5IGOA 4IA9A 3AH8B 3I8CA 5H17A 2HYEA 3W15A 4PSXB 3PXTD 5EAPA 3SN6B 2IUVA 2OK6A 2G9AA 3P4FA 3VH0A 3UKUC 2XL2A 5CXBB 2Z2NA 4NSXA 2J57G 4XYIA 2HJ4A 4O45A 1XKSA 4GM8A 4X63B 5CYKA 3RSEC 3N0EA 1GP2B 2HKMA 3I7NA 5GSAA 1TYQC 4CZVA 5KDOB 4XEIC 3JAMg 3PE7A 5TF2A 2Q7QA 2CO0C 2OVQB 4GQBB 5GXHA 2B5MA 4JSXC 3EI2A 4EWRA 4A0BA 5HE2B 2XU7A 5EMKB 2CE9A 1FWXA 4J8GA 4ESGA 5FQDA 3PXWD 4J81A 4Y7RA 4GM9A 4U7AA 5I5IA 3L4MD 3AL8B 5SXMA 3EWEA 2P9IC 5TEFA 3JZHA 2UZXB 5IC7A 1ERJA 5I5JA 4LGNA 4U1EI 5TEEA 2P9LC 4J78A 3UVMA 4G56B 4CI1A 3KRXB 1YFQA 5FKRA 3MXXA 1K32A 2HKRA 2PM9B 4FA5D 1PI6A 3BG1A 4J0WA 4AOWA 3EI3A 1N6FA 5IGQA 2H9LA 2Z2PA 4JD2C 3OTTA 3MKSB 3DM0A 3EI4A 3I8EA 4L3HD 4QRJA 4ZOYA 5I5MA 4JSVC 1B9XA 5AMSA 3C75H 4JT6C 5EAMA 3NVXA 3V9FA 3FM0A 4PC0A 2AGLA 3JRPA 3F3PA 1MDAH 1U2VC 2IURA 2YBAA 4OWRA 4CY3A 3UVKA 1PBYB 3IIWA 3OKTA 3VGZA 3I7PA 3MKQA 2YNOA 4I79A 4CZYA 3GFCA 4FA9D 4J0XA 4FHLA 4XYHA 3RN0D 4L3GD 3SXTD 4J87A 3MZLA 1GXRA 4A09B 4L1QD 3C99A 2B5LA 4E54B 5HQGA 4O3TB 4L9OA 3NVQA 4BL0A 5EMJB 2H68A 3RRMC 1OLZA 2H13A 3IIYA 4GMBA 2W18A 1XIPA 5AFU3 3PSCB 4BUJC 4UI9R 3SWSD 2I3TA 2PM9A 3U4YA 3F3GA 2P9PC 3MMYA 4J77A 2J56H 4J82A 4A08B 3DWLC 1PEVA 3I7LA 5A2Qg 2I0TA 3C5MA 4GGCA 2UZYB 3I7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VA6 A;  3OL2 B;  5IT9 g;  4X61 B;  4E5Z A;  5K1C C;  4ZOX A;  2I0R A;  4CI3 A;  4H5I A;  4O9D A;  2P9N C;  5THA A;  3K26 A;  4CY2 A;  4TZ4 A;  3SLE D;  5EML B;  3SBR A;  1XHM A;  3C9C A;  2IWK A;  5IJ7 E;  4E54 A;  4ZOZ A;  3PXS D;  2YNP A;  3UVO A;  4PNK B;  3IKO A;  5EAL A;  4FA1 D;  3SVW D;  3NVN A;  1SQ9 A;  5HE0 B;  2AGY A;  1A0R B;  4CZX A;  2HXC A;  3I7K A;  3RFG A;  3UVL A;  3IJ0 A;  1N6E A;  2H6N A;  1S4U X;  5TDH B;  3JZG A;  3I89 A;  3JRO A;  5FKQ A;  4A11 B;  2PM6 B;  5H14 A;  2HJB A;  2GC4 A;  3KRW B;  2YB8 B;  3PSL A;  4A08 A;  2BCJ B;  2EBS A;  5CXB A;  3JZN A;  3SMR A;  4Z8L A;  4CY5 A;  3E0C A;  3A0F A;  3ZWL B;  2IUQ A;  5EM2 B;  3ORV D;  2Z2O A;  3UR4 A;  1JMZ B;  1RI6 A;  4GZ8 A;  3RLM D;  2HES X;  3JB9 L;  1GOT B;  2GC7 A;  3ULE C;  1PGU A;  4D6V A;  3OL2 A;  4GQ1 A;  4Y5R D;  2IUP A;  2H14 A;  2OJY A;  4O1Q D;  4A0A B;  4JSN C;  3UVN A;  4PBY A;  4X3E A;  4R7A B;  2G99 A;  2H9N A;  4CI8 A;  2B4E A;  2TRC B;  4H5J A;  3FGB A;  1JOF A;  5FKT A;  3SCY A;  4PBZ A;  4CY1 A;  3L4O D;  1OMW B;  4LG8 A;  3EI1 B;  2AGZ A;  3AL8 A;  4J86 A;  1MG3 A;  4FAV D;  4A2M A;  5GXI A;  4ERY A;  3EI2 B;  3V7D B;  1TBG A;  2J55 H;  1QNI A;  4A0B B;  2H9M A;  3I2N A;  4J73 A;  4D0K A;  5EMM B;  3B7F A;  1B9Y A;  3K27 A;  4A11 A;  3UKR C;  3GRE A;  4YVD A;  5IJ8 E;  3JPX A;  4HDJ A;  5HE3 B;  1K8K C;  3PVW B;  3OKY B;  4IMM A;  5C2W B;  4N14 A;  2CO0 A;  4O3U B;  2YMU A;  3SBQ A;  1Q47 A;  3BWS A;  3CFV A;  3AFC A;  1SHY B;  5K19 A;  5GMK n;  2AH1 A;  4A0A A;  5CXC B;  3EI3 B;  3DXK C;  5H1M A;  3SBP A;  4FB1 D;  1MG2 A;  3I7O A;  4K3J B;  2B5N A;  1U4C A;  1GG2 B;  2O9K A;  3EI4 B;  3EU7 A;  1NR0 A;  3RFH A;  4GGD A;  3J81 g;  3IJC A;  4PSW B;  3SFZ A;  4ERQ A;  5B4W A;  2I0S A;  4ERZ A;  4A09 A;  5C9Z B;  3HFQ A;  3EI1 A;  4X60 B;  1R5M A;  4QT8 A;  2GNQ A;  2OVP B;  2OIZ A;  3OW8 A;  4GGA A;  3FRX A;  2MTA H;  2AH0 A;  4A2L A;  5AJA A;  1VYH C;  2IWF A;  3PVU B;  4LG9 A;  4OZU A;  2I3S A;  4QQE A;  4BH6 A;  4A7J A;  2PM7 B;  2H6K A;  2CN3 A;  2IAA A;  3AL9 A;  3OKY A;  3CIK B;  4JT5 C;  4FA4 D;  3EG6 A;  3RMZ D;  2AGW A;  4J79 A;  2H6Q A;  3SJL D;  3OKW A;  1P22 A;  5CXC A;  1JJU B;  2OVR B;  4JXM A;  2OK4 A;  4ES0 A;  2P9S C;  2PBI B;  1N6D A;  3V5W B;  5FXY A;  3DSM A;  5EAR A;  3MZK A;  3SHF A;  2XL3 A;  2P9K C;  4JSP C;  1JMX B;  4J84 A;  5C2V B;  3DXM C;  5FLX g;  4QL1 A;  2H47 A;  5CYK B;  2H9P A;  2QC5 A;  2YNN A;  2AQ5 A;  3RN1 D;  4E5Z B;  2CNX A;  5HYN B;  4CC9 A;  2BBK H;  4K3I D;  4CI2 A;  3EMH A;  4FWW A;  4ZOV A;  4J8B A;  1NEX B;  2H3X A;  3BG0 A;  1L0Q A;  4GM3 A;  4KFM B;  4PXW A;  2AGX A;  3ODT A;  2CE8 A;  2CN2 A;  4ZN4 A;  4FAN D;  2P9U C;  3J80 g;  4AEZ A;  3CFS B;  5FKS A;  2QXV A;  5JWZ A;  2XYI A;  5HE1 B;  5FA5 B;  3N0D A;  4MK0 B;  4GQ2 P;  5EM2 A;  3IJ1 A;  1SQJ A;  3F3F A;  5IGO A;  4IA9 A;  3AH8 B;  3I8C A;  5H17 A;  2HYE A;  3W15 A;  4PSX B;  3PXT D;  5EAP A;  3SN6 B;  2IUV A;  2OK6 A;  2G9A A;  3P4F A;  3VH0 A;  3UKU C;  2XL2 A;  5CXB B;  2Z2N A;  4NSX A;  2J57 G;  4XYI A;  2HJ4 A;  4O45 A;  1XKS A;  4GM8 A;  4X63 B;  5CYK A;  3RSE C;  3N0E A;  1GP2 B;  2HKM A;  3I7N A;  5GSA A;  1TYQ C;  4CZV A;  5KDO B;  4XEI C;  3JAM g;  3PE7 A;  5TF2 A;  2Q7Q A;  2CO0 C;  2OVQ B;  4GQB B;  5GXH A;  2B5M A;  4JSX C;  3EI2 A;  4EWR A;  4A0B A;  5HE2 B;  2XU7 A;  5EMK B;  2CE9 A;  1FWX A;  4J8G A;  4ESG A;  5FQD A;  3PXW D;  4J81 A;  4Y7R A;  4GM9 A;  4U7A A;  5I5I A;  3L4M D;  3AL8 B;  5SXM A;  3EWE A;  2P9I C;  5TEF A;  3JZH A;  2UZX B;  5IC7 A;  1ERJ A;  5I5J A;  4LGN A;  4U1E I;  5TEE A;  2P9L C;  4J78 A;  3UVM A;  4G56 B;  4CI1 A;  3KRX B;  1YFQ A;  5FKR A;  3MXX A;  1K32 A;  2HKR A;  2PM9 B;  4FA5 D;  1PI6 A;  3BG1 A;  4J0W A;  4AOW A;  3EI3 A;  1N6F A;  5IGQ A;  2H9L A;  2Z2P A;  4JD2 C;  3OTT A;  3MKS B;  3DM0 A;  3EI4 A;  3I8E A;  4L3H D;  4QRJ A;  4ZOY A;  5I5M A;  4JSV C;  1B9X A;  5AMS A;  3C75 H;  4JT6 C;  5EAM A;  3NVX A;  3V9F A;  3FM0 A;  4PC0 A;  2AGL A;  3JRP A;  3F3P A;  1MDA H;  1U2V C;  2IUR A;  2YBA A;  4OWR A;  4CY3 A;  3UVK A;  1PBY B;  3IIW A;  3OKT A;  3VGZ A;  3I7P A;  3MKQ A;  2YNO A;  4I79 A;  4CZY A;  3GFC A;  4FA9 D;  4J0X A;  4FHL A;  4XYH A;  3RN0 D;  4L3G D;  3SXT D;  4J87 A;  3MZL A;  1GXR A;  4A09 B;  4L1Q D;  3C99 A;  2B5L A;  4E54 B;  5HQG A;  4O3T B;  4L9O A;  3NVQ A;  4BL0 A;  5EMJ B;  2H68 A;  3RRM C;  1OLZ A;  2H13 A;  3IIY A;  4GMB A;  2W18 A;  1XIP A;  5AFU 3;  3PSC B;  4BUJ C;  4UI9 R;  3SWS D;  2I3T A;  2PM9 A;  3U4Y A;  3F3G A;  2P9P C;  3MMY A;  4J77 A;  2J56 H;  4J82 A;  4A08 B;  3DWL C;  1PEV A;  3I7L A;  5A2Q g;  2I0T A;  3C5M A;  4GGC A;  2UZY B;  3I7H A; 
#chains in the Genus database with same CATH topology
 1VE7 A;  3VA6 A;  3ZE0 A;  5M61 A;  3OL2 B;  4WK0 A;  5IT9 g;  4X61 B;  4D9S A;  4E5Z A;  1UTC A;  5K1C C;  4ZOX A;  2I0R A;  4CI3 A;  4H5I A;  4DNW A;  4O9D A;  2P9N C;  5THA A;  3K26 A;  1T2X A;  4CY2 A;  3V4V A;  4TZ4 A;  3SLE D;  5EML B;  3SBR A;  1XHM A;  3C9C A;  2IWK A;  5IJ7 E;  4E54 A;  4ZOZ A;  3PXS D;  2YNP A;  3UVO A;  4PNK B;  3IKO A;  3ZDZ A;  5EAL A;  4FA1 D;  3SVW D;  3NVN A;  1SQ9 A;  5HE0 B;  2AGY A;  1A0R B;  4G1E A;  4CZX A;  2HXC A;  3I7K A;  4NC4 A;  3RFG A;  3UVL A;  3IJ0 A;  4NBM A;  1N6E A;  2H6N A;  1S4U X;  4AN1 A;  5TDH B;  3JZG A;  1GOG A;  3I89 A;  3JRO A;  5FKQ A;  4A11 B;  2PM6 B;  4BCB A;  5H14 A;  2HJB A;  4UM8 A;  2GC4 A;  3IUR A;  3KRW B;  5E6S A;  2YB8 B;  3PSL A;  4A08 A;  2BCJ B;  2EBS A;  5CXB A;  1VZ2 A;  4WK2 A;  3JZN A;  3SMR A;  4Z8L A;  4WJK A;  4CY5 A;  3E0C A;  3A0F A;  1L5G A;  3ZWL B;  2IUQ A;  4G1M A;  3ORV D;  5EM2 B;  2Z2O A;  3UR4 A;  2VDO A;  1JMZ B;  1RI6 A;  4GZ8 A;  3RLM D;  2HES X;  4BCC A;  3JB9 L;  1GOT B;  2GC7 A;  3ULE C;  2XDW A;  1PGU A;  4D6V A;  3OL2 A;  4GQ1 A;  4Y5R D;  2IUP A;  2H14 A;  2OJY A;  4O1Q D;  4A0A B;  4JSN C;  4O2W A;  3UVN A;  2VDQ A;  1H2Z A;  4PBY A;  2VDM A;  4X3E A;  4R7A B;  3K6S A;  2G99 A;  2H9N A;  4CI8 A;  2B4E A;  2TRC B;  4H5J A;  3FGB A;  1JOF A;  5FKT A;  2EIE A;  3SCY A;  4PBZ A;  4CY1 A;  1C9L A;  3L4O D;  1OMW B;  1BPO A;  4LG8 A;  4DNV A;  3EI1 B;  2AGZ A;  3AL8 A;  3ZDY A;  3IUN A;  4J86 A;  1MG3 A;  4FAV D;  3O4J A;  4NAA A;  4A2M A;  5GXI A;  4ERY A;  4Z7N A;  3EI2 B;  4BP8 A;  3V7D B;  1TBG A;  2J55 H;  1QNI A;  4A0B B;  2H9M A;  3I2N A;  4J73 A;  4JHP C;  4D0K A;  4RE5 A;  5EMM B;  3B7F A;  1B9Y A;  3K27 A;  4A11 A;  3UKR C;  3GRE A;  1YR2 A;  4YVD A;  3MUN A;  4L1M A;  5IJ8 E;  3JPX A;  4HDJ A;  5HE3 B;  1K8K C;  3PVW B;  3KCI A;  2XZG A;  3OKY B;  4IMM A;  2VC2 A;  5C2W B;  4N14 A;  2CO0 A;  4O3U B;  2VDK A;  4AMY A;  2YMU A;  3SBQ A;  1Q47 A;  3BWS A;  3CFV A;  4Z7O A;  1E8N A;  3AFC A;  1SHY B;  5K19 A;  5GMK n;  3FCU A;  4AX4 A;  2AH1 A;  4A0A A;  5CXC B;  3EI3 B;  3DXK C;  5H1M A;  3SBP A;  4FB1 D;  1MG2 A;  3I7O A;  4K3J B;  2B5N A;  1U4C A;  1GG2 B;  2O9K A;  3EI4 B;  3EU7 A;  3O4H A;  1NR0 A;  3RFH A;  4GGD A;  3J81 g;  4G55 A;  4AMZ A;  3IJC A;  4PSW B;  1E8M A;  2BKL A;  3SFZ A;  4ERQ A;  5B4W A;  2I0S A;  3ZDX A;  4ERZ A;  4A09 A;  5C9Z B;  3HFQ A;  3EI1 A;  1I2M B;  1UOO A;  2JKX A;  4X60 B;  4MMZ A;  1R5M A;  4QT8 A;  2GNQ A;  2OVP B;  2OIZ A;  3OW8 A;  4GGA A;  3FRX A;  2MTA H;  2AH0 A;  4A2L A;  5AJA A;  1VYH C;  2IWF A;  1H2X A;  3PVU B;  1E5T A;  4LG9 A;  5M5R A;  4IRZ A;  4OZU A;  4JHN A;  2I3S A;  4QQE A;  4BH6 A;  4RE6 A;  4A7J A;  2PM7 B;  2H6K A;  2CN3 A;  2IAA A;  1UOQ A;  3AL9 A;  3K71 A;  1M1X A;  3OKY A;  3CIK B;  4JT5 C;  3O4G A;  1O6F A;  4FA4 D;  3EG6 A;  3RMZ D;  2AGW A;  4J79 A;  2HU8 A;  2H6Q A;  4NEN A;  3IUQ A;  3OKW A;  3SJL D;  2VDP A;  3VI3 A;  3VI4 A;  1P22 A;  5CXC A;  1JJU B;  2OVR B;  4JXM A;  1JTD B;  2OK4 A;  4ES0 A;  2P9S C;  2PBI B;  1N6D A;  3V5W B;  5FXY A;  1QFS A;  3DSM A;  5EAR A;  3MZK A;  3SHF A;  2EIC A;  2XL3 A;  2P9K C;  4JSP C;  2EIB A;  1JMX B;  4J84 A;  5C2V B;  3DXM C;  4QAM A;  3EQ9 A;  5FLX g;  4QL1 A;  3T3M A;  2H47 A;  1C9I A;  5CYK B;  2H9P A;  5E6R A;  2QC5 A;  2YNN A;  2AQ5 A;  5E6U A;  1JV2 A;  1O6G A;  3RN1 D;  4E5Z B;  2CNX A;  5HYN B;  4CC9 A;  2BBK H;  4K3I D;  4CI2 A;  3EMH A;  1H2Y A;  4FWW A;  4ZOV A;  4J8B A;  1NEX B;  3MVD K;  3MUO A;  2H3X A;  3BG0 A;  1L0Q A;  4GM3 A;  4KFM B;  4PXW A;  2AGX A;  1TYE A;  3ODT A;  2CE8 A;  2CN2 A;  4ZN4 A;  2QR5 A;  4FAN D;  2P9U C;  3IUJ A;  3J80 g;  3OF7 A;  4AEZ A;  3CFS B;  5FFG A;  2EID A;  5FKS A;  2QXV A;  2VDL A;  2XYI A;  4O02 A;  2HU7 A;  5JWZ A;  3NIF A;  3V4P A;  3GD1 I;  5HE1 B;  5FA5 B;  3N0D A;  4MK0 B;  4GQ2 P;  5EM2 A;  3IJ1 A;  2VDR A;  1GOF A;  1SQJ A;  3F3F A;  5IGO A;  4IA9 A;  2XE4 A;  3AH8 B;  3I8C A;  5H17 A;  2HYE A;  2QZP A;  3W15 A;  4PSX B;  3PXT D;  5EAP A;  1U8C A;  1UOP A;  3SN6 B;  2IUV A;  2OK6 A;  2G9A A;  3P4F A;  3VH0 A;  3UKU C;  2XL2 A;  5CXB B;  4DNU A;  2Z2N A;  4NSX A;  2J57 G;  4XYI A;  1VE6 A;  2HJ4 A;  5M5S A;  2WQ8 A;  4O45 A;  4AN0 A;  1XKS A;  3GC3 B;  5M5V A;  4GM8 A;  4X63 B;  5CYK A;  3RSE C;  3N0E A;  1GP2 B;  2HKM A;  3I7N A;  5GSA A;  5M5U A;  1TYQ C;  3O4I A;  4CZV A;  5KDO B;  4XEI C;  3JAM g;  3PE7 A;  5TF2 A;  2Q7Q A;  2CO0 C;  2OVQ B;  4GQB B;  5GXH A;  2B5M A;  4JSX C;  1QFM A;  3EI2 A;  4EWR A;  4A0B A;  5HE2 B;  2XU7 A;  5EMK B;  2CE9 A;  1FWX A;  4J8G A;  4ESG A;  5FQD A;  3PXW D;  5HDB A;  5C92 A;  1VZ3 A;  4J81 A;  4Y7R A;  4GM9 A;  4U7A A;  5I5I A;  4MMX A;  4MMY A;  3L4M D;  4BCD A;  3AL8 B;  3IVM A;  5SXM A;  3EWE A;  2P9I C;  5TEF A;  3JZH A;  3EQ7 A;  2UZX B;  5IC7 A;  1ERJ A;  5I5J A;  4LGN A;  4U1E I;  5TEE A;  2P9L C;  4J78 A;  3UVM A;  4G56 B;  4CI1 A;  3KRX B;  1YFQ A;  5FKR A;  3MXX A;  1K32 A;  2HKR A;  2PM9 B;  4FA5 D;  1PI6 A;  3BG1 A;  4J0W A;  4AOW A;  3EI3 A;  3EQ8 A;  4BP9 A;  1GOH A;  3ZE1 A;  1H2W A;  1N6F A;  5IGQ A;  2H9L A;  2Z2P A;  4JD2 C;  3OTT A;  3MKS B;  3DM0 A;  3EI4 A;  3I8E A;  4L3H D;  4QRJ A;  4ZOY A;  5I5M A;  3QHY B;  4JSV C;  1B9X A;  3T3P A;  5AMS A;  3C75 H;  4JT6 C;  5EAM A;  3NVX A;  3V9F A;  3FM0 A;  3ZE2 A;  4PC0 A;  2AGL A;  3JRP A;  3F3P A;  1MDA H;  1U2V C;  2IUR A;  2YBA A;  4OWR A;  4CY3 A;  3IUL A;  3UVK A;  1PBY B;  3IIW A;  1K3I A;  3OKT A;  3I7P A;  3MKQ A;  3VGZ A;  2YNO A;  3QI0 A;  4I79 A;  4CZY A;  2VZ3 A;  3GFC A;  4FA9 D;  4WK4 A;  4J0X A;  5M5T A;  4FHL A;  4XYH A;  2VDN A;  3RN0 D;  4L3G D;  3SXT D;  3MZL A;  4J87 A;  1GXR A;  4A09 B;  4L1Q D;  3C99 A;  2B5L A;  3NID A;  4E54 B;  5HQG A;  4O3T B;  4L9O A;  3NVQ A;  4BL0 A;  5EMJ B;  2H68 A;  3RRM C;  1OLZ A;  2H13 A;  3IIY A;  3IJE A;  4GMB A;  2W18 A;  1XIP A;  3NIG A;  5AFU 3;  3PSC B;  4BUJ C;  4UI9 R;  3SWS D;  2I3T A;  2PM9 A;  3U4Y A;  3F3G A;  2P9P C;  1A12 A;  3K72 A;  4Z7Q A;  3MMY A;  2VZ1 A;  4J77 A;  5C86 A;  2J56 H;  4J82 A;  3IUM A;  5FFO A;  4A08 B;  4UM9 A;  3DWL C;  1PEV A;  3I7L A;  5A2Q g;  2I0T A;  3C5M A;  3DDU A;  4GGC A;  2UZY B;  2HU5 A;  3I7H A;  3FCS A; 
#chains in the Genus database with same CATH homology
 3VA6 A;  3OL2 B;  5IT9 g;  4X61 B;  4E5Z A;  5K1C C;  4ZOX A;  2I0R A;  4CI3 A;  4H5I A;  4O9D A;  2P9N C;  5THA A;  3K26 A;  4CY2 A;  4TZ4 A;  3SLE D;  5EML B;  3SBR A;  1XHM A;  3C9C A;  2IWK A;  5IJ7 E;  4E54 A;  4ZOZ A;  3PXS D;  2YNP A;  3UVO A;  4PNK B;  3IKO A;  5EAL A;  4FA1 D;  3SVW D;  3NVN A;  1SQ9 A;  5HE0 B;  2AGY A;  1A0R B;  4CZX A;  2HXC A;  3I7K A;  3RFG A;  3UVL A;  3IJ0 A;  1N6E A;  2H6N A;  1S4U X;  5TDH B;  3JZG A;  3I89 A;  3JRO A;  5FKQ A;  4A11 B;  2PM6 B;  5H14 A;  2HJB A;  2GC4 A;  3KRW B;  2YB8 B;  3PSL A;  4A08 A;  2BCJ B;  2EBS A;  5CXB A;  3JZN A;  3SMR A;  4Z8L A;  4CY5 A;  3E0C A;  3A0F A;  3ZWL B;  2IUQ A;  5EM2 B;  3ORV D;  2Z2O A;  3UR4 A;  1JMZ B;  1RI6 A;  4GZ8 A;  3RLM D;  2HES X;  3JB9 L;  1GOT B;  2GC7 A;  3ULE C;  1PGU A;  4D6V A;  3OL2 A;  4GQ1 A;  4Y5R D;  2IUP A;  2H14 A;  2OJY A;  4O1Q D;  4A0A B;  4JSN C;  3UVN A;  4PBY A;  4X3E A;  4R7A B;  2G99 A;  2H9N A;  4CI8 A;  2B4E A;  2TRC B;  4H5J A;  3FGB A;  1JOF A;  5FKT A;  3SCY A;  4PBZ A;  4CY1 A;  3L4O D;  1OMW B;  4LG8 A;  3EI1 B;  2AGZ A;  3AL8 A;  4J86 A;  1MG3 A;  4FAV D;  4A2M A;  5GXI A;  4ERY A;  3EI2 B;  3V7D B;  1TBG A;  2J55 H;  1QNI A;  4A0B B;  2H9M A;  3I2N A;  4J73 A;  4D0K A;  5EMM B;  3B7F A;  1B9Y A;  3K27 A;  4A11 A;  3UKR C;  3GRE A;  4YVD A;  5IJ8 E;  3JPX A;  4HDJ A;  5HE3 B;  1K8K C;  3PVW B;  3OKY B;  4IMM A;  5C2W B;  4N14 A;  2CO0 A;  4O3U B;  2YMU A;  3SBQ A;  1Q47 A;  3BWS A;  3CFV A;  3AFC A;  1SHY B;  5K19 A;  5GMK n;  2AH1 A;  4A0A A;  5CXC B;  3EI3 B;  3DXK C;  5H1M A;  3SBP A;  4FB1 D;  1MG2 A;  3I7O A;  4K3J B;  2B5N A;  1U4C A;  1GG2 B;  2O9K A;  3EI4 B;  3EU7 A;  1NR0 A;  3RFH A;  4GGD A;  3J81 g;  3IJC A;  4PSW B;  3SFZ A;  4ERQ A;  5B4W A;  2I0S A;  4ERZ A;  4A09 A;  5C9Z B;  3HFQ A;  3EI1 A;  4X60 B;  1R5M A;  4QT8 A;  2GNQ A;  2OVP B;  2OIZ A;  3OW8 A;  4GGA A;  3FRX A;  2MTA H;  2AH0 A;  4A2L A;  5AJA A;  1VYH C;  2IWF A;  3PVU B;  4LG9 A;  4OZU A;  2I3S A;  4QQE A;  4BH6 A;  4A7J A;  2PM7 B;  2H6K A;  2CN3 A;  2IAA A;  3AL9 A;  3OKY A;  3CIK B;  4JT5 C;  4FA4 D;  3EG6 A;  3RMZ D;  2AGW A;  4J79 A;  2H6Q A;  3SJL D;  3OKW A;  1P22 A;  5CXC A;  1JJU B;  2OVR B;  4JXM A;  2OK4 A;  4ES0 A;  2P9S C;  2PBI B;  1N6D A;  3V5W B;  5FXY A;  3DSM A;  5EAR A;  3MZK A;  3SHF A;  2XL3 A;  2P9K C;  4JSP C;  1JMX B;  4J84 A;  5C2V B;  3DXM C;  5FLX g;  4QL1 A;  2H47 A;  5CYK B;  2H9P A;  2QC5 A;  2YNN A;  2AQ5 A;  3RN1 D;  4E5Z B;  2CNX A;  5HYN B;  4CC9 A;  2BBK H;  4K3I D;  4CI2 A;  3EMH A;  4FWW A;  4ZOV A;  4J8B A;  1NEX B;  2H3X A;  3BG0 A;  1L0Q A;  4GM3 A;  4KFM B;  4PXW A;  2AGX A;  3ODT A;  2CE8 A;  2CN2 A;  4ZN4 A;  4FAN D;  2P9U C;  3J80 g;  4AEZ A;  3CFS B;  5FKS A;  2QXV A;  5JWZ A;  2XYI A;  5HE1 B;  5FA5 B;  3N0D A;  4MK0 B;  4GQ2 P;  5EM2 A;  3IJ1 A;  1SQJ A;  3F3F A;  5IGO A;  4IA9 A;  3AH8 B;  3I8C A;  5H17 A;  2HYE A;  3W15 A;  4PSX B;  3PXT D;  5EAP A;  3SN6 B;  2IUV A;  2OK6 A;  2G9A A;  3P4F A;  3VH0 A;  3UKU C;  2XL2 A;  5CXB B;  2Z2N A;  4NSX A;  2J57 G;  4XYI A;  2HJ4 A;  4O45 A;  1XKS A;  4GM8 A;  4X63 B;  5CYK A;  3RSE C;  3N0E A;  1GP2 B;  2HKM A;  3I7N A;  5GSA A;  1TYQ C;  4CZV A;  5KDO B;  4XEI C;  3JAM g;  3PE7 A;  5TF2 A;  2Q7Q A;  2CO0 C;  2OVQ B;  4GQB B;  5GXH A;  2B5M A;  4JSX C;  3EI2 A;  4EWR A;  4A0B A;  5HE2 B;  2XU7 A;  5EMK B;  2CE9 A;  1FWX A;  4J8G A;  4ESG A;  5FQD A;  3PXW D;  4J81 A;  4Y7R A;  4GM9 A;  4U7A A;  5I5I A;  3L4M D;  3AL8 B;  5SXM A;  3EWE A;  2P9I C;  5TEF A;  3JZH A;  2UZX B;  5IC7 A;  1ERJ A;  5I5J A;  4LGN A;  4U1E I;  5TEE A;  2P9L C;  4J78 A;  3UVM A;  4G56 B;  4CI1 A;  3KRX B;  1YFQ A;  5FKR A;  3MXX A;  1K32 A;  2HKR A;  2PM9 B;  4FA5 D;  1PI6 A;  3BG1 A;  4J0W A;  4AOW A;  3EI3 A;  1N6F A;  5IGQ A;  2H9L A;  2Z2P A;  4JD2 C;  3OTT A;  3MKS B;  3DM0 A;  3EI4 A;  3I8E A;  4L3H D;  4QRJ A;  4ZOY A;  5I5M A;  4JSV C;  1B9X A;  5AMS A;  3C75 H;  4JT6 C;  5EAM A;  3NVX A;  3V9F A;  3FM0 A;  4PC0 A;  2AGL A;  3JRP A;  3F3P A;  1MDA H;  1U2V C;  2IUR A;  2YBA A;  4OWR A;  4CY3 A;  3UVK A;  1PBY B;  3IIW A;  3OKT A;  3VGZ A;  3I7P A;  3MKQ A;  2YNO A;  4I79 A;  4CZY A;  3GFC A;  4FA9 D;  4J0X A;  4FHL A;  4XYH A;  3RN0 D;  4L3G D;  3SXT D;  4J87 A;  3MZL A;  1GXR A;  4A09 B;  4L1Q D;  3C99 A;  2B5L A;  4E54 B;  5HQG A;  4O3T B;  4L9O A;  3NVQ A;  4BL0 A;  5EMJ B;  2H68 A;  3RRM C;  1OLZ A;  2H13 A;  3IIY A;  4GMB A;  2W18 A;  1XIP A;  5AFU 3;  3PSC B;  4BUJ C;  4UI9 R;  3SWS D;  2I3T A;  2PM9 A;  3U4Y A;  3F3G A;  2P9P C;  3MMY A;  4J77 A;  2J56 H;  4J82 A;  4A08 B;  3DWL C;  1PEV A;  3I7L A;  5A2Q g;  2I0T A;  3C5M A;  4GGC A;  2UZY B;  3I7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...