1XKSA

The crystal structure of the n-terminal domain of nup133 reveals a beta-propeller fold common to several nucleoporins
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
403
structure length
374
Chain Sequence
b'ESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSTQAVAVMVATREGSIRYWPSLAGEDTYTEAFVDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHILPQGQGMSDLTLSSVLWDRERSSFYSLTSSNISKWELDDSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWHSADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLYNESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup133
molecule tags Protein transport
source organism Homo sapiens
publication title Structural and functional analysis of Nup133 domains reveals modular building blocks of the nuclear pore complex.
pubmed doi rcsb
total genus 87
structure length 374
sequence length 403
ec nomenclature
pdb deposition date 2004-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1xksA00
5H14A 5EM2B 1N6FA 1SQ9A 2B5LA 3SXTD 1JJUB 3EMHA 4I79A 3EG6A 3MKQA 3I7NA 3UVMA 5I5JA 3PSLA 5AFU3 4N14A 1OMWB 4GGAA 3OW8A 4GM8A 4FA9D 2H9LA 3DXMC 2HYEA 4OWRA 3W15A 4J87A 2IWFA 4CI2A 3EI1B 4CZYA 3FRXA 2B5NA 4U1EI 4CY1A 2PM9A 3DM0A 3MMYA 3AL8B 4X3EA 5FKSA 3KRXB 5FKRA 2P9UC 4JXMA 3RN1D 1QNIA 2IAAA 5EMMB 4Z8LA 5CXCB 5EMJB 4PXWA 2XU7A 2MTAH 4TZ4A 5FKTA 2CN3A 2HJBA 3UVNA 4J8BA 4CY5A 4FHLA 4CC9A 2P9IC 2GNQA 3ORVD 4E54A 2I0RA 3MXXA 5HE0B 4A11A 4FA5D 5CXBB 5A2Qg 3SVWD 2B4EA 3F3FA 3OTTA 2TRCB 3SJLD 2AQ5A 3I7KA 3DXKC 5IJ8E 5C9ZB 4L1QD 1MG3A 3U4YA 2HJ4A 3SBPA 3EI2A 3I7LA 1SHYB 3PE7A 4PNKB 3DWLC 4JSXC 5HE3B 5TEFA 5I5IA 3PVWB 1N6EA 3JPXA 3UKUC 2CO0A 5EM2A 3PVUB 3JZGA 4ZOXA 1ERJA 4ZOVA 5SXMA 3SN6B 1N6DA 4LG9A 4BL0A 4AEZA 3I7HA 2B5MA 2CE9A 5K1CC 4X63B 3UVKA 5GMKn 4YVDA 3CFVA 4J77A 5B4WA 3UKRC 2CE8A 3BG1A 4PBZA 3BWSA 3MZLA 3AFCA 1GP2B 2PM9B 4J81A 3E0CA 4U7AA 4GM3A 5JWZA 5THAA 4BUJC 3PXWD 1JMZB 2YNNA 3I7OA 2H47A 4IMMA 4GMBA 4Y5RD 2OVQB 4A09B 5IC7A 3JZNA 4GM9A 4ESGA 3JROA 3JRPA 3FM0A 4A09A 2YBAA 4FWWA 2H9MA 4O1QD 2PM7B 2CO0C 2GC7A 4AOWA 3K27A 4X61B 1PI6A 3EU7A 3MKSB 4CI8A 2HESX 5K19A 4L3HD 2PBIB 4L9OA 3RLMD 1TYQC 3J80g 3IJ0A 4CY2A 2H13A 4QT8A 4FB1D 1R5MA 3KRWB 4ERQA 5FA5B 3P4FA 5TEEA 3AL9A 4JSPC 4E5ZB 4O3UB 4UI9R 3SBRA 4KFMB 3SWSD 4CZVA 2H6KA 4J0XA 4MK0B 2OVRB 3RSEC 2IURA 3EI4A 3IJ1A 4GGCA 2H9PA 3IIYA 5I5MA 2AGZA 3AL8A 4ZOZA 5FXYA 5AMSA 4A08A 3RFHA 4O45A 5H1MA 2QC5A 3EI3A 4ERZA 1XHMA 2XL2A 2O9KA 2BCJB 3L4OD 5EAPA 2OIZA 4X60B 5EAMA 4O9DA 5HE1B 2J55H 4CI3A 5FKQA 4LGNA 3SBQA 3K26A 5TDHB 4A2LA 1GXRA 4A7JA 2QXVA 3I89A 4CZXA 2P9SC 3I8EA 3OKTA 3EI1A 4A0AB 3PSCB 4O3TB 4E5ZA 3SCYA 2CNXA 2OK4A 3NVQA 4LG8A 2H6QA 1Q47A 2IUVA 1PEVA 2J56H 4J84A 3BG0A 4HDJA 2BBKH 2W18A 4JD2C 1FWXA 2IUQA 3EI4B 3JZHA 1L0QA 3SLED 4FA4D 3RN0D 1B9YA 1VYHC 4IA9A 4JSNC 4A11B 3L4MD 2P9LC 3PXSD 4PSXB 2G99A 3RRMC 1TBGA 3GREA 1B9XA 4A0AA 3ZWLB 3JB9L 3OL2B 4OZUA 1GOTB 4A0BB 4A2MA 4JSVC 5HQGA 5CXBA 2AGYA 3N0DA 4PBYA 4GGDA 5CXCA 3JAMg 3GFCA 2AGXA 2HKRA 2OJYA 3NVNA 1GG2B 4ES0A 4EWRA 4XYIA 2YB8B 5H17A 4CI1A 4J86A 4ERYA 3EI2B 1RI6A 3A0FA 2XL3A 2H68A 2J57G 5EALA 2I0SA 4J79A 2IUPA 4ZOYA 5CYKB 3VH0A 5EMKB 3V9FA 5EMLB 3RFGA 3HFQA 4J8GA 4NSXA 2YMUA 4GQBB 4J78A 1K8KC 1MDAH 3V5WB 1XIPA 3UR4A 4FAND 2AH1A 4L3GD 3OKYB 4R7AB 3OL2A 3C9CA 4A08B 4GZ8A 4A0BA 5CYKA 5HE2B 2P9KC 4FA1D 2UZYB 2YNPA 4QL1A 2P9PC 4GQ1A 1NEXB 3C99A 4JT6C 2HKMA 4GQ2P 1XKSA 2Z2PA 5IT9g 4BH6A 4CY3A 4E54B 5GSAA 1MG2A 4QQEA 2EBSA 2AGWA 2P9NC 4JT5C 5EARA 2H6NA 3SFZA 3N0EA 3OKYA 4ZN4A 1U2VC 4J82A 2OVPB 5GXIA 3MZKA 5AJAA 3IIWA 3VGZA 5FQDA 3I2NA 3UVLA 3DSMA 3UVOA 5KDOB 1U4CA 3B7FA 5C2WB 1A0RB 1OLZA 1JMXB 3CFSB 4Y7RA 2UZXB 3IJCA 2CN2A 3C75H 4K3JB 3PXTD 3RMZD 3IKOA 5IGQA 2Q7QA 4PSWB 4D0KA 3C5MA 5GXHA 2HXCA 4H5IA 3FGBA 2I3TA 1PGUA 2I3SA 3OKWA 1PBYB 2H3XA 1YFQA 2AH0A 1JOFA 2H14A 4PC0A 2AGLA 2XYIA 3EI3B 5IGOA 4D6VA 4J73A 2OK6A 4K3ID 1S4UX 2I0TA 4H5JA 1P22A 3EWEA 3I8CA 2Z2NA 2G9AA 4XYHA 3ULEC 1SQJA 1K32A 3V7DB 4FAVD 4G56B 3VA6A 3SHFA 5HYNB 2Z2OA 4QRJA 3CIKB 5C2VB 5TF2A 2GC4A 3AH8B 3J81g 5IJ7E 2PM6B 5FLXg 4XEIC 3SMRA 3F3GA 3ODTA 3I7PA 4J0WA 2H9NA 3F3PA 2IWKA 1NR0A 2YNOA 3NVXA
chains in the Genus database with same CATH superfamily
5H14A 5EM2B 1N6FA 2XE4A 1SQ9A 2B5LA 1JTDB 3SXTD 1JJUB 3O4JA 3EMHA 4I79A 3EG6A 3MKQA 1T2XA 3I7NA 2XDWA 5I5JA 3UVMA 3PSLA 5AFU3 4N14A 1OMWB 4GGAA 3OW8A 4GM8A 4FA9D 2H9LA 3DXMC 2HYEA 4OWRA 3W15A 4J87A 2IWFA 1O6FA 3VI3A 4CI2A 3EI1B 4CZYA 3FRXA 2B5NA 3KCIA 4U1EI 4CY1A 2PM9A 1JV2A 3DM0A 3MMYA 3AL8B 1O6GA 4X3EA 3O4IA 5FKSA 3KRXB 3EQ7A 5FKRA 2P9UC 4JXMA 3V4VA 3RN1D 1E8NA 1QNIA 2IAAA 4O02A 5EMMB 4Z8LA 3O4GA 5CXCB 1QFSA 5EMJB 4PXWA 2XU7A 4DNWA 4QAMA 1QFMA 2MTAH 4TZ4A 5FKTA 4G55A 2CN3A 2HJBA 3UVNA 4J8BA 4CY5A 4FHLA 4CC9A 2P9IC 2GNQA 3ORVD 2VDNA 4E54A 1UOPA 2I0RA 3MXXA 5HE0B 4A11A 4FA5D 5CXBB 5A2Qg 3SVWD 2B4EA 3F3FA 3OTTA 2TRCB 3SJLD 1H2YA 2AQ5A 3I7KA 3MUOA 3DXKC 5IJ8E 5C9ZB 4L1QD 1MG3A 3O4HA 3U4YA 2HJ4A 3SBPA 3EI2A 5C86A 3I7LA 1SHYB 3PE7A 3IULA 4PNKB 3DWLC 4JSXC 5HE3B 5C92A 5TEFA 5I5IA 2VDMA 3PVWB 1N6EA 4WK2A 3JPXA 3UKUC 2CO0A 5EM2A 3PVUB 3JZGA 5M5RA 1E8MA 4ZOXA 1ERJA 4ZOVA 5SXMA 3SN6B 1N6DA 3GC3B 3IUMA 4LG9A 3FCSA 4BL0A 4AEZA 2VDOA 3I7HA 3T3PA 2B5MA 2CE9A 5K1CC 4X63B 3UVKA 5GMKn 4YVDA 3CFVA 4J77A 4NENA 5B4WA 3UKRC 2VZ3A 1TYEA 2CE8A 4O2WA 3BG1A 4PBZA 3BWSA 3MZLA 3AFCA 3K72A 2EIBA 1GP2B 2PM9B 4J81A 3E0CA 4U7AA 4GM3A 5JWZA 5THAA 4BUJC 3PXWD 1BPOA 1JMZB 2YNNA 3I7OA 2H47A 1K3IA 1H2XA 4IMMA 4GMBA 4RE5A 3DDUA 4IRZA 4Y5RD 2OVQB 4A09B 5IC7A 4L1MA 3ZDZA 3JZNA 4GM9A 4ESGA 3JROA 3JRPA 3FM0A 4A09A 2YBAA 4FWWA 2H9MA 4WJKA 3IUNA 4O1QD 5M5TA 2PM7B 2CO0C 2GC7A 4AOWA 3K27A 4X61B 1PI6A 3EU7A 3MKSB 4CI8A 2HESX 5K19A 4L3HD 1UOQA 2PBIB 3NIDA 4L9OA 3RLMD 5M5UA 1TYQC 3J80g 2BKLA 1VZ3A 3IJ0A 4CY2A 2H13A 4QT8A 4FB1D 1R5MA 3KRWB 4ERQA 3QHYB 5FA5B 2HU5A 3P4FA 5TEEA 3AL9A 4JSPC 4E5ZB 4O3UB 4UI9R 4D9SA 3SBRA 4KFMB 3SWSD 4CZVA 2H6KA 4J0XA 4MK0B 2OVRB 3RSEC 2IURA 3EI4A 3IJ1A 4GGCA 2H9PA 3IIYA 5I5MA 2AGZA 2WQ8A 3AL8A 4ZOZA 5FXYA 5AMSA 4A08A 3RFHA 5M61A 4O45A 5H1MA 2JKXA 2QC5A 3EI3A 1VE6A 4ERZA 1XHMA 4JHNA 2XL2A 1YR2A 2O9KA 1UTCA 2BCJB 3L4OD 5EAPA 2OIZA 4X60B 5EAMA 4O9DA 5HE1B 2J55H 3OF7A 4CI3A 5FKQA 4LGNA 3SBQA 1U8CA 3K26A 5TDHB 1L5GA 4A2LA 3K6SA 1GXRA 4A7JA 3ZE1A 2QXVA 4BCCA 3I89A 3NIGA 4CZXA 2P9SC 3I8EA 3QI0A 5FFGA 3OKTA 3VI4A 3EI1A 4A0AB 3PSCB 4O3TB 4E5ZA 3SCYA 2CNXA 5E6RA 2OK4A 3NVQA 5E6UA 2H6QA 1Q47A 2IUVA 2J56H 1PEVA 4J84A 4LG8A 3BG0A 4HDJA 2BBKH 2W18A 4JD2C 1FWXA 4DNVA 2IUQA 5E6SA 3EI4B 3JZHA 1L0QA 3SLED 4FA4D 3RN0D 1B9YA 3EQ8A 1VYHC 4IA9A 2VDKA 4JSNC 4A11B 3L4MD 2P9LC 3PXSD 4NBMA 4PSXB 1GOHA 2G99A 3RRMC 2VDRA 1TBGA 3GREA 1B9XA 4A0AA 4G1EA 3ZWLB 3JB9L 3OL2B 4OZUA 4Z7NA 1GOTB 3IUJA 4A0BB 3ZE0A 4JSVC 4A2MA 5HQGA 5CXBA 2AGYA 3N0DA 1E5TA 4PBYA 4GGDA 5CXCA 3JAMg 2QZPA 2AGXA 3GFCA 2OJYA 3IVMA 2HKRA 3NVNA 4Z7OA 1GG2B 4ES0A 3K71A 4EWRA 1GOFA 4XYIA 2YB8B 5H17A 4CI1A 4J86A 4BP8A 4ERYA 3EI2B 1RI6A 3A0FA 2XL3A 2H68A 2J57G 5EALA 2I0SA 4J79A 5M5VA 4UM8A 2IUPA 4ZOYA 5M5SA 2HU8A 5CYKB 3VH0A 5EMKB 3V9FA 5EMLB 3RFGA 3HFQA 4J8GA 4NSXA 2YMUA 4GQBB 4J78A 3FCUA 1K8KC 4MMYA 2EICA 1MDAH 3V5WB 1XIPA 3UR4A 4FAND 4AMYA 2AH1A 4L3GD 3OKYB 4R7AB 3OL2A 3C9CA 4A08B 4GZ8A 4A0BA 5HDBA 5CYKA 5HE2B 2P9KC 1UOOA 2UZYB 4FA1D 2YNPA 3T3MA 4AN1A 4BCDA 4QL1A 2P9PC 4GQ1A 1H2WA 1NEXB 3C99A 3EQ9A 4JT6C 4MMXA 2HKMA 4GQ2P 3MVDK 1XKSA 2Z2PA 4MMZA 5IT9g 4AMZA 4BH6A 4CY3A 3MUNA 4E54B 5GSAA 3NIFA 1MG2A 1GOGA 4QQEA 2EBSA 2AGWA 2P9NC 4JT5C 5EARA 2H6NA 3SFZA 3ZE2A 1C9LA 2EIDA 3N0EA 3OKYA 4ZN4A 1U2VC 4J82A 2OVPB 5GXIA 3MZKA 5AJAA 3IJEA 3IIWA 3VGZA 5FQDA 3I2NA 3UVLA 3DSMA 4WK0A 3UVOA 5KDOB 1U4CA 3B7FA 5C2WB 2QR5A 1A0RB 1OLZA 3IUQA 1JMXB 3CFSB 3IURA 4RE6A 4Y7RA 2VDPA 3ZDXA 2UZXB 3ZDYA 3IJCA 2CN2A 3C75H 4K3JB 3PXTD 3RMZD 3IKOA 5IGQA 2Q7QA 4PSWB 1VE7A 1M1XA 4NC4A 4JHPC 4D0KA 3C5MA 5GXHA 2VC2A 2VDLA 2HXCA 4H5IA 3FGBA 1A12A 2VDQA 2I3TA 1PGUA 2I3SA 3OKWA 1PBYB 2H3XA 1VZ2A 4NAAA 5FFOA 1YFQA 4BP9A 2AH0A 1JOFA 2H14A 4PC0A 2AGLA 4BCBA 2XYIA 3EI3B 5IGOA 4D6VA 4J73A 2OK6A 4K3ID 1S4UX 2VZ1A 1C9IA 2I0TA 3GD1I 4H5JA 4Z7QA 4WK4A 1P22A 3EWEA 3I8CA 2XZGA 2G9AA 2Z2NA 4XYHA 1SQJA 2HU7A 3ULEC 1K32A 3V7DB 4FAVD 4G56B 3VA6A 3SHFA 4AX4A 1I2MB 5HYNB 4AN0A 4UM9A 2Z2OA 4G1MA 4QRJA 3CIKB 5C2VB 2EIEA 5TF2A 2GC4A 3AH8B 3J81g 5IJ7E 2PM6B 5FLXg 4XEIC 3SMRA 3F3GA 3ODTA 3I7PA 4J0WA 4DNUA 1H2ZA 2H9NA 3F3PA 2IWKA 1NR0A 3V4PA 2YNOA 3NVXA
chains in the Genus database with same CATH topology
5H14A 5EM2B 1N6FA 1SQ9A 2B5LA 3SXTD 1JJUB 3EMHA 4I79A 3EG6A 3MKQA 3I7NA 3UVMA 5I5JA 3PSLA 5AFU3 4N14A 1OMWB 4GGAA 3OW8A 4GM8A 4FA9D 2H9LA 3DXMC 2HYEA 4OWRA 3W15A 4J87A 2IWFA 4CI2A 3EI1B 4CZYA 3FRXA 2B5NA 4U1EI 4CY1A 2PM9A 3DM0A 3MMYA 3AL8B 4X3EA 5FKSA 3KRXB 5FKRA 2P9UC 4JXMA 3RN1D 1QNIA 2IAAA 5EMMB 4Z8LA 5CXCB 5EMJB 4PXWA 2XU7A 2MTAH 4TZ4A 5FKTA 2CN3A 2HJBA 3UVNA 4J8BA 4CY5A 4FHLA 4CC9A 2P9IC 2GNQA 3ORVD 4E54A 2I0RA 3MXXA 5HE0B 4A11A 4FA5D 5CXBB 5A2Qg 3SVWD 2B4EA 3F3FA 3OTTA 2TRCB 3SJLD 2AQ5A 3I7KA 3DXKC 5IJ8E 5C9ZB 4L1QD 1MG3A 3U4YA 2HJ4A 3SBPA 3EI2A 3I7LA 1SHYB 3PE7A 4PNKB 3DWLC 4JSXC 5HE3B 5TEFA 5I5IA 3PVWB 1N6EA 3JPXA 3UKUC 2CO0A 5EM2A 3PVUB 3JZGA 4ZOXA 1ERJA 4ZOVA 5SXMA 3SN6B 1N6DA 4LG9A 4BL0A 4AEZA 3I7HA 2B5MA 2CE9A 5K1CC 4X63B 3UVKA 5GMKn 4YVDA 3CFVA 4J77A 5B4WA 3UKRC 2CE8A 3BG1A 4PBZA 3BWSA 3MZLA 3AFCA 1GP2B 2PM9B 4J81A 3E0CA 4U7AA 4GM3A 5JWZA 5THAA 4BUJC 3PXWD 1JMZB 2YNNA 3I7OA 2H47A 4IMMA 4GMBA 4Y5RD 2OVQB 4A09B 5IC7A 3JZNA 4GM9A 4ESGA 3JROA 3JRPA 3FM0A 4A09A 2YBAA 4FWWA 2H9MA 4O1QD 2PM7B 2CO0C 2GC7A 4AOWA 3K27A 4X61B 1PI6A 3EU7A 3MKSB 4CI8A 2HESX 5K19A 4L3HD 2PBIB 4L9OA 3RLMD 1TYQC 3J80g 3IJ0A 4CY2A 2H13A 4QT8A 4FB1D 1R5MA 3KRWB 4ERQA 5FA5B 3P4FA 5TEEA 3AL9A 4JSPC 4E5ZB 4O3UB 4UI9R 3SBRA 4KFMB 3SWSD 4CZVA 2H6KA 4J0XA 4MK0B 2OVRB 3RSEC 2IURA 3EI4A 3IJ1A 4GGCA 2H9PA 3IIYA 5I5MA 2AGZA 3AL8A 4ZOZA 5FXYA 5AMSA 4A08A 3RFHA 4O45A 5H1MA 2QC5A 3EI3A 4ERZA 1XHMA 2XL2A 2O9KA 2BCJB 3L4OD 5EAPA 2OIZA 4X60B 5EAMA 4O9DA 5HE1B 2J55H 4CI3A 5FKQA 4LGNA 3SBQA 3K26A 5TDHB 4A2LA 1GXRA 4A7JA 2QXVA 3I89A 4CZXA 2P9SC 3I8EA 3OKTA 3EI1A 4A0AB 3PSCB 4O3TB 4E5ZA 3SCYA 2CNXA 2OK4A 3NVQA 4LG8A 2H6QA 1Q47A 2IUVA 1PEVA 2J56H 4J84A 3BG0A 4HDJA 2BBKH 2W18A 4JD2C 1FWXA 2IUQA 3EI4B 3JZHA 1L0QA 3SLED 4FA4D 3RN0D 1B9YA 1VYHC 4IA9A 4JSNC 4A11B 3L4MD 2P9LC 3PXSD 4PSXB 2G99A 3RRMC 1TBGA 3GREA 1B9XA 4A0AA 3ZWLB 3JB9L 3OL2B 4OZUA 1GOTB 4A0BB 4A2MA 4JSVC 5HQGA 5CXBA 2AGYA 3N0DA 4PBYA 4GGDA 5CXCA 3JAMg 3GFCA 2AGXA 2HKRA 2OJYA 3NVNA 1GG2B 4ES0A 4EWRA 4XYIA 2YB8B 5H17A 4CI1A 4J86A 4ERYA 3EI2B 1RI6A 3A0FA 2XL3A 2H68A 2J57G 5EALA 2I0SA 4J79A 2IUPA 4ZOYA 5CYKB 3VH0A 5EMKB 3V9FA 5EMLB 3RFGA 3HFQA 4J8GA 4NSXA 2YMUA 4GQBB 4J78A 1K8KC 1MDAH 3V5WB 1XIPA 3UR4A 4FAND 2AH1A 4L3GD 3OKYB 4R7AB 3OL2A 3C9CA 4A08B 4GZ8A 4A0BA 5CYKA 5HE2B 2P9KC 4FA1D 2UZYB 2YNPA 4QL1A 2P9PC 4GQ1A 1NEXB 3C99A 4JT6C 2HKMA 4GQ2P 1XKSA 2Z2PA 5IT9g 4BH6A 4CY3A 4E54B 5GSAA 1MG2A 4QQEA 2EBSA 2AGWA 2P9NC 4JT5C 5EARA 2H6NA 3SFZA 3N0EA 3OKYA 4ZN4A 1U2VC 4J82A 2OVPB 5GXIA 3MZKA 5AJAA 3IIWA 3VGZA 5FQDA 3I2NA 3UVLA 3DSMA 3UVOA 5KDOB 1U4CA 3B7FA 5C2WB 1A0RB 1OLZA 1JMXB 3CFSB 4Y7RA 2UZXB 3IJCA 2CN2A 3C75H 4K3JB 3PXTD 3RMZD 3IKOA 5IGQA 2Q7QA 4PSWB 4D0KA 3C5MA 5GXHA 2HXCA 4H5IA 3FGBA 2I3TA 1PGUA 2I3SA 3OKWA 1PBYB 2H3XA 1YFQA 2AH0A 1JOFA 2H14A 4PC0A 2AGLA 2XYIA 3EI3B 5IGOA 4D6VA 4J73A 2OK6A 4K3ID 1S4UX 2I0TA 4H5JA 1P22A 3EWEA 3I8CA 2Z2NA 2G9AA 4XYHA 3ULEC 1SQJA 1K32A 3V7DB 4FAVD 4G56B 3VA6A 3SHFA 5HYNB 2Z2OA 4QRJA 3CIKB 5C2VB 5TF2A 2GC4A 3AH8B 3J81g 5IJ7E 2PM6B 5FLXg 4XEIC 3SMRA 3F3GA 3ODTA 3I7PA 4J0WA 2H9NA 3F3PA 2IWKA 1NR0A 2YNOA 3NVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H14 A;  5EM2 B;  1N6F A;  1SQ9 A;  2B5L A;  3SXT D;  1JJU B;  3EMH A;  4I79 A;  3EG6 A;  3MKQ A;  3I7N A;  3UVM A;  5I5J A;  3PSL A;  5AFU 3;  4N14 A;  1OMW B;  4GGA A;  3OW8 A;  4GM8 A;  4FA9 D;  2H9L A;  3DXM C;  2HYE A;  4OWR A;  3W15 A;  4J87 A;  2IWF A;  4CI2 A;  3EI1 B;  4CZY A;  3FRX A;  2B5N A;  4U1E I;  4CY1 A;  2PM9 A;  3DM0 A;  3MMY A;  3AL8 B;  4X3E A;  5FKS A;  3KRX B;  5FKR A;  2P9U C;  4JXM A;  3RN1 D;  1QNI A;  2IAA A;  5EMM B;  4Z8L A;  5CXC B;  5EMJ B;  4PXW A;  2XU7 A;  2MTA H;  4TZ4 A;  5FKT A;  2CN3 A;  2HJB A;  3UVN A;  4J8B A;  4CY5 A;  4FHL A;  4CC9 A;  2P9I C;  2GNQ A;  3ORV D;  4E54 A;  2I0R A;  3MXX A;  5HE0 B;  4A11 A;  4FA5 D;  5CXB B;  5A2Q g;  3SVW D;  2B4E A;  3F3F A;  3OTT A;  2TRC B;  3SJL D;  2AQ5 A;  3I7K A;  3DXK C;  5IJ8 E;  5C9Z B;  4L1Q D;  1MG3 A;  3U4Y A;  2HJ4 A;  3SBP A;  3EI2 A;  3I7L A;  1SHY B;  3PE7 A;  4PNK B;  3DWL C;  4JSX C;  5HE3 B;  5TEF A;  5I5I A;  3PVW B;  1N6E A;  3JPX A;  3UKU C;  2CO0 A;  5EM2 A;  3PVU B;  3JZG A;  4ZOX A;  1ERJ A;  4ZOV A;  5SXM A;  3SN6 B;  1N6D A;  4LG9 A;  4BL0 A;  4AEZ A;  3I7H A;  2B5M A;  2CE9 A;  5K1C C;  4X63 B;  3UVK A;  5GMK n;  4YVD A;  3CFV A;  4J77 A;  5B4W A;  3UKR C;  2CE8 A;  3BG1 A;  4PBZ A;  3BWS A;  3MZL A;  3AFC A;  1GP2 B;  2PM9 B;  4J81 A;  3E0C A;  4U7A A;  4GM3 A;  5JWZ A;  5THA A;  4BUJ C;  3PXW D;  1JMZ B;  2YNN A;  3I7O A;  2H47 A;  4IMM A;  4GMB A;  4Y5R D;  2OVQ B;  4A09 B;  5IC7 A;  3JZN A;  4GM9 A;  4ESG A;  3JRO A;  3JRP A;  3FM0 A;  4A09 A;  2YBA A;  4FWW A;  2H9M A;  4O1Q D;  2PM7 B;  2CO0 C;  2GC7 A;  4AOW A;  3K27 A;  4X61 B;  1PI6 A;  3EU7 A;  3MKS B;  4CI8 A;  2HES X;  5K19 A;  4L3H D;  2PBI B;  4L9O A;  3RLM D;  1TYQ C;  3J80 g;  3IJ0 A;  4CY2 A;  2H13 A;  4QT8 A;  4FB1 D;  1R5M A;  3KRW B;  4ERQ A;  5FA5 B;  3P4F A;  5TEE A;  3AL9 A;  4JSP C;  4E5Z B;  4O3U B;  4UI9 R;  3SBR A;  4KFM B;  3SWS D;  4CZV A;  2H6K A;  4J0X A;  4MK0 B;  2OVR B;  3RSE C;  2IUR A;  3EI4 A;  3IJ1 A;  4GGC A;  2H9P A;  3IIY A;  5I5M A;  2AGZ A;  3AL8 A;  4ZOZ A;  5FXY A;  5AMS A;  4A08 A;  3RFH A;  4O45 A;  5H1M A;  2QC5 A;  3EI3 A;  4ERZ A;  1XHM A;  2XL2 A;  2O9K A;  2BCJ B;  3L4O D;  5EAP A;  2OIZ A;  4X60 B;  5EAM A;  4O9D A;  5HE1 B;  2J55 H;  4CI3 A;  5FKQ A;  4LGN A;  3SBQ A;  3K26 A;  5TDH B;  4A2L A;  1GXR A;  4A7J A;  2QXV A;  3I89 A;  4CZX A;  2P9S C;  3I8E A;  3OKT A;  3EI1 A;  4A0A B;  3PSC B;  4O3T B;  4E5Z A;  3SCY A;  2CNX A;  2OK4 A;  3NVQ A;  4LG8 A;  2H6Q A;  1Q47 A;  2IUV A;  1PEV A;  2J56 H;  4J84 A;  3BG0 A;  4HDJ A;  2BBK H;  2W18 A;  4JD2 C;  1FWX A;  2IUQ A;  3EI4 B;  3JZH A;  1L0Q A;  3SLE D;  4FA4 D;  3RN0 D;  1B9Y A;  1VYH C;  4IA9 A;  4JSN C;  4A11 B;  3L4M D;  2P9L C;  3PXS D;  4PSX B;  2G99 A;  3RRM C;  1TBG A;  3GRE A;  1B9X A;  4A0A A;  3ZWL B;  3JB9 L;  3OL2 B;  4OZU A;  1GOT B;  4A0B B;  4A2M A;  4JSV C;  5HQG A;  5CXB A;  2AGY A;  3N0D A;  4PBY A;  4GGD A;  5CXC A;  3JAM g;  3GFC A;  2AGX A;  2HKR A;  2OJY A;  3NVN A;  1GG2 B;  4ES0 A;  4EWR A;  4XYI A;  2YB8 B;  5H17 A;  4CI1 A;  4J86 A;  4ERY A;  3EI2 B;  1RI6 A;  3A0F A;  2XL3 A;  2H68 A;  2J57 G;  5EAL A;  2I0S A;  4J79 A;  2IUP A;  4ZOY A;  5CYK B;  3VH0 A;  5EMK B;  3V9F A;  5EML B;  3RFG A;  3HFQ A;  4J8G A;  4NSX A;  2YMU A;  4GQB B;  4J78 A;  1K8K C;  1MDA H;  3V5W B;  1XIP A;  3UR4 A;  4FAN D;  2AH1 A;  4L3G D;  3OKY B;  4R7A B;  3OL2 A;  3C9C A;  4A08 B;  4GZ8 A;  4A0B A;  5CYK A;  5HE2 B;  2P9K C;  4FA1 D;  2UZY B;  2YNP A;  4QL1 A;  2P9P C;  4GQ1 A;  1NEX B;  3C99 A;  4JT6 C;  2HKM A;  4GQ2 P;  1XKS A;  2Z2P A;  5IT9 g;  4BH6 A;  4CY3 A;  4E54 B;  5GSA A;  1MG2 A;  4QQE A;  2EBS A;  2AGW A;  2P9N C;  4JT5 C;  5EAR A;  2H6N A;  3SFZ A;  3N0E A;  3OKY A;  4ZN4 A;  1U2V C;  4J82 A;  2OVP B;  5GXI A;  3MZK A;  5AJA A;  3IIW A;  3VGZ A;  5FQD A;  3I2N A;  3UVL A;  3DSM A;  3UVO A;  5KDO B;  1U4C A;  3B7F A;  5C2W B;  1A0R B;  1OLZ A;  1JMX B;  3CFS B;  4Y7R A;  2UZX B;  3IJC A;  2CN2 A;  3C75 H;  4K3J B;  3PXT D;  3RMZ D;  3IKO A;  5IGQ A;  2Q7Q A;  4PSW B;  4D0K A;  3C5M A;  5GXH A;  2HXC A;  4H5I A;  3FGB A;  2I3T A;  1PGU A;  2I3S A;  3OKW A;  1PBY B;  2H3X A;  1YFQ A;  2AH0 A;  1JOF A;  2H14 A;  4PC0 A;  2AGL A;  2XYI A;  3EI3 B;  5IGO A;  4D6V A;  4J73 A;  2OK6 A;  4K3I D;  1S4U X;  2I0T A;  4H5J A;  1P22 A;  3EWE A;  3I8C A;  2Z2N A;  2G9A A;  4XYH A;  3ULE C;  1SQJ A;  1K32 A;  3V7D B;  4FAV D;  4G56 B;  3VA6 A;  3SHF A;  5HYN B;  2Z2O A;  4QRJ A;  3CIK B;  5C2V B;  5TF2 A;  2GC4 A;  3AH8 B;  3J81 g;  5IJ7 E;  2PM6 B;  5FLX g;  4XEI C;  3SMR A;  3F3G A;  3ODT A;  3I7P A;  4J0W A;  2H9N A;  3F3P A;  2IWK A;  1NR0 A;  2YNO A;  3NVX A; 
#chains in the Genus database with same CATH topology
 5H14 A;  5EM2 B;  1N6F A;  2XE4 A;  1SQ9 A;  2B5L A;  1JTD B;  3SXT D;  1JJU B;  3O4J A;  3EMH A;  4I79 A;  3EG6 A;  3MKQ A;  1T2X A;  3I7N A;  2XDW A;  5I5J A;  3UVM A;  3PSL A;  5AFU 3;  4N14 A;  1OMW B;  4GGA A;  3OW8 A;  4GM8 A;  4FA9 D;  2H9L A;  3DXM C;  2HYE A;  4OWR A;  3W15 A;  4J87 A;  2IWF A;  1O6F A;  3VI3 A;  4CI2 A;  3EI1 B;  4CZY A;  3FRX A;  2B5N A;  3KCI A;  4U1E I;  4CY1 A;  2PM9 A;  1JV2 A;  3DM0 A;  3MMY A;  3AL8 B;  1O6G A;  4X3E A;  3O4I A;  5FKS A;  3KRX B;  3EQ7 A;  5FKR A;  2P9U C;  4JXM A;  3V4V A;  3RN1 D;  1E8N A;  1QNI A;  2IAA A;  4O02 A;  5EMM B;  4Z8L A;  3O4G A;  5CXC B;  1QFS A;  5EMJ B;  4PXW A;  2XU7 A;  4DNW A;  4QAM A;  1QFM A;  2MTA H;  4TZ4 A;  5FKT A;  4G55 A;  2CN3 A;  2HJB A;  3UVN A;  4J8B A;  4CY5 A;  4FHL A;  4CC9 A;  2P9I C;  2GNQ A;  3ORV D;  2VDN A;  4E54 A;  1UOP A;  2I0R A;  3MXX A;  5HE0 B;  4A11 A;  4FA5 D;  5CXB B;  5A2Q g;  3SVW D;  2B4E A;  3F3F A;  3OTT A;  2TRC B;  3SJL D;  1H2Y A;  2AQ5 A;  3I7K A;  3MUO A;  3DXK C;  5IJ8 E;  5C9Z B;  4L1Q D;  1MG3 A;  3O4H A;  3U4Y A;  2HJ4 A;  3SBP A;  3EI2 A;  5C86 A;  3I7L A;  1SHY B;  3PE7 A;  3IUL A;  4PNK B;  3DWL C;  4JSX C;  5HE3 B;  5C92 A;  5TEF A;  5I5I A;  2VDM A;  3PVW B;  1N6E A;  4WK2 A;  3JPX A;  3UKU C;  2CO0 A;  5EM2 A;  3PVU B;  3JZG A;  5M5R A;  1E8M A;  4ZOX A;  1ERJ A;  4ZOV A;  5SXM A;  3SN6 B;  1N6D A;  3GC3 B;  3IUM A;  4LG9 A;  3FCS A;  4BL0 A;  4AEZ A;  2VDO A;  3I7H A;  3T3P A;  2B5M A;  2CE9 A;  5K1C C;  4X63 B;  3UVK A;  5GMK n;  4YVD A;  3CFV A;  4J77 A;  4NEN A;  5B4W A;  3UKR C;  2VZ3 A;  1TYE A;  2CE8 A;  4O2W A;  3BG1 A;  4PBZ A;  3BWS A;  3MZL A;  3AFC A;  3K72 A;  2EIB A;  1GP2 B;  2PM9 B;  4J81 A;  3E0C A;  4U7A A;  4GM3 A;  5JWZ A;  5THA A;  4BUJ C;  3PXW D;  1BPO A;  1JMZ B;  2YNN A;  3I7O A;  2H47 A;  1K3I A;  1H2X A;  4IMM A;  4GMB A;  4RE5 A;  3DDU A;  4IRZ A;  4Y5R D;  2OVQ B;  4A09 B;  5IC7 A;  4L1M A;  3ZDZ A;  3JZN A;  4GM9 A;  4ESG A;  3JRO A;  3JRP A;  3FM0 A;  4A09 A;  2YBA A;  4FWW A;  2H9M A;  4WJK A;  3IUN A;  4O1Q D;  5M5T A;  2PM7 B;  2CO0 C;  2GC7 A;  4AOW A;  3K27 A;  4X61 B;  1PI6 A;  3EU7 A;  3MKS B;  4CI8 A;  2HES X;  5K19 A;  4L3H D;  1UOQ A;  2PBI B;  3NID A;  4L9O A;  3RLM D;  5M5U A;  1TYQ C;  3J80 g;  2BKL A;  1VZ3 A;  3IJ0 A;  4CY2 A;  2H13 A;  4QT8 A;  4FB1 D;  1R5M A;  3KRW B;  4ERQ A;  3QHY B;  5FA5 B;  2HU5 A;  3P4F A;  5TEE A;  3AL9 A;  4JSP C;  4E5Z B;  4O3U B;  4UI9 R;  4D9S A;  3SBR A;  4KFM B;  3SWS D;  4CZV A;  2H6K A;  4J0X A;  4MK0 B;  2OVR B;  3RSE C;  2IUR A;  3EI4 A;  3IJ1 A;  4GGC A;  2H9P A;  3IIY A;  5I5M A;  2AGZ A;  2WQ8 A;  3AL8 A;  4ZOZ A;  5FXY A;  5AMS A;  4A08 A;  3RFH A;  5M61 A;  4O45 A;  5H1M A;  2JKX A;  2QC5 A;  3EI3 A;  1VE6 A;  4ERZ A;  1XHM A;  4JHN A;  2XL2 A;  1YR2 A;  2O9K A;  1UTC A;  2BCJ B;  3L4O D;  5EAP A;  2OIZ A;  4X60 B;  5EAM A;  4O9D A;  5HE1 B;  2J55 H;  3OF7 A;  4CI3 A;  5FKQ A;  4LGN A;  3SBQ A;  1U8C A;  3K26 A;  5TDH B;  1L5G A;  4A2L A;  3K6S A;  1GXR A;  4A7J A;  3ZE1 A;  2QXV A;  4BCC A;  3I89 A;  3NIG A;  4CZX A;  2P9S C;  3I8E A;  3QI0 A;  5FFG A;  3OKT A;  3VI4 A;  3EI1 A;  4A0A B;  3PSC B;  4O3T B;  4E5Z A;  3SCY A;  2CNX A;  5E6R A;  2OK4 A;  3NVQ A;  5E6U A;  2H6Q A;  1Q47 A;  2IUV A;  2J56 H;  1PEV A;  4J84 A;  4LG8 A;  3BG0 A;  4HDJ A;  2BBK H;  2W18 A;  4JD2 C;  1FWX A;  4DNV A;  2IUQ A;  5E6S A;  3EI4 B;  3JZH A;  1L0Q A;  3SLE D;  4FA4 D;  3RN0 D;  1B9Y A;  3EQ8 A;  1VYH C;  4IA9 A;  2VDK A;  4JSN C;  4A11 B;  3L4M D;  2P9L C;  3PXS D;  4NBM A;  4PSX B;  1GOH A;  2G99 A;  3RRM C;  2VDR A;  1TBG A;  3GRE A;  1B9X A;  4A0A A;  4G1E A;  3ZWL B;  3JB9 L;  3OL2 B;  4OZU A;  4Z7N A;  1GOT B;  3IUJ A;  4A0B B;  3ZE0 A;  4JSV C;  4A2M A;  5HQG A;  5CXB A;  2AGY A;  3N0D A;  1E5T A;  4PBY A;  4GGD A;  5CXC A;  3JAM g;  2QZP A;  2AGX A;  3GFC A;  2OJY A;  3IVM A;  2HKR A;  3NVN A;  4Z7O A;  1GG2 B;  4ES0 A;  3K71 A;  4EWR A;  1GOF A;  4XYI A;  2YB8 B;  5H17 A;  4CI1 A;  4J86 A;  4BP8 A;  4ERY A;  3EI2 B;  1RI6 A;  3A0F A;  2XL3 A;  2H68 A;  2J57 G;  5EAL A;  2I0S A;  4J79 A;  5M5V A;  4UM8 A;  2IUP A;  4ZOY A;  5M5S A;  2HU8 A;  5CYK B;  3VH0 A;  5EMK B;  3V9F A;  5EML B;  3RFG A;  3HFQ A;  4J8G A;  4NSX A;  2YMU A;  4GQB B;  4J78 A;  3FCU A;  1K8K C;  4MMY A;  2EIC A;  1MDA H;  3V5W B;  1XIP A;  3UR4 A;  4FAN D;  4AMY A;  2AH1 A;  4L3G D;  3OKY B;  4R7A B;  3OL2 A;  3C9C A;  4A08 B;  4GZ8 A;  4A0B A;  5HDB A;  5CYK A;  5HE2 B;  2P9K C;  1UOO A;  2UZY B;  4FA1 D;  2YNP A;  3T3M A;  4AN1 A;  4BCD A;  4QL1 A;  2P9P C;  4GQ1 A;  1H2W A;  1NEX B;  3C99 A;  3EQ9 A;  4JT6 C;  4MMX A;  2HKM A;  4GQ2 P;  3MVD K;  1XKS A;  2Z2P A;  4MMZ A;  5IT9 g;  4AMZ A;  4BH6 A;  4CY3 A;  3MUN A;  4E54 B;  5GSA A;  3NIF A;  1MG2 A;  1GOG A;  4QQE A;  2EBS A;  2AGW A;  2P9N C;  4JT5 C;  5EAR A;  2H6N A;  3SFZ A;  3ZE2 A;  1C9L A;  2EID A;  3N0E A;  3OKY A;  4ZN4 A;  1U2V C;  4J82 A;  2OVP B;  5GXI A;  3MZK A;  5AJA A;  3IJE A;  3IIW A;  3VGZ A;  5FQD A;  3I2N A;  3UVL A;  3DSM A;  4WK0 A;  3UVO A;  5KDO B;  1U4C A;  3B7F A;  5C2W B;  2QR5 A;  1A0R B;  1OLZ A;  3IUQ A;  1JMX B;  3CFS B;  3IUR A;  4RE6 A;  4Y7R A;  2VDP A;  3ZDX A;  2UZX B;  3ZDY A;  3IJC A;  2CN2 A;  3C75 H;  4K3J B;  3PXT D;  3RMZ D;  3IKO A;  5IGQ A;  2Q7Q A;  4PSW B;  1VE7 A;  1M1X A;  4NC4 A;  4JHP C;  4D0K A;  3C5M A;  5GXH A;  2VC2 A;  2VDL A;  2HXC A;  4H5I A;  3FGB A;  1A12 A;  2VDQ A;  2I3T A;  1PGU A;  2I3S A;  3OKW A;  1PBY B;  2H3X A;  1VZ2 A;  4NAA A;  5FFO A;  1YFQ A;  4BP9 A;  2AH0 A;  1JOF A;  2H14 A;  4PC0 A;  2AGL A;  4BCB A;  2XYI A;  3EI3 B;  5IGO A;  4D6V A;  4J73 A;  2OK6 A;  4K3I D;  1S4U X;  2VZ1 A;  1C9I A;  2I0T A;  3GD1 I;  4H5J A;  4Z7Q A;  4WK4 A;  1P22 A;  3EWE A;  3I8C A;  2XZG A;  2G9A A;  2Z2N A;  4XYH A;  1SQJ A;  2HU7 A;  3ULE C;  1K32 A;  3V7D B;  4FAV D;  4G56 B;  3VA6 A;  3SHF A;  4AX4 A;  1I2M B;  5HYN B;  4AN0 A;  4UM9 A;  2Z2O A;  4G1M A;  4QRJ A;  3CIK B;  5C2V B;  2EIE A;  5TF2 A;  2GC4 A;  3AH8 B;  3J81 g;  5IJ7 E;  2PM6 B;  5FLX g;  4XEI C;  3SMR A;  3F3G A;  3ODT A;  3I7P A;  4J0W A;  4DNU A;  1H2Z A;  2H9N A;  3F3P A;  2IWK A;  1NR0 A;  3V4P A;  2YNO A;  3NVX A; 
#chains in the Genus database with same CATH homology
 5H14 A;  5EM2 B;  1N6F A;  1SQ9 A;  2B5L A;  3SXT D;  1JJU B;  3EMH A;  4I79 A;  3EG6 A;  3MKQ A;  3I7N A;  3UVM A;  5I5J A;  3PSL A;  5AFU 3;  4N14 A;  1OMW B;  4GGA A;  3OW8 A;  4GM8 A;  4FA9 D;  2H9L A;  3DXM C;  2HYE A;  4OWR A;  3W15 A;  4J87 A;  2IWF A;  4CI2 A;  3EI1 B;  4CZY A;  3FRX A;  2B5N A;  4U1E I;  4CY1 A;  2PM9 A;  3DM0 A;  3MMY A;  3AL8 B;  4X3E A;  5FKS A;  3KRX B;  5FKR A;  2P9U C;  4JXM A;  3RN1 D;  1QNI A;  2IAA A;  5EMM B;  4Z8L A;  5CXC B;  5EMJ B;  4PXW A;  2XU7 A;  2MTA H;  4TZ4 A;  5FKT A;  2CN3 A;  2HJB A;  3UVN A;  4J8B A;  4CY5 A;  4FHL A;  4CC9 A;  2P9I C;  2GNQ A;  3ORV D;  4E54 A;  2I0R A;  3MXX A;  5HE0 B;  4A11 A;  4FA5 D;  5CXB B;  5A2Q g;  3SVW D;  2B4E A;  3F3F A;  3OTT A;  2TRC B;  3SJL D;  2AQ5 A;  3I7K A;  3DXK C;  5IJ8 E;  5C9Z B;  4L1Q D;  1MG3 A;  3U4Y A;  2HJ4 A;  3SBP A;  3EI2 A;  3I7L A;  1SHY B;  3PE7 A;  4PNK B;  3DWL C;  4JSX C;  5HE3 B;  5TEF A;  5I5I A;  3PVW B;  1N6E A;  3JPX A;  3UKU C;  2CO0 A;  5EM2 A;  3PVU B;  3JZG A;  4ZOX A;  1ERJ A;  4ZOV A;  5SXM A;  3SN6 B;  1N6D A;  4LG9 A;  4BL0 A;  4AEZ A;  3I7H A;  2B5M A;  2CE9 A;  5K1C C;  4X63 B;  3UVK A;  5GMK n;  4YVD A;  3CFV A;  4J77 A;  5B4W A;  3UKR C;  2CE8 A;  3BG1 A;  4PBZ A;  3BWS A;  3MZL A;  3AFC A;  1GP2 B;  2PM9 B;  4J81 A;  3E0C A;  4U7A A;  4GM3 A;  5JWZ A;  5THA A;  4BUJ C;  3PXW D;  1JMZ B;  2YNN A;  3I7O A;  2H47 A;  4IMM A;  4GMB A;  4Y5R D;  2OVQ B;  4A09 B;  5IC7 A;  3JZN A;  4GM9 A;  4ESG A;  3JRO A;  3JRP A;  3FM0 A;  4A09 A;  2YBA A;  4FWW A;  2H9M A;  4O1Q D;  2PM7 B;  2CO0 C;  2GC7 A;  4AOW A;  3K27 A;  4X61 B;  1PI6 A;  3EU7 A;  3MKS B;  4CI8 A;  2HES X;  5K19 A;  4L3H D;  2PBI B;  4L9O A;  3RLM D;  1TYQ C;  3J80 g;  3IJ0 A;  4CY2 A;  2H13 A;  4QT8 A;  4FB1 D;  1R5M A;  3KRW B;  4ERQ A;  5FA5 B;  3P4F A;  5TEE A;  3AL9 A;  4JSP C;  4E5Z B;  4O3U B;  4UI9 R;  3SBR A;  4KFM B;  3SWS D;  4CZV A;  2H6K A;  4J0X A;  4MK0 B;  2OVR B;  3RSE C;  2IUR A;  3EI4 A;  3IJ1 A;  4GGC A;  2H9P A;  3IIY A;  5I5M A;  2AGZ A;  3AL8 A;  4ZOZ A;  5FXY A;  5AMS A;  4A08 A;  3RFH A;  4O45 A;  5H1M A;  2QC5 A;  3EI3 A;  4ERZ A;  1XHM A;  2XL2 A;  2O9K A;  2BCJ B;  3L4O D;  5EAP A;  2OIZ A;  4X60 B;  5EAM A;  4O9D A;  5HE1 B;  2J55 H;  4CI3 A;  5FKQ A;  4LGN A;  3SBQ A;  3K26 A;  5TDH B;  4A2L A;  1GXR A;  4A7J A;  2QXV A;  3I89 A;  4CZX A;  2P9S C;  3I8E A;  3OKT A;  3EI1 A;  4A0A B;  3PSC B;  4O3T B;  4E5Z A;  3SCY A;  2CNX A;  2OK4 A;  3NVQ A;  4LG8 A;  2H6Q A;  1Q47 A;  2IUV A;  1PEV A;  2J56 H;  4J84 A;  3BG0 A;  4HDJ A;  2BBK H;  2W18 A;  4JD2 C;  1FWX A;  2IUQ A;  3EI4 B;  3JZH A;  1L0Q A;  3SLE D;  4FA4 D;  3RN0 D;  1B9Y A;  1VYH C;  4IA9 A;  4JSN C;  4A11 B;  3L4M D;  2P9L C;  3PXS D;  4PSX B;  2G99 A;  3RRM C;  1TBG A;  3GRE A;  1B9X A;  4A0A A;  3ZWL B;  3JB9 L;  3OL2 B;  4OZU A;  1GOT B;  4A0B B;  4A2M A;  4JSV C;  5HQG A;  5CXB A;  2AGY A;  3N0D A;  4PBY A;  4GGD A;  5CXC A;  3JAM g;  3GFC A;  2AGX A;  2HKR A;  2OJY A;  3NVN A;  1GG2 B;  4ES0 A;  4EWR A;  4XYI A;  2YB8 B;  5H17 A;  4CI1 A;  4J86 A;  4ERY A;  3EI2 B;  1RI6 A;  3A0F A;  2XL3 A;  2H68 A;  2J57 G;  5EAL A;  2I0S A;  4J79 A;  2IUP A;  4ZOY A;  5CYK B;  3VH0 A;  5EMK B;  3V9F A;  5EML B;  3RFG A;  3HFQ A;  4J8G A;  4NSX A;  2YMU A;  4GQB B;  4J78 A;  1K8K C;  1MDA H;  3V5W B;  1XIP A;  3UR4 A;  4FAN D;  2AH1 A;  4L3G D;  3OKY B;  4R7A B;  3OL2 A;  3C9C A;  4A08 B;  4GZ8 A;  4A0B A;  5CYK A;  5HE2 B;  2P9K C;  4FA1 D;  2UZY B;  2YNP A;  4QL1 A;  2P9P C;  4GQ1 A;  1NEX B;  3C99 A;  4JT6 C;  2HKM A;  4GQ2 P;  1XKS A;  2Z2P A;  5IT9 g;  4BH6 A;  4CY3 A;  4E54 B;  5GSA A;  1MG2 A;  4QQE A;  2EBS A;  2AGW A;  2P9N C;  4JT5 C;  5EAR A;  2H6N A;  3SFZ A;  3N0E A;  3OKY A;  4ZN4 A;  1U2V C;  4J82 A;  2OVP B;  5GXI A;  3MZK A;  5AJA A;  3IIW A;  3VGZ A;  5FQD A;  3I2N A;  3UVL A;  3DSM A;  3UVO A;  5KDO B;  1U4C A;  3B7F A;  5C2W B;  1A0R B;  1OLZ A;  1JMX B;  3CFS B;  4Y7R A;  2UZX B;  3IJC A;  2CN2 A;  3C75 H;  4K3J B;  3PXT D;  3RMZ D;  3IKO A;  5IGQ A;  2Q7Q A;  4PSW B;  4D0K A;  3C5M A;  5GXH A;  2HXC A;  4H5I A;  3FGB A;  2I3T A;  1PGU A;  2I3S A;  3OKW A;  1PBY B;  2H3X A;  1YFQ A;  2AH0 A;  1JOF A;  2H14 A;  4PC0 A;  2AGL A;  2XYI A;  3EI3 B;  5IGO A;  4D6V A;  4J73 A;  2OK6 A;  4K3I D;  1S4U X;  2I0T A;  4H5J A;  1P22 A;  3EWE A;  3I8C A;  2Z2N A;  2G9A A;  4XYH A;  3ULE C;  1SQJ A;  1K32 A;  3V7D B;  4FAV D;  4G56 B;  3VA6 A;  3SHF A;  5HYN B;  2Z2O A;  4QRJ A;  3CIK B;  5C2V B;  5TF2 A;  2GC4 A;  3AH8 B;  3J81 g;  5IJ7 E;  2PM6 B;  5FLX g;  4XEI C;  3SMR A;  3F3G A;  3ODT A;  3I7P A;  4J0W A;  2H9N A;  3F3P A;  2IWK A;  1NR0 A;  2YNO A;  3NVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...