1XKTA

Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
260
Chain Sequence
VNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQHNSLFLFDGSPTYPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYYGNVMLLRAKTGLGADYNLSQVCDGKVSVHVIEGDHRTLLESGLESIISIIHSSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords fatty acid synthase
publication title Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydroxylase
total genus 83
structure length 260
sequence length 286
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 1xktA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xktA01
2PSJA 1DQZA 3A2MA 2XQGA 4CCYA 3ZWQA 1ACJA 3HLKA 2GYVA 5JD6A 4Q82A 4MXDA 1AKNA 4RNCA 4BVJA 1UT6A 3JWEA 5D7BA 3IIIA 5EIAA 2VEOA 2H7YA 4K6GA 2B4KA 4RE6A 3OURA 3C6ZA 1XZFA 4BZZA 1L7RA 1U65A 2ZYIA 1MNAA 3L1HA 4TPKA 4CG3A 3DKRA 3C6BA 2WU3A 1EDBA 5FKJA 2BAGA 3HC7A 4XIIA 1ZGCA 1O6GA 2GYUA 4OU4A 4HRYA 3WJ2A 4J03A 2PKYX 4G5XA 3DJYA 5LKAA 4Y2QA 1VZ3A 3SX4A 5ALHA 4AX4A 2R11A 3H2JA 4EZIA 2BGRA 4HXGA 4CCYB 5CXXA 4IHAA 5JAUA 3D5EA 3PFBA 4UBOA 3D7RA 1Q0RA 3GZJA 3HZOA 5AIBA 4WFKA 1D07A 3ZV7A 1X2BA 3C8DA 3I6YA 2G5PA 2XUHA 3WWOA 4QEKA 2Y2VA 3V1MA 3ZI7A 2OCGA 1ZOIA 3S8YA 2X76A 3B5EA 2XDWA 3D3NA 1XZAA 4MYDA 4LXHA 2HU7A 1N8SA 1YA8A 1BCSA 5AH0A 2Z3WA 5FV4A 3G0BA 4B7ZA 2HIHA 3ESDA 2HA5A 4OD0A 1QIEA 4AN1A 1T2NA 1DINA 3SWWA 1QFMA 3WYDA 4ZWNA 4U2DA 4UUQA 5K3EA 2J4CA 4QNNA 1ZIYA 2XUJA 2YYSA 2HA2A 5J3JA 5KREA 1DWQA 2QJWA 2ZJ6A 4AO6A 3VVLA 4Q34A 3C43A 1F6WA 3DD5A 1MX9A 2QXUA 1UK7A 5HCUA 1C4XA 1GPKA 4GEGA 1CR6A 3DS8A 4QDTA 5T4EA 4B84A 5AK3A 4BATA 3UUFA 1AGYA 5IH7A 3BWXA 1WM1A 5HK8A 5E4JA 1K8QA 1P0MA 5ALMA 5H3HA 2O7VA 1F8UA 4Q1VA 5JIBA 2BUBA 2LIPA 1EK1A 3V1LA 1VZ2A 4L9AA 4Q05A 4D9JA 4BAZA 3ANTA 4C4XA 3LLCA 4QWMA 4MWSA 3F98A 5LP1A 5AM3A 2CKMA 3UUEA 1YB7A 4P92A 3M83A 3RARA 5DWDA 1A88A 5AP9A 4XX1A 3IUNA 1FJ2A 3WQHA 2O7RA 3A2LA 1QIKA 1UKAA 4N8SA 5ALLA 1H23A 1UOOA 3W04A 2BFNA 1CUUA 1UXOA 2XQIA 5CH5A 4HS9A 3WL7A 1DX4A 1GQSA 3MUNA 4CG1A 1GXSA 1DTEA 1JJIA 1ODCA 4QDZA 4E46A 2PSFA 5AICA 3D2AA 2ZYHA 2XMDA 3O4HA 3KD2A 2WG0A 2QMQA 1ZD2P 3TRDA 4FNMA 4N8DA 5IVKA 4W63A 3PFCA 3C8HA 1K5PA 5LZ9A 3R0VA 5FRDA 2JEYA 2QT9A 5CTAA 4FLEA 1L7QA 3FAKA 4KAJA 3FWHA 5AK5A 2PVSA 2QZPA 5AKGA 2V98A 2HU8A 1EX9A 3WWEA 1FFEA 3WIOA 4X85A 3DL4A 2WUFA 1LNSA 3EQ8A 1X2EA 2QXTA 5CXUA 1P0QA 2XUPA 1GPNA 2OAEA 3QPAA 5HF5A 3S2ZA 3G9XA 3IUMA 2HA7A 4UHCA 4ARAA 3N2ZB 1MAHA 2XUKA 3IBTA 3RK4A 3ICWA 4FWBA 1ODSA 4GHWA 4HRXA 2ZVDA 3BF7A 2JGKA 4W1QA 1USWA 1DQYA 3OC0A 2AJ8A 3VXKA 1R9NA 4BRZA 3WLAA 1MTZA 4XJVA 3FBWA 5ALWA 4DIUA 1GT6A 1IUPA 2JIDA 3QPCA 1BRTA 4UHBA 4AXBA 5C81A 1ZD5A 4X95A 2C7BA 3WI7A 3LCRA 5E2IA 3G0CA 1CUDA 3WK5A 1GKKA 4H7HA 4WY8A 1UK9A 4U2GA 4BAGA 5AI5A 1QOZA 5AKXA 1X70A 3C87A 5JZSA 1B41A 2V97A 3A70A 1C7IA 3AILA 5DTJA 4H0CA 5ALUA 1J1IA 3HXKA 1CUVA 4CG2A 1JU4A 4ZXFA 1TK3A 1WHSA 1ZD4A 1EB8A 4MYSA 4Y2TA 3G0DA 4KE6A 2Z5GA 3PF8A 3O95A 4PSCA 5CW2A 3HACA 1IUNA 4RPCA 3I2FA 5HF6A 2JGLA 4J0IA 5CT8A 2AJBA 3IDAA 5LZ2A 2WJ4A 2QUAA 1XZLA 4UBKA 2PU7A 2AXEA 2DFPA 5CRIA 2WQZA 4GWLA 1E5TA 1LZKA 1I6WA 3TJMA 2BKLA 4KACA 3I1IA 3VVMA 5CT6A 2HRRA 4A5SA 2JGJA 2D5LA 1Y37A 5AKKA 1DWPA 2CB9A 3AIOA 3A2NA 1SOMA 1THGA 1XQYA 1CQWA 4BVKA 2B20A 3WKEA 1UOQA 1NU6A 1C7JA 5ALEA 4ZI5A 5ALGA 3FSGD 3AIMA 1Y7IA 5JADA 4AN0A 1XZCA 1EVEA 1XZKA 3H1AA 3ICVA 5HQ3A 1CIJA 5AKEA 4UHEA 4MWTA 3FVTA 3LIPA 2RIPA 2VTVA 1AUOA 4JNCA 3GBSA 4EY7A 1AX9A 2WKWA 1QZ3A 2QVBA 5CH8A 5AI6A 2WJ6A 1XRMA 4BTLA 5AHXA 2XMBA 4HXFB 1TCBA 5A6VA 2XB6A 4G8BA 3IUQA 5AM1A 1JT2A 3R3ZA 5JZBA 3F9CA 1EB9A 1ZGBA 1YS2X 3QM1A 5JD4A 3BXPA 1E89A 5JAOA 4M0EA 1CFJA 4X91A 1CUAA 4ZREA 4KR0A 2W22A 3DDUA 2XUFA 1XQXA 3ZLVA 4N5IX 4Y2XA 5A2GA 1QIDA 2PUHA 7YASA 2WFLA 1IZ7A 2G5TA 3DOIA 4KYVA 3DKKA 4OUKX 1A8UA 1EK2A 3CN7A 4DSAA 4FBLA 3I6MA 4Y2UA 1RP1A 1CUGA 4WFIA 4J0HA 4BCCA 1YASA 5ALDA 1DWOA 5DLPA 4EY4A 1QIMA 2QTBA 5KWIA 1LPOA 3G7NA 4N5HX 3KSRA 4AO8A 4KRXA 3L1IA 1CUHA 5C8VA 1HQDA 1XKLA 3HEAA 5AIAA 2Y6UA 2I3DA 3BL8A 4GBGA 2CJPA 2RGUA 1CUSA 5EFZA 4BDTA 3W2TA 3C6YA 5ALIA 1BEEA 2ZSIA 2I78A 2WFLB 1A7UA 5IVHA 3QMWA 1ZICA 1ORWA 3IUJA 2HU5A 1W76A 4LYEA 5D3KA 2ROQA 2VT7A 4G1FA 1BE0A 4Q3OA 2JEZA 4PSUA 2XI4A 3FSGA 5LZ7A 5DYYA 4BE9A 2GZRA 3STWA 2CBGA 4ETWA 4PF1A 4RGYA 3IB3A 3E4DA 4KAAA 2H7XA 2WIFA 2WJ3A 1G5FA 3BF8A 1N1MA 1EDDA 4E14A 3STUA 2IX9A 1U8EA 2QM0A 4N8EA 2K2QB 4C88A 3YASA 1PFQA 1PV1A 2HDWA 1ZI9A 3QZUA 1EH5A 2VT6A 3KOOA 5ALVA 1XZBA 2VSQA 5CURA 2RAUA 5DYTA 1WPRA 2OCIA 3OTQA 2PM8A 4EB0A 4FOLA 4FBMA 4ZV7A 4F5ZA 3I28A 3WWCA 2HFKA 3CCCA 3UMJA 1J07A 4BTVA 4X6XA 1GZ7A 4J3JA 2XMRA 1XFDA 2XMSA 1VXRA 4Y7DA 4EY5A 4YK7A 4XVCA 2ZSHA 1BROA 1QIJA 3WK7A 4NS4A 3STTA 4Y2JA 1OCEA 5BWCA 4DSZA 2OCKA 4I3FA 3I1YA 2PL5A 3OPMA 2GBIA 4UFPA 4GXNA 3C5WP 1CUCA 1WB6A 1QIGA 2DHEA 1E66A 4H18A 1NX9A 1K4YA 1EINA 4MQLA 5HF9A 5AOBA 4UBJA 5AKIA 4WDQA 5HFAA 5T4BA 1ZI8A 1JJBA 3FYUA 1MN6A 3PDCA 2RHTA 4NZZA 4CFSA 2WUDA 1W52X 5ALRA 2RONA 5FUMA 1QE3A 3BJRA 4X90A 3E3AA 4W1PA 1LPMA 1VE7A 2Y6VA 2C5GA 5BWBA 2CMFA 4UBIA 3R3UA 4X00A 4BCBA 1HBJA 3BIXA 5DNVA 2O2HA 1XRNA 4KE7A 3ZLUA 3O9MA 4ZGBA 3H19A 3P2MA 2QKYA 2WHPA 5DJ5A 3FCYA 2WTNA 3CCBA 1MT3A 4W1RA 4BDSA 4V2IA 1LBSA 4PV7A 4YPVA 4DNQA 2RI6A 2OPHA 1M33A 3ANSA 1R1DA 1DT3A 5FP0A 1KEZA 1ZJ4A 2R8BA 1YCDA 1IVYA 4YX9A 1P0IA 1YSCA 2HHAA 4LYDA 3DYIA 4IQ4A 5E4YA 5EHQA 4QWWA 2AJLI 4U2EA 1HPLA 3W9BA 4L72A 3IA2A 5FLKA 4Y2VA 1CRLA 1THTA 1R4ZA 2EDCA 5DYWA 1W75A 5ESRA 3WKDA 3M3DA 4P93A 3QH4A 3V1NA 4FLFA 2RHWA 2WIKA 2VJBA 2OLEA 2WM2A 4FTWA 3RM3A 5JAHA 4PNZA 4INZA 2XQJA 1YAJA 1KU0A 2WHPB 4LXGA 4PSDA 1LBTA 3H2KA 1TCCA 1WCYA 5AM4A 5JATA 1IZ8A 3WMRA 2BUCA 1UK8A 1XZIA 4HTAA 1SCKA 2QS9A 2J3QA 2HA4A 2VF2A 5ALQA 4I4CA 2HFJA 2C4HA 4L3WA 2Y2UA 4UHHA 3H2HA 4FFWA 3BDVA 2JBWA 4BP9A 1MX5A 4Q3KA 3O4GA 3F97A 2BJHA 1R88A 3C70A 2H7CA 1XQVA 3O4IA 4G8DA 4G4JA 5C8XA 1QIIA 1E3QA 1UKBA 3GFFA 5HZGA 3W05A 2XUQA 2YASA 2QOEA 1ODTC 5EHZA 2WIDA 3B12A 1XLVA 2C0PA 1BN7A 3HI4A 4C01A 1U2EA 2QRUA 4CI9A 4ROTA 3W06A 3C6XA 3R3WA 3IULA 4AZ3A 1VJ5A 3VJMA 1K63A 5ALOA 1SCIA 2DCMA 2I03A 3WKCA 3E0XA 4P08A 1TIBA 3C5VA 5BV7A 4W1SA 1QJ4A 3VDXA 3STXA 2C58A 1QO7A 2YXPX 1XZJA 3GUUA 1MX1A 2G63A 5ALXA 4FNGA 5EI5A 4DTCA 1JJFA 2ONCA 1XRQA 4X6UA 5ALSA 1OXMA 4Y2YA 4X93A 5ALYA 1XKTA 4QLOA 1NU8A 1WB5A 3BJMA 1K6EA 1QFSA 4JH0A 1QTIA 2AJCA 4ZV9A 1CEXA 3PUIA 3O4JA 2C0QA 3G0IA 2HA6A 5FDFA 4ZRDA 4QA9A 1WHTA 5LZ5A 2WG2A 2WU4A 3VJKA 1A8QA 1UZAA 2E3JA 3AJAA 1AC5A 3GELA 5AOCA 2ZYRA 3G9ZA 2JGFA 4F60A 5A62A 4U2FA 5D3ZA 4M0FA 4EUSA 4E15A 2AJDA 4QDUA 4UHFA 2WFMA 1A8SA 2P8SA 2ZJFA 2W6CX 3T52A 1ZD3A 5CT4A 2JF0A 4BRSA 3QMMA 3D2CA 1H2WA 1SFRA 1BCRA 5FPQA 1CUEA 1LPPA 5ALTA 5CT5A 3R3VA 2YH2A 1XZGA 3EBLA 5AK4A 5E4TA 2HM7A 4IH1A 3JYHA 1R9MA 5KBYA 3LP5A 5K3DA 2WIJA 5HF8A 4BCDA 5K3FA 4W9RA 2XUOA 3DQZA 1OILA 1CUZA 4LHEA 3E1GA 1R3DA 4H35A 4UFOA 1WOMA 4AZ0A 3STYA 5JZ9A 4BBZA 2HADA 1JI3A 4BC1A 4UBNA 1AQLA 4OYLA 1JMKC 4LXIA 4DMHA 3NWOA 1WB4A 1ACLA 2QJRA 2WG1A 1FSSA 3VISA 2PBLA 1MU0A 4H7IA 3SC2A 2ECFA 3WKAA 1CPYA 4K6KA 5LLSA 3U0VA 2CEKA 1DX6A 3BIWA 1TKRA 3HSSA 5JASA 3V48A 4UPDA 3RKSA 3EQ9A 3I2HA 3WKBA 2XLBA 5HKAA 4ITVA 5HQ3B 1G66A 4BP8A 4RE5A 1QIHA 1N5RA 5IVIA 4E11A 4MEAA 2WLSA 4KJXA 4WJLA 3G0GA 4X3CA 3FNBA 2QR5A 5K5EA 1XLUA 4OPMA 4G4GA 2OG1A 2WSLA 1FFAA 4QDOA 3WA6A 5AM5A 4X6YA 3DYVA 5HK9A 5KWJA 1H2ZA 4F0JA 4J0JA 5D6OA 4B85A 3EF3A 1AZWA 3F8SA 1XZHA 1ETHA 4BC0A 1EHYA 2GBFA 4QDXA 1ORVA 3FOBA 2Z8XA 3WWDA 3K2IA 4B82A 4GW3A 4C87A 4X92A 4PO3X 3B3QA 3WK6A 1FFBA 1TRHA 4AQDA 5F4ZA 2GBGA 1YB6A 1SC9A 1XZEA 3I6ZA 1HL7A 2Y1KA 2HL6A 4DMFA 2ZYSA 2BCEA 5ISMA 1DU4A 5AKZA 1E8NA 1E8DA 3ILSA 2UZ0A 2WUEA 2DHCA 4U2BA 2WIGA 4FDMA 3FYUC 1B6GA 1JFRA 4B6GA 1QGED 4B0PA 1UWCA 4L0CA 4JYMA 5FOQA 1LPBB 1WPXA 5ALKA 2WHRA 4OCZA 4KE9A 1LPSA 4GDMA 4WY5A 3R41A 1YS1X 1JMYA 3QPDA 2DQZA 4O08A 2XUGA 3KXPA 1TAHA 5FXMA 2FX5A 3R40A 3HRHA 4CCWA 3DCNA 2PU5A 1GQRA 1VOTA 1IUOA 2BGNA 2XT0A 2H9YA 3KWJA 1W4LA 1JKMA 1PJAA 1RWQA 3WIBA 3PI6A 4FLMA 3TGLA 3TEJA 1QTRA 3LS2A 4QLAA 2EEPA 4J7AA 4J0DA 4QE3A 2JGEA 1EDEA 2V96A 1MPXA 3G9TA 3H0CA 5AM0A 1P0PA 2Z3ZA 3BE8A 2XE4A 3G8YA 3EQ7A 5AI8A 5CT9A 1YA4A 4BZWA 4FHZA 4J0GA 2J4FA 4BAUA 5A71A 4IH4A 4FMPA 3WK8A 4YASA 2XMCA 1LZLA 4HAIA 2XUDA 2I3ZA 4BYMA 3WA7A 3O0DA 3ESAA 4X97A 3QBJA 1GPLA 3ZPXA 2IIVA 1F0PA 4G4IA 3OOSA 3I2IA 3OM8A 1XZMA 3G02A 2NW6A 3FLAA 1XROA 2FJ0A 5EHXA 1FFCA 5EIHA 3H2GA 3H1BA 2IITA 4PW0A 5HKBA 1QONA 1BU8A 4A16A 4A23A 1XLWA 4K5QA 3K6KA 3H18A 1TQHA 3PICA 2Z8ZA 2Q0XA 5AKYA 4JYPA 5AOAA 2VJCA 3MVEA 3FLBA 2WHQA 4Y2SA 3QMVA 4F21A 5K3AA 1H2YA 4B81A 1VXOA 4KRYA 2VA9A 5IKXA 1XRRA 5ALPA 5K3CA 4OU5A 2PX6A 4H7JA 5I7UA 4QZVA 3L1JA 1CUJA 4FKBA 4GI1A 5JAPA 4DYHA 1CUBA 1CV2A 5AKHA 3FYUB 3O9VA 1ZIXA 1ZI6A 4JEIA 1W1IA 1Q0ZA 2HA3A 3DL7A 2VAVA 1ZJ5A 5A7FA 2XLCA 5LYYA 3R3YA 1W6RA 5T4FA 1H2XA 3IVMA 1VKHA 4WDRA 5CH3A 1EI9A 4C89A 1O6FA 4HXEB 3Q0TA 2XUAA 1CUXA 1XRPA 2V9ZA 4MJ3A 3RLIA 4EBBA 1MO2A 1XQWA 1MAAA 1VA4A 4GLBA 3Q8WA 2QUBA 3HJUA 2WUGA 2BUAA 5JALA 5LKRA 2ES4A 3M81A 5AKLA 5AO9A 3SK0A 1VE6A 3F67A 4WFJA 2OGZA 4EHBA 4X94A 2C5FA 3DEAA 1FFDA 2OGSA 1Q83A 3U1TA 2WFZA 1TCAA 1VA5A 4B9EA 3NGMA 1AMNA 2X8BA 3AZPA 4B0OA 3VKFA 1QIFA 1T4MA 5DTIA 2XMQA 3I2GA 3T4UA 2ACKA 3KWFA 1CUWA 2VQ6A 4OYYA 5SYNA 4XWGA 3ESCA 2D0DA 4CIBA 3D4LA 4G8CA 3STVA 5AJHA 4Y9SA 1KU6A 3KDAA 3HYSA 1U4NA 4K6HA 1LGYA 6YASA 2JGIA 3WK4A 4IO0A 5A7HA 4B83A 1HLGA 5JD5A 3WL5A 1DT5A 3AUKA 3AIKA 2XQFA 4Z49A 4LIPD 1BEZA 1CUYA 1G4HA 4H7FA 2DQYA 1IMJA 1HKHA 2GZSA 2WILA 3GA7A 2XQKA 4JUIA 4J0CA 1CVLA 4TVKA 2H1IA 3W9UA 3NUZA 4KE8A 4G9GA 5DNUA 3DOHA 1E8MA 4EA6A 1MJ5A 4AO7A 1VLQA 1QO9A 4OB7A 3D2BA 1ISPA 2OQVA 3I2JA 1CUIA 5AK6A 5ALNA 1UKCA 1EA5A 2ORYA 4TGLA 4KEAA 4Y2RA 3CXUA 3QITA 4H7KA 1JU3A 3MGAA 4C6HA 5CMLA 4DNPA 5JARA 2VJDA 3PUHA 3WWPA 3D0KA 1L7AA 3V1KA 2CUTA 3WZMA 5DNWA 5IVDA 3MUOA 4NMWA 4P9NA 5LZ4A 3C45A 3NOXA 2OQIA 3AZQA 1CQZA 5C8ZA 3ESBA 4PQEA 1XRLA 1EXWA 4AMZA 2HA0A 5JYCA 4UHDA 4OSEA 5I9IA 4ARBA 2PSEA 3QVMA 2ZJ7A 3A6ZA 4DMKA 1BS9A 2J3DA 5JANA 3ZLTA 3CN9A 4H77A 1GKLA 2PPLA 4DM7A 3BDIA 3DLTA 1UK6A 2OCLA 2CZQA 4MQMA 5AI0A 4HVTA 1LPNA 1SCQA 3WYNA 2B61A 4S0XA 3FYTA 5ALFA 3K9BA 1CLEA 4C4ZA 3WK9A 5K3BA 5YASA 4K2AA 3LIIA 4CIAA 3V9AA 3FLEA 3H2IA 1XZDA 5C7YA 4BB0A 3WJ1A 4B80A 2GYWA 3X3HA 1EVQA 3D59A 2XMZA 4DNFA 4AB1A 1G42A 4DGQA 2O2GA 5LZ8A 3DNMA 2DR0A 3PF9A 2VJAA 3N0TA 1LPAB 5AI4A 2EDAA 2VATA 2G4LA 1RYYA 1HDEA 4H7DA 1S8OA 2DHDA 4C4YA 1UFOA 4BE4A 5EGNA 5LIPA 4I19A 3G9UA 3JW8A 2X5XA 5EHNA 3WL8A 3VJLA 2FUKA 5BOVA 1BN6A 5AI9A 5AM2A 5T4HA 5HFNA 5ALZA 1J06A 2OXEA 3I2KA 5EIEA 1N5MA 3IURA 1MNQA 4HZGA 4U2CA 3AZOA 4G9EA 1R50A 4J0KA 5FPPA 5K3FB 4FFVA 3F96A 4Q3LA 2WTMA 1J2EA 1YR2A 5AKJA 4OB6A 4X7BA 4M0MA 4DMCA 3AINA 4DLNA 1Y7HA 2B9VA 3FVRA 3EIOA 2PSHA 2OGTA 2FJPA 4OB8A 5I8PA 4IH9A 4KAFA 1LLFA 2VAXA 4UBLA 4DNOA 1Z68A 3WZLA 5CBKA 4WCVA 4EY6A 4GECA 4LKOA 1UOPA 1Q84A 1QLWA 1H22A 3H17A 3R3XA 2OAGA 2O2IA 3QYJA 1CUFA 4NVRA 3H04A 1YAHA 4MEBA 2XMGA 4H7EA 2PSDA 3HABA 2ACEA 1F0NA 1AURA 2XUIA 5ALJA 3PE6A 4UBMA 4AMYA 2HRQA 4B9AA 3GROA 3OG9A 2JGMA 2DSNA 3ED1A 4BVLA 2GBCA 3FCXA 4UFNA 5A7GA 2PUJA 4EY8A 3M82A 3AFIA 4X71A 5SYMA 1GGVA 3WL6A 4Y2PA
chains in the Genus database with same CATH superfamily
4L8VA 4ZQCB 3RGGA 1ZK2A 3A2MA 1PTKA 4MRSA 2B21A 2XQGA 1JN0A 2EL9A 2FRDA 2PTGA 1X7YA 1QG4A 2ZZKA 3AG6A 4MJLA 2WWGA 4RNDB 4RHFA 3PUZA 3SJ7A 4BKQA 3HLKA 1NIPA 2GYVA 2J41A 5DNEA 3V80A 2GB4A 1NM5C 1E7SA 2ATVA 3W7VA 1Q2UA 2ZTSA 4TLDA 2G70A 5ILGA 1GPMA 3B1VA 2YY6A 3ZHQA 1FDOA 3JZDA 2CLDX 2ZYVX 4JA0A 5EGSA 3MS4A 1I3KA 1R3UA 2H5JA 2PANA 4OK3A 5EIAA 3N6XA 2L18A 3R5TA 1HDXA 4RVNA 2MR6A 5IFLA 2PCJA 3H8JA 4XRRA 4ZQHA 2RIRA 3K6JA 4EELA 1JX6A 2CNOA 4FZVA 4MAFA 2WJJA 2H7YA 2VUSA 4RAOA 5LNK6 3EVCA 4DPMA 3JQAD 1YACA 2Z2JA 4LHVA 1U81A 2EOAA 4P2BA 4Q15A 4RIEA 2GN2A 4R98A 4PGHA 4RE6A 2HNKA 2CLMB 4QSHA 4O5AA 3DAYA 3RVBA 4IWNA 4P34A 3UF0A 3D43A 3GEEA 2JNWA 4GGPA 3EX7C 1YRAA 1XZFA 2KJQA 2NSJA 3H5IA 4KWCA 4OJMX 3PZRA 1H6DA 3KLNA 3IAUA 3TSYA 2B30A 4CG3A 4D5GA 5L7WA 3UY4A 5HWSA 4Z5XA 2HWUA 2B7BA 2P2LA 1RKXA 5DO9A 5BSMA 2X4DA 2AG6A 1SZCA 3D7SA 4IGFA 5EXTA 3RH0A 2BFDB 4TQUS 1UPFA 3NWEA 4RJLA 4BLRA 1PTJC 1U7UA 1XBTA 1ZGCA 1XAGA 2G6BA 2P6PA 3GGSA 4ZPJA 3RAJA 3KCQA 4CV0A 1CWUA 1XQ6A 5EXXA 4B8ZA 5HOQA 1OTHA 2C03A 3LPDA 4EMUA 3ADDA 3OA0A 1GITA 2R62A 4BB9A 1JEYA 1TOAA 4LTDA 4RSRA 1X3LA 2GEKA 3HEBA 2EJBA 3AESB 4AX4A 3H2JA 3CW8X 2EYQA 2VYND 3A9CA 3KT8A 4HXGA 4JA2A 1SD1A 1L5OA 4CCYB 5CXXA 5TIIA 4NV1A 1SKAA 3PFBA 2AR0A 3MD0A 2AR7A 3GZJA 1GILA 4ETNA 1RLIA 4ZOBA 2BLLA 3HCBA 5JEEA 3ZW8A 4AAYA 3I6YA 2PKQO 5EYPA 4DR5B 1DPFA 2G5PA 4ZI7F 1ZN9A 3TKLA 3DZKA 1GZ6A 4CBVA 5B4TA 4NFHA 2UXDB 3ZEIA 2TSYB 1X9GA 2ZAGA 2OO5C 2P1RA 4HDSA 3EG9A 4ND2A 1RC8A 5IC4A 2C3PA 4F84A 4JR2A 2ZIVB 1JVBA 1VKZA 3PQCA 4LMAA 5I8WA 5CDFE 3B5EA 1NJ5A 2XDWA 3E61A 3MSCA 3GRVA 4NBRA 4QFCA 3GAZA 1WMAA 1T5LA 5FOVA 1G2IA 2OK7A 2PHZA 3FAZA 1CR4A 4MYDA 4I4TA 2FX3A 4R1TA 4URHA 1W2WB 2XZPA 3SYLA 4MYUA 1TO6A 2HU7A 3OJCA 4P3PA 4XDYA 4L4SA 3DMTA 2GO7A 1SKQA 1RQ7A 4WUTA 1HDGO 4UMEA 5JT1A 4MQFB 2Z3WA 4Z9YA 4EJ6A 3LCJA 5C5EA 1WSDA 4DEYA 3Q3EA 4E6PA 4CLXA 2HK9A 1QIEA 2X3YA 4WBSA 2JBAA 1HG0A 4IKOA 4M0PA 5CFZA 3R20A 1TAQA 1N2CA 2WBLC 4UUQA 3D4NA 3FHJA 5K3EA 2OHFA 1TZMA 2X9NA 3T9AA 2G82A 1HA3A 2PG3A 4BVAA 2CLHB 1D2MA 1U1DA 2P0YA 3TW8A 1SVUA 5TGZA 4KSBA 4DV2B 4ITRC 3ACBA 5KKCA 5HTKA 1BOOA 4JLNA 3ZW9A 3VYRB 3CJTA 1RQGA 5FWAA 1COWA 1GCIA 2IYOA 2ZJ6A 1IN7A 1CF9A 1TQDA 1OR8A 4I55F 4JMLA 4OQFA 4P3OA 1H9BA 2PLNA 4YAEA 1O6BA 3VVLA 3EFEA 2P67A 4K88A 2AYXA 2D1TA 1Q3HA 4GXQA 3OF5A 5FFFA 1W29A 2PUWA 1KY2A 1F6WA 1IZ9A 3X0DA 2Y9PB 1O96B 3OFJA 1KBZA 1O57A 2F3TA 1ECGA 1YRHA 4P3NA 1C4XA 3LCVB 2D54A 1IULA 4DVGA 4RZ2A 3K1YA 2PH1A 4GH5A 1II8A 2EC5A 4QDTA 2D0PB 4B84A 5I7FA 1EJ6A 2RGWA 3UUFA 4QOJA 3W6NA 2W2XA 2FZLA 1KA9H 3RAPR 5IH7A 4BU0A 2ONZA 4AF8A 5CYFA 3BWXA 3QVXA 1T5OA 3NC1C 4TLLB 3M34A 3TTYA 5KYUB 5GM1A 4X1KA 4XIFA 1R15A 1ZW1A 2CVFA 1VL0A 5HA5A 1YJ8A 5E3JA 3KRTA 4DWJA 3I5AA 3GT7A 3Q0IA 1ZN8A 5H3HA 3CW2A 3H8WA 4OM7A 1Z26A 1Z45A 3WDMA 3CLKA 3B3GA 3V32A 3PCTA 1SN7A 4QX6A 5E7QA 1CEEA 3IAHA 2MDTA 5DNDA 1UDAA 3ZS8A 1OBVA 2XKBA 4U6SA 3AI2A 4EPXA 1CE8A 3TUJC 3KL4A 4XX0A 1RYEA 4EB0A 1RLUA 2AD5A 1F2VA 1F12A 5JDCC 3V1LA 4MV3A 4F2PA 4Q05A 1EM6A 2NU7A 1L0BA 2P2DA 3ANTA 4MKRA 1G8YA 4YCAA 4BKUA 4D9HA 1IOZA 1M10A 4NC9A 5K03A 3QVOA 1KYZA 3EK2A 2B36A 4WKNA 4WBNF 1KYTA 4OM8A 4YNBA 4INJA 4IUBS 4CM5A 3EGOA 4UVHA 5CDHA 3C4JA 1VLJA 1G8SA 2RGCA 1X38A 2Q29A 3C8MA 3G2LA 3MZ0A 1FDWA 1MAWA 1WZUA 4G5OA 4NBWA 5CA0A 2GXUA 1PQPA 4OMDA 2I9KA 1FDUA 4LHZA 3FI0A 1WD7A 3OLYA 1G2PA 1BS1A 3KYDB 4GOJA 4XKJA 5AD1A 5C0OE 4A8TA 3HG7A 4KDRA 2HBYA 4S24A 2ECOA 5IBPA 1D2RA 1W8IA 1YQ9A 2WMYA 3A05A 4TTAA 5AP9A 4ESOA 4ZCTA 1VIAA 2XA2A 3WTCA 1VYTA 1IY8A 1Y1SA 2FMKA 4KQ1A 5AJVB 2A0KA 3NHPA 3THWB 2O7RA 2ZIUB 2ECKA 3KEGA 5JWHA 3BN3A 3GVCA 1Y6RA 1UKAA 3KVOA 5BQ3A 5J1TB 2ZETA 4YR7A 2IDMA 4DC9A 1D2GA 2IF0A 1ZXBA 3GLUA 4GOOD 2OV1A 1UOOA 4CDNA 2VYVD 2KS6A 1TLLA 2XQIA 1UXOA 1TK9A 4W4TA 7REQB 4UNIA 4IHJF 4L15A 5KSZA 1QQAA 2JW5A 3WL7A 4BFCA 1RYKA 1X7ZB 4U0KA 4C78A 2FW6A 1E92A 1ELOA 1NF3A 1QGUA 4O4JB 2UUAB 4ZDWA 1DJQA 3MCZA 1DTEA 2VRWA 3GGJA 2WUWE 3COZA 3OLVA 4QTXA 4QKQA 1AS3A 3L93A 1JQAA 4P32A 2H9AA 5D6NA 4GAEA 4C0KA 4TWIA 2I34A 2ZYHA 1TVKA 1T4DA 2QG9A 2X0JA 1J9EA 2FETA 1KP9A 2WG0A 1GYQA 2XGGA 2QMQA 2C82A 3LF2A 5AVRA 1K88A 5C37A 4RM2A 3H0KA 1ZD2P 3MQFA 3UMVA 4B44A 1T1JA 5DHUA 3SVLA 5DHTA 5DT9A 5JQGB 4KV9A 3LI2A 3TH5A 1SZJG 5IVKA 2OMKA 2CYBA 3EZGA 4DBLC 3D8TA 1F0YA 4X84A 3OQHA 3LPNA 1HXHA 3GJ6A 4R2MA 5FPTA 1XKXA 3C8HA 4MLCA 4HT3B 1K2WA 3HS3A 2JEYA 4P31A 3UIEA 3DOJA 1RFLA 3FPCA 1OLSB 4CMEC 2PV0A 2XKJE 2YVLA 2H8GA 4FLEA 3V8BA 3NBXX 1WABA 2PMCA 3AEKB 4PYIA 5CXQA 5P21A 3UFBA 1GPAA 3DP9A 3H1TA 3LUKA 2ZPTX 1WXXA 2PGAA 2PVSA 3BOSA 3NP9A 4GEKA 4P35A 3NT4A 3JALB 4ZANA 1Q0UA 3A11A 3OQIB 4CNBA 1I1NA 3PHJA 3S1SA 3SIXA 4HYQA 2ZTLA 3HUUA 2HU8A 3C3WA 5C46F 4JASB 3WWEA 1FFEA 1YOBA 2GPBA 3Q7EA 4R9UC 4H15A 5KHLB 1WSAA 4CL2A 2EIHA 1RAIA 3KVVA 1QG6A 1LNSA 2G9VA 3MJCA 5FBKA 2G80A 1F60A 1DEAA 5UKDA 5CXUA 2X42A 3PC3A 1P0QA 5GONF 4N9WA 1QYDA 4NCBA 5L95A 1N2GA 3ORFA 1XJQA 2C20A 3Q7QA 3MLEA 2FVXA 4II3A 4WACA 3VH4A 4EPRA 5HF5A 5I9LA 4AKTA 1VL8A 2JH9A 3CBQA 3H5TA 1EVJA 4RTNA 1IIRA 4QGAA 3IILA 3K72B 4L6IA 1S9HA 1VB3A 1BW9A 3L92A 4TL6A 2BBTA 1DJMA 1D4FA 2X7HA 4TMXA 3F71A 2HA7A 4UHCA 5JSZB 5I8ZA 1ZN2A 4B76A 4DDUA 1Z74A 1RD4A 1S2DA 4ARAA 1NJSA 3ILYA 2OBBA 2ZIXA 1N2JA 3KKKA 5DV9A 4EHJA 4LTNA 1LSOA 2Q28A 2R5WA 4M76B 3O2SB 2ID4A 3Q6IA 4B31A 4FWBA 1ODSA 2W2MA 2ZPAA 2QTVB 3A1UA 4GHWA 3TIGA 1HRKA 4HRXA 221PA 1U6KA 3ZI0A 3BF7A 4ED9A 4HUQA 1CFZA 3OCCA 2P9JA 2FZWA 5CD9A 5KOYA 4QICA 4HOYA 3F4KA 3ZDEA 1K5GA 4KFTA 1J1UA 2NO6A 4FFPA 1OF1A 2GEDA 2HNAA 3PQ5A 1CKEA 2PT9A 4BRZA 4EAAA 4EO9A 5JSUA 4XJVA 1O77A 5FL7A 3TCXB 3FNFA 3FBWA 4F8EA 4JI1B 4PAOA 4DIUA 2ENWA 3DUWA 4KPGA 1GA6A 1EUCA 1RWVA 2E89A 1TKAA 1Z0JA 1RHMA 5I7SA 1QFZA 3COJA 3CLRC 4GDFA 1CY0A 2B9EA 3NATA 5C81A 2P1DA 3IELA 4CDRA 5ABPA 1K0FA 3ZHOA 2PO5A 4BS9A 5C8YB 3O9ZA 2IX3A 5ARCA 3PXCX 3CWCA 3M9LA 2BOVA 3R23A 5H4HA 3RRFA 4DQXA 3SYNA 2LPMA 2MSEB 2Y3IA 5D5HA 3V2HA 2XRYA 3FUVA 1GNVA 4H7HA 2HT6A 2NZWA 1D5CA 3SZGA 2IOYA 4F4IA 5KX5A 3ZVMA 1D5WA 4MPTA 4BAGA 1ONNA 2ORIA 2GN6A 4FUTA 5EKSA 3TBKA 4C0WA 3TBHA 5AKXA 3BUSA 3EZYA 4ZDJA 1VSTA 2AXQA 1B93A 1J5XA 3IE2A 4J1SA 1B41A 4K2HA 2ON6A 2V97A 3IQIX 4O1HA 4BZXA 3K31A 2VT3A 2JLVA 4I6EA 4ZYYA 4QATA 5ERGB 5F77A 2I6SA 4H0CA 3IDFA 2ZI3A 1UR5A 2OV8A 4OL0A 1XNQB 2WMDA 3A6DA 3TQQA 3UQZA 4FBGA 3ICEA 2AOTA 1G9XA 3OKAA 3RUAA 4Q9KA 5M34A 1RJGA 3BGOS 5GJCA 5COBA 1ULTA 1RAAA 2GD1O 1EEHA 4ZXFA 3C7KA 2A7XA 2ZT8A 1ZD4A 3IQFA 3CEJA 1H2HA 4BFWA 1A4XA 2DUUA 2G36A 2PGXA 1G4UR 2JFQA 2X86A 3MJVA 5FPKA 3WY9A 3LPLA 3TKYA 1QZXA 1T3TA 2X13A 1CF2O 3UATA 1K98A 2A59A 2PKCA 3BH7A 2JC3A 3C1UA 1ACMA 4D6XA 3RUEA 3GPIA 4PINA 1S2OA 3N3BC 4NMLA 3T41A 4CM9D 3R9WA 1SXJC 1XC7A 2FSFA 1IUNA 3HACA 3HB5X 2O5VA 3OFNA 1GEEA 4YROA 1LDEA 2CFCA 5DP1A 5H9VA 1A27A 4LOIA 4E03A 4J0IA 1QU2A 5CT8A 2AJBA 2FPGB 3ZHVA 3GLQA 3NFYA 4K7JA 4TOIA 4M55A 4AFNA 5I45A 4RVUA 2QUAA 2H6EA 1GZ4A 5A6SA 4IUYA 2V59A 2PU7A 1E1CB 3ENQA 4UBKA 4PO1A 4DHEA 4NBSA 3RDPA 3OQVA 5CRIA 5JJCA 2BFFB 1H6AA 4HX9A 2E0IA 3PRKE 1GADO 2BKLA 4RHTA 4H6XA 3DDOA 1WSBA 1F7UA 1VHQA 4KACA 2VQDA 4IO1A 1XEAA 4R31A 2G8LA 3JZMA 4JUBA 4DCNA 3P9ZA 1I7LA 1A9TA 2YVKA 3BK2A 4A5SA 2W6NA 3FFXA 1KJZA 1R4AA 3GEMA 1G19A 4KIFA 1F8GA 4R8KA 5B2FA 3L4SO 1P9OA 3LPMA 4TMFA 5AKKA 3U16A 1B6TA 2EJWA 3NOOA 1AKMA 5CPBA 1CVRA 1QQTA 2L82A 1SOMA 2Q3BA 1C9MA 1IRIA 2I0FA 4RV5A 3OE5A 2G40A 1WWKA 4C3UA 3IVGA 4Y8VA 5DBIA 2AF4C 1UOQA 3WKEA 3BT7A 4II2A 4RDXA 1NU6A 1X7DA 1ZM7A 3USES 1C7JA 2PMEA 3N1UA 3E9MA 1U9ZA 4Q9HA 3IHWA 3DDHA 4RCYA 3LKZA 4GUDA 3KSUA 2PKEA 4FXPA 3PGMA 3N07A 4TLMB 1XHLA 2XADA 5L6MB 3WIUA 2NG1A 3MAAC 1JYFA 3G23A 1QDEA 3IE0A 1EXDA 3SS7X 1PSDA 4E4TA 4Z54A 4AN0A 1G20E 5CM9C 1CS0B 1B15A 4BX3A 3WFZA 2XZDA 3CEHA 1EVEA 4QASA 4CIVA 2QTTA 1A9ZA 2JJYA 1NRXA 3ICVA 4INOA 1CIJA 2XVAA 3JR3A 4NYIR 1U0BB 3TNFA 1XHFA 3AO0B 4WECA 1EP3B 1R0XA 2PS3A 4J1NA 3KLOA 4I9HA 2IZZA 3B9QA 3R3JA 3KV1A 5DEIA 1FBTA 4YHBA 4B45A 1A04A 2AI2A 2VTVA 4E5VA 1XPRA 2A5JA 2O50A 2AEJA 1NOIA 1DKOA 1NP3A 3P9QA 3V2GA 4A2WA 1KMIY 4DA0A 3DOFA 5EY5B 2JLAA 3GJ4A 2ARKA 1ENYA 1VB5A 3FWNA 2CNLA 4QPPA 4U02A 4DYVA 2XWBF 5CHEA 1QVAA 4YJ2A 3TXXA 4E2WA 4F85A 2ASVA 5DNCA 3N70A 1XDUA 2ZAOA 1M1YE 2IYWA 5CH8A 3P7MA 3HYRA 1ZS9A 3PT5A 1L7PA 4BMSA 5DWVA 5AI6A 2XEXA 5TSDA 5FV7A 2WJ6A 2C5BA 4HADA 1UWLA 3IQXA 4ARZA 1KO4A 4YR9A 3B9BA 2PXAA 2NUAA 4D4LA 4HXFB 3O8RA 3NHFA 3KPUA 1JEQA 4TKUB 1WXFA 4N6NA 5A6VA 2XB6A 1LRJA 2AT1A 2ID9A 1E7QA 1N6RA 2V7XA 3EE6A 4Y7CA 4EHAA 4AS1A 3LPCA 4FR5A 1RZUA 4EG5A 2HI0A 1ISIA 3L1UA 4ZVRA 3LNTA 2QPAA 2O59A 4KCGA 2W58A 2W2LA 4MO9A 5KTSA 4FFNA 4LWOA 1ZGBA 5LDGA 1RPTA 4TKLA 3T4EA 3JR7A 1EE9A 3ABRB 4E32A 3T3PB 2VHTA 1Z13A 2I6FA 4Z0NA 3IP8A 1JI0A 3ET4A 2IUEA 2QVGA 2WE7A 3D1JA 3IMEA 3P32A 4NK5A 4J29A 1V95A 3DHYA 3UA3A 1XQXA 3GFVA 5DCYA 1TD9A 3T4XA 1FL9A 2F6RA 1QF7A 3C7CB 4N5IX 5EMKA 1ZC3A 1NMEA 2PZEA 2Q4EA 5BMVA 2PUHA 5CEJA 3HJFA 3P2EA 3RVQA 2XTNA 1S01A 5KJ1A 4KREA 5T5QA 1ANKA 2R8EA 2J30A 2G5TA 2I4NA 1P0CA 4GBED 1JKIA 4JT4A 3DKKA 1TA4A 4PZZA 1Z2NX 2ZRIA 4OUKX 3KHSA 4RH1A 3ETNA 4MV8A 1JHMA 4ZEOA 3CN7A 3BSWA 4MUEA 1M6VA 4CQLB 4NAHA 1HFJA 1OHHD 4Y2UA 1U63A 3T94A 2JIQA 4X45A 1V1MA 1UXKA 2GLXA 2GVNA 2QD1A 2CHUA 2FSUA 1YASA 4HQFA 4J16C 2IU0A 1XJWA 3A1VA 1Z4JA 4XASA 1S2MA 1B73A 3UMFA 4XUEA 3AR3A 1WRBA 3RSOA 1AUQA 4GBJA 2D8AA 1QIMA 2HWYA 4MMZB 3L9XA 1B0UA 4AIIA 1YKGA 1YVRA 2W2VA 5KWIA 2QMYA 2XGOA 4YWHA 2C94A 1Q17A 3KSRA 1O95C 1DJPA 2C1EA 4LXTA 2HSDA 3BKWA 1ITZA 1D2CA 5BT9A 1ZNQO 1VE9A 2Q5HA 4ZI7A 5AIAA 3T1OA 1C30B 3BL8A 1GGJA 4KN8A 3IUEA 1DAKA 4Z99A 5LSAA 2CJPA 2NP7A 2CUZA 3P4UA 3KXKA 1JIKA 1T36A 4Q18A 4UM5A 2G09A 3ZJ4A 4BDTA 1ZMTA 2TMGA 3EUEA 3QQ5A 2H2DA 4CEHB 4CCSA 1OH5A 1P6XA 4JL6A 5KUTA 3SEFA 1C3XA 4GG1A 4FJ2A 1ZXLA 1WY5A 1HDYA 3EUFA 3F6YA 1W5AA 3FJ1A 3O82A 3TRJA 3W5VA 2DP4E 1MP0A 3ZGOA 3RVJA 1YWGO 4M38A 5ITZA 2ZSIA 3L82B 5BYAA 3IL2A 1NY5A 3K09C 1A7UA 4RVDA 3Q98A 3OTOB 3PTLA 1GPWB 1N2EA 2YWXA 3L8DA 3KT6A 1RLTA 1IQ0A 4MDHA 4TSFA 3N8NA 4RTMA 4C06A 3HBAA 4NENB 2VYQA 3QLUA 4LYEA 6CHYA 1YCHA 3QOFA 2VT7A 3NS7A 4AF7A 5LDDC 1I6KA 1N2OA 3RS2A 4G1FA 5I9NA 3CWZA 3I01M 4JKIA 1FJXA 4AZVA 4Q3OA 3WWYA 4ZT4A 2OBFA 2P40A 1F17A 1JKJA 2MSLA 1B6SA 3G8AA 4PSUA 3VR0A 4C2AA 5KINB 1WBBA 1MLDA 2X4LA 3GDWA 3HXPA 4V0NA 2WIAA 4MGKR 5LZ7A 3V4LA 1XAIA 3RYCB 3B36A 1QP4A 3DSRA 1UMCA 4X64B 5K8LA 2YWFA 4BE9A 3O84A 4TTQA 3UXMA 2OFFA 2JLYA 4W5TA 2OBXA 2YJTD 4ZXPA 3O8DA 2CBGA 1NNLA 3WHKA 4ETWA 1HO3A 1YBFA 1O58A 3IB3A 4RTJA 1OVMA 4D3ZA 2IU6A 3Q3CA 4G09A 4MX8A 3WYBA 3KVYA 4IGKA 5BP7A 3SPXA 3PL5A 1Q57A 4C4PA 2VI5A 5A3QA 4DIFA 3K94A 4F3RA 5BXQC 3KYCA 3E8MA 1U0EA 1YZKA 3GJ5A 5IJ0B 2JAQA 2X5KO 1EDDA 3STUA 4DTIA 4EA8A 3L0BA 1JFLA 1U8EA 3MC1A 4CJXA 5DHRA 1R4MA 3F5FA 2PRZA 4N8EA 4WI1A 2K2QB 1R0WA 5AW5A 4YT8A 4IG4A 2J9YB 5DXAA 5H81A 1XPOA 2CL6X 4EEXA 3YASA 1SD5A 1PJ2A 3OTIA 1PFQA 5IBQA 2H85A 1Z56C 3QZUA 5CFQA 3NM5A 1EH5A 1YL5A 3RIGA 1U11A 1H1TA 2IXDA 1UEJA 3ICPA 5CURA 3QRWA 5CA0F 6REQB 1ADYA 3E3MA 2Z43A 1XFAA 3DT9A 1WPRA 1L4YA 1LJ8A 2G17A 4P4SB 1W7AA 4AJHA 3PV0A 1YZQA 2Y1CA 1V47A 2C1ZA 2JLBA 3U2QA 1KK1A 1OXKB 1S4QA 3GLSA 3OTQA 2ZR9A 3KR2A 1LLUA 2I6TA 3QKUA 3OE4A 2GN9A 4J2OA 1ZAKA 3WV4A 1YUNA 2FPIB 2DC1A 3EIWA 4HLNA 3BTUA 3CRW1 2ADOA 2ODQA 3VI3B 4F4CA 4BJHB 1A4IA 3EZLA 3HN2A 3TGPA 1T3HA 4HAZA 3UMJA 4Q7JB 1U02A 4D9NA 1WKCA 3SMVA 3OX3A 4V38A 1GZ7A 2CXQA 3SFTA 1MJNA 2XMRA 5FFNA 3TAHA 1JFFA 3Q3JB 4BXOB 3LXMA 4M9ZA 2EJCA 3FOZA 1J0DA 5I4IA 1E6EA 3K20A 2QQEA 3L9WA 1DAIA 1XD2B 3K1AA 4B34A 5AQ1A 1US8B 1HURA 1HORA 3I9KA 3PPIA 4YK7A 4ZOLA 5TPWB 4B2PA 1WNTA 2ZSHA 2W6MA 1BROA 2C2KA 3E70C 4B2IA 4EY3A 4KHPB 4KN5A 1I7PA 1Q7BA 4AZTA 1FDIA 2WWFA 4TKVB 3JWIA 2OCKA 2R87A 4I3FA 3OTHA 4NCIA 4CQMA 2PL5A 3PSAA 2H31A 2HC9A 3QKSA 2DOKA 4P2GA 3Q1KA 2VJMB 1AB5A 2VDJA 3ECCA 4GXNA 3DVAB 3MRSA 3C5WP 2O5CA 2B92A 1CUCA 2NU9A 4GNKA 4DR2B 4FFSA 1NN0A 1WB6A 5FOSA 1I3OA 1QIGA 2FQQA 3FGZA 4RY9A 4B8YA 2BCGY 1WU7A 2NYRA 3HCFA 2C4UA 1C3LA 3HUDA 3LO8A 4H18A 5E2AA 5DBGA 1JUDA 3IRUA 4EFLA 2O8EA 1K4YA 4ZQEA 1FSZA 4QECA 4HQ0A 4KFCA 3E2PA 2OMEA 3DKVA 4P3XA 1I13A 3FFTA 2QW0X 4I5EA 2NU6B 3IVAA 3HDYA 4JL8A 3VM6A 5COQA 3B9RA 3OI7A 4CHGA 2FEAA 1DBSA 1KO8A 1NLMA 5KX5B 3V8PA 1ZI8A 3R6LA 1OYYA 1EMDA 1JJBA 4KZPA 1MN6A 1QRAA 1SVLA 2Y4NA 3E9DA 4HWPA 4JP3A 5EOVA 4V0RA 2Q2QA 5H70A 2RHTA 3EFOB 1MG5A 2WUDA 3WJ7A 5KTOA 4Q9LA 5I9BA 2L42A 3JU3A 1W52X 2RHRA 4XYMA 5ALRA 2M2IA 3KXIA 2GF2A 3DLAA 4LNUA 1HDCA 4WOKA 3BG5A 2BLNA 3VX4A 3KQHA 2PMFA 4C2BA 1H2EA 4ZVOA 3R6DA 4MW0A 2NSDA 4MVCA 4Q3EA 3AJ8A 2CLLB 2XYRA 3V6MA 2Z4TA 4LDQA 3UMYA 4A73A 1YS7A 5BWBA 3CBGA 3SOZA 3RVPA 1JG2A 4Q93A 4D41A 3IV7A 2RJOA 3CR3C 1SK8A 1QVVA 3AQIA 1XAJA 3R3UA 1H2BA 2AWOA 2IGBA 2H7VA 2QN8A 2YV3A 3LQYA 2ST1A 3PJGA 4WY2A 3VSCA 4B6OA 4I08A 1H4TA 3RCBA 4KXYA 3IC5A 3WBBA 3CE6A 4B33A 1W88A 5ICCA 3VR2A 1N36B 2A1TR 3RBXA 2VHQA 3QOXA 2IWRA 2JCYA 3DAPA 3MCTA 1F8YA 1KOJA 5I4CA 2Q6LA 3VOSA 1JECA 1EFPA 1XCLA 4ZAFA 5JNWA 3I9V1 3EC1A 1XN1A 2JAHA 3EHDA 3JZIA 2ODTX 2W8BB 4KUHA 5A5GA 4DL9A 2BEUB 4P4LA 5KNBA 3H19A 3BBLA 3P2MA 3TBFA 2OOSA 1JLRA 1YIDA 5C9ZA 4IFTA 5F73A 5ETJA 3AR7A 5CM2Z 4DUZB 3PRYA 1EFVA 1YR1A 2QKYA 5DMXA 4LZLA 5LU9A 3BVPA 5B4UA 2X2EA 4X1IA 5DJ5A 3FCYA 3AETB 5FTLA 5KNCH 5FT9A 4KSYA 2DKNA 3AY0A 3KR9A 4ZT2A 1XOIA 1J99A 2R1UA 4YO8A 4UCXA 2OC9A 2H59A 4FS8A 3BTSA 3N2EA 2ZG6A 1GGMA 1XVLA 2R1TA 1DUVG 4MMYB 4L0MA 1EBUA 1HK7A 4OUDB 4D0LB 4JOBA 2RI6A 3EXG2 1H3NA 4H3SA 4K81B 4HB2A 1M33A 2A0UA 4FQ7A 4L3OA 3ANSA 4D96A 4EABA 2X6RA 4LEIA 1GU7A 4RVHA 3RANA 1ZJ4A 1WLYA 3MWYW 1EP2B 5K8IA 3HCEA 1IVYA 2AJTA 1W5TA 2GMWA 1VBFA 1PI3A 4RD0A 1P0IA 4JFRA 3ZWCA 2H2FA 5EZ6B 1NBMD 2JJ2A 5EHQA 3WSWA 3RV4A 2IXAA 1AVTA 5FTWA 3VH2A 4K9NA 3GYGA 3ZIDA 5JHHB 5KX5F 5IHPA 2A9PA 4QBFA 2IV2X 2WKQA 4CM3A 4U2EA 4NBTA 1C3OB 4TWRA 3E9RA 1LLDA 3PFGA 3IA2A 5FLKA 1CRLA 3P52A 4E51A 5G1OA 3P9RA 1PL6A 2ZIFA 3K2QA 5ESDA 1E61A 3TR5A 5LU8A 4GKJB 2EDCA 1GUYA 5DYWA 3UNXA 5BW6B 1J8QA 2C9YA 2KM1A 1CZHA 1BHQ1 3H5WA 4MVYA 5JSFA 2BPOA 4GPD1 4CN9A 1UPCA 4OP2A 4QXAA 4DMLA 1YVUA 5J63A 3F6CA 4RTOA 4AK9A 3QH4A 3V1NA 3PC6A 4FLFA 2GILA 4FOPA 4HX2A 2OLEA 1PL8A 5JAHA 2ZROA 2QAIA 3O94A 5I7UA 1N0VC 5CG2A 1YONA 2I29A 1WPQA 2JCSA 4DZZA 4KPYA 1E2JA 4LX8A 2ANBA 1HNXB 1PX2A 2WHPB 1NI4A 1XJ0A 2O1WA 3T7CA 4LY3A 2DZDA 1KH2A 2PY6A 4KXVA 2BFOA 2GFQA 4O59O 4YAFA 5BW8A 1G0NA 2BMEA 2V5UA 2E37A 3DB2A 2EZTA 3SHVA 3FUCA 1TCCA 1SUSA 3AJEA 1CNMA 4LYAA 5JVDB 3PD0A 4L9SA 2H0AA 3VGJA 5KNDD 3RTDA 1IZ8A 2BUCA 2ZRDA 3RUFA 1UK8A 4BNDB 4BO2A 5JY1A 1N5DA 1M5TA 4HTAA 1JF8A 3PD7A 1SBIA 1J22A 1ETUA 1QGAA 2DTDA 3QVGA 4LQDA 5B37A 4ENSA 5K0JA 3ND9A 1USIA 2BFCA 4R2KA 4F3TA 3PLNA 4XGQA 1Y8AA 1C7EA 4MB2A 4FDUA 4I4CA 4D9IA 2HFJA 4RWZA 1QHHB 3KUXA 4D4JA 4XLLA 5IC5A 2BSQA 4X8OA 5L3QA 5E9JA 3PUHA 4IV0A 1PJ3A 4B8WA 2BFBA 2I4MA 1Z4OA 4TMYA 4E0BA 1V7ZA 3NYQA 2CFOA 4RQBA 2YIJA 3H2HA 4FFWA 4EYSA 4E22A 4LJ9A 4JKOA 3ZGXA 3ER8A 1N6PA 1EJ0A 2ZVPX 1A2OA 4Q3KA 2VP4A 4AS2A 3RU7A 3ZGYA 3LX6A 5BSWA 2D74A 3M5WA 3P5SA 5DP2A 5LD2C 4HWKA 4JDPA 3C70A 3BD6A 1EBFA 2PFKA 2H7CA 3K9FC 1GFIA 3RROA 1XQVA 2AFIB 3PR1A 5DHAA 3ZJ5A 3ZI4A 5U9CA 2ICAA 4RD4A 4PQYA 5LQRA 3ZU3A 1I6MA 1YGPA 1OBFO 2E6KA 5JJLA 1CB7A 1Q0HA 1E3QA 5B3JA 3LMKA 1UKBA 4P7BA 1NUHA 3UJHA 4R1QA 3V8QA 2V6FA 4FNOA 1P91A 3VU9A 1R5NA 4BNVA 2XUQA 4XCXA 3HTXA 4H08A 4M53A 4R1MA 2GASA 1PV2A 1NMSA 3N2GA 3GCDA 2WIDA 3TLYA 5KTMA 1XLVA 5IAAA 4HLQB 4ZGWA 1TJ4A 3ZE1B 2C7GA 2P6MA 1VRCA 4GBMA 3U31A 5HIAA 3SDSA 4ZVMA 3HI4A 4EFMA 1U2PA 4OYHA 4DNXA 1UF9A 4D9GA 3GLGE 3A9TA 3K0CA 2PEYA 4CI9A 4TTIA 1HTWA 4INAA 4ROTA 3L7BA 3SZMA 3NORA 3TAXA 3CUKA 2OC4A 2OEPA 2Q8QA 4AZ3A 1UBOS 1YU6A 5ALOA 4ER0A 4QUAA 1DAPA 1GFWA 2BDUA 2YBDA 3LUPA 4OREX 4W7HA 4YJ2F 4YQFA 1TIBA 1JWLA 4QGHA 1S6YA 3CRMA 4NJMB 1WOYA 3TZBA 5BV7A 1L7DA 5IK2A 3LBYA 4FC7A 3TSOA 1Q16A 3AEZA 1G3UA 2WJPA 1VLZA 4B3DA 3HO1A 3VC3A 1TYZA 2E1RA 2PMKA 4IDCA 4UQOA 4CZ2A 5CIYA 4LG1A 1M34E 3GUUA 3L0DA 4HEJA 4PYMA 2X58A 3VUEA 2NUBA 4OI2A 4RK6A 1Z29A 5KQLA 1R66A 5DYGA 1DV2A 1ML4A 1U3FA 3Q8XB 1JJFA 2BF4A 4WEQA 3BULA 5CNJA 4DTCA 1XRQA 3IP5A 4PFQA 4Y2YA 2JIMA 2Z4SA 5ALYA 5BNIA 3HXMA 1J0CA 1AKUA 2Q6OA 4FSDA 2V7QA 3ORHA 3DD1A 3QTTA 4QLOA 3FFAA 4FX5A 4HNQA 4AKHA 1M1NB 2FUNB 4IDAA 4RY8A 4ZZ0A 1YJ5A 3DW3X 3F4BA 2R2AA 2JKVA 4JH0A 1IBRA 2O5RA 3EOBI 4A26A 1T2CA 4ZZ1A 1U3WA 1H8HA 4FEYA 4ZV9A 4I8XA 1R37A 3CTMA 4MCJA 4EWLA 1U6JA 4CQNA 4HDNA 5IJAA 3OHSX 4EFKA 1EVLA 3G0IA 2Y67A 4IX9A 5G1NA 1P0FA 4EHDA 2IS1A 4ZRDA 4QA9A 2VPXA 1G9SA 3ZCVA 3W5AA 4ZQBA 2FW7A 1NVWQ 3WLFA 2X77A 1B2RA 2HWKA 2ZJOA 3OLWA 2GRUA 1A8QA 1UZAA 2E3JA 3AJAA 3QSYA 2H63A 4JJKA 2R6ZA 4F60A 4H3VA 4C7MA 5A62A 1IBSA 1KH3A 4U2FA 5HW0A 3AI7A 3WO0A 1E6KA 1EQ2A 4HTFA 1MV5A 4AX8A 3BRWA 4IQ0A 1VECA 4M0FA 3RRXA 4TYMA 4D92A 5E3IA 4E15A 4D3XA 2WP8J 3N0XA 1E2EA 2PUBA 5CA1B 3RBZA 1CQJA 2J9FB 2JA1A 5GZ6A 3SQDA 2P8SA 2ZAIA 2O8DB 2GA9A 3VO2A 2LE0A 2WU8A 3O4FA 4MS1A 3UC5A 3R0QA 5DNYB 4BLWA 1U2GC 4GVLA 1L7OA 3VR6A 1GQOA 3NVDA 4PTLA 2HJRA 2CNWA 1Z4MA 2O23A 3ABQB 3F7OA 3KOXA 5B6IA 3DBRB 1ZD3A 1FLAA 1HTBA 3ODPA 2JF0A 4PRKA 4BRSA 1QJCA 4HGPA 1A9XA 2YFKA 1UFQA 4WGGA 4G6ZA 1XMXA 3VI4B 1H2WA 3C39A 1PZHA 4KLAA 4RF5A 3VR5H 2Q1WA 4N76A 4DQ0A 4FWTA 2CDCA 1LF5A 4EDFA 2UXCB 1T1RA 1BXKA 3E48A 1NAIA 1OI3A 4O29A 1VLLA 2ETXA 1AKWA 3R7AA 5IJZA 4LXYA 4MA0A 5A5EA 1Q91A 4KITB 4MUKA 4IDEA 3NBAA 3W9SA 1I2ZA 2VDRB 3LQ4A 2ZSKA 4KQCA 3PGLA 1WA5A 3LW8A 5FBWB 2LGJA 4XWOA 1YZLA 2G9ZA 2PX2A 3FHOA 3M6MD 4QVGA 4RSMA 4GMDA 5KOJB 3OZGA 3EGIA 2VJOA 2ZBPA 2Q0QA 2GGSA 5KBYA 3LP5A 1NVUQ 4J75A 1XP5A 1T2VA 3ZV4A 2W71A 4PLPA 4XRGA 5B58T 4QYTA 1PW7A 1I9GA 1YULA 1Z16A 4W9RA 4WJZA 2WD7B 2XNDD 2VLIA 4C43A 1CUZA 4MPPA 2AL7A 1EX6A 3IJRA 4LUCA 5T3YA 4K0KB 1SVNA 1R3DA 2WWTA 1YXMA 3I9V6 3EJWA 4WZAB 4RFVA 2WWXA 5EPEA 1W0KD 3ZIAD 2JIPA 2JGDB 2OB2A 4Y9DA 1K0UA 3E3NA 1GYPA 4OYRA 5CR9A 2DULA 3R5FA 3H6KA 5FIUA 2XWPA 5LVAA 1GDTA 4HV4A 2ZB2A 4BC1A 3BMNB 2E6UX 1QZUA 4KNWA 4QBKA 1FDSA 1P7WA 3LYUA 3WP0A 2XYHA 4TUYA 4B35A 4YS6A 2NP6A 1E5QA 2F55A 1Q0TA 1JMKC 3FW1A 3JWPA 4OY3A 4ZOEA 3P2IA 4X0EA 4JT8A 1KMHB 2EG9A 2BMVA 1XL0A 1XXLA 1GTVA 1ZPDA 2QJRA 1QYCA 1K3UB 1OWMA 3EF1A 3GIWA 3JQ6A 1YOVB 3MPUA 3EXEB 4FWIB 2CHEA 3B6JA 3JYPA 1MB3A 5H80A 1ZCBA 1ZAYA 4PY2A 1KPGA 2W43A 2OXCA 5LJLA 5SY6A 2O06A 3EC2A 4JUCA 4UULA 2VPTA 3UT0A 3ACDA 3ZWKA 5CB4B 2VOJA 2AV6A 3GU3A 4M87A 3SC2A 1YHNA 5HRCA 4LK2A 1G38A 1SBQA 2R6CA 2W6JD 3GNTA 4JX8A 4V0MA 3ACCA 2ZBVA 5LLSA 3AUFA 3OJEA 4UE2A 3U0VA 4FGZA 3QNWA 3NBMA 3SHWA 1MKYA 4R8MA 2A58A 2HXYA 5IN4A 2H07A 1VBKA 1E0JA 4D79A 3BE4A 4MR7B 2RK4A 3GNSA 4RKYA 3NCHA 1RRPA 4F4DA 1CDDA 1HFWA 4BIIA 4EHIA 3KOZA 4NHOA 3H7AA 4HGRA 3TR6A 4YV2A 2R2GA 4DT1B 5HQ3B 1C1DB 1G66A 3BRCA 1JSRA 3LL7A 5K0EA 1FYWA 2CVHA 1R8JA 4N65A 3V1TC 1I30A 4ZCSA 3UN1A 1CDOA 5IVIA 4IVQA 1EP1B 2ZQZA 3PDWA 2Z83A 1K9VF 4JJ6A 2WABA 2TMYA 4YJFB 1KBOA 1FYEA 4ZU6X 3RW9A 2GO1A 3EIQA 2WLSA 3LNCA 2VF8A 4KJXA 3ORYA 4AZ0B 3CB2A 4EFNA 2IK8A 3PE3A 4WJLA 5AVTA 5GJBA 3G0GA 3QBVA 1HT1E 2IZ6A 4RTLA 5I5GA 4A9AA 3ZUGA 1XLUA 4BB5A 5KI6A 1RBYA 2DFDA 3IDZA 1N5LA 3CZRA 4MUYA 2W2KA 4IX1A 3MA0A 4LSZA 4HNAA 1NXVA 3PDUA 4OATA 3K8YA 1E1RA 3HFRA 1E2HA 2B78A 3M4JA 3T7RA 1MQAA 3G49A 5J5CA 1ZBDA 1JZQA 5KWJA 1VLHA 4ZODA 3G5LA 5DGXA 1K5HA 5BWMA 4RPLA 1RDFA 4OQPA 4YP6A 3T9DA 4B85A 5KYNA 4RMJA 2YIMA 4LYYA 2GWHA 4KGXA 2X8WA 4ZOLF 5JS8A 2YHIB 5HOEA 1IN6A 2I8LA 3RUCA 1F4VA 3TD2A 3A7EA 3F8SA 3C98A 3I53A 4E3ZA 3Q8LA 4JITA 1ETHA 3LWDA 4Y0AA 5HS6A 1Y5RA 4QDXA 2RKBA 3IB6A 3FOBA 2NSHA 3K2IA 5ELXA 1U4SA 1VIMA 1W8DA 2I7VA 3N3AC 4YJGB 3H2ZA 4OFWA 1QRSA 2QUJA 3O47A 3SXJA 1COWD 1MCZA 4UEQA 1U0TA 2NO9A 3AERB 2LWIA 2OUIA 5COAA 3RIEA 1MRNA 4TMTA 3ZU5A 1TM2A 4ZIRA 5EKXA 3WK6A 3ZD6A 1G8MA 4AQDA 2JKZA 3VNAA 4Z9FA 2WV7A 2APJA 1JLKA 2O8CA 1TLFA 2IYNA 1GQYA 1OZHA 1GD1O 3BHMA 1SOVA 4JOSA 5DN6A 4A10A 1S02A 1NMYA 5FJIA 1VPEA 5KU7A 1J0BA 4YRZA 3X1JA 1WG8A 1XWFA 3I42A 3FIUA 3OBIA 5BV1A 2ZU6A 1I8TA 2R9VA 4DIBA 5J40A 6GPBA 3MHPA 1WUJS 4XR4A 2DCUA 1Z5PA 4S1TA 2I33A 3H3FA 3H0EA 4CF5A 4FJ1A 1ODIA 4EEKA 2PS0A 5D3QA 3VJRA 3MT8A 2CE7A 2FKAA 1YZHA 4RCZA 4M1EA 1PRYA 4EUEA 2Y71A 1U1IA 4OGKA 2WIGA 4FDMA 3FYUC 5J9FA 4A27A 4B6GA 3WRVA 4IJMA 4D3SA 4KR7A 5EZ5A 3ZWYA 1Y8RB 2FN7A 9ATCA 4BFVA 4OJTA 2OT3B 3GI1A 3GT3A 1EFKA 1QFXA 3K05A 4UD2A 4FI3F 3RR2A 3K5IA 5ECYA 4LI3X 4JYMA 3ZCPA 4W5RA 4K87A 4LZJA 1VSVA 1H1LB 4FDLA 1D9XA 1LPBB 1JP7A 1M67A 5FOQA 1KORA 5G4KB 1SKBA 2WZCA 1E6CA 1WZ2A 2WHRA 3GQBB 4AROA 1AT1A 3MELA 4ND8A 3N05A 3R09A 4WNCA 2VHEA 5EMLA 4B71A 4GDMA 2DBQA 1GG5A 1Z36A 3NHWA 4BLOA 3FKQA 3HCNA 5JSQA 1LW6E 2QU8A 3T7SA 3DULA 2DQZA 8GPBA 2Q0HA 1KWGA 3RRBA 4O4IA 4HCJA 1N8NA 4IDNA 4YTEA 1KKMA 4BKRA 1JAXA 1TAHA 5FXMA 2LBPA 4O3MA 5EIOA 3NNDA 2AFHE 1S5PA 3BGWA 3R40A 5K4GA 4Y30A 2HEIA 2YVAA 2WVJA 4BNJA 2GF0A 3T3OA 4HWRA 3FTEA 5EHIA 2QVLA 3DCNA 5MF6A 1O9HA 4ZI3A 1TJ3A 2PU5A 3LK7A 3FWKA 5JAMA 2BV3A 2F8MA 1CS4C 1WBJB 1XG5A 3SJCA 2NX2A 3DPUA 3QVKA 3KE9A 1XTTA 4PSVA 4WNAB 2R8XA 1NXPA 3LFUA 1E1KA 3K15A 3KWJA 3PHHA 1BA2A 1QDLB 1F3OA 1OYWA 1W4LA 3MB5A 1RNLA 2HRBA 3CGWA 2PJZA 3BK1A 4DG5A 4AUKA 5IJ9B 3BFPA 3QUBA 4DCVA 5TMPA 1A9QA 5ULLA 4DAOA 1ZH6A 3WIBA 1RXWA 5IT0A 4FLMA 3MB8A 3BFJA 2ONKA 1E2FA 1GU0A 1QTRA 2GHIA 4D3FA 1NZDA 2V03A 1X7XB 4J0DA 4QE3A 4US1R 4AY6A 3NI2A 4QC2A 2FKNA 4NOJA 5IYZB 2BBOA 3ND8A 1XNHA 3P71T 3V00A 3CURA 2Y0EA 4HHEA 1P7VA 3LDFA 1PP4A 4FQ8A 2HF9A 4YGXB 5G0TA 1K92A 3HU3A 3ENWA 4R68A 3ZH9B 2JARA 1N6OA 2OFWA 4XYEA 4RW0A 4G0ZA 1NBIA 2DUJA 2P78A 4TROA 1LQTA 1QKKA 1W5SA 3QMPA 1TYCA 3V4ZA 3OZUA 1H0SA 3FOAA 4WCFA 4IXMA 4FONA 1YFKA 5KMGB 4FHZA 3FPBA 3DDZX 1TX4B 1F6BA 5JNSA 3C1OA 2X5OA 3GL9A 4RK1A 3AG5A 3HM9A 2C84A 4ILEA 3CSSA 4R69A 2CNDA 2V3VA 1FX0B 1XDSA 3IVCA 5CCDA 3WK8A 2FWPA 4KYUA 2HTEA 4R2IA 3MJHA 3N0RA 1KZGB 2XMCA 1CJMA 4BOYA 4OIMA 2IP2A 5AVSA 1FVOA 4EARA 2YMPA 3NV7A 2I3ZA 5TVKA 1TT5A 1K75A 1C81A 2ZATA 4DSUA 3IXMA 1YI8A 2QU7A 3B8HA 3PNQA 4QBIA 1KP3A 4FK8A 1Q50A 1WZIA 4Z3OA 2NU8B 2HOQA 3OE7D 5GQSA 4IIXA 3O0DA 1TF5A 4X97A 1N1DA 2PS1A 1D1SA 1IOWA 1MOPA 1DKRA 5D7NA 3OOSA 3D3QA 3MTAA 2VRCA 4BVHA 2PR2A 3GZNB 4ASUA 4D98A 4CIDA 1YUMA 1L4HA 3GVIA 4MRAA 5LXTA 1OFUX 4OQDA 2FLVA 2CXPA 5MGNA 2FMXA 1UBFA 3DFKA 3ML1A 4U9HS 1T9GS 2PUEA 1N2SA 2LDXA 3I8XA 5HKBA 1QONA 1BU8A 3BQMB 2ZUVA 4MKHA 1EBBA 1P1KA 1ZRMA 2WYUA 4A16A 4CLRB 4LHSA 4QYWA 1L9XA 1XLWA 3U3XA 2VP5A 3HCAA 4AQ7A 1E5XA 4FDTA 3TPCA 2ZRNA 2C3MA 3GGCA 3QJ5A 4LOKA 4KQJA 1UKVY 4C03A 3VPXA 3CSUA 3L1VA 1QZTA 3QVWA 4KPEC 4D46A 4PX2A 2Z8ZA 4KWEA 3CF2A 5AKYA 3RYHB 4DMMA 3R8CA 3PDIB 3JQ8B 1Q7CA 4CKXA 2VVTA 5AOAA 1G21E 3HYLA 4EL5A 2RGRA 1EQUA 2KMLA 2NWQA 4QOGA 2A0YA 1CERA 1GZVA 1OFGA 2AVNA 3RS8A 1QQBA 2QENA 5HILA 4Y2SA 2BL4A 3CINA 4NLLA 3U44A 4EJSC 2PX4A 2XT6A 3A4NA 3PJEA 1PK8A 4GPBA 5EMJA 3ZU2A 3JD3A 3D7KA 3ENVA 3ZYCA 3NHAA 3OE1A 1Y8ZA 3LXRA 5FYDA 1Z08A 1Y7PA 1NUUA 3RBAA 4BBPA 4BUCA 4B81A 1DRUA 2DWOA 3K9HA 3O3OB 3PXGA 4R1PA 3R77A 4ANFA 2QUHA 5DBOA 3DWFA 2CMGA 4C0QC 5BPFA 1XRRA 3GLFA 5FL7D 4LQCA 1ZJWA 3C3XA 5DYIA 4OU5A 4H6WA 4OXNA 4A6EA 2W0MA 4ENQA 1HEYA 4MQEA 2P2NA 2CMDA 4IDOA 1V26A 4BTEA 4L5JA 4K8RB 1HI9A 2Q7XA 3LOUA 3E8SA 4RBNA 1DIGA 4QQKA 3MW8A 2WWVD 4V0QA 4FCWA 1I0LA 4O4HA 2CCJA 5E8JA 2RD2A 4ALLA 1FXWA 2A88A 4OGLA 4TL9A 2PKWA 4JLMA 4O2LA 4REMA 1PZNA 3M4XA 1YQWA 1JRLA 1Y0BA 3O9VA 1R12A 5HKOA 3TDKA 5TNXA 5AVKA 3N2IA 4K9DA 1FP2A 3Q40A 1XCOA 4BFYA 3DL7A 3Q9UA 3OPVA 1E1DA 1FP4B 1LWOA 2Q3FA 2CZGA 2EWVA 1J39A 2VHVA 2PUFA 1WUTA 2QLMA 3R3YA 4OLHA 4PNPA 5JNLA 1W6RA 3LUCA 5T4FA 4GKVA 3IVMA 2Q2NA 4IV8A 3UHPA 5EP1A 3GXOA 1NLFA 1RYFA 1L7XA 4WDRA 1XEWX 5CH3A 4YUAA 1EI9A 3SHOA 1OLXA 2JDIA 2Z09A 4YH1A 3JS5A 1RI5A 3LKBA 1DJLA 1LSSA 4Y98A 3TVYA 1V9CA 1UXJA 3S1LA 3TECE 2YCBA 4HXEB 2XUAA 1DAFA 3GD7A 4FZJA 5HRAA 4J4TA 3DFMA 3A3YA 4XOUA 1NWHA 3G79A 4L75A 3RLIA 4EBBA 2F9MA 1IQUA 3RAFC 3DT6A 4BO5A 4YO7A 4B43A 2UZIR 2V45A 1X15A 1PS0A 4TLBA 2AR9A 4NX2A 1WJGA 3N8IA 2Y93A 2ZULA 2PYZA 1M75A 4MEJA 2HIMA 2ZT5A 2ZJ2A 3SEZA 5IPFA 1H8EA 5JI2E 2M32A 2IT1A 1EFUA 1J21A 2BUAA 2CJXA 3AKYA 4RV9A 5JAPA 1ZBQA 5DHQA 5FF9A 2C8VA 2VEDA 2WM9B 3KELA 3MINB 3D6UA 3DKPA 3DEYX 5AO9A 3LUGA 4RMNA 2OGZA 3OOHA 2HPZA 2C5FA 1LVGA 1WETA 1BVYF 3B6EA 5C5CA 3M2TA 2XJ4A 4RPJA 3AUSA 4WLNA 2R7KA 3LBIA 2WFZA 1OFHA 3CU5A 4WINA 2FEWB 9LDBA 4GLLA 1TCAA 4PAMA 4IL5A 1SKYE 4B9EA 4G24A 1I3CA 2FRVA 4GX2A 2W00A 1C0PA 4Q24A 2GARA 4N6OA 3IOBA 4DV4B 5EIBD 1YR7A 4ESVA 3VKFA 2R68A 2BGWA 4DJAA 1NXSA 4DUYB 5DCUA 1J8VA 1WZEA 5LWHA 4MB0A 1TF2A 2OORC 2HSWA 2EATA 3I2GA 3BCRA 2KHZA 1EFLA 3S2GA 3AEUA 2ACKA 2HDHA 1SXIA 2QI9F 1ZNWA 4BKPA 3CFYA 4UCWA 3KYJB 2VQ6A 4OYYA 1PV4A 1SWVA 3M4NA 5DXFA 3PNVA 3PUWA 4Z7NB 5C3UA 3TLBA 1L5ZA 1ZITA 1G63A 1MTOA 4RXUA 3VSEA 4PPNA 1QC5A 1E98A 1TVMA 2VZEA 4G8CA 4TXMA 1U9CA 1M3SA 2IOFA 5T8KA 2OA0A 3STVA 3NHMA 1GJRA 4ONEA 3OWOA 3E5HA 4AI6A 1IWOA 1GARA 1UBHS 3KDAA 3I62A 1BQEA 2O8FB 1V3VA 2NAPA 5SZHB 2VXYA 2G72A 1E3LA 2G07A 1U8YA 2FN3A 1OZGA 3A06A 3CCFA 4TV9F 4DLWA 4F96A 4BP1A 1QPZA 2Z98A 2Q46A 3B1XA 3KAJA 1JL3A 4N54A 1P4RA 4UAGA 2QVXX 4Z7QB 3GRRA 4M0CA 4UM7A 3JQEA 5JH7B 2HV8A 4IYRA 1JNXX 3F2IA 4WXYB 1Z83A 2PXCA 1HLGA 3PEYA 3WL5A 5EINA 1DT5A 2A86A 1NBEA 1YJBA 1J42A 2UZ4A 2HHLA 1TQ2A 3P0IA 1OUMA 1RXIA 2J67A 4Y67A 4INPA 4LIPD 2OBMA 2Y1EA 1BEZA 1E20A 2J0UA 2WPNA 2VPIA 3DE5X 5B1SA 3MTEA 1XYGA 1E6UA 1T6NA 2R4UA 3AHHA 4KXUA 4HLUA 4L9WA 2DQYA 3R4CA 4OGWA 1HKHA 3FTNA 2GZSA 2BGUA 2WWRA 3RVDA 1TUBB 3G6WA 521PA 5WRFA 2KI5A 4JUIA 4AUNA 1FRZA 4J0CA 1XMOB 3COYA 4YMIA 1IOLA 3N5CA 3TL2A 3LLVA 3NHJA 1KEKA 3BA1A 3NUZA 4A03A 1IXYA 3R5HA 1R6XA 2WWYA 1EG2A 2V5VA 1NW4A 3SBOA 3QSGA 1LBIA 4HQKA 1NRJB 3ZLBA 3N8GA 4BNFA 1QH0A 4R54A 3LHSA 4DEVA 1RI4A 1GEGA 3IQHX 3A2KA 3IV9A 4F6RB 1PJQA 1Z4PX 5A5VA 2J3JA 3F6RA 3P19A 1MJ5A 3KZMA 4JLUA 5GINE 2C29D 3H11B 4GNRA 4HXYA 2IBTA 1CLUA 1SOWA 1QLJA 1EP9A 3G5MA 3EOZA 4URVR 1VLQA 4BWVA 3BWDD 2UVDA 3H8SA 4OB7A 5KKNB 4DG9A 1G8HA 3GFQA 2BMFA 2OQVA 1CUIA 1RAGA 2W2LD 1CP3A 1I6LA 1M2EA 2YZ2A 3CQ9A 5IN5A 1VE1A 3A04A 5ALNA 3BSSA 4CODB 3QXCA 5KWVA 4RORA 4TGLA 1W2GA 4Y2RA 4C20A 2B6NA 2XMPA 5FADA 3QITA 1EWYA 3CNOA 4UUNA 2J87A 4C7JA 2FR8A 1N2HA 1S89A 4LXXA 4I9UA 2D62A 1SXJD 4XPIA 4YMHA 1N2XA 4UEJA 1P6UA 1HLFA 2AN1A 2PMBA 3DNFA 4KBFA 5EFOA 4C6HA 4E5MA 2HJHA 1SO8A 3O8NA 4W6QA 2VJDA 5DM1A 3QXGA 4BO7A 1Q15A 3V1KA 3M49A 5IEBA 4YYZA 5J4YA 4IEEA 3VMFA 4ZA2A 2SCUA 4RD3A 5J2TB 3A6HA 3WZMA 4LX0A 1U0SY 1F9AA 3ELWA 4X20A 5AVXA 1FFGA 4BASA 3N2LA 3JAWB 1BTOA 1RE0A 3A6FA 4JSRA 2D1RA 1BRMA 5EJ5A 1LF0A 2HN9A 4FMBB 3RVSA 3CF4G 2IXTA 4RTQA 4F3CA 1TUGA 3LQRA 4QDJA 3LDUA 3QYFA 2FW9A 3DVLA 1WW3A 4B47A 1DCMA 1LI7A 1XRLA 3KZNA 4I2VA 1P5HA 1FMFA 4GR4A 4KQGA 3B1JA 4Q7MB 2OHIA 2RARA 1WXGA 2HA0A 3SS8A 5JYCA 2A0FA 5AHOA 1SCUA 4QQFA 4ARBA 3EWAA 1G20A 1RR6A 2D5IA 2QGZA 3DB1A 1TYDE 3ZY4A 3C3MA 4Y9RA 5FA8A 1DEXA 3KS9A 2J3DA 3REOA 2P9FA 2BGMA 3V2UA 4DMKA 2F1HA 4HJXA 3IP1A 1QNFA 3SICE 3CN9A 3T7AA 2C7PA 2W11A 4NFSA 4EBFA 2LNDA 2UVPA 3ZVKA 1JLSA 2PPLA 1II0A 5TT1A 2QTCA 4DM7A 4LDJA 1U1CA 1UK6A 1UFRA 4O4LB 3FYCA 4QBGB 2AOVA 2QL5A 4MQMA 2DRIA 1E4OA 3BFKA 1XIVA 4BO8A 1P29A 4O2BA 2NTVA 1RLOA 5A4FS 4PSAA 1N7IA 2XODA 1KPIA 2O05A 1FSPA 3PTAA 1OGIA 4PLVA 2JBHA 2H51A 2Q1YA 3SM9A 4TYWA 2AQ8A 1L7EA 1SXGA 1E9FA 1GKUB 3GAMA 3KR1A 4K86A 4S0XA 3S28A 3AEQB 3X2FA 3CHYA 3WV5A 2DLCX 2W6QA 3PGVA 1Z35A 4Q48A 3EGEA 4FCTA 4ZKEA 5AW6A 2X40A 1MOZA 1V41E 4XM1A 4BQNA 3K9BA 1CLEA 1JTEA 1NBME 2INGX 5FUWA 4FEGA 4EKNB 1JEJA 1OI4A 3OD5A 1MRZA 3LUJA 2O2SA 4WLEA 3HB9A 1USKA 4GP7A 4K2AA 3CZQA 3PKZA 3LIIA 4CIAA 2LKCA 5DCWA 4QBHA 3RABA 3GUVA 2QP9X 3FLEA 3V9AA 5JS7A 2BSAA 2D5CA 1RWMA 1GOTA 1NQOA 2I6UA 2K7ZA 3PYMA 4D4IA 1T15A 3H1GA 4YJ3B 3VFDA 3RFTA 4XQGA 3AFMA 1GQ2A 3AIIA 4B80A 5FWXA 5BMOA 3U6BA 2FG6C 3GQVA 3OPYA 3OO1A 1L5VA 2XCOA 4U1RA 4YRQA 1LEHA 1FTNA 5CIWA 3X3HA 1EVQA 4DIDA 2Q1UA 1H0RA 2XMZA 1REQB 4TRJA 4O1MA 3Q2IA 4DGQA 2GWRA 5LZ8A 5JXWA 1VHTA 1X19A 3DNMA 3PF9A 4DSTA 1X7HA 4IQGA 4QYIB 3N0TA 1PNOA 1T10A 2ZXFA 3OETA 3RYIB 3WIVA 1DX9A 4ZHQA 1PNRA 2J3EA 1M2NA 3KEFA 1DOZA 4GMGA 1WEKA 4F38A 5K8JB 4A36A 1YQTA 5BV8A 1LV8A 2A7QA 1DEKA 2EFJA 2GSWA 4H7DA 4S05A 1AA9A 1S8OA 4LVUA 3D3EA 2DHDA 5EJIA 4KK4A 3M5CA 4FZRA 2BEJA 4IG9A 2SNIE 4FFOA 3S8EA 1Q11A 3W2FA 1RKVA 3IFSA 1XVIA 3JATB 5CK5A 3GLIB 3DMYA 2OAQ1 1MPTA 2M1ZA 2RC5A 1BCRB 2AXNA 4UCQA 3K0AA 3NH6A 5LIPA 3L0OA 2W5UA 3D6VA 4ZOAA 4I19A 3WLHA 4B3GA 2BHNA 4YCMA 1FFWA 1QE0A 3MXTA 1RM3A 2B94A 1SB8A 1SHLA 1YB2A 4KN6A 1ABFA 4PLYA 4YLGA 3L79A 2FUKA 2P6NA 3RIXA 3G7SA 2D0IA 4O4IF 1E4EB 5EZYA 5AM2A 2D1YA 5AHWA 4EG1A 4OFXA 5ALZA 2XGSA 2AG1A 2YWGA 4HAWA 5KVCA 3FDIA 2HQOA 2IW3A 1GUFA 4I3HA 3E7XA 2OQ2A 2VSFA 3PXEA 4HNTA 2WQ7A 5B1YA 1QTQA 1W94A 3THXA 3LVBA 3W5UA 2ACWA 4EH1A 1XR3A 4U2CA 3GUZA 3C3PA 3LTEA 3MGKA 3F5SA 2ZOSA 4C4AA 5GZ1A 1C7FA 1JBEA 2J3KA 3CGGA 4FFVA 1RXSA 3F96A 2AFRA 3MMNA 2B6HA 4QEZA 1J2EA 3M89A 3OCYA 2KQUA 5EQJB 3UUWA 4BLTA 2FOIA 1JFVA 1LC3A 3D6TB 4H2DA 4L8WB 4JEUA 4C7KA 3D4IA 4M0MA 4PHGA 4UXIA 4ZTUB 1SG6A 3BMOB 4XQCA 1QK5A 1L5QA 2C3OA 2ZIZA 5LCXA 2JIZA 1RRGA 3KLBA 3LW7A 2ZSEA 4GMHA 3EWNA 3UCEA 4FHFA 1QG2A 2XSZA 4PCLA 2OG2A 4KYTA 1K3TA 1XQ1A 2YX1A 3PRHA 5EEGA 4L4UA 1ORIA 3BWVA 5I8PA 3DUFA 2GM9A 3DBVO 2WT4A 4K1XA 3JVIA 4PG7A 2BRUC 4PR0A 1ORTA 3CVWA 2PBZA 1O0CA 2C2OA 2JVJA 4IH9A 2V8OA 4EIWA 1B8VA 5FNZA 2G9UA 3RC2A 1PHRA 5ESXA 3GFOA 1CD5A 1QP7A 4H31A 3C74A 2FR1A 5DSZA 2BHRA 4IDBA 1TMKA 1X1RA 3GV0A 2JK1A 3DMHA 4FT2A 1G1MA 2MOKA 2Y1GA 2YS7A 4GECA 2UVQA 3TNYA 3TOZA 1Q84A 5AUOB 3LT0A 5L3RA 1P45A 3ZGLA 3NQ41 5GJWC 3EEBA 4DANA 3MLBA 2VBCA 2E5LB 1NXTA 4NVRA 3I6BA 2IQIA 3GYBA 4MEBA 3ICQB 2G9QA 2JLRA 4FGLA 1R6TA 2PSDA 4GM4A 2WAOA 3A9VA 1KFKB 1CY4A 2AEMA 4LVOA 1F0NA 1AURA 1ISMA 4MKXA 5DIFA 1QO0A 2C59A 2VXBA 1HMYA 3PE6A 4RY2A 1Y98A 1KZ7B 4AMYA 5C1PA 1KDTA 2OFXA 4B9AA 3KHKA 3CH5A 5IAJA 4CEJB 1L7NA