1XKSA

The crystal structure of the n-terminal domain of nup133 reveals a beta-propeller fold common to several nucleoporins
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
403
structure length
374
Chain Sequence
ESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSTQAVAVMVATREGSIRYWPSLAGEDTYTEAFVDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHILPQGQGMSDLTLSSVLWDRERSSFYSLTSSNISKWELDDSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWHSADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLYNESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of Nup133 domains reveals modular building blocks of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup133
total genus 87
structure length 374
sequence length 403
ec nomenclature
pdb deposition date 2004-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1xksA00
1N6EA 1PEVA 2PM7B 3ULEC 4JSPC 2CNXA 2PM9B 2P9KC 4O3UB 3DSMA 1S4UX 2B5LA 4FA9D 3MKQA 4JSXC 1SHYB 5CYKA 1ERJA 1SQJA 2H6NA 1RI6A 2IURA 3EI1A 3K26A 4H5IA 3SFZA 3JAMg 3SN6B 2OVPB 3F3FA 3FM0A 4CI3A 3J81g 3N0DA 3C99A 3V5WB 1P22A 4FA1D 3FGBA 2YNOA 2I3SA 3PVUB 5H14A 3AL8A 4A09B 1VYHC 2HJBA 2XL2A 2H14A 4LG9A 5I5MA 2TRCB 5CXCA 4Z8LA 4L3HD 3DM0A 3I7PA 3UVNA 2P9NC 4J73A 5IJ8E 4QRJA 1OLZA 2P9LC 2HESX 3I7NA 2P9UC 4G56B 3MZKA 4CZXA 3RSEC 4XEIC 4Y5RD 5JWZA 2H6KA 3EI2B 5EM2B 3EWEA 5C9ZB 5FKSA 3UVOA 2H47A 2CO0A 2YNPA 4O45A 1FWXA 5EALA 3RRMC 3AL8B 4A09A 3PXTD 2H68A 3SBQA 1B9YA 2B5NA 3ORVD 3FRXA 1PBYB 1JOFA 3JZHA 3AH8B 3UKUC 1TBGA 3SBPA 4O9DA 5EARA 5EMMB 1GP2B 2I0SA 5GXIA 4R7AB 5GSAA 2IWFA 3IIYA 3GREA 2G9AA 4BH6A 5EMJB 4YVDA 4JXMA 2AH0A 4H5JA 4D6VA 1XIPA 3NVQA 2HJ4A 2OK4A 4PSXB 3EMHA 4CY5A 2CE9A 5SXMA 4PNKB 1MG3A 4GM3A 2O9KA 4U7AA 3SLED 4OWRA 4OZUA 3U4YA 5HE1B 4PBYA 5KDOB 2YMUA 2MTAH 3PE7A 2CN2A 3IIWA 4CY2A 4AOWA 4J86A 3F3GA 5I5JA 4E54A 5TEFA 5I5IA 2UZYB 2BBKH 3IJ0A 5EAPA 5CXBA 4TZ4A 4BUJC 3JRPA 4ERZA 2GC4A 4GQ2P 3EG6A 2P9SC 4LGNA 3DWLC 2J57G 3I2NA 3I89A 1PI6A 5EMKB 3RFHA 5TDHB 5K19A 5H17A 3UVKA 1TYQC 4L3GD 4EWRA 1NR0A 3JZGA 3VGZA 4IA9A 3SHFA 2Z2OA 3RFGA 4QQEA 1K8KC 4A0AA 1JJUB 3EI3B 1Q47A 2OIZA 1JMZB 2AGXA 2W18A 3BWSA 3HFQA 4CI8A 4N14A 4MK0B 2H9MA 5HE3B 3UR4A 3W15A 2HXCA 3EI3A 5H1MA 2GC7A 2AQ5A 3MMYA 4GGAA 5IC7A 2AGZA 3PXSD 2H9LA 3EI2A 3JB9L 4A0BB 4GQBB 1L0QA 3EI1B 2Z2NA 4QT8A 2XU7A 2PBIB 4JSNC 5IGOA 3EI4B 4J82A 2PM9A 5TF2A 4FA5D 4J78A 1JMXB 1MG2A 1YFQA 2CE8A 3CIKB 4J79A 3OKWA 4E5ZA 3OW8A 5EAMA 2IUPA 4GM8A 3RLMD 4J84A 1N6FA 4E54B 2P9IC 3UKRC 2H6QA 4J8BA 3OL2B 3ZWLB 5TEEA 4JT5C 4L1QD 2I3TA 5IJ7E 4ZN4A 4ESGA 3RN1D 3E0CA 3I7LA 3UVMA 3F3PA 2CN3A 3VA6A 5IT9g 4CC9A 4E5ZB 3I7HA 5B4WA 4X60B 3SWSD 4ERQA 2B5MA 4JD2C 2YNNA 4CZVA 3KRWB 2HKMA 4HDJA 2QC5A 2AGWA 4ES0A 5EM2A 3OKYB 2H9NA 2IWKA 4O1QD 3C75H 3MKSB 2G99A 1R5MA 3MXXA 3K27A 3PSLA 4FAVD 1U2VC 4ZOXA 3CFSB 5HQGA 4A0BA 5C2WB 4FWWA 2CO0C 1XKSA 3OKYA 3SMRA 4FA4D 4CY3A 5FXYA 4PSWB 4J0XA 3UVLA 3MZLA 3RMZD 4XYHA 4Y7RA 2IUQA 4A2LA 3DXKC 1K32A 5CXBB 2OK6A 2XL3A 5FQDA 4L9OA 2Z2PA 4A11B 2H9PA 3EU7A 1GXRA 1GG2B 4A0AB 3V7DB 4CZYA 2OVRB 5IGQA 2I0TA 1OMWB 3NVXA 4O3TB 4X3EA 4J8GA 2GNQA 4AEZA 2J55H 2OJYA 3SXTD 5CYKB 2Q7QA 4I79A 3JZNA 5GMKn 4ZOVA 3A0FA 3PVWB 1QNIA 4LG8A 5CXCB 3PSCB 2QXVA 4CY1A 4FAND 2H3XA 5AFU3 2P9PC 3IKOA 4J0WA 3RN0D 4D0KA 3SVWD 3B7FA 3JROA 2HKRA 3OTTA 2BCJB 3JPXA 5HE2B 2XYIA 2B4EA 4J77A 4A08A 5EMLB 1SQ9A 3OL2A 2AGYA 4JSVC 3I7OA 4GGDA 4BL0A 1GOTB 5FKTA 4U1EI 4A08B 5A2Qg 3L4OD 3I7KA 4J87A 3ODTA 5FKRA 3IJ1A 3SJLD 2I0RA 4ZOZA 4GMBA 3GFCA 1U4CA 1MDAH 1N6DA 4IMMA 5GXHA 4XYIA 3CFVA 1XHMA 3SCYA 4FHLA 2IAAA 4A7JA 5K1CC 3AL9A 3N0EA 5FA5B 4CI2A 3EI4A 4ZOYA 5FLXg 2PM6B 1NEXB 3SBRA 4JT6C 3AFCA 5AMSA 4CI1A 4PC0A 5FKQA 2EBSA 4GM9A 1A0RB 3NVNA 4KFMB 4UI9R 3C9CA 4QL1A 3VH0A 5THAA 1B9XA 3P4FA 4NSXA 2YB8B 4A11A 5HE0B 4PBZA 2H13A 5C2VB 3I8CA 4PXWA 3I8EA 4ERYA 3J80g 3DXMC 4GQ1A 4GZ8A 4A2MA 3BG0A 3KRXB 3C5MA 2IUVA 2OVQB 2AGLA 5AJAA 3PXWD 1PGUA 3L4MD 4X61B 2HYEA 3V9FA 3IJCA 2AH1A 4J81A 2UZXB 4GGCA 3BG1A 4X63B 2J56H 5HYNB 4K3ID 4K3JB 4FB1D 3OKTA 2YBAA
chains in the Genus database with same CATH superfamily
1N6EA 1PEVA 2PM7B 3ULEC 4JSPC 3MVDK 2CNXA 2PM9B 3EQ7A 2P9KC 4O3UB 3DSMA 1S4UX 2B5LA 4FA9D 3MKQA 4JSXC 1SHYB 5CYKA 3IUQA 1ERJA 1SQJA 2H6NA 1RI6A 2IURA 3EI1A 3K26A 4H5IA 3SFZA 3JAMg 2EIEA 3SN6B 2XDWA 2OVPB 3F3FA 3FM0A 4CI3A 3J81g 3VI4A 3N0DA 3C99A 3V5WB 1P22A 3K72A 4FA1D 2QZPA 3FGBA 2YNOA 2I3SA 3PVUB 5H14A 3AL8A 4A09B 1C9IA 1VYHC 2HJBA 5FFGA 2XL2A 1VE7A 2H14A 4LG9A 2TRCB 5I5MA 4WK2A 5CXCA 4G1MA 4Z8LA 4L3HD 3DM0A 3I7PA 3UVNA 2P9NC 4J73A 5IJ8E 4QRJA 1OLZA 2P9LC 2HESX 3I7NA 2P9UC 4G56B 3MZKA 5FFOA 4CZXA 3RSEC 4XEIC 1UOOA 4Y5RD 5JWZA 2VDMA 2H6KA 3EI2B 4BP8A 5EM2B 3EWEA 5C9ZB 5FKSA 1H2WA 2H47A 3UVOA 2VDNA 2CO0A 3T3MA 2YNPA 4O45A 1FWXA 5EALA 3RRMC 3AL8B 4A09A 3PXTD 4WK4A 2H68A 3SBQA 1B9YA 3GC3B 2B5NA 3ORVD 4DNVA 3FRXA 1PBYB 1JOFA 3JZHA 4DNUA 4UM8A 3AH8B 3UKUC 1L5GA 3QI0A 1TBGA 3SBPA 4O9DA 5EARA 2VDQA 5EMMB 3O4HA 4G1EA 1YR2A 5HDBA 1GP2B 4QAMA 1GOGA 5E6UA 2I0SA 5GXIA 4R7AB 5GSAA 2IWFA 3IIYA 4NENA 3GREA 2G9AA 2VDKA 4BH6A 5EMJB 4YVDA 4JXMA 2AH0A 4H5JA 4D6VA 1XIPA 3NVQA 2HJ4A 3T3PA 2OK4A 4PSXB 3EMHA 4CY5A 2CE9A 5SXMA 4PNKB 1MG3A 4GM3A 2O9KA 4U7AA 3SLED 3KCIA 4Z7OA 4OWRA 2VDPA 4OZUA 3U4YA 5HE1B 4PBYA 4MMXA 5KDOB 2YMUA 2MTAH 3PE7A 2CN2A 3IIWA 3IUMA 3O4JA 4CY2A 4AOWA 4J86A 3F3GA 5I5JA 4E54A 4MMYA 5TEFA 5I5IA 2UZYB 2BBKH 4NAAA 5E6RA 3IJ0A 3IUNA 5EAPA 4Z7NA 5CXBA 4TZ4A 3MUOA 4BUJC 3JRPA 4ERZA 2GC4A 5M5UA 4GQ2P 1JV2A 3EG6A 2P9SC 3IULA 4LGNA 3I2NA 1VE6A 2J57G 3DWLC 3I89A 1PI6A 5M5TA 3IVMA 5EMKB 1VZ3A 3RFHA 3O4IA 5TDHB 5K19A 3O4GA 1T2XA 1BPOA 2WQ8A 5H17A 3UVKA 1TYQC 2VZ3A 4L3GD 2XZGA 4EWRA 1NR0A 4AN0A 3QHYB 4RE6A 3JZGA 3VGZA 1I2MB 4IA9A 3SHFA 3VI3A 2Z2OA 3RFGA 4QQEA 1K8KC 4A0AA 1JJUB 3EI3B 1Q47A 2OIZA 2BKLA 2EIBA 1JMZB 2AGXA 2W18A 3BWSA 3HFQA 4CI8A 4N14A 4MK0B 2H9MA 5HE3B 3UR4A 3W15A 2JKXA 5C92A 2HXCA 3EI3A 1M1XA 5H1MA 2GC7A 1E8MA 2AQ5A 3MMYA 4GGAA 5IC7A 2AGZA 2VDOA 3PXSD 2H9LA 3EI2A 3JB9L 4JHNA 4A0BB 4GQBB 1L0QA 3EI1B 2Z2NA 2EICA 4QT8A 2XU7A 2PBIB 4JSNC 5IGOA 3EI4B 4J82A 2PM9A 5TF2A 4FA5D 4J78A 2VDLA 3NIDA 1JMXB 1MG2A 1YFQA 2CE8A 3CIKB 4J79A 3ZE0A 3OKWA 1U8CA 4E5ZA 3OW8A 5EAMA 4DNWA 1UOQA 2IUPA 4GM8A 3RLMD 3IURA 4J84A 1N6FA 1UTCA 4E54B 1GOFA 2P9IC 3NIFA 3UKRC 1H2YA 2H6QA 4J8BA 3OL2B 4WJKA 3ZWLB 5TEEA 4JT5C 4L1QD 2I3TA 5IJ7E 4ZN4A 4ESGA 3RN1D 3E0CA 3I7LA 3GD1I 3UVMA 3F3PA 2CN3A 3VA6A 5IT9g 1UOPA 4MMZA 4CC9A 4E5ZB 3I7HA 3MUNA 5B4WA 5C86A 4X60B 3SWSD 4ERQA 2B5MA 4JD2C 2YNNA 4CZVA 3KRWB 4UM9A 2HKMA 4HDJA 2QC5A 1E8NA 2AGWA 4ES0A 5EM2A 3OKYB 1O6FA 2H9NA 2IWKA 3C75H 4O1QD 3MKSB 2G99A 5M61A 1R5MA 4BP9A 3MXXA 3K27A 1K3IA 3PSLA 4FAVD 4RE5A 1U2VC 4ZOXA 3CFSB 5HQGA 4A0BA 5C2WB 4FWWA 2CO0C 1XKSA 3OKYA 3SMRA 5E6SA 4FA4D 4G55A 4CY3A 1C9LA 5FXYA 4PSWB 4J0XA 3UVLA 3MZLA 3RMZD 4XYHA 4Y7RA 2IUQA 4A2LA 3NIGA 3DXKC 1K32A 5CXBB 2OK6A 2XL3A 5FQDA 4L9OA 4NBMA 2Z2PA 4A11B 2HU5A 2H9PA 3EU7A 3ZE2A 1GXRA 2VDRA 1GG2B 4A0AB 3V7DB 4CZYA 2OVRB 5IGQA 3OF7A 2I0TA 3EQ9A 1OMWB 1QFSA 3NVXA 4O3TB 2XE4A 4X3EA 4J8GA 3V4VA 2GNQA 4D9SA 4AEZA 2J55H 2OJYA 3SXTD 5CYKB 4WK0A 2Q7QA 4I79A 3JZNA 3ZDZA 4JHPC 5GMKn 4ZOVA 3A0FA 3PVWB 1QNIA 4LG8A 5CXCB 3PSCB 2QXVA 4CY1A 3V4PA 4AMZA 2H3XA 4FAND 2P9PC 5AFU3 3IKOA 4J0WA 3RN0D 4D0KA 3SVWD 3B7FA 3JROA 2HKRA 3OTTA 2BCJB 3JPXA 5HE2B 2XYIA 1GOHA 2B4EA 1VZ2A 4J77A 2QR5A 4O2WA 4A08A 2HU7A 5EMLB 1QFMA 1O6GA 1SQ9A 3IUJA 3OL2A 2AGYA 4JSVC 3I7OA 4GGDA 4BL0A 1GOTB 5FKTA 4U1EI 4A08B 5A2Qg 3L4OD 3I7KA 4J87A 3ODTA 5FKRA 3IJ1A 4AX4A 3SJLD 2I0RA 4ZOZA 4GMBA 3GFCA 1U4CA 1JTDB 1MDAH 1N6DA 4BCDA 4IMMA 5GXHA 4XYIA 4BCBA 3CFVA 1XHMA 3SCYA 4FHLA 1H2XA 1TYEA 4AN1A 3EQ8A 3ZDYA 2IAAA 4A7JA 5K1CC 3AL9A 3N0EA 5FA5B 4CI2A 3EI4A 4ZOYA 5FLXg 3K6SA 2PM6B 3ZE1A 1NEXB 3SBRA 4JT6C 3AFCA 5AMSA 4CI1A 4PC0A 5FKQA 2EBSA 4GM9A 4O02A 5M5SA 1A0RB 3NVNA 3FCUA 4KFMB 4UI9R 3C9CA 4QL1A 3VH0A 5THAA 2VZ1A 1A12A 1B9XA 3P4FA 4IRZA 4NSXA 2YB8B 2HU8A 4A11A 3DDUA 5HE0B 4PBZA 2H13A 5C2VB 3I8CA 4PXWA 3I8EA 3ZDXA 4ERYA 3J80g 3DXMC 4GQ1A 4GZ8A 5M5RA 4A2MA 4BCCA 3BG0A 3KRXB 3C5MA 1E5TA 2IUVA 2EIDA 2OVQB 2AGLA 5AJAA 4AMYA 3PXWD 1PGUA 3L4MD 4L1MA 2VC2A 4X61B 2HYEA 3V9FA 3IJCA 2AH1A 1H2ZA 4J81A 2UZXB 4GGCA 3BG1A 4X63B 3FCSA 5M5VA 2J56H 4Z7QA 5HYNB 3IJEA 4NC4A 4K3ID 4K3JB 4FB1D 3K71A 3OKTA 2YBAA
chains in the Genus database with same CATH topology
1N6EA 1PEVA 2PM7B 3ULEC 4JSPC 2CNXA 2PM9B 2P9KC 4O3UB 3DSMA 1S4UX 2B5LA 4FA9D 3MKQA 4JSXC 1SHYB 5CYKA 1ERJA 1SQJA 2H6NA 1RI6A 2IURA 3EI1A 3K26A 4H5IA 3SFZA 3JAMg 3SN6B 2OVPB 3F3FA 3FM0A 4CI3A 3J81g 3N0DA 3C99A 3V5WB 1P22A 4FA1D 3FGBA 2YNOA 2I3SA 3PVUB 5H14A 3AL8A 4A09B 1VYHC 2HJBA 2XL2A 2H14A 4LG9A 5I5MA 2TRCB 5CXCA 4Z8LA 4L3HD 3DM0A 3I7PA 3UVNA 2P9NC 4J73A 5IJ8E 4QRJA 1OLZA 2P9LC 2HESX 3I7NA 2P9UC 4G56B 3MZKA 4CZXA 3RSEC 4XEIC 4Y5RD 5JWZA 2H6KA 3EI2B 5EM2B 3EWEA 5C9ZB 5FKSA 3UVOA 2H47A 2CO0A 2YNPA 4O45A 1FWXA 5EALA 3RRMC 3AL8B 4A09A 3PXTD 2H68A 3SBQA 1B9YA 2B5NA 3ORVD 3FRXA 1PBYB 1JOFA 3JZHA 3AH8B 3UKUC 1TBGA 3SBPA 4O9DA 5EARA 5EMMB 1GP2B 2I0SA 5GXIA 4R7AB 5GSAA 2IWFA 3IIYA 3GREA 2G9AA 4BH6A 5EMJB 4YVDA 4JXMA 2AH0A 4H5JA 4D6VA 1XIPA 3NVQA 2HJ4A 2OK4A 4PSXB 3EMHA 4CY5A 2CE9A 5SXMA 4PNKB 1MG3A 4GM3A 2O9KA 4U7AA 3SLED 4OWRA 4OZUA 3U4YA 5HE1B 4PBYA 5KDOB 2YMUA 2MTAH 3PE7A 2CN2A 3IIWA 4CY2A 4AOWA 4J86A 3F3GA 5I5JA 4E54A 5TEFA 5I5IA 2UZYB 2BBKH 3IJ0A 5EAPA 5CXBA 4TZ4A 4BUJC 3JRPA 4ERZA 2GC4A 4GQ2P 3EG6A 2P9SC 4LGNA 3DWLC 2J57G 3I2NA 3I89A 1PI6A 5EMKB 3RFHA 5TDHB 5K19A 5H17A 3UVKA 1TYQC 4L3GD 4EWRA 1NR0A 3JZGA 3VGZA 4IA9A 3SHFA 2Z2OA 3RFGA 4QQEA 1K8KC 4A0AA 1JJUB 3EI3B 1Q47A 2OIZA 1JMZB 2AGXA 2W18A 3BWSA 3HFQA 4CI8A 4N14A 4MK0B 2H9MA 5HE3B 3UR4A 3W15A 2HXCA 3EI3A 5H1MA 2GC7A 2AQ5A 3MMYA 4GGAA 5IC7A 2AGZA 3PXSD 2H9LA 3EI2A 3JB9L 4A0BB 4GQBB 1L0QA 3EI1B 2Z2NA 4QT8A 2XU7A 2PBIB 4JSNC 5IGOA 3EI4B 4J82A 2PM9A 5TF2A 4FA5D 4J78A 1JMXB 1MG2A 1YFQA 2CE8A 3CIKB 4J79A 3OKWA 4E5ZA 3OW8A 5EAMA 2IUPA 4GM8A 3RLMD 4J84A 1N6FA 4E54B 2P9IC 3UKRC 2H6QA 4J8BA 3OL2B 3ZWLB 5TEEA 4JT5C 4L1QD 2I3TA 5IJ7E 4ZN4A 4ESGA 3RN1D 3E0CA 3I7LA 3UVMA 3F3PA 2CN3A 3VA6A 5IT9g 4CC9A 4E5ZB 3I7HA 5B4WA 4X60B 3SWSD 4ERQA 2B5MA 4JD2C 2YNNA 4CZVA 3KRWB 2HKMA 4HDJA 2QC5A 2AGWA 4ES0A 5EM2A 3OKYB 2H9NA 2IWKA 4O1QD 3C75H 3MKSB 2G99A 1R5MA 3MXXA 3K27A 3PSLA 4FAVD 1U2VC 4ZOXA 3CFSB 5HQGA 4A0BA 5C2WB 4FWWA 2CO0C 1XKSA 3OKYA 3SMRA 4FA4D 4CY3A 5FXYA 4PSWB 4J0XA 3UVLA 3MZLA 3RMZD 4XYHA 4Y7RA 2IUQA 4A2LA 3DXKC 1K32A 5CXBB 2OK6A 2XL3A 5FQDA 4L9OA 2Z2PA 4A11B 2H9PA 3EU7A 1GXRA 1GG2B 4A0AB 3V7DB 4CZYA 2OVRB 5IGQA 2I0TA 1OMWB 3NVXA 4O3TB 4X3EA 4J8GA 2GNQA 4AEZA 2J55H 2OJYA 3SXTD 5CYKB 2Q7QA 4I79A 3JZNA 5GMKn 4ZOVA 3A0FA 3PVWB 1QNIA 4LG8A 5CXCB 3PSCB 2QXVA 4CY1A 4FAND 2H3XA 5AFU3 2P9PC 3IKOA 4J0WA 3RN0D 4D0KA 3SVWD 3B7FA 3JROA 2HKRA 3OTTA 2BCJB 3JPXA 5HE2B 2XYIA 2B4EA 4J77A 4A08A 5EMLB 1SQ9A 3OL2A 2AGYA 4JSVC 3I7OA 4GGDA 4BL0A 1GOTB 5FKTA 4U1EI 4A08B 5A2Qg 3L4OD 3I7KA 4J87A 3ODTA 5FKRA 3IJ1A 3SJLD 2I0RA 4ZOZA 4GMBA 3GFCA 1U4CA 1MDAH 1N6DA 4IMMA 5GXHA 4XYIA 3CFVA 1XHMA 3SCYA 4FHLA 2IAAA 4A7JA 5K1CC 3AL9A 3N0EA 5FA5B 4CI2A 3EI4A 4ZOYA 5FLXg 2PM6B 1NEXB 3SBRA 4JT6C 3AFCA 5AMSA 4CI1A 4PC0A 5FKQA 2EBSA 4GM9A 1A0RB 3NVNA 4KFMB 4UI9R 3C9CA 4QL1A 3VH0A 5THAA 1B9XA 3P4FA 4NSXA 2YB8B 4A11A 5HE0B 4PBZA 2H13A 5C2VB 3I8CA 4PXWA 3I8EA 4ERYA 3J80g 3DXMC 4GQ1A 4GZ8A 4A2MA 3BG0A 3KRXB 3C5MA 2IUVA 2OVQB 2AGLA 5AJAA 3PXWD 1PGUA 3L4MD 4X61B 2HYEA 3V9FA 3IJCA 2AH1A 4J81A 2UZXB 4GGCA 3BG1A 4X63B 2J56H 5HYNB 4K3ID 4K3JB 4FB1D 3OKTA 2YBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6E A;  1PEV A;  2PM7 B;  3ULE C;  4JSP C;  2CNX A;  2PM9 B;  2P9K C;  4O3U B;  3DSM A;  1S4U X;  2B5L A;  4FA9 D;  3MKQ A;  4JSX C;  1SHY B;  5CYK A;  1ERJ A;  1SQJ A;  2H6N A;  1RI6 A;  2IUR A;  3EI1 A;  3K26 A;  4H5I A;  3SFZ A;  3JAM g;  3SN6 B;  2OVP B;  3F3F A;  3FM0 A;  4CI3 A;  3J81 g;  3N0D A;  3C99 A;  3V5W B;  1P22 A;  4FA1 D;  3FGB A;  2YNO A;  2I3S A;  3PVU B;  5H14 A;  3AL8 A;  4A09 B;  1VYH C;  2HJB A;  2XL2 A;  2H14 A;  4LG9 A;  5I5M A;  2TRC B;  5CXC A;  4Z8L A;  4L3H D;  3DM0 A;  3I7P A;  3UVN A;  2P9N C;  4J73 A;  5IJ8 E;  4QRJ A;  1OLZ A;  2P9L C;  2HES X;  3I7N A;  2P9U C;  4G56 B;  3MZK A;  4CZX A;  3RSE C;  4XEI C;  4Y5R D;  5JWZ A;  2H6K A;  3EI2 B;  5EM2 B;  3EWE A;  5C9Z B;  5FKS A;  3UVO A;  2H47 A;  2CO0 A;  2YNP A;  4O45 A;  1FWX A;  5EAL A;  3RRM C;  3AL8 B;  4A09 A;  3PXT D;  2H68 A;  3SBQ A;  1B9Y A;  2B5N A;  3ORV D;  3FRX A;  1PBY B;  1JOF A;  3JZH A;  3AH8 B;  3UKU C;  1TBG A;  3SBP A;  4O9D A;  5EAR A;  5EMM B;  1GP2 B;  2I0S A;  5GXI A;  4R7A B;  5GSA A;  2IWF A;  3IIY A;  3GRE A;  2G9A A;  4BH6 A;  5EMJ B;  4YVD A;  4JXM A;  2AH0 A;  4H5J A;  4D6V A;  1XIP A;  3NVQ A;  2HJ4 A;  2OK4 A;  4PSX B;  3EMH A;  4CY5 A;  2CE9 A;  5SXM A;  4PNK B;  1MG3 A;  4GM3 A;  2O9K A;  4U7A A;  3SLE D;  4OWR A;  4OZU A;  3U4Y A;  5HE1 B;  4PBY A;  5KDO B;  2YMU A;  2MTA H;  3PE7 A;  2CN2 A;  3IIW A;  4CY2 A;  4AOW A;  4J86 A;  3F3G A;  5I5J A;  4E54 A;  5TEF A;  5I5I A;  2UZY B;  2BBK H;  3IJ0 A;  5EAP A;  5CXB A;  4TZ4 A;  4BUJ C;  3JRP A;  4ERZ A;  2GC4 A;  4GQ2 P;  3EG6 A;  2P9S C;  4LGN A;  3DWL C;  2J57 G;  3I2N A;  3I89 A;  1PI6 A;  5EMK B;  3RFH A;  5TDH B;  5K19 A;  5H17 A;  3UVK A;  1TYQ C;  4L3G D;  4EWR A;  1NR0 A;  3JZG A;  3VGZ A;  4IA9 A;  3SHF A;  2Z2O A;  3RFG A;  4QQE A;  1K8K C;  4A0A A;  1JJU B;  3EI3 B;  1Q47 A;  2OIZ A;  1JMZ B;  2AGX A;  2W18 A;  3BWS A;  3HFQ A;  4CI8 A;  4N14 A;  4MK0 B;  2H9M A;  5HE3 B;  3UR4 A;  3W15 A;  2HXC A;  3EI3 A;  5H1M A;  2GC7 A;  2AQ5 A;  3MMY A;  4GGA A;  5IC7 A;  2AGZ A;  3PXS D;  2H9L A;  3EI2 A;  3JB9 L;  4A0B B;  4GQB B;  1L0Q A;  3EI1 B;  2Z2N A;  4QT8 A;  2XU7 A;  2PBI B;  4JSN C;  5IGO A;  3EI4 B;  4J82 A;  2PM9 A;  5TF2 A;  4FA5 D;  4J78 A;  1JMX B;  1MG2 A;  1YFQ A;  2CE8 A;  3CIK B;  4J79 A;  3OKW A;  4E5Z A;  3OW8 A;  5EAM A;  2IUP A;  4GM8 A;  3RLM D;  4J84 A;  1N6F A;  4E54 B;  2P9I C;  3UKR C;  2H6Q A;  4J8B A;  3OL2 B;  3ZWL B;  5TEE A;  4JT5 C;  4L1Q D;  2I3T A;  5IJ7 E;  4ZN4 A;  4ESG A;  3RN1 D;  3E0C A;  3I7L A;  3UVM A;  3F3P A;  2CN3 A;  3VA6 A;  5IT9 g;  4CC9 A;  4E5Z B;  3I7H A;  5B4W A;  4X60 B;  3SWS D;  4ERQ A;  2B5M A;  4JD2 C;  2YNN A;  4CZV A;  3KRW B;  2HKM A;  4HDJ A;  2QC5 A;  2AGW A;  4ES0 A;  5EM2 A;  3OKY B;  2H9N A;  2IWK A;  4O1Q D;  3C75 H;  3MKS B;  2G99 A;  1R5M A;  3MXX A;  3K27 A;  3PSL A;  4FAV D;  1U2V C;  4ZOX A;  3CFS B;  5HQG A;  4A0B A;  5C2W B;  4FWW A;  2CO0 C;  1XKS A;  3OKY A;  3SMR A;  4FA4 D;  4CY3 A;  5FXY A;  4PSW B;  4J0X A;  3UVL A;  3MZL A;  3RMZ D;  4XYH A;  4Y7R A;  2IUQ A;  4A2L A;  3DXK C;  1K32 A;  5CXB B;  2OK6 A;  2XL3 A;  5FQD A;  4L9O A;  2Z2P A;  4A11 B;  2H9P A;  3EU7 A;  1GXR A;  1GG2 B;  4A0A B;  3V7D B;  4CZY A;  2OVR B;  5IGQ A;  2I0T A;  1OMW B;  3NVX A;  4O3T B;  4X3E A;  4J8G A;  2GNQ A;  4AEZ A;  2J55 H;  2OJY A;  3SXT D;  5CYK B;  2Q7Q A;  4I79 A;  3JZN A;  5GMK n;  4ZOV A;  3A0F A;  3PVW B;  1QNI A;  4LG8 A;  5CXC B;  3PSC B;  2QXV A;  4CY1 A;  4FAN D;  2H3X A;  5AFU 3;  2P9P C;  3IKO A;  4J0W A;  3RN0 D;  4D0K A;  3SVW D;  3B7F A;  3JRO A;  2HKR A;  3OTT A;  2BCJ B;  3JPX A;  5HE2 B;  2XYI A;  2B4E A;  4J77 A;  4A08 A;  5EML B;  1SQ9 A;  3OL2 A;  2AGY A;  4JSV C;  3I7O A;  4GGD A;  4BL0 A;  1GOT B;  5FKT A;  4U1E I;  4A08 B;  5A2Q g;  3L4O D;  3I7K A;  4J87 A;  3ODT A;  5FKR A;  3IJ1 A;  3SJL D;  2I0R A;  4ZOZ A;  4GMB A;  3GFC A;  1U4C A;  1MDA H;  1N6D A;  4IMM A;  5GXH A;  4XYI A;  3CFV A;  1XHM A;  3SCY A;  4FHL A;  2IAA A;  4A7J A;  5K1C C;  3AL9 A;  3N0E A;  5FA5 B;  4CI2 A;  3EI4 A;  4ZOY A;  5FLX g;  2PM6 B;  1NEX B;  3SBR A;  4JT6 C;  3AFC A;  5AMS A;  4CI1 A;  4PC0 A;  5FKQ A;  2EBS A;  4GM9 A;  1A0R B;  3NVN A;  4KFM B;  4UI9 R;  3C9C A;  4QL1 A;  3VH0 A;  5THA A;  1B9X A;  3P4F A;  4NSX A;  2YB8 B;  4A11 A;  5HE0 B;  4PBZ A;  2H13 A;  5C2V B;  3I8C A;  4PXW A;  3I8E A;  4ERY A;  3J80 g;  3DXM C;  4GQ1 A;  4GZ8 A;  4A2M A;  3BG0 A;  3KRX B;  3C5M A;  2IUV A;  2OVQ B;  2AGL A;  5AJA A;  3PXW D;  1PGU A;  3L4M D;  4X61 B;  2HYE A;  3V9F A;  3IJC A;  2AH1 A;  4J81 A;  2UZX B;  4GGC A;  3BG1 A;  4X63 B;  2J56 H;  5HYN B;  4K3I D;  4K3J B;  4FB1 D;  3OKT A;  2YBA A; 
#chains in the Genus database with same CATH topology
 1N6E A;  1PEV A;  2PM7 B;  3ULE C;  4JSP C;  3MVD K;  2CNX A;  2PM9 B;  3EQ7 A;  2P9K C;  4O3U B;  3DSM A;  1S4U X;  2B5L A;  4FA9 D;  3MKQ A;  4JSX C;  1SHY B;  5CYK A;  3IUQ A;  1ERJ A;  1SQJ A;  2H6N A;  1RI6 A;  2IUR A;  3EI1 A;  3K26 A;  4H5I A;  3SFZ A;  3JAM g;  2EIE A;  3SN6 B;  2XDW A;  2OVP B;  3F3F A;  3FM0 A;  4CI3 A;  3J81 g;  3VI4 A;  3N0D A;  3C99 A;  3V5W B;  1P22 A;  3K72 A;  4FA1 D;  2QZP A;  3FGB A;  2YNO A;  2I3S A;  3PVU B;  5H14 A;  3AL8 A;  4A09 B;  1C9I A;  1VYH C;  2HJB A;  5FFG A;  2XL2 A;  1VE7 A;  2H14 A;  4LG9 A;  2TRC B;  5I5M A;  4WK2 A;  5CXC A;  4G1M A;  4Z8L A;  4L3H D;  3DM0 A;  3I7P A;  3UVN A;  2P9N C;  4J73 A;  5IJ8 E;  4QRJ A;  1OLZ A;  2P9L C;  2HES X;  3I7N A;  2P9U C;  4G56 B;  3MZK A;  5FFO A;  4CZX A;  3RSE C;  4XEI C;  1UOO A;  4Y5R D;  5JWZ A;  2VDM A;  2H6K A;  3EI2 B;  4BP8 A;  5EM2 B;  3EWE A;  5C9Z B;  5FKS A;  1H2W A;  2H47 A;  3UVO A;  2VDN A;  2CO0 A;  3T3M A;  2YNP A;  4O45 A;  1FWX A;  5EAL A;  3RRM C;  3AL8 B;  4A09 A;  3PXT D;  4WK4 A;  2H68 A;  3SBQ A;  1B9Y A;  3GC3 B;  2B5N A;  3ORV D;  4DNV A;  3FRX A;  1PBY B;  1JOF A;  3JZH A;  4DNU A;  4UM8 A;  3AH8 B;  3UKU C;  1L5G A;  3QI0 A;  1TBG A;  3SBP A;  4O9D A;  5EAR A;  2VDQ A;  5EMM B;  3O4H A;  4G1E A;  1YR2 A;  5HDB A;  1GP2 B;  4QAM A;  1GOG A;  5E6U A;  2I0S A;  5GXI A;  4R7A B;  5GSA A;  2IWF A;  3IIY A;  4NEN A;  3GRE A;  2G9A A;  2VDK A;  4BH6 A;  5EMJ B;  4YVD A;  4JXM A;  2AH0 A;  4H5J A;  4D6V A;  1XIP A;  3NVQ A;  2HJ4 A;  3T3P A;  2OK4 A;  4PSX B;  3EMH A;  4CY5 A;  2CE9 A;  5SXM A;  4PNK B;  1MG3 A;  4GM3 A;  2O9K A;  4U7A A;  3SLE D;  3KCI A;  4Z7O A;  4OWR A;  2VDP A;  4OZU A;  3U4Y A;  5HE1 B;  4PBY A;  4MMX A;  5KDO B;  2YMU A;  2MTA H;  3PE7 A;  2CN2 A;  3IIW A;  3IUM A;  3O4J A;  4CY2 A;  4AOW A;  4J86 A;  3F3G A;  5I5J A;  4E54 A;  4MMY A;  5TEF A;  5I5I A;  2UZY B;  2BBK H;  4NAA A;  5E6R A;  3IJ0 A;  3IUN A;  5EAP A;  4Z7N A;  5CXB A;  4TZ4 A;  3MUO A;  4BUJ C;  3JRP A;  4ERZ A;  2GC4 A;  5M5U A;  4GQ2 P;  1JV2 A;  3EG6 A;  2P9S C;  3IUL A;  4LGN A;  3I2N A;  1VE6 A;  2J57 G;  3DWL C;  3I89 A;  1PI6 A;  5M5T A;  3IVM A;  5EMK B;  1VZ3 A;  3RFH A;  3O4I A;  5TDH B;  5K19 A;  3O4G A;  1T2X A;  1BPO A;  2WQ8 A;  5H17 A;  3UVK A;  1TYQ C;  2VZ3 A;  4L3G D;  2XZG A;  4EWR A;  1NR0 A;  4AN0 A;  3QHY B;  4RE6 A;  3JZG A;  3VGZ A;  1I2M B;  4IA9 A;  3SHF A;  3VI3 A;  2Z2O A;  3RFG A;  4QQE A;  1K8K C;  4A0A A;  1JJU B;  3EI3 B;  1Q47 A;  2OIZ A;  2BKL A;  2EIB A;  1JMZ B;  2AGX A;  2W18 A;  3BWS A;  3HFQ A;  4CI8 A;  4N14 A;  4MK0 B;  2H9M A;  5HE3 B;  3UR4 A;  3W15 A;  2JKX A;  5C92 A;  2HXC A;  3EI3 A;  1M1X A;  5H1M A;  2GC7 A;  1E8M A;  2AQ5 A;  3MMY A;  4GGA A;  5IC7 A;  2AGZ A;  2VDO A;  3PXS D;  2H9L A;  3EI2 A;  3JB9 L;  4JHN A;  4A0B B;  4GQB B;  1L0Q A;  3EI1 B;  2Z2N A;  2EIC A;  4QT8 A;  2XU7 A;  2PBI B;  4JSN C;  5IGO A;  3EI4 B;  4J82 A;  2PM9 A;  5TF2 A;  4FA5 D;  4J78 A;  2VDL A;  3NID A;  1JMX B;  1MG2 A;  1YFQ A;  2CE8 A;  3CIK B;  4J79 A;  3ZE0 A;  3OKW A;  1U8C A;  4E5Z A;  3OW8 A;  5EAM A;  4DNW A;  1UOQ A;  2IUP A;  4GM8 A;  3RLM D;  3IUR A;  4J84 A;  1N6F A;  1UTC A;  4E54 B;  1GOF A;  2P9I C;  3NIF A;  3UKR C;  1H2Y A;  2H6Q A;  4J8B A;  3OL2 B;  4WJK A;  3ZWL B;  5TEE A;  4JT5 C;  4L1Q D;  2I3T A;  5IJ7 E;  4ZN4 A;  4ESG A;  3RN1 D;  3E0C A;  3I7L A;  3GD1 I;  3UVM A;  3F3P A;  2CN3 A;  3VA6 A;  5IT9 g;  1UOP A;  4MMZ A;  4CC9 A;  4E5Z B;  3I7H A;  3MUN A;  5B4W A;  5C86 A;  4X60 B;  3SWS D;  4ERQ A;  2B5M A;  4JD2 C;  2YNN A;  4CZV A;  3KRW B;  4UM9 A;  2HKM A;  4HDJ A;  2QC5 A;  1E8N A;  2AGW A;  4ES0 A;  5EM2 A;  3OKY B;  1O6F A;  2H9N A;  2IWK A;  3C75 H;  4O1Q D;  3MKS B;  2G99 A;  5M61 A;  1R5M A;  4BP9 A;  3MXX A;  3K27 A;  1K3I A;  3PSL A;  4FAV D;  4RE5 A;  1U2V C;  4ZOX A;  3CFS B;  5HQG A;  4A0B A;  5C2W B;  4FWW A;  2CO0 C;  1XKS A;  3OKY A;  3SMR A;  5E6S A;  4FA4 D;  4G55 A;  4CY3 A;  1C9L A;  5FXY A;  4PSW B;  4J0X A;  3UVL A;  3MZL A;  3RMZ D;  4XYH A;  4Y7R A;  2IUQ A;  4A2L A;  3NIG A;  3DXK C;  1K32 A;  5CXB B;  2OK6 A;  2XL3 A;  5FQD A;  4L9O A;  4NBM A;  2Z2P A;  4A11 B;  2HU5 A;  2H9P A;  3EU7 A;  3ZE2 A;  1GXR A;  2VDR A;  1GG2 B;  4A0A B;  3V7D B;  4CZY A;  2OVR B;  5IGQ A;  3OF7 A;  2I0T A;  3EQ9 A;  1OMW B;  1QFS A;  3NVX A;  4O3T B;  2XE4 A;  4X3E A;  4J8G A;  3V4V A;  2GNQ A;  4D9S A;  4AEZ A;  2J55 H;  2OJY A;  3SXT D;  5CYK B;  4WK0 A;  2Q7Q A;  4I79 A;  3JZN A;  3ZDZ A;  4JHP C;  5GMK n;  4ZOV A;  3A0F A;  3PVW B;  1QNI A;  4LG8 A;  5CXC B;  3PSC B;  2QXV A;  4CY1 A;  3V4P A;  4AMZ A;  2H3X A;  4FAN D;  2P9P C;  5AFU 3;  3IKO A;  4J0W A;  3RN0 D;  4D0K A;  3SVW D;  3B7F A;  3JRO A;  2HKR A;  3OTT A;  2BCJ B;  3JPX A;  5HE2 B;  2XYI A;  1GOH A;  2B4E A;  1VZ2 A;  4J77 A;  2QR5 A;  4O2W A;  4A08 A;  2HU7 A;  5EML B;  1QFM A;  1O6G A;  1SQ9 A;  3IUJ A;  3OL2 A;  2AGY A;  4JSV C;  3I7O A;  4GGD A;  4BL0 A;  1GOT B;  5FKT A;  4U1E I;  4A08 B;  5A2Q g;  3L4O D;  3I7K A;  4J87 A;  3ODT A;  5FKR A;  3IJ1 A;  4AX4 A;  3SJL D;  2I0R A;  4ZOZ A;  4GMB A;  3GFC A;  1U4C A;  1JTD B;  1MDA H;  1N6D A;  4BCD A;  4IMM A;  5GXH A;  4XYI A;  4BCB A;  3CFV A;  1XHM A;  3SCY A;  4FHL A;  1H2X A;  1TYE A;  4AN1 A;  3EQ8 A;  3ZDY A;  2IAA A;  4A7J A;  5K1C C;  3AL9 A;  3N0E A;  5FA5 B;  4CI2 A;  3EI4 A;  4ZOY A;  5FLX g;  3K6S A;  2PM6 B;  3ZE1 A;  1NEX B;  3SBR A;  4JT6 C;  3AFC A;  5AMS A;  4CI1 A;  4PC0 A;  5FKQ A;  2EBS A;  4GM9 A;  4O02 A;  5M5S A;  1A0R B;  3NVN A;  3FCU A;  4KFM B;  4UI9 R;  3C9C A;  4QL1 A;  3VH0 A;  5THA A;  2VZ1 A;  1A12 A;  1B9X A;  3P4F A;  4IRZ A;  4NSX A;  2YB8 B;  2HU8 A;  4A11 A;  3DDU A;  5HE0 B;  4PBZ A;  2H13 A;  5C2V B;  3I8C A;  4PXW A;  3I8E A;  3ZDX A;  4ERY A;  3J80 g;  3DXM C;  4GQ1 A;  4GZ8 A;  5M5R A;  4A2M A;  4BCC A;  3BG0 A;  3KRX B;  3C5M A;  1E5T A;  2IUV A;  2EID A;  2OVQ B;  2AGL A;  5AJA A;  4AMY A;  3PXW D;  1PGU A;  3L4M D;  4L1M A;  2VC2 A;  4X61 B;  2HYE A;  3V9F A;  3IJC A;  2AH1 A;  1H2Z A;  4J81 A;  2UZX B;  4GGC A;  3BG1 A;  4X63 B;  3FCS A;  5M5V A;  2J56 H;  4Z7Q A;  5HYN B;  3IJE A;  4NC4 A;  4K3I D;  4K3J B;  4FB1 D;  3K71 A;  3OKT A;  2YBA A; 
#chains in the Genus database with same CATH homology
 1N6E A;  1PEV A;  2PM7 B;  3ULE C;  4JSP C;  2CNX A;  2PM9 B;  2P9K C;  4O3U B;  3DSM A;  1S4U X;  2B5L A;  4FA9 D;  3MKQ A;  4JSX C;  1SHY B;  5CYK A;  1ERJ A;  1SQJ A;  2H6N A;  1RI6 A;  2IUR A;  3EI1 A;  3K26 A;  4H5I A;  3SFZ A;  3JAM g;  3SN6 B;  2OVP B;  3F3F A;  3FM0 A;  4CI3 A;  3J81 g;  3N0D A;  3C99 A;  3V5W B;  1P22 A;  4FA1 D;  3FGB A;  2YNO A;  2I3S A;  3PVU B;  5H14 A;  3AL8 A;  4A09 B;  1VYH C;  2HJB A;  2XL2 A;  2H14 A;  4LG9 A;  5I5M A;  2TRC B;  5CXC A;  4Z8L A;  4L3H D;  3DM0 A;  3I7P A;  3UVN A;  2P9N C;  4J73 A;  5IJ8 E;  4QRJ A;  1OLZ A;  2P9L C;  2HES X;  3I7N A;  2P9U C;  4G56 B;  3MZK A;  4CZX A;  3RSE C;  4XEI C;  4Y5R D;  5JWZ A;  2H6K A;  3EI2 B;  5EM2 B;  3EWE A;  5C9Z B;  5FKS A;  3UVO A;  2H47 A;  2CO0 A;  2YNP A;  4O45 A;  1FWX A;  5EAL A;  3RRM C;  3AL8 B;  4A09 A;  3PXT D;  2H68 A;  3SBQ A;  1B9Y A;  2B5N A;  3ORV D;  3FRX A;  1PBY B;  1JOF A;  3JZH A;  3AH8 B;  3UKU C;  1TBG A;  3SBP A;  4O9D A;  5EAR A;  5EMM B;  1GP2 B;  2I0S A;  5GXI A;  4R7A B;  5GSA A;  2IWF A;  3IIY A;  3GRE A;  2G9A A;  4BH6 A;  5EMJ B;  4YVD A;  4JXM A;  2AH0 A;  4H5J A;  4D6V A;  1XIP A;  3NVQ A;  2HJ4 A;  2OK4 A;  4PSX B;  3EMH A;  4CY5 A;  2CE9 A;  5SXM A;  4PNK B;  1MG3 A;  4GM3 A;  2O9K A;  4U7A A;  3SLE D;  4OWR A;  4OZU A;  3U4Y A;  5HE1 B;  4PBY A;  5KDO B;  2YMU A;  2MTA H;  3PE7 A;  2CN2 A;  3IIW A;  4CY2 A;  4AOW A;  4J86 A;  3F3G A;  5I5J A;  4E54 A;  5TEF A;  5I5I A;  2UZY B;  2BBK H;  3IJ0 A;  5EAP A;  5CXB A;  4TZ4 A;  4BUJ C;  3JRP A;  4ERZ A;  2GC4 A;  4GQ2 P;  3EG6 A;  2P9S C;  4LGN A;  3DWL C;  2J57 G;  3I2N A;  3I89 A;  1PI6 A;  5EMK B;  3RFH A;  5TDH B;  5K19 A;  5H17 A;  3UVK A;  1TYQ C;  4L3G D;  4EWR A;  1NR0 A;  3JZG A;  3VGZ A;  4IA9 A;  3SHF A;  2Z2O A;  3RFG A;  4QQE A;  1K8K C;  4A0A A;  1JJU B;  3EI3 B;  1Q47 A;  2OIZ A;  1JMZ B;  2AGX A;  2W18 A;  3BWS A;  3HFQ A;  4CI8 A;  4N14 A;  4MK0 B;  2H9M A;  5HE3 B;  3UR4 A;  3W15 A;  2HXC A;  3EI3 A;  5H1M A;  2GC7 A;  2AQ5 A;  3MMY A;  4GGA A;  5IC7 A;  2AGZ A;  3PXS D;  2H9L A;  3EI2 A;  3JB9 L;  4A0B B;  4GQB B;  1L0Q A;  3EI1 B;  2Z2N A;  4QT8 A;  2XU7 A;  2PBI B;  4JSN C;  5IGO A;  3EI4 B;  4J82 A;  2PM9 A;  5TF2 A;  4FA5 D;  4J78 A;  1JMX B;  1MG2 A;  1YFQ A;  2CE8 A;  3CIK B;  4J79 A;  3OKW A;  4E5Z A;  3OW8 A;  5EAM A;  2IUP A;  4GM8 A;  3RLM D;  4J84 A;  1N6F A;  4E54 B;  2P9I C;  3UKR C;  2H6Q A;  4J8B A;  3OL2 B;  3ZWL B;  5TEE A;  4JT5 C;  4L1Q D;  2I3T A;  5IJ7 E;  4ZN4 A;  4ESG A;  3RN1 D;  3E0C A;  3I7L A;  3UVM A;  3F3P A;  2CN3 A;  3VA6 A;  5IT9 g;  4CC9 A;  4E5Z B;  3I7H A;  5B4W A;  4X60 B;  3SWS D;  4ERQ A;  2B5M A;  4JD2 C;  2YNN A;  4CZV A;  3KRW B;  2HKM A;  4HDJ A;  2QC5 A;  2AGW A;  4ES0 A;  5EM2 A;  3OKY B;  2H9N A;  2IWK A;  4O1Q D;  3C75 H;  3MKS B;  2G99 A;  1R5M A;  3MXX A;  3K27 A;  3PSL A;  4FAV D;  1U2V C;  4ZOX A;  3CFS B;  5HQG A;  4A0B A;  5C2W B;  4FWW A;  2CO0 C;  1XKS A;  3OKY A;  3SMR A;  4FA4 D;  4CY3 A;  5FXY A;  4PSW B;  4J0X A;  3UVL A;  3MZL A;  3RMZ D;  4XYH A;  4Y7R A;  2IUQ A;  4A2L A;  3DXK C;  1K32 A;  5CXB B;  2OK6 A;  2XL3 A;  5FQD A;  4L9O A;  2Z2P A;  4A11 B;  2H9P A;  3EU7 A;  1GXR A;  1GG2 B;  4A0A B;  3V7D B;  4CZY A;  2OVR B;  5IGQ A;  2I0T A;  1OMW B;  3NVX A;  4O3T B;  4X3E A;  4J8G A;  2GNQ A;  4AEZ A;  2J55 H;  2OJY A;  3SXT D;  5CYK B;  2Q7Q A;  4I79 A;  3JZN A;  5GMK n;  4ZOV A;  3A0F A;  3PVW B;  1QNI A;  4LG8 A;  5CXC B;  3PSC B;  2QXV A;  4CY1 A;  4FAN D;  2H3X A;  5AFU 3;  2P9P C;  3IKO A;  4J0W A;  3RN0 D;  4D0K A;  3SVW D;  3B7F A;  3JRO A;  2HKR A;  3OTT A;  2BCJ B;  3JPX A;  5HE2 B;  2XYI A;  2B4E A;  4J77 A;  4A08 A;  5EML B;  1SQ9 A;  3OL2 A;  2AGY A;  4JSV C;  3I7O A;  4GGD A;  4BL0 A;  1GOT B;  5FKT A;  4U1E I;  4A08 B;  5A2Q g;  3L4O D;  3I7K A;  4J87 A;  3ODT A;  5FKR A;  3IJ1 A;  3SJL D;  2I0R A;  4ZOZ A;  4GMB A;  3GFC A;  1U4C A;  1MDA H;  1N6D A;  4IMM A;  5GXH A;  4XYI A;  3CFV A;  1XHM A;  3SCY A;  4FHL A;  2IAA A;  4A7J A;  5K1C C;  3AL9 A;  3N0E A;  5FA5 B;  4CI2 A;  3EI4 A;  4ZOY A;  5FLX g;  2PM6 B;  1NEX B;  3SBR A;  4JT6 C;  3AFC A;  5AMS A;  4CI1 A;  4PC0 A;  5FKQ A;  2EBS A;  4GM9 A;  1A0R B;  3NVN A;  4KFM B;  4UI9 R;  3C9C A;  4QL1 A;  3VH0 A;  5THA A;  1B9X A;  3P4F A;  4NSX A;  2YB8 B;  4A11 A;  5HE0 B;  4PBZ A;  2H13 A;  5C2V B;  3I8C A;  4PXW A;  3I8E A;  4ERY A;  3J80 g;  3DXM C;  4GQ1 A;  4GZ8 A;  4A2M A;  3BG0 A;  3KRX B;  3C5M A;  2IUV A;  2OVQ B;  2AGL A;  5AJA A;  3PXW D;  1PGU A;  3L4M D;  4X61 B;  2HYE A;  3V9F A;  3IJC A;  2AH1 A;  4J81 A;  2UZX B;  4GGC A;  3BG1 A;  4X63 B;  2J56 H;  5HYN B;  4K3I D;  4K3J B;  4FB1 D;  3OKT A;  2YBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...