1XKTA

Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
260
Chain Sequence
VNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQHNSLFLFDGSPTYPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYYGNVMLLRAKTGLGADYNLSQVCDGKVSVHVIEGDHRTLLESGLESIISIIHSSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydroxylase
molecule keywords fatty acid synthase
total genus 83
structure length 260
sequence length 286
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.20 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; Fatty acid synthase; domain 2 1xktA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xktA01
2PKYX 2QKYA 2AJBA 1T4MA 3JW8A 2JGIA 4QA9A 5JATA 4X94A 5AM5A 4KEAA 1JI3A 2R11A 1BROA 2Z8XA 5FXMA 4C4ZA 4TGLA 5KREA 1J1IA 2JF0A 3EQ9A 3HJUA 2XMGA 3WK5A 4DGQA 4HTAA 5DNUA 1E5TA 1QONA 3ZI7A 3DOHA 2OQIA 3OURA 3DJYA 4C4YA 3P2MA 4E14A 3DNMA 4HXGA 5D7BA 1IMJA 1BS9A 5LKAA 4Y2SA 5ALRA 1TQHA 1WHSA 5JZ9A 2VATA 4BDTA 4BRSA 4CG1A 1UKCA 4AO8A 2QJWA 5DNVA 1XQYA 2XUJA 4PO3X 2JGJA 2DHDA 2XMRA 5EFZA 3R40A 4M0MA 5F4ZA 1DWPA 2WHPB 1R9MA 3G9UA 3GZJA 2WLSA 4QLOA 2OCIA 5AKEA 4UFNA 3HC7A 1SFRA 1AURA 3I1IA 1XLWA 4LIPD 3VISA 3E4DA 4WFKA 1FFCA 2ZYRA 2WHRA 1SCKA 4GWLA 4BC0A 3M81A 4U2GA 4FLEA 5HQ3B 4P08A 4AMYA 4FTWA 4CIAA 5CH5A 4KR0A 5EHXA 1MAAA 1CUUA 3D0KA 4WFJA 3W9UA 3FVTA 4RNCA 2GBCA 1ZI8A 4QLAA 2GBFA 2QRUA 4UHHA 2FJ0A 1R3DA 2K2QB 3C5VA 3QMVA 3DKKA 3SC2A 1XRPA 2VT6A 2V97A 1XQWA 3GELA 3V1LA 1VZ3A 3F67A 1MJ5A 1PJAA 2BKLA 4GI1A 3AIMA 2X76A 3WWPA 3G0IA 1CV2A 2JGFA 1AMNA 4K2AA 4A16A 1QIFA 1MN6A 2GYUA 5AKZA 5K3BA 5JYCA 3H18A 1JJBA 3WKEA 1EB9A 4H7JA 2QTBA 4CCWA 3MVEA 3KWJA 3I28A 5AO9A 2I3ZA 3WQHA 1RP1A 1NU8A 3LIPA 3D59A 2OCLA 2XT0A 3IUQA 5CT9A 1TCCA 1TCAA 4G9EA 4J0IA 3STYA 5AKHA 4X6YA 3WZLA 5ALLA 2ACEA 3HRHA 4X6UA 1TAHA 3H17A 2ACKA 1QIEA 2PL5A 5D6OA 5LZ4A 1XZAA 5A7GA 3ZWQA 4A5SA 3BJRA 4OB6A 4YX9A 3GROA 4FNGA 4MJ3A 2DHCA 3IUNA 5CH3A 5LYYA 3DYVA 3E0XA 4H35A 2C58A 3C8HA 1QE3A 1FFDA 4RPCA 1XZEA 4PV7A 3V9AA 1DU4A 3PI6A 2HFJA 3F98A 4X95A 4F60A 1J2EA 4FKBA 5AI9A 4JYPA 3T4UA 4DMKA 1EK2A 4N5IX 2OGZA 1LZLA 2C0PA 2EDAA 3FWHA 4ARBA 1IVYA 4X90A 3IURA 1N1MA 3BWXA 1S8OA 3RKSA 2WJ3A 3WKBA 4Y2YA 1QIGA 2AJDA 4HRXA 1N8SA 4Q82A 3W05A 5ESRA 4IH4A 3HSSA 4JEIA 4X85A 5AKLA 3PICA 2CEKA 4Q05A 4FDMA 3TRDA 4FBMA 1W76A 5ALZA 1JMKC 5CMLA 4XJVA 4TPKA 3PFCA 3I2HA 4ARAA 5JIBA 3AZOA 4KAFA 2BCEA 3FYUB 4PSUA 4EY8A 1ORWA 4GLBA 5BV7A 4ETWA 4Y9SA 4L3WA 1CPYA 2WQZA 5AM0A 2XUGA 2BGNA 2ZYIA 1W1IA 5E4YA 2OQVA 1XZCA 1CLEA 2O2GA 4C6HA 2JGEA 3RLIA 1MTZA 2H7CA 1DWOA 5SYMA 4B7ZA 2JGLA 4OU5A 4Y7DA 3QYJA 3IUJA 1CUIA 2QJRA 4Z49A 2HA5A 4W1QA 4HZGA 4QDXA 3DEAA 4HAIA 1XZDA 1XZIA 4Q1VA 4F21A 1UKAA 1TIBA 1ZD3A 2JGKA 3D2AA 3GUUA 2NW6A 2CZQA 5CT5A 2QXTA 3WK4A 1ZD2P 3EIOA 2BUAA 5DLPA 2WG1A 4FNMA 1MO2A 1R9NA 4X7BA 1XLVA 4MXDA 3BF8A 4NZZA 5ALGA 3D4LA 2C4HA 2IIVA 2PSFA 3X3HA 3DKRA 1Z68A 3G0DA 5ALYA 1OCEA 1PV1A 3FAKA 2CMFA 3OTQA 5FLKA 1G4HA 4H18A 2C0QA 1WHTA 4X92A 5IVIA 4CG3A 3FCYA 5EIHA 1UK6A 2Z3WA 3AILA 5JAPA 1EDEA 3ESBA 3NUZA 3KDAA 5AOCA 3AFIA 4EY6A 2HA6A 4EBBA 1RYYA 3LCRA 2O2IA 2O7VA 1XKLA 1YB6A 4PQEA 1CUFA 5HFNA 5AH0A 1CUHA 1XROA 4U2CA 2Q0XA 4K6HA 2ZJ6A 2HFKA 3W2TA 5LLSA 4H0CA 5DTJA 4K6KA 2V96A 2WIDA 1MX1A 4Q34A 4H7FA 5AIAA 2ES4A 1VKHA 3L1JA 3JWEA 3RARA 1P0QA 4CI9A 1XQVA 4L72A 2HU8A 2ZSIA 2FUKA 2EEPA 1XRLA 3STWA 3VDXA 1H2YA 5DTIA 1A8SA 4BATA 1W75A 3WLAA 2QZPA 4QDTA 4AO7A 1WPRA 5EHZA 3HLKA 5K3AA 3AUKA 3LS2A 4BTVA 3ESAA 4ROTA 5FV4A 2HM7A 2AJCA 4EY5A 5JAOA 3ICVA 1WB6A 4ZREA 2CKMA 2WG2A 4NS4A 2B20A 1R50A 1Q0ZA 1UXOA 1BE0A 4FOLA 1X70A 1CR6A 3DOIA 2DR0A 3V48A 1QGED 2HIHA 5DYTA 1AC5A 4P93A 2O7RA 5JADA 5LZ2A 2OLEA 3T52A 4HVTA 1LPMA 1OILA 1BN6A 3DS8A 1SCIA 4PW0A 4GDMA 2WUDA 5AKIA 1H2ZA 2IITA 3NWOA 5AKXA 3DQZA 5ALVA 1CUXA 1ETHA 3RK4A 4QNNA 1D07A 1BEEA 2WU4A 1TRHA 5ALKA 2WUGA 3L1HA 2XUIA 1RWQA 4EY7A 4ZRDA 1XZBA 1ZGCA 5CXXA 1Y37A 1XZGA 1XFDA 5D3KA 4Y2TA 4OSEA 1BN7A 1YS1X 3AIOA 1F0PA 4AZ3A 2ECFA 4RE6A 4U2BA 2Y1KA 3WK7A 1WCYA 2XUAA 2YXPX 4NVRA 1IUPA 5JAHA 3K2IA 4CFSA 1TKRA 3QZUA 5LZ9A 4M0EA 4JUIA 5AOAA 1QO7A 2CBGA 4C89A 1CEXA 2WU3A 3DL4A 4GEGA 1O6FA 1VA5A 3DD5A 1CUYA 1SC9A 3HEAA 5T4HA 2VEOA 1IUNA 3GBSA 3I2IA 4KJXA 3B12A 4MEAA 5I9IA 4D9JA 1EVEA 4UBJA 3WWDA 1XRRA 5LZ7A 3W06A 5JASA 2WILA 3WK8A 3F8SA 5E2IA 5HKAA 1SCQA 4L9AA 4GHWA 3W04A 5IVHA 4NMWA 1MAHA 4I19A 4HXFB 2XUPA 3OG9A 2QM0A 4J0CA 1XZMA 4MYSA 4WDRA 4WJLA 2BAGA 1FFEA 4Y2VA 3H2HA 3SWWA 4K5QA 2DCMA 4E46A 2J4FA 2XMDA 4XIIA 4FLFA 4DTCA 5I8PA 5ALJA 5ALTA 2G5TA 5K3FA 5A62A 1ZD4A 2I03A 4UBNA 1X2EA 1A7UA 5BWBA 4KRYA 4ZV9A 3S8YA 1CUWA 5KWJA 4AO6A 2WUEA 1UKBA 1FJ2A 1KU6A 3GA7A 1HBJA 3L1IA 2X8BA 5C7YA 5HK8A 2YASA 1BRTA 3IB3A 3IUMA 3WKAA 3Q8WA 1QIIA 4DSZA 1L7QA 1XRMA 4OCZA 3FLAA 1AZWA 4DIUA 3FSGA 3SK0A 3QPCA 3WWEA 4UPDA 1U8EA 3PE6A 1K6EA 5J3JA 3AIKA 4K6GA 4KE6A 1AKNA 5EIAA 5LZ8A 1K63A 2WG0A 3VJLA 5LIPA 5AHXA 3WYDA 5I7UA 2DQYA 1U4NA 2V98A 3F97A 2DHEA 2JGMA 3ANTA 3AINA 3WK9A 3QH4A 4AX4A 1DINA 1LPPA 6YASA 3BIWA 1AGYA 5AKJA 4B84A 3NOXA 2Z5GA 2VQ6A 4N8DA 1QIKA 1JU3A 1LPAB 3NGMA 2C5FA 1QO9A 5A7HA 3G02A 1CUSA 4G8CA 4BZZA 1Q84A 5AJHA 2JEYA 1LLFA 2Y2UA 2XMBA 3I6ZA 4PSDA 2PVSA 4H77A 3H19A 4QWMA 3C43A 4O08A 3FYUC 1Y7HA 2WIJA 2VAXA 4B6GA 2ZVDA 3AZQA 4RE5A 4IH1A 3IULA 3K6KA 1ZGBA 1CQZA 1T2NA 4BAUA 3BDVA 1DWQA 2RGUA 2HL6A 3FOBA 3A2NA 3DDUA 1EK1A 5C8ZA 4W1PA 2PBLA 4LXGA 4MQLA 4LYDA 4AMZA 1UOPA 4CG2A 4A23A 2OAGA 4UHEA 4FBLA 2CJPA 1LPNA 1QZ3A 1K8QA 4JNCA 5T4BA 5DJ5A 3EF3A 3ZLUA 4S0XA 4YPVA 1E3QA 4BBZA 5AK5A 5ALPA 1QFMA 5A2GA 4OPMA 4LKOA 1IUOA 1CUVA 5CH8A 1E8MA 4AN1A 1CUZA 1K5PA 5D3ZA 5CBKA 4C4XA 4KYVA 1W4LA 3STUA 2ONCA 4FWBA 4FLMA 1QFSA 3PF8A 5LZ5A 5EIEA 5DYWA 4XX1A 3KD2A 2AXEA 4WDQA 2J3QA 4DNPA 2HA3A 3C6YA 3OC0A 4X91A 1TK3A 3VJMA 1XZKA 4H7IA 2RHWA 3ANSA 5BOVA 3QBJA 1B41A 1R88A 4ITVA 1GPKA 1ZD5A 4KAAA 1CUDA 3CN7A 2XB6A 4FMPA 2B4KA 5T4EA 4Y2UA 2EDCA 1MX9A 1VE7A 3WKDA 3FCXA 4UBMA 3HXKA 5AOBA 2ROQA 3BJMA 1CIJA 1C7JA 3C70A 1MT3A 3ESCA 2B61A 4Q3LA 4W1SA 3ILSA 3S2ZA 4GECA 3O9VA 2VJAA 1UFOA 4ZI5A 3K9BA 2H9YA 3G7NA 2GZSA 1WB4A 4C87A 5C8VA 3VXKA 4ZV7A 1O6GA 2I3DA 4F5ZA 3WL6A 1IZ8A 2ZJFA 4MWTA 3ESDA 2QUBA 2RIPA 3D2BA 2Y2VA 3PUHA 1QIDA 4HXEB 2XUFA 5K3DA 3UUFA 4EUSA 2FX5A 2XMCA 5ALIA 3O95A 4Q3OA 1VXRA 2G4LA 3PF9A 1LBSA 2Z8ZA 4J03A 4U2DA 1VZ2A 1H2WA 5K3FB 2PU7A 1MX5A 1U2EA 1YA8A 2OCKA 2OGTA 3ZLTA 2WHQA 4UHCA 2WSLA 3YASA 2J3DA 5FDFA 4KE7A 3EQ7A 3U1TA 3D2CA 2I78A 4UUQA 5HF8A 5DYYA 3QPAA 5HCUA 1YSCA 3DYIA 4J0DA 5HF5A 1N5MA 3MUNA 3RM3A 3WL5A 3STVA 1GKKA 2PSEA 4KAJA 1HDEA 4EB0A 4XVCA 5H3HA 1AX9A 4BCBA 4JYMA 1QTIA 3R0VA 3F9CA 3O4JA 4P92A 2PSHA 4EY4A 4LXIA 1JT2A 3FVRA 1CFJA 1USWA 4BTLA 1EHYA 1JU4A 5JD4A 1ZJ5A 3A6ZA 4WY5A 5JZBA 1Y7IA 3R3UA 4J0GA 4XWGA 4LYEA 1H22A 1ZI6A 4X3CA 1EINA 4UHFA 4DYHA 3DL7A 3IDAA 4FFVA 4YASA 5AM1A 1ZJ4A 1U65A 3IVMA 2W22A 5AM2A 1EVQA 1MU0A 4BVLA 3BIXA 5JD6A 1K4YA 4J0JA 1ODCA 1CUBA 1EDBA 2B9VA 4U2FA 4H7HA 5JANA 1G66A 1GGVA 5AM4A 3WK6A 1L7RA 3WJ2A 2VSQA 3LLCA 4G4GA 1QOZA 1SOMA 1JJIA 4GXNA 2ZSHA 1QLWA 3BF7A 4C88A 3C6ZA 3OPMA 1DX6A 3C45A 3I1YA 4QEKA 1QJ4A 3IBTA 2OPHA 2WIKA 4MWSA 4EHBA 1P0MA 2P8SA 3A2MA 2VAVA 5A7FA 4BYMA 1GT6A 3BL8A 1EI9A 3I2JA 4PSCA 2PPLA 3CXUA 1QIHA 5A6VA 4B0PA 1J06A 3HI4A 1MNQA 3PUIA 2WIFA 1YR2A 4BE4A 1MPXA 5ALQA 4UFPA 1EB8A 2PX6A 2WTMA 4BRZA 1ZIYA 4RGYA 4BE9A 4QE3A 5AI0A 3ZPXA 5YASA 1JMYA 1CUAA 1A88A 3OM8A 4QDZA 5KWIA 3FLBA 1THGA 5EGNA 5FUMA 5AP9A 4X00A 1M33A 4AN0A 2WHPA 5EHQA 3ZLVA 5CTAA 2XQIA 4DM7A 3CCCA 3PDCA 1YAHA 1R1DA 3WA7A 4BVKA 1GZ7A 4OUKX 3VVMA 1NX9A 2OG1A 2WJ4A 3KWFA 5JAUA 5CT8A 4U2EA 1GPNA 2DQZA 1GXSA 5HF6A 3KXPA 3H1BA 3AJAA 1UOOA 5AI4A 1HPLA 2QOEA 3G0GA 4QDOA 4DLNA 1THTA 3FNBA 3UUEA 5AK4A 4KACA 1JJFA 1YCDA 4LHEA 4Q3KA 2XLBA 2OAEA 4CCYB 4WCVA 4F0JA 2WKWA 2PSJA 5HFAA 5JARA 1QIMA 1LZKA 1I6WA 5AK6A 3U0VA 2XUDA 1UZAA 2VJCA 3H2GA 4AXBA 3BXPA 2XI4A 5AIBA 4N8EA 1XZJA 3HABA 4I4CA 1H2XA 4UBOA 1AUOA 3G9ZA 4E15A 1NU6A 1H23A 4DMHA 1HL7A 1DX4A 5ALFA 3O4GA 3R3XA 5JZSA 4INZA 4Y2QA 2GYWA 2H7YA 2XQJA 1LBTA 5AKYA 2OGSA 3QM1A 2VJDA 1BU8A 2Z3ZA 4G1FA 4J0KA 1E66A 5E4JA 4EZIA 4C01A 3A70A 3TEJA 5AI5A 5JD5A 1HKHA 3I6YA 4N8SA 1ORVA 4X71A 3QITA 1ACJA 4HS9A 5AI8A 2GZRA 5ALEA 3WMRA 3V1MA 1XZHA 4W1RA 2PUHA 2XLCA 2AJ8A 3M83A 3D7RA 1E8DA 5IVKA 4FFWA 1KEZA 2PSDA 1CVLA 3BDIA 3WWOA 4B80A 1C4XA 2BUCA 5T4FA 5CW2A 4B81A 1WOMA 1CUJA 1HQDA 3G9XA 3FYTA 2RHTA 1VXOA 2XUOA 5AKKA 5IVDA 1B6GA 4W9RA 2WIGA 2GBGA 4Y2RA 4YK7A 2CB9A 3W9BA 5C81A 3N2ZB 3D5EA 5ALOA 4QDUA 2BFNA 2QXUA 3JYHA 4MQMA 4G8BA 3FYUA 5DWDA 1ZI9A 4LXHA 3D3NA 1EH5A 3A2LA 2VA9A 5ALUA 2JIDA 5ALHA 5K3EA 2HU5A 1ISPA 2G63A 1LNSA 4MYDA 4IH9A 1UOQA 2WFMA 4OYLA 3KSRA 1GKLA 4CCYA 5CXUA 2HA7A 3Q0TA 1DQYA 3VJKA 4G5XA 3WWCA 2V9ZA 3E3AA 1WM1A 4B85A 4BB0A 3GFFA 1VOTA 3H0CA 2XUQA 2Y6VA 4Y2XA 3DCNA 4PNZA 3CCBA 4BP9A 5C8XA 5CURA 1EDDA 2XUHA 2BUBA 3H2IA 1E8NA 4BAZA 3WA6A 2XMSA 5CT6A 1ACLA 1VA4A 2W6CX 3AZPA 1UT6A 4ZXFA 1KU0A 1P0IA 4TVKA 2XUKA 2XQFA 4DMFA 3O9MA 2FJPA 5ALSA 5HQ3A 1VJ5A 2PU5A 4EA6A 2ZJ7A 5HF9A 4UBIA 1BCRA 4B9AA 3I2KA 1X2BA 3CN9A 3H04A 2X5XA 3G8YA 3ICWA 2VT7A 5FP0A 1DT5A 5K5EA 2OXEA 2WFLA 1YASA 2E3JA 2YH2A 3V1KA 4IHAA 1ODSA 1WB5A 1IZ7A 3WYNA 1BCSA 5IH7A 4DNQA 3G0BA 3STXA 1Q83A 4J7AA 5SYNA 4GBGA 5FKJA 3EBLA 4BZWA 3G0CA 2WM2A 4H7DA 2HA4A 1CQWA 3C87A 2QMQA 2ZYSA 3G9TA 3QVMA 2QUAA 2D5LA 3C5WP 3HYSA 1GQSA 5FPPA 2PUJA 1R4ZA 2XQGA 1F0NA 4B82A 3PFBA 3V1NA 1LGYA 2HRRA 4FHZA 4DSAA 5FOQA 3QPDA 2Y6UA 3IIIA 1EA5A 2WFZA 2RONA 4G9GA 3M82A 2WFLB 3WIOA 4B0OA 5ALDA 4BCCA 1MNAA 4M0FA 4QWWA 1Q0RA 2DFPA 2QVBA 2H7XA 1UK8A 1LPBB 3VKFA 1LPOA 1F8UA 1C7IA 2H1IA 2ORYA 4UFOA 3KOOA 3LIIA 4X93A 1TCBA 4KE8A 4B9EA 4E11A 5CRIA 3STTA 1J07A 4DNOA 3TGLA 4W63A 3OOSA 1XZFA 1L7AA 3B5EA 2ZYHA 3WKCA 4H7KA 1ZIXA 1VLQA 4BC1A 2BGRA 3H2KA 4BP8A 1YAJA 5FRDA 1N5RA 2HADA 5ALWA 3C8DA 3H1AA 4DNFA 5HKBA 2VF2A 3B3QA 3TJMA 3DLTA 4OD0A 4UBKA 2UZ0A 5IKXA 2J4CA 3HZOA 5A71A 2HHAA 2GBIA 5LP1A 4UBLA 4AZ0A 1FFAA 4OB7A 4G4IA 4OU4A 4ZWNA 3WL8A 1GPLA 1UK9A 5FPQA 4DMCA 1WPXA 3SX4A 2XMQA 3F96A 2D0DA 2QS9A 2HRQA 3I2GA 3WL7A 2RI6A 3IA2A 1CRLA 2XMZA 5AK3A 5AICA 1W6RA 3QMMA 1DTEA 1JFRA 1W52X 2O2HA 4BAGA 3C6XA 1G5FA 4H7EA 1YS2X 4OB8A 4ZGBA 3FBWA 5ALMA 5HZGA 4BDSA 3R41A 1VE6A 4MEBA 3WZMA 2DSNA 2OCGA 1A8QA 2JBWA 1P0PA 4OYYA 2JEZA 3R3WA 3LP5A 4P9NA 4UHBA 1XZLA 1HLGA 1PFQA 3R3VA 2XE4A 2BJHA 2QT9A 5ALXA 4HRYA 2VTVA 1EXWA 1FSSA 2CUTA 2XQKA 1GQRA 1UK7A 3UMJA 4X97A 4WFIA 4L0CA 5HK9A 2YYSA 3H2JA 4BCDA 1UWCA 5JALA 1XRNA 5KBYA 1BEZA 1OXMA 5AI6A 2LIPA 1XKTA 1EX9A 4IO0A 4J3JA 3FSGD 1AQLA 5ISMA 1F6WA 4KE9A 4AB1A 1ZOIA 3E1GA 3WI7A 4GW3A 5EHNA 4PF1A 1CUGA 2GYVA 1DQZA 1G42A 3R3YA 3O4IA 4G4JA 4N5HX 1CUEA 2WUFA 3N0TA 3O0DA 1YA4A 2AJLI 4QZVA 1YB7A 1XRQA 2WTNA 7YASA 1ODTC 4Y2JA 3O4HA 3MGAA 1LPSA 2HA0A 4CIBA 2QR5A 3I6MA 4V2IA 4UHDA 4WY8A 3WIBA 4J0HA 3HACA 2C7BA 2WJ6A 5DNWA 3M3DA 1CUCA 4AQDA 5CT4A 3BE8A 2VJBA 1ZICA 1DT3A 1E89A 3ZV7A 3ED1A 5E4TA 3I2FA 2HA2A 3R3ZA 2C5GA 2G5PA 2XDWA 3EQ8A 3QMWA 4B83A 4I3FA 4KRXA 4Y2PA 1XLUA 4JH0A 3MUOA 2HU7A 2PM8A 1FFBA 4G8DA 2IX9A 1A8UA 5K3CA 3WJ1A 5AM3A 5AKGA 3FLEA 5BWCA 3C6BA 1XQXA 1QIJA 4BVJA 5LKRA 1QTRA 3VVLA 5EI5A 1JKMA 4X6XA 2RAUA 2HDWA 4IQ4A 2R8BA 5ALNA
chains in the Genus database with same CATH superfamily
2JFYA 4NXNB 3SSAA 2ZPUA 4WOCA 2AUMA 2Y1LA 2I65A 4AECA 1KAMA 2UKDA 1NNSA 1T4MA 1M2KA 2UZ1B 3W0LB 2PJUA 4FWIB 1XD8A 5BR7A 1IOLA 3KLPX 3QEMA 4XLZA 4YH1A 1ML3A 2IHKA 5B37A 3WADA 4ZCMA 2DWUA 2EC5A 3CIFA 3I0ZA 4R7ZA 1N1EA 1V96A 3KJFA 3HCRA 4H27A 4MAAA 4ZVMA 4W5OA 4H0FA 4YT4A 1AQNA 1UXGA 2D8AA 4X94A 3ZX5A 4EH1A 4A6XA 4A8TA 4EAAA 1BG6A 5AM5A 4XLTA 5F1KA 4DRXB 3W5SA 3PNOA 1MJGA 1PR2A 2FN8A 3O4VA 4QECA 2GZDA 4BQEA 3AETA 3L6UA 5KQLA 4LEIA 4UE3S 5FXMA 4ZYVA 4TGLA 5KREA 1DC8A 1FUKA 5F3RA 4C2UA 3EQ9A 4RDXA 3HJUA 3FZQA 4XD7D 2EP5A 3OECA 1T2UA 2R44A 4B46A 4PN7A 1Q74A 2X8LA 3FLMA 2IZZA 3EZLA 3LUGA 4RXMA 3WE7A 3IHTA 4DGQA 2WJHA 1KI6B 5DNUA 4AY6A 1Q6ZA 3I39X 5I51A 3L1KA 4F12A 3U7JA 3OURA 4JOQA 2WFAA 3QU5A 3R6WA 1JQKA 4HFJA 2DUJA 1W59A 1VCOA 3FKSD 3QVTA 2XRFA 2DHQA 1Y7TA 4OOFA 1PX0A 4YWJA 4HDRA 2FUG6 2H57A 2GTHA 1T24A 2JZNA 2VATA 1HE3A 1KYZA 1QH8B 3DAPA 4BDTA 1SJ9A 4BNMA 1ZXBA 3H1FA 3RWMB 2PD6A 1NW5A 3E3OA 4RF5A 4P7KA 1USVA 1XDWA 1UMDA 2I2CA 4GAEA 4XA8A 1FUUA 1XWFA 2KI5A 3EVGA 4PLGA 3UMMA 1SEPA 2Q46A 1ENPA 2GXAA 4CIDA 5JC8A 4GZ6A 2XUJA 2EP8A 3BE5A 1NSFA 3PFGA 4JC5A 3EXHA 2QN8A 5TSDA 4R2HA 3W3AH 2XMRA 1IATA 3AT1A 4FJ0A 3EUAA 2QW1A 1DFIA 3GGOA 3R40A 4RDIA 4CUKA 3N0VA 4AJKA 3RB8A 1ZW6A 4N18A 1YF3A 4IL5A 4LF7B 5F4ZA 1DWPA 4J76A 4EL0A 4GBJA 5LQAA 4MRAA 3ADKA 4V0SA 4LGYA 1JAXA 2FMFA 2Q3BA 2EGUA 2WLSA 1M7BA 4IDEA 2XXAA 5HUJA 4EF6A 1DRKA 3PEEA 2OCIA 4HAUA 3IKVA 4Q9NA 1U99A 2WSMA 3GJ5A 3HC7A 1VHDA 2PMKA 4GP9A 1ZH6A 5CM9C 1YVRA 4AZVA 3RAFC 2P67A 4EGFA 3U6KA 1U63A 4FKZA 2VBGA 3R0ZA 4G0YA 5JBQA 1T1SA 1X1EA 3MMNA 2BR5A 1HKUA 2Q99A 4NDZA 4WFKA 4J8PA 1UADA 1M2JA 3ICPA 5AW9A 1W46A 4Q6BA 2RJOA 2NO1A 4EJSA 3QW2A 1ENOA 2W43A 3DG9A 2NU7A 3KQTA 3ZE0B 4MO2A 1SUWA 3WRYA 3T95A 4FLEA 1PR0A 2VSNA 4WXYB 1MVLA 2J09A 4J2OA 4P08A 3BBPA 3K96A 4OH1A 1XCBA 1H69A 2HEIA 2NNWB 3CVOA 3IE2A 5CH5A 3LLMA 3ZTYA 2ZTSA 2GUGA 1CUUA 1K75A 4KSYA 3T38A 4O2BF 1L8QA 1RFLA 2D7JA 2WSBA 2WWRA 1D1QA 1GKIA 3DEKA 4WFJA 5LQRA 5AMXA 5IEJA 2UV8A 2OWDA 3BHIA 5IYZB 2HNKA 2QGZA 4HLQB 3N7UA 3RASA 3HO8A 5IJ9A 1SU4A 1X7YA 4BO4A 2LBPA 1N7HA 2ZTHA 2GBCA 3JZFA 4K9KA 1A5BB 2CNWD 3ZQKA 2XAUA 4Z53A 4HAOA 1XRSB 2R1VB 1ZK3A 2FE4A 4HRVA 2PFSA 3PJFA 2FPUA 2C5EA 3HJRA 4IR7A 4C4RA 2H54A 4E5UA 5IPFA 4PAWA 4ZOQI 4BQNA 3DLPX 1IJBA 1ENZA 4HYTA 4RH0A 4RVUA 1JSZA 4U3JA 2B83A 1Z45A 3RC7A 3M5DA 5AVXA 4RHTA 3AOEC 3ZHTA 5DX0A 3ETGA 4FSHA 3SC2A 2A9PA 1PIWA 3ZJ4A 3SLGA 4OJKA 1E0DA 3HDQA 4TTRA 4Z9BA 2EG5A 1CZOA 4ZFNA 3F67A 2XCTB 5KAMA 1EKXA 1HT0A 3BUSA 4DWVA 1HDOA 1U80A 3CR8A 1HK7A 4GI1A 4XVHA 2H3EA 2CVHA 1I4TD 4X8OA 3RVDA 1OAOA 1PRYA 4JDPA 1BYUA 4PNHA 4BMOB 2ZTLA 1NYQA 4R69A 1CV2A 2DTXA 2W8ZA 1AMNA 1HR0B 4K2AA 2IYEA 5H8WA 5H7XA 1FFSA 5A03A 3U7GA 5K3BA 2ZI7A 3IJRA 3QLVC 4JR1A 2BN4A 4MULA 3UF0A 2Y4OA 3H18A 2V3VA 4EY3A 1N5OX 1JR3E 3WKEA 1EUYA 3T0FA 3V4ZA 1V16A 3UMSA 2C9BA 3BB1A 3ETHA 3K0KA 1ZSVA 3MVEA 3PKZA 4CCWA 4F84A 2H4JA 3NTVA 1W36C 2D2EA 2A94A 1C1XA 2WF5A 3I28A 3KWJA 3OQVA 2I3ZA 4LW8A 3T5TA 1E7RA 2AEFA 2H1VA 2F67A 5IK2D 2IY7A 2ODPA 2P79A 4MV4A 2ZJBA 1RP1A 4F4JA 1PK8A 5K4AA 3CO5A 2WM9B 3HDJA 3L7NA 1NU8A 5FTLA 1YO6A 2J67A 3CSUA 1E3WA 4FR2A 1VI2A 2JCBA 3D59A 3QWIA 4KO3S 3IQGX 4C0HA 2P0YA 3JSXA 1R64A 1FYFA 3UFXB 1TCCA 1R18A 3EA0A 3A1WA 3GJYA 1TCAA 1V71A 4G24A 4F93B 1CJKC 2Q8NA 2XDQB 3UW1A 5JXWA 4RANA 1JVSA 1WD5A 4B3XA 1I10A 2D59A 4J3FA 2H1HA 4X20B 1KK3A 4J0IA 4KQ2A 4CGYA 1XZQA 5AW1A 5A0FA 2X2FA 1NBEA 1Z6ZA 2V45A 5I48A 2R6DA 4MVCA 4DDWA 3HJHA 2Y67A 3HRHA 1NVEA 2XJ9A 2GA9A 2XE6A 3H17A 1MOZA 2ZSDA 2YWJA 4LJ6A 1K06A 1U7ZA 4UATA 1XQ9A 2NYVA 2OHVA 2X58A 3OOJA 5CIWA 4LGVA 3NYIA 3C4QA 3MCZA 3PVZA 2JJ1D 4OJQA 1G5IA 3REGA 5CVUA 4DADA 3LKZA 4D25A 3A6HA 3EXIA 1BMFD 1M5TA 2P62A 1S96A 3D4BA 4JJKA 3VC2A 4A5SA 1EXDA 1N2CE 3PEYA 4OB6A 1E9VA 1P1KA 3CRZA 1JMVA 2GD0A 3GROA 3QX9A 4HPXB 5GTDA 3OJ0A 4XM1A 2P6UA 5DGHA 5A3VA 3A4NA 2NG1A 4FNGA 4MKXA 1Y6FA 3QEBZ 4BO9A 5EP3A 5JE8A 5BPFA 3TR0A 5LYYA 2WY2D 1B1CA 3BZUA 4MUJA 2IHTA 2CXNA 5DISB 2PUFA 2A35A 3MUFA 1KH1A 3BXEA 2E82A 3JD2A 3A9CA 3JQGA 3BSYA 3RNLA 4V3CA 3VYRB 1C2YA 4Y1EA 2BKAA 4LZOA 3RT7A 1NI4B 2WOOA 4IGKA 3S3TA 1DU4A 1WW3A 4LNUB 5I5GA 5K6TA 1IBRA 1KY3A 2QRNA 2YHUA 4P3KA 3PI6A 2PX3A 3P0IA 5LXTB 1KZHA 4E70A 4Q3CA 3F98A 2A9QA 1SB9A 1RCFA 2Z2JA 2ECKA 1UEJA 3Q3EA 4U7TB 2OHFA 1LK0A 4JI4B 4AJEA 1O0BA 1J2EA 1MHPA 2B0CA 2VDUE 4YFVA 4G67A 1ZYUA 4HATA 3CRNA 1HYHA 4JYPA 3B9RA 3D4PA 4P7FA 4UNRA 1SZPA 1H1LA 1TKAA 1FP6A 1WWKA 2OV6A 2X3YA 4MARA 4GX0A 2A3RA 3DV0B 4RJJA 4DDUA 2C0PA 4ZQBA 2I2DA 1L8XA 4D57A 1RQ7A 1R6TA 2NV0A 3K0HA 4B3HA 1MQ8B 1Q1EA 1C8LA 4QC2A 5IANA 4X90A 5KUTA 1GYRA 4BV3A 4TYYA 5KYVA 1LSOA 3ZNNA 3WLOA 1QANA 2UUOA 3BWXA 3I6QA 1S8OA 4WZ6A 3RKSA 3V1KA 1JIJA 2WJ3A 4G56A 4YRAA 3TTVA 2IPXA 1N0HA 2Z2KA 4RIHA 1YIAA 3U37A 4Y7CA 4HRXA 2AJDA 4I99A 2ZR8A 4HZIA 1VKNA 1PT8A 4NJMB 4JB3A 2JI6A 4HDNA 4ZVRA 3VH2A 2IYLD 4O2BA 3OPQA 5ESRA 3ZCTA 3OT4A 3V2GA 1K3UB 1PR6A 2GGSA 3IAM6 3LVQE 2FF5A 4EPTA 1MDFA 3G1WA 4FGJA 3VKGA 2EKQA 2HOQA 1SG0A 2Q3JA 3NVMB 4YUVA 2PO7A 2JLRA 2CEKA 2RHGB 2TS1A 3IUPA 4E2FA 5M04A 3TRDA 3P4XA 3K0EA 3N07A 5EJAA 3I0NA 5LA6B 2XTZA 3OD5A 2D5IA 1QAOA 3D3WB 1M1XB 1XGKA 4CIVA 4EFNA 1OXVA 1U7TA 1G0OA 1KFJB 4TPKA 2OK7A 1TECE 3PFCA 2XRYA 3AL3A 4RV9A 3VMMA 4UDNA 2CFOA 1TVCA 1ZMOA 2OUIA 3EEIA 1GRNA 1UBUS 2BM0A 3OESA 3DZHA 3OEED 2CE7A 1KVTA 2X0IA 3CZ9A 1BDMA 1IHUA 1ORWA 1E7QA 3GGSA 4UJ5A 2WSSA 1M83A 5BV7A 5FADA 4ETWA 4LBZA 4IG9A 4OATA 4OX9B 1JS1X 1CZHA 1OLUB 2R6GA 5ETJA 2HXYA 3EOAI 5EN4A 5KI6A 2JCVA 4YJ2A 1E9FA 3WLLA 3KIPA 3MJRA 1XJCA 3P0HA 2X0FA 4BXOB 1RI3A 3ZD9A 2G6TA 4E1VA 4EWLA 1J2JA 5CVVA 3NP9A 4BQSA 2PKRA 1PGQA 3JYPA 4DG8A 4S2UA 1KEEA 1FNCA 2P1RA 5E4YA 5AUOB 4TVSA 5CB4F 4FD2A 1CLEA 5LQJA 2O2GA 1V47A 4M0LA 3ER9A 4Z3OA 5JISA 2G3YA 4U7FA 3IPLA 3UAXA 4H1TA 3NAGA 2J9FB 521PA 4NK4A 2GK7A 2CXPA 1J1ZA 3D3JA 4N7JA 5SYMA 2UVPB 3DZFA 1L5MA 2GETA 5HW0A 2PS1A 4E5KA 2PV0A 2RB5A 4FCTA 4R9NA 4Y7DA 1ULUA 4U5QA 4YT5A 3WQSB 3FBGA 2IXEA 2YMMA 5EQTA 5F2KA 4M1QA 2QJRA 1M8FA 3DBOB 2NYUA 1PLLA 3W5IA 2FLKA 2O8VA 1LS6A 4EJSB 2QZJA 3L8EA 2C20A 4EI9A 5FO0A 4QUJA 1F6BA 2NO4A 2EVWX 5LWHA 4G0PA 1OVGA 1PNVA 1RT9A 2A9FA 2C57A 3A1VA 4J1NA 3OPYI 4Q1VA 2ZULA 4UUMA 1YI1A 1ZD3A 3ADPA 1DRVA 2V6FA 3AKZA 3DOUA 1BZYA 1KY5A 1D8TA 4OAPA 2AHOA 1XUOA 4YJ3F 2QXTA 3V1UA 2ADOA 4KXNA 4ZAGA 4R71A 4H1WA 3ZV3A 1KAHA 4XRGA 3EIOA 1T2DA 2AV6A 1HO3A 3DT8A 4HUTA 1CZUA 1P5RA 1GUDA 3HZRA 3T3MB 3SQMA 2AOUB 4BNTA 3MTAA 4EQ6B 2C00A 4FXOA 1MGOA 5CVEA 1LNQA 1XTSA 2ZT5A 4MSUA 2FHSA 4CQLA 1XLVA 4D3ZA 1Y1PA 2G04A 3EQ6A 5B53A 2N1BA 3PCRB 1G98A 3RAPR 2OZLA 5F51A 3H9UA 2HHCA 4YFYA 3TAUA 5ESWA 3KP1A 3A6FA 3MTIA 1PJ8A 3QVGB 4OMDA 4US1R 4QBHA 4DR7B 1UF9A 1WMBA 2FMIA 2Z2YA 3KUKA 1POWA 1XDSA 1YR9A 2NSJA 3D8NA 3G0DA 4KB5A 3X3HA 4MVJI 1SZDA 4O4LB 1GCOA 4CMEC 2W9XA 1I2ZA 4V0MA 5A1TA 3WB1A 2UXDB 1IZZA 2J5RA 2NO5A 1E5LA 3VR2D 1HGXA 3LF2A 1G4HA 1RHUA 3F5DA 3MWKA 2YCBA 4H18A 4HTFA 4I9FA 4DL9A 1Y6QA 2OMKA 3N74A 2J1LA 4V24A 1W581 4E31A 3MOIA 4B3MB 3DM5A 3PENA 1IL0A 4J0EA 3ZGYA 4IBOA 1WHTA 3CNBA 1II9A 1E3EA 1QQ7A 4LSZA 5IVIA 3GQBB 1CSEE 3JVVA 3OZWA 4NOKA 3G85A 4K03A 4RPKA 2XVYA 2XA2A 1XEXB 5TF4A 3RANA 1E94E 2EJVA 3ZW8A 5JROA 4MPDA 5DYIA 5JAPA 2CDCA 3SYKA 4EHHA 4LXXA 4J4TA 5J4HA 2XA9A 2VO1A 3IXLA 2QLLA 1R6BX 3GO4A 3PDHA 4R8LA 4CN9A 5C7LO 2AKYA 3U19A 3KDAA 4DXHA 5CXQA 1FXSA 2YJTD 3B1WA 4QTZA 5AOCA 1CNEA 1GV0A 5CBPA 1ECPA 1Y3DE 2BEUA 4MAMA 1YR3A 3HV2A 3M4JA 4GOOD 1COWD 1RLUA 1YJAA 2VYNA 1Q7TA 3OQOA 4FCVA 1V41E 3BWMA 4DJTA 5DN6A 1LX6A 2X1HA 4B6FA 3V4OA 1RXVA 5I7RA 5DGXA 5JVDA 3CQ9A 4DR5B 1VHWA 1CJSA 3JQAB 2O3TA 1EFKA 1TKCA 1IXSB 4PHGA 2ORIA 4D9IA 2GK4A 4PS0A 2PNJA 3W1VA 1OU0A 4EDFA 4F5YA 1YFZA 2Q0XA 1GGJA 4IV8A 3SS7X 3T5CA 1V3VA 2HPVA 4ZHSA 1OXKB 1P7YA 5LLSA 3O82A 1IPFA 4DV4B 5F7ZA 1ZEMA 2QN3A 5IUJC 1SXHA 1FFXA 5DTJA 2ZUFA 1JQLB 4Z54A 3KEMA 1GYQA 5KTNA 1FMLA 2VDQB 3OA2A 5IJ9B 2XSZD 1Q14A 5H70A 3V42A 1PVDA 3C74A 3GRUA 4Q34A 4GSYA 4CMHA 3BE4A 1V8ZA 2O1EA 4L5AA 1VKHA 2ERCA 1TM4E 5E7JA 3MS7A 4GT1A 3L1JA 3IAFA 3KZNA 3TPZA 4P4LA 4K9OA 1P0QA 4FFNA 4MV8A 1ZK2A 2PGDA 1MTOA 4WZBA 2H08A 3PUYA 3PFNA 1W5BA 1GAWA 4H3SA 2W2OA 4TS3A 2E85A 1B6TA 1J56A 4EG6A 1RYMA 1XVIA 3BFVA 2HYIC 4R8VA 5A0VA 3VDXA 4ZYUA 5BMVA 3OX1A 3P9PA 4EEXA 4YCLA 3ZG6A 5LIRA 4JHXA 4OEHA 2IEIA 2VDWB 1H2YA 3B1ZA 3EGVA 4PC7A 4KXWA 4B31A 4W7IA 4Q15A 1XNQB 5JSFA 1FNNA 5G02A 5H3CA 1T9KA 2QZPA 4QDTA 4DIBA 2B4AA 5KJ1A 3FPHA 1ZBDA 5DEIA 2JBAA 3V4SA 4Y30A 3MMXA 4HXYA 2HMSA 2RAFA 2I29A 3GUYA 2WAMA 2E4WA 3ZCPA 3PEWA 3DVLA 5EHZA 2P2GA 3SFVA 4I9HA 1OPXA 2V7XA 2VJYA 3CUSA 3AUKA 3TR6A 1UDBA 3DAFA 4B7AA 1FTGA 2QK4A 1AQIA 3OQMA 2JHPA 1QOQB 4PHCA 1Q16A 5C8YF 5JXHA 1RPNA 4MVJG 5FV4A 3JWGA 1VRWA 4ARZB 1Y8RB 4EO4A 5JPDA 2B2CA 4LDRA 1IBSA 4L6AA 3EPRA 4QULA 3UV6A 1G21B 3ICVA 4R1PA 4U00A 1R00A 1A97A 1GU1A 1WB6A 4NCXA 4ZREA 3K9QO 4CF5A 1HRDA 1W25A 1XN1A 1O87A 2XEXA 4MLZA 1PL6A 4OYHA 5KO2A 3AKYA 3EWNA 4XR9A 3AQIA 1TFRA 5DWVA 1RKUA 5JBIA 1CR6A 1V7QA 3E5NA 3TKYA 3V48A 1A7AA 4QXQA 3ZVMA 1H1TA 5BNWA 4P93A 1E3IA 1F8GA 1TZKA 1MEOA 2IZ5A 5E95A 1U94A 8ADHA 4M3NA 4JJFA 1U6JA 2O0JA 3U17A 4D81A 3THOA 3GZNA 1GR1A 2PUTA 3ZDBA 1SURA 2H1FA 2YWBA 1OJ7A 2GRUA 2PVPA 1LPMA 2A59A 3Q6MA 1DC4A 2XWSA 4I66A 1AMOA 2A33A 1A27A 1K4MA 2A67A 2D06A 2PIAA 3AY6A 4LJ4A 4ZVUA 3IC5A 3NKLA 3SEAA 3DS8A 4PW0A 2PZLA 1U4SA 5H9WA 1FXWF 2VP0A 4NZNA 4NU8X 1X3SA 2E89A 5LD2B 5AKIA 2IITA 3C98A 3EARA 1ENYA 2GT1A 2PBRA 3DQZA 1SVLA 5DHPA 5AKXA 1O0SA 5FTNA 3TE7A 1ETHA 1Q0PA 3U39A 1T0PA 2C99A 1PJRA 2SCUB 5B3KA 3QF4A 2EFHB 2VPIA 3HNPA 3OKPA 3B82A 2YWXA 3IEIA 1DUVG 5BQXA 1F20A 1JX6A 2X8WA 3LO5A 3RU3A 3TW0A 1YK0A 2OL4A 3MWEA 5IJ0B 1MOQA 2R8XA 2XTAA 1NVUQ 3GVCA 3L1HA 4CDMA 3WFZA 3PCXA 4EY7A 1B76A 3KXIA 4L0DA 1BHSA 1F1JA 1OYOA 4EW1A 1Z5OA 2DPYA 1ZGCA 5TMPA 1LH0A 3AKEA 3ANNA 3QPWA 3TSWA 1SKUA 4CLHA 2HBYA 2ZAGA 3M1IA 1TZBA 4N5DA 3FOFC 2GAAA 3ET5A 4HJXA 4TMZA 3TG8A 5M5BA 4TUYA 3ZZTA 3ZKWA 1V1MA 4Y2TA 5DM70 3FOEC 5DE3A 1EVJA 1BN7A 1DAKA 3AHJA 1DBVO 4QTTB 3LOUA 1PZXA 5BN5A 3K6SB 5JYEA 4ENTA 2VHXA 4V1CB 1EU1A 2RHRA 5DHRA 4AZ3A 3DR3A 2AI3A 3GVHA 4DZRA 1JAYA 1S2OA 3CNNA 4RE6A 1D4ZA 2DPHA 1PQWA 4U2BA 2PL3A 1EK6A 3NIFB 1CY7A 5IAGA 1HL3A 3OBBA 4MW9A 1RAGA 3SPXA 2Y1KA 3NJRA 5KQPA 3WK7A 3GLGE 2XUAA 4OK5A 3E35A 1Q1ZA 1CY1A 4H1HA 3WGOA 4CR7A 3QWFA 2HMWA 2VJOA 1RM5A 3K2IA 4MVJD 4QU9A 3MEQA 2A14A 2FEOA 2J31A 1TKRA 1TA4A 4MIKA 3QZUA 5JTTA 1YQ9A 1U1FA 1NQAO 2BH9A 1PJTA 3TQCA 5KMGB 5JNWA 5K2MA 5CYPA 1GPYA 3M5WA 5HJ2A 3TIXB 3VR0A 1N2JA 2WU3A 4AJJA 1G7TA 2QU8A 3QKSB 3VYSB 3DL4A 3PWZA 2XB9A 3Q3CA 2P75A 4GEGA 4NJMA 4ZICA 4ZZ1A 3CNQS 2BGIA 4TS9A 3G8CA 3ORYA 4DOMA 1T29A 4H4CA 3LCMA 1CUYA 5KOJB 1II8A 1G2IA 1U3DA 4PLWA 4YRFA 1MB4A 2P5TB 4D45A 2OGUA 5T4HA 1TZJA 1GV1A 2QB5A 1F2DA 5J5CA 3GBSA 1EXMA 3I2IA 1YCGA 1QRRA 1RBMA 1TTTA 4JFAA 1PR4A 1PL8A 3UMFA 1ZJ6A 2FZWA 4D9JA 3KE8A 4RK1A 2I1VB 3NMUF 5K0GA 4TZKA 4PTLA 4UBJA 2C9OA 3HRIA 1DV2A 1XRRA 4JZKA 2YWDA 1YVUA 2OZEA 3KKNA 3TZQA 3W06A 4BFXA 2WJYA 5JASA 2QE6A 2WILA 3Q7TA 3CT4A 4N0EA 2YMLA 1JDVA 4WWHA 4AYXA 1YL5A 4DJ5X 3QHPA 5IDXA 5HNKA 3HKDA 1OFUA 2Y1CA 4DCVA 4A0GA 4URFA 1RI1A 3WV5A 4LJ5A 5DNYB 4GMXA 4J07A 4U9HS 3W04A 5IVHA 1O3YA 3CF4G 2JLVA 3HR4A 3DWEX 3ZGNA 2G36A 1MAVA 4NMWA 1PT6A 4AIRA 1NNUA 3RSGA 2VC2B 3FPCA 4AM8A 2KB0A 4CMEA 1XL0A 2IK8A 3KZKA 1Z2AA 1ZHFA 9LDTA 2PL9A 3FFWA 3EVAA 3NEYA 5D5HA 3TSCA 2GTIA 2UXCB 1QYWA 4J0CA 1XZMA 1GL9B 4EKNB 3DPSA 4EL5A 1JF8A 3L6BA 4L28A 2B0JA 1DQNA 2OCAA 4DWWA 5K0BA 4Y2VA 1QH1A 1M1UA 1VC2A 3ZE8A 4D79A 3SIPA 1MORA 1DKOA 1Y80A 3LHSA 1AF7A 3LY7A 3L49A 3LQYA 5CDFA 1A9XA 5DNEA 1YBVA 3FIJA 3Q8XB 4KN9S 4OHUA 2FMKA 3F5FA 3RBVA 4XIIA 5K03A 4P0QB 2W48A 4NNOA 4DTCA 4K81B 4MGIR 5F3DA 3KZOA 4BV9A 1KI1A 3A1FA 1KOGA 3HP4A 2JATA 3A7DA 3LT5A 2YQ4A 3SDBA 1L5FA 4BY9E 4UBNA 3GOHA 1A7UA 4OK6A 1RI4A 3KFVA 3ZZUA 3U6BA 1FTWA 4EG7A 2ONJA 1T5SA 1BJTA 1SM4A 2UYGA 3P7MA 5KWJA 4KQJA 2BZ0A 1U1GA 2DBQA 4P3XA 3TNJA 3HVRA 2BM9A 2PVCA 2Q1YA 1UKBA 3OMWA 3GA7A 1HBJA 1NR1A 3R3JA 1E3MA 3L1IA 3JAWA 5L53A 3QENA 1FZTA 3CLRC 3HB0A 1I8TA 1VKRA 3HH8A 3II6X 2KBEA 1GTL1 3VNUA 1JN0A 4YNBA 3IIEA 4IEFB 5HK8A 2GKSA 2AXQA 2RSLA 2PZGA 3VHXA 5ICSA 2QTRA 3Q8WA 4IHJA 4X8MA 5LFAA 4DQDA 2NQ2C 2CHVA 2BY4A 3DZIA 3WGHA 1IHOA 3GLTA 1SQSA 1C50A 4RHUA 3WWYA 3TOCA 2H31A 1IHYA 2G4VA 1XYYA 3QXJA 4UCXA 3TFQA 1DPGA 3AR5A 4Q93A 4DVJA 2X7HA 3ZZMA 2MTBA 3OE7D 4YLEA 3S7ZA 3B48A 4YJGA 1GPMA 3EA4A 3FLAA 1X0XA 3SF0A 4G5YA 4WNIA 1FSPA 4EJFA 3GL9A 4N5MA 2R2GA 3MTQA 1G41A 1DMRA 3EWIA 4EVIA 1DELA 1FP7A 1EGQA 3KYIB 3ESRA 3PE6A 5IAJA 5J3JA 2MYPA 1QPBA 3AIKA 2HCJB 3ENQA 2ODWA 1SO8A 1XB2A 2XOXA 4X1KA 2DY0A 5AVJA 5TV2A 3BILA 2VYVA 4TMWA 1E5DA 1ZRNA 3SXUB 2VPPA 3IERA 1NSYA 2DTEA 2CD9A 5EIAA 3S0JA 4RTKA 1YR7A 1FMFA 1IY9A 1D04A 1VB3A 2JHCA 3LPMA 2INGX 4R54A 4UW9A 4YRTA 2X8AA 2VJQA 5ARDA 5LIPA 3DWIA 3WYDA 2JFBA 5KKAA 4E5YA 1Y6GA 3UK2A 4C08A 4EGJA 5C0OE 2UYYA 4AP6A 3GF4A 2WU8A 3LX5A 3OM1A 3T1TA 3CEHA 5BV8A 2OM6A 5A02A 2VP3A 3ANTA 2V8BA 3I9KA 3WGZA 1CRWG 4EEKA 3OLWA 5AHWA 3LU1A 2IKQA 3KB1A 4BKRA 1OX4B 2JIMA 1JIIA 3EIUA 4N12A 1L3BA 4BNFA 2V6GA 2BBWA 1KJYA 1AGYA 8OHMA 2QSUA 1YULA 5AJWA 4PNEA 3EW7A 1UMBB 1USIA 5CVJA 1SVKA 3FZGA 3ICCA 1U2QA 3ENZA 3OTHA 4N8DA 5KSYA 4EENA 4R68A 2PFGA 4TV9B 2FQYA 4CMAA 3NGMA 1QO9A 4KQ1A 1N2IA 4M89A 3WAGA 2PZ8A 3C14C 4CM5A 4R40A 1IEVA 5AJHA 1DSSG 1U0JA 4FR5A 2IJGX 1K6MA 1L4BA 1VE1A 3FTQA 1LF5A 3OIWA 5ERXA 5TS2A 4B2YA 1ZUNA 1G7CA 1VBFA 1H66A 1YJQA 2XYQA 3SZUA 1PZEA 1M6WA 1KTVA 2AOTA 4HEJA 4QWMA 1G1MA 1JTEA 2VQFB 2I3GA 1LQ2A 2IELA 2WIJA 2VAXA 3IV6A 4G3XA 2OCBA 2ZVDA 3BKWA 4UVDA 5FUBA 5KC9A 2R5FA 2A7XA 2QD4A 4X45A 5F5XA 1ZJWA 4XD7A 2EQ5A 2ZJ5A 1F5NA 1MJGM 2WIBA 4DR3B 1Z4IA 4F5WA 3BRWD 1MEEA 4HYQA 2A1UB 4JXXA 1C3LA 4CDRA 2I54A 4M38A 4DAOA 1WB9A 2EEZA 3UMGA 4LYDA 1K9VF 1T2EA 5KNDA 4RZQA 3X1ZA 1DXYA 1Q15A 1E5VA 3VR5A 3GY0A 4F6LA 1RMYA 1UAYA 1UOPA 3E22B 2DUNA 3VR6D 3N53A 4A23A 4AJIA 1RBQA 4UHEA 2ZB7A 5BURA 1CE8B 2R7LA 3R09A 3RV3A 3KTAA 5DMHA 1IY2A 2CJPA 4ZCQA 2W2LD 2AIRA 3NVKI 4P7JA 3WOVA 3C0KA 3EN0A 1TPZA 4NQRA 1K8QA 1WE2A 4MI1A 3D4OA 4OLBA 5T4BA 3MLBA 5EXDA 1SCUA 3AVYA 2DKOA 1E3QA 2F4NA 3HCAA 4PX9A 1UPXA 2A78A 4OPMA 3U4DA 4A92A 2UUBB 5D84A 1CUVA 1EFCA 1K3TA 2B69A 3EAQA 4INOA 1RVV1 4K9MA 4CKBA 2FDRA 3KAJA 1ND6A 1P72A 4RMIA 4K87A 2R0QC 4OX9Y 1JEJA 3CZQA 2FW1A 4I46A 4O4JA 3STUA 2ONCA 4N54A 1OFTA 1D7AA 4FGSA 4HH0A 4B33A 1M8GA 4FWBA 3GYBA 5EIFA 2G1JA 1MB2A 4K6CA 1QYXA 4FLMA 3C3KA 3A1SA 1I7NA 4LRUA 3PF8A 3NH9A 1AH2A 4RV4A 2RGEA 1LDNA 3AM1A 2PJDA 4M86A 3W90A 1MJNA 2C5SA 3ACCA 1BCRB 5IJAA 1ZSYA 2TMDA 4C4TA 3DTVB 2F55A 1PFUA 1AKVA 2BEVB 4XIYA 2FRVA 1O8BA 2HMVA 3PQEA 4G0NA 5J2UB 3USCS 3WB9A 3X1XA 5CA0A 5JW6A 5A5EA 2HA3A 4PLTA 4F9GA 5EPUA 3H2BA 3EAFA 1CW2B 1TK3A 1A4UA 1EDOA 4ND8B 2AD1A 4H7IA 4QNMA 3R1IA 4MGZR 2BMFA 2RHWA 4ZI3A 1ZISA 2V1XA 1TKBA 3ANSA 1XJWA 4CV2A 4RAOA 3V32A 5I7HA 4HUQB 2PLAA 2PZJA 3EXHC 4NMLA 4K9PA 2C96A 2VSFA 3AFHA 3DMPA 1VLZA 1ZZEA 2Q3LA 2GD1O 2ILVA 3MBKA 4BX3A 2AZ4A 1E9DA 3HN2A 4L5JA 2JD2A 3UUGA 4IIJB 3UYKA 1Z0SA 3K1JA 1IMOA 3M6LA 1JXQA 2IIPA 1XD2B 3AOEA 3I01A 1SVNA 3DPIA 3PGVA 3NEAA 2EX0A 4F2PA 3X1MA 3RSHA 1MH1A 4GC9A 3TWOA 1I3MA 4Q7QA 1WMSA 1QYRA 4CXMA 5F2EA 4QAQA 1CVIA 4KAAA 4KR3A 1NVMB 1P7ZA 2OHHA 3LY5A 4EVQA 5TJ9A 4HQ6A 1MOPA 2XB6A 4EGAA 4E88A 2GM4A 5DN6D 3HMQA 5A9SB 2I2BA 5T3UA 1BSVA 1NVXQ 1TMGE 2O6HA 3DE1X 3NKFA 5EIBD 1YJCA 1TAQA 2FFHA 3ZZNA 1VE7A 3G1UA 3IT1A 5HKLA 5A5DA 3CJQA 2BP7A 4YMSA 3W78A 5JSHA 1UFVA 4MP8A 3KYCB 4G4SP 5TMDA 2O0LA 1NAIA 4TLCA 4XRRA 4ZGWA 1CIPA 4D4HA 1QAQA 1Z34A 3GFTA 2AFVA 4IX1A 2RCNA 4RS3A 2FZCA 2LWIA 2XVAA 3HXKA 3KLBA 4GD3Q 3DMNA 5DT9A 5AOBA 4FYKA 3MMZA 1GDTA 1AO0A 3JQPA 4M8NE 5G41A 1K5HA 1W4AA 2X15A 3GB9A 3NLLA 5I5EA 3K2EA 1JNYA 4M7RA 1NZJA 3S2ZA 4GECA 3WIUA 5BSFA 1R4MA 4LYJA 1CP2A 3C97A 4X60A 4DV3B 2H9YA 3G7NA 5L7TA 1GGHA 1X14A 1XVTA 2XXJA 4NBLA 2VDRB 2HXSA 4LFCB 5JXIA 5ICGA 3QBTA 3ZOZA 4RQAA 1JEYB 1F06A 2PWZA 1SA0A 3QKUA 4WL0A 4LECA 2C3PA 2CBXA 3EMDA 4IDCA 4WMLA 3WBKA 1KEWA 3TLAA 1CNMA 4QU5A 4DFDA 1YUNA 3AIIA 1Z0ZA 4TLEA 2X2PA 1KSFX 3GWZA 2B92A 5LWQA 2HRZA 1T9CA 2H59A 4RHCA 4DLPA 3ITNA 4JP5A 3CVUA 1VCHA 1G8JA 1L4GA 1PJ3A 2R8PA 2ZUBA 4V1CA 1KWKA 1UBMS 3RVNA 1TM7E 4FT4A 3S28A 5KYWA 1I2MA 4DRYA 3A1DA 4KQFA 5AJZA 2Y2VA 4ZCPA 2CV2A 3B3AA 3PUHA 1P4AA 5HP4A 5C5DA 2AZTA 1U7XA 3P9XA 4YJKA 1HZZC 2D2VA 1U8FO 1E4EB 3BWYA 2CWWA 1M2NA 1MGPA 1P60A 1RAFA 1Z28A 4LG1A 4MWBA 2Q49A 4CKBB 4XLLA 5K51A 3PHLA 1UOEA 3QUQA 3KVVA 5KWVA 3LKBA 3LPCA 4C9BA 2EZ9A 2P2CA 4GUDA 5LA6A 5TGTA 3RG8A 4QYXA 1R0KA 3LNTA 4N3AA 4O4IA 5ARCA 1BGXT 2QLNA 2FX5A 4IXDA 1E3WB 4XB1A 3DMTC 4BNNA 1JQBA 2QW0X 5M34A 4ZEVA 3ICEA 1NN1A 3LK7A 3A6LA 3O95A 4E0BA 1EZ1A 4KWHA 1M1ZA 4O5AA 1D4FA 4MLDA 2QTCA 4CNQA 4XE5A 1KOFA 1HEYA 1SQ6A 3OTWA 2NO7A 1M2HA 2I71A 4EJ0A 4MI3A 3GUVA 4FCCA 4CETA 4BP1A 1CY4A 3DT9A 3R8XA 2Z8ZA 3SR4A 3JD4A 4IMPA 3E8MA 3WVNA 2OHJA 1LVHA 4P3YA 3K70D 3HFSA 1WZEA 2IL1A 2GXUA 1YZYA 3IIMA 2GO7A 4QYWA 4OJNA 1OLSB 2FW6A 4F3KA 1N78A 1A8IA 5D85A 1WMAA 3U44A 3OZAA 1AV6A 3LOPA 1G18A 1BH6A 3T0IA 4DLZA 1P33A 2C7OA 4D44A 1UMBA 1U2EA 1KJNA 4JR2A 1A2OA 4TKUB 4D8XA 2GAOA 2YC2C 4ESHA 1X7XA 2JI9A 2QVYX 4MQUA 4JXKA 4C5BA 2R00C 1WIWA 3MRVA 1UKYA 3UYLA 1LRJA 1XA4A 2WHQA 3VOBA 3T12A 5KEIA 5JWRA 5BVHA 3ODPA 1GTJ1 4FMBB 4LBYA 4QREA 3VAAA 4BLRA 3K0CC 3CBGA 4HLUA 1Y8AA 2J9RA 4EMBA 4F7DA 3SZ3A 2BE7A 1UPUA 3NDJA 3R7DA 3MAAC 1A9TA 3EULA 5CJPA 1AF4A 3PC8A 2IWHA 3UHJA 2A9KA 5C34B 4F4UA 1B42A 5BWOA 2PYZA 5IHXA 1IQUA 5K0JA 3FKQA 1K7SN 4OGLA 4XWOA 4LYYA 3NOQA 4LY9A 3REQB 4IHKA 3SOPA 4B34A 1QYCA 2XIQA 1WULS 2JIOA 3K6JA 4D9BA 1SXQA 1QB7A 2F8LA 4J0DA 5HF5A 4R1QA 1ATIA 1V5EA 3CG0A 2ZDGA 3QJYA 2NUAA 2OSVA 2PXHA 4I5DA 3TQHA 1V9CA 2WRZA 2B4YA 2RGWA 2AOWA 3QYAA 1VSQA 1LSUA 3FWYA 1NP3A 5BR4A 1ZK0A 1PU2A 4ZAXA 2PAFA 4F4HA 2Y99A 3L8GA 5EMMA 1XCLA 2ZRKA 5H3HA 5H4HA 1NE2A 5IW8A 2JGRA 3SN6A 2BF4A 2OFPA 4MUIA 3HCOA 4N7MA 4OA5A 5JYBA 1B23P 1X0VA 1XMJA 4XYGA 3NQ41 5FR2A 4UOZA 1WUKS 3UWPA 3OCUA 3OU7A 2RHDA 2ZBDA 3LDUA 3JVEA 5DXAA 1CD5A 3DE5X 4OKIA 1JDUA 2IYRA 1E1LA 1Q91A 2OB2A 4QRDA 3EW9A 1JFSA 1LBEA 5ESXA 2PSHA 4RYDA 1PNTA 1GFSA 3G13A 3U4IA 3P0JA 3NDRA 3FVRA 1USWA 2CHGA 4X44A 2XNSA 1EHYA 2G0TA 5KTKA 1HQKA 4LKRA 1SXJE 3FOZA 1GQYA 1KGSA 1D0SA 5JD4A 3E7WA 3JYOA 1KY4A 4ALNA 2FZVA 2QLBA 3A6ZA 3BRSA 3FMGA 3UAYA 2HT1A 1XL1A 3O38A 4DS3A 2EF1A 3LKVA 5JZBA 1P2FA 1T1RA 3WJ7A 1JE0A 1IEWA 3CHYA 3FHOA 2HB6A 4C3UA 1U7OA 3ITKA 3KK0A 3SM9A 1RJDA 2I2FA 4XWGA 4EHDA 4LYEA 3F3KA 5B4TA 1WVIA 3DQPA 2H4ZA 4QBGB 4NNJA 1ISHA 1ZI6A 1QYDA 2C3OA 1L1RA 3BK1A 3CNHA 4H16A 5C51B 2FFRA 1J0DA 1PLJA 2I4OA 4K2HA 2KSQA 4OYRA 4UHFA 4BLPA 2ZBPA 3IMFA 4JEMA 4ZANA 4A26A 1PUIA 4DYHA 4TM7A 4ZYTA 5C5CA 1ODKA 3FHCB 1ZJ4A 3NASA 1U65A 1PWZA 4I4TF 1XE3A 2BGJA 3UY4A 2FLVA 1JSLA 1HQCA 3LHKA 2JVIA 2IYSA 2ZRQA 1Z22A 1ULBA 5J9FA 1E99A 3G2MA 3OJEA 3SYLA 4RFSA 3DBLA 3HTXA 4Q12A 4ZT3A 4HF7A 1QTNA 1C4OA 4LAFA 1MA3A 4AY5A 5F76A 1NMXA 4MQ6A 1ZZGA 1QZUA 2QHXA 1KQPA 3B13B 3PDIA 3PXXA 3K4PA 1OYWA 2HX1A 5BRNA 3T3NA 1SVWA 3EAGA 4JFRA 4MV7A 3W6PA 4GL4A 5J58A 2VHZA 1CUBA 1EDBA 2B9VA 4RVFA 1W30A 3O2NA 4CFZA 5A6SA 5CA1F 3RREA 5JJCA 3FHTA 4H7HA 5JANA 1G66A 2P7HA 5EQDA 2XCQA 4TN5A 4HMQA 2VYVD 4COKA 4BO3A 3KQUA 1L7RA 1OTYA 3JZAA 1NTOA 2FRXA 1J8YF 2G0AA 3HDGA 1SOMA 1JJIA 4E2ZA 3CF6R 5BW8A 3O1IC 3E8SA 1NLUA 2C2HA 3JQCA 2RGNA 1ZUIA 4D97A 4U7HA 4L7VA 3BF7A 3TRIA 5KNBD 1KI8A 5A04A 3C6ZA 2GWHA 3ZJYA 1AZLA 3B9QA 2BP7B 4QEKA 4CT5A 1R15A 1J2YA 1QJ4A 2R8EA 4JI7B 3L7DA 4NE9A 1UJ6A 2A1UA 4R3NA 1AQYA 1KMMA 3I01M 3TZEA 2OPHA 4D0NA 1DTWB 1Y5MA 4HWRA 1GVHA 4EHBA 1P0MA 1GGEA 2VAVA 3FGOA 2XIJA 1P5FA 4P36A 4Z4GA 5LMZA 1OZ0A 3KPWA 5GGXA 3EZXA 2PA3A 2YWEA 4ND3A 2X4LA 3EEFA 4QBIA 3RU7A 4BKMA 1DCFA 5LM3A 4C0KA 5LDGA 3OTOB 2JG3A 5E6UB 2DR3A 1VG8A 3OBIA 1KPHA 1OR8A 4ATNA 1C9MA 2ORED 1GDHA 1NBMA 3KV1A 1D2GA 3GLHB 4DLUA 4YQZA 5FORA 3WGYA 3PUIA 2XHZA 2Q9AA 1GARA 2QENA 4TSFD 1UM8A 1DG9A 3MGCA 4QYIA 1O9BA 2O06A 1D0VA 5IJZA 4KGVA 2R7KA 4NENB 3RHTA 3WGJA 2IA5A 3OQHA 1Q50A 2BLNA 1KQOA 3C48A 4HNSA 4IIUA 1WZNA 1NQVA 4PE5B 4L8WB 2C92A 4WJZA 3E18A 3T9FA 4EHKA 3CB4A 3QVXA 4OFWA 1UT8A 4Y8VA 3UOWA 4QE3A 4U6QA 4WX2B 1U28A 1D4OA 1PS9A 3EUEA 5YASA 2JVKA 4COOA 4P82A 1LB1B 3A26A 1YBFA 1ZITA 4WNCA 4V0QA 3OM8A 2YZNA 2G72A 3ULKA 2Y68A 1PL7A 4KMSA 5EGNA 1JLKA 1I33A 3FJOA 4PZLA 5FUMA 2B9EA 5AP9A 3SMQA 3WICA 4D8VA 1RQRA 4TS4A 5KOIA 1IEXA 1SOVA 1DKNA 3ZIAA 4AN0A 4Q4HB 3KZVA 1C3OA 5FTMA 2YINC 1HG1A 4MCHA 3SYRA 2LDBA 6Q21A 4E5MA 3EFBA 1J9EA 3TBFA 3U62A 1R8JA 4JJ4A 4DM7A 2J32A 2WT8A 1QXSA 4HQNA 4XIJA 3FPLA 3BXFA 1ZMTA 4BQQA 2PTGA 4JR0A 1GU7A 3AF0A 1QBGA 1GO2A 3DMDA 3M8KA 1ZQ9A 4XUDA 3S2SA 2FWJA 3DDHA 4QVGA 4WK2B 4XCXA 2C1ZA 1ZC4A 2GD2A 3GJRA 2PGIA 3K2BA 4PG4A 1MO4A 1R37A 1T3LA 3E27A 1XJ0A 4JGGA 1I6MA 1NY5A 4UXHA 3SCZA 3TTSA 1E4EA 1O6ZA 2YR0A 2H7VA 3DOOA 2VPXA 4XKJA 4YO7A 4UVGA 5ITZB 3WZ2A 3IT0A 4YTEA 2P3QA 5TVGA 1F2UA 2CLHB 3HXTA 3KWFA 4H15A 4WAUA 1T6XA 2XBUA 3QGMA 5F73A 2ZUTA 3RGGA 5T5QA 2VQSA 3I6IA 3VAZA 4PGFA 5LP6A 2NZJA 5ITSA 1TJPB 2G40A 4DCPA 1SOAA 3LPAA 4FX2A 3FG9A 4LRSB 2IS6A 1K27A 2X5KO 3EE6A 1M2EA 1TK9A 4L5BA 4MQFB 2W70A 3EDYA 3ZNQA 4F2HA 4MPPA 4ZO4A 4WVLA 2ZSBA 3GT3A 4ZYXA 1R0ZA 1SPBS 4FSDA 3VSDA 2QOEA 5AFSA 1UFQA 1AHHA 4IQ0A 2P90A 2L69A 3EQZA 4LXQA 3WSTA 3M3PA 4GMKA 4DCCA 4EHLA 3OFVA 3HZHA 2Q0HA 1JQJC 5AK4A 4FOTA 2HF2A 4Y6GB 4F85A 2RKOA 1JJFA 3W8RA 2VUSA 3TO5A 1WSBA 3QLJA 1EZ4A 2XLBA 5TJHA 4DIFA 4FIDA 1MVOA 2ZCUA 3KEOA 1EUDA 2WKWA 2HDHA 3IAXA 4MIEA 2NWQA 5E1BA 4ZALA 2B94A 5IMBA 5IAOA 1RWBA 1UJ5A 5HJEA 3IOMA 3NP7A 4C0LA 1YBHA 4FGKA 1TEXA 3GRFA 1U6IA 3U0VA 1C0LA 3TDMA 1UZAA 3H2GA 4XGKA 1FUEA 1ZKMA 1EVIA 2C4NA 2ZPTX 3KJEA 3GFVA 3PUJA 4FYHA 4GXTA 4NATA 4RD1A 4ZZ0A 3ENKA 2I91A 1V3QE 3AC0A 1Q22A 2UZ3A 3DHYA 5F1PA 4JLUA 4L22A 3EDRA 3ZUGA 1ODFA 1XMSA 1XZJA 4GGPA 5CB4B 2R1UA 1H2BA 1GCAA 3KTOA 1KJWA 3C3XA 1NU6A 4N0PA 5KHAA 4E15A 4JROA 4KO2S 2RARA 4N3GA 3Q0EA 3T9CA 3EVTA 4QUDA 3RKRA 2ZIGA 3N5KA 3PPIA 1VKOA 2ETVA 2G77B 3O4GA 3UWMA 1VJRA 3ZWPA 4D80A 5A3JA 4GDFA 2X9LA 2I4LA 1JJVA 3TD6A 3PFHA 4IUYA 3VU0A 1GGMA 5B3LA 3QM1A 3DL2A 2R3SA 2A0FA 3PI7A 1BU8A 4HUQA 2P9HA 2Z3ZA 3GLHE 2WNHA 4ILKA 5JWHA 3ZCSA 4J0KA 2ZIWB 3LT1A 3OY2A 3F3YA 3IHWA 1G5HA 2Y27A 3PNSA 3FPFA 3ZCUA 1QNLA 4NXMB 3O83A 3TEJA 5AI5A 5JDIC 1HKHA 2CLSA 1Y48E 4YBZA 1MHTA 1ZOSA 2A0KA 5TQ0B 2BTQB 4KH1A 3QITA 4ND7A 3KHTA 1XZ8A 1KJIA 2WMYA 3KAPA 4DXAA 7MHTA 3FNIA 4ECEA 1Z62A 4RTQA 4JC0A 4JJAA 3THRA 1FX1A 3UG7A 3WMRA 4CV1A 1RZRD 4HNAB 1EA7A 4XX0A 5K7SA 3IE1A 2ESRA 2PWYA 1DC6A 1M76A 1I7LA 4DA7A 4JJGA 3D7RA 4MCAA 1W5AA 4RSRA 5A4KA 3EPHA 1KERA 4F5DA 4W5RA 1QQ6A 3RODA 3N7TA 1E63A 3GMIA 3T8YA 4UOEA 4N6OA 1EMDA 4PSAA 5GOZA 4FT2A 1UBLS 4TZTA 3H5AA 5EIWA 1YKFA 3ZXSA 1NBWB 2Q4DA 4IRMA 4PAMA 4CM6A 2HRBA 2VQDA 2GDZA 3ZHSA 1UZNA 3OFND 1YI0A 2D0IA 5CW2A 3OO0A 1S89A 2IYAA 4TKUA 2WPDD 3WLMA 5AD1A 2HHLA 2R1TB 2E1RA 1U3GA 2JARA 3FCCA 1ZQ1A 4G63A 3IPYA 3JAKB 1B6GA 2VIIA 3NH6A 1VFPA 3D6VA 1L8AA 3DBIA 1NATA 3EVBA 3OZCA 4MS3B 2WIGA 2GBGA 4Q18A 2OGWA 4QYSA 5M3BA 3GJ7A 1H8HA 4DIEA 5HRUA 3AUUA 3N2ZB 1ZJZA 2EGGA 1BGVA 4RZSA 1M34B 1LDBA 2QV7A 1NQXA 1V16B 2QXUA 2RGGA 2W6JD 2ZJ3A 3JYHA 4FX5A 3KZXA 4M1TA 1BIFA 3D0RA 4RCZA 5G3ZA 3TW8A 2HPAA 1K8XB 3G5MA 4B2PA 4CMKA 3L40A 3CKKA 4YCBA 2FN7A 5FWAA 4QOGA 1CEQA 2ZRIA 3K6SA 4PLFA 1JR6A 3DC7A 5BN5B 5JCZA 4FZ3A 2Y05A 5ALUA 2JIDA 4K6FA 4D3FA 2HU5A 2ZQZA 5E9AA 1HRKA 4OQEA 5I9TA 1ZGJA 2XZPA 5KX5F 2NUTA 3CRMA 4YECA 4MYDA 4TS1A 5JO0A 1KK2A 4CUJA 1SXJB 3ZWBA 5F2OA 2HU2A 4JI2B 1DBQA 4OYLA 3NRBA 2FSVA 4XSHA 3QYFA 1O5IA 5CXUA 4KO1S 1OB2A 1F9EA 3VDNB 2CGEA 5DHSA 2HA7A 1YS9A 1TC2A 2J5QA 1EBBA 5IKPA 2VF4X 1LRLA 1SVIA 4I4TB 4NZOA 3EH1A 2CF5A 4G5XA 1AQUA 1VG0B 4BVEA 3B1VA 3T7AA 1Q6YA 3CLKA 2Q28A 4Z9YA 3UJ3X 1GG9A 4E5NA 1O89A 1WM1A 4M0CA 2G7MC 2VK4A 3HNRA 5B5SA 3GRYA 4B6JA 4DJEC 1X15A 3HL0A 1N2HA 4KNYA 1HE1C 2NUBA 3GAMA 1Z83A 4EO9A 1RAEA 1SY7A 1Y9DA 2P6PA 2X8JB 3E9NA 1IJKA 1FDRA 1NFRA 2Y6VA 3P27A 4JKOA 5LUAA 4O4HF 1ADYA 3V4PB 5FAKA 1SKYE 4EX7A 4WZZA 5GPBA 1C3EA 2ZEJA 1YXMA 3LXXA 3QFFA 2D1YA 3ZDEA 5IS2A 4EPRA 3RJ9A 1TO2E 2EBUA 1RAIA 3QVKA 4HUJA 5C8XA 3KOUA 4WSOA 1IDOA 2AVNA 4WBNF 1GM5A 1J0EA 3TKLA 3H2IA 1IYZA 4M83A 2QY6A 4P81A 1LWOA 4D4MA 4BAZA 4EI2A 3QFTA 3TDKA 3G82C 3R44A 4QT4A 5EMHA 2XMSA 3K4HA 2VI5A 3PNVA 4LZNA 5CT6A 3NVAA 1C29B 3AZPA 2HTFA 4FYIA 3MD0A 5EIOA 4BJHB 1UT6A 2QN7A 3H05A 4DDTA 2QA5A 3UA3A 1JU9A 3I83A 2VDOB 1KU0A 1DAMA 4WZAA 2I6FA 3RWOA 3WFIA 4YJDA 4Z4FA 2R7NA 4TVKA 3E81A 2J33A 3N2IA 1VJDA 3V97A 2WYOA 1Q0UA 1TMKA 1XCOA 1C1DB 1ZH8A 4JQCA 3ETDA 3RVMA 3QOXA 3V6MA 3L7JA 2UUAB 2IW3A 3IUYA 5FNVB 4DMFA 1KS9A 4FMCF 4DV1B 2YNMC 5B6PA 1P17A 3B8EA 4IJMA 3PC6A 3OJXA 1HWYA 3NHLA 4RGQA 1P80A 1XO1A 1IE3A 1I1QB 2ZJ7A 4QTUB 2P4QA 3EIWA 4QU8A 1XTQA 3HFGA 4WY2A 5HF9A 3VR4A 1ZXXA 3A1UA 1IPHA 4MB2A 4MAFA 4ZT4A 3U7RA 3ZGZA 1E6WA 1K2WA 2BHSA 2I3BA 4Q0MA 3NJ4A 3I9MA 4LGCA 5HMLA 3VA7A 3QYPA 2VDJA 1NI5A 2X5XA 2ATVA 2O0KA 5FP0A 4PLVA 4D9NA 1A2KC 4CQJA 2OXEA 5JS6A 4GZ5A 2WFLA 1RTTA 5C8YB 4PLZA 5EWMB 1FJGB 4LF5B 3KT3A 3AERA 4IIHA 4J29A 3MTDA 5CP8A 2DH6A 3MT8A 4L0QA 2XYPA 4NPCA 1XKXA 1YACA 1WB5A 3O91A 1RJWA 4X1KB 5EXSA 5IBRA 1O58A 3PK0A 3I9JA 2PX5A 4TKMA 4UNQA 1PGJA 3O0TA 5IH7A 2P0AA 1VCNA 1E9CA 1T5OA 2RGBA 2QTVA 1NUSA 2JJ2D 3NBKA 2CNOA 4G0ZA 3G0BA 4IIJA 4LOAA 1WPGA 1EFVA 4S24A 2NMVA 4ARCA 3DXYA 1N5LA 5SYNA 1LLUA 2ZOSA 4B6RA 2CSUA 2AI1A 4BZWA 4BMSA 2HA4A 1O54A 3SSOA 2QYHA 3D0OA 2QUAA 3AYXB 5KQSA 7MDHA 3K1YA 4MRRA 1OZFA 4IW3B 1U0FA 3GRZA 4IJVA 1WY7A 2IEAA 4KFUA 3ECCA 2PH1A 2IDKA 1R4ZA 3NX4A 2CFRA 4ND2A 5TVKA 4DCJA 4EHNA 5AW2A 5T7BA 3N9IA 1MUUA 3NTXA 4JI6B 1MT0A 2XNHA 2JJYA 4M7PA 4RY0A 2HRRA 3KEGA 2C9CA 4UVHA 4TX1A 2Z9DA 3N3AC 3RYHA 2OK8A 4ZAWA 4E3ZA 2VA8A 1QQBA 3X44A 2Y6UA 1JHMA 1UMCA 5U1PA 3TX2A 4O4HB 3SS8A 3IIJA 1EA5A 2J87A 1FLDA 2WFZA 3AESB 2LIVA 2O2SA 4GX1A 4G09A 4N65A 4LC0A 5CNMA 4B0OA 4EW2A 4CKCB 2YFYA 4QPPA 3K9HA 1PE0A 5ALDA 4PXYA 5TDHA 1RABA 3CLTC 3UMBA 4ITUA 1Q0RA 1YMVA 3UM9A 1OFUX 2DFPA 4WCFB 4L8GA 3CX8A 1OXSC 4F9FA 1UXIA 1LPBB 5B4UA 1N4DA 3TAHA 1C7IA 4LCJA 2FOIA 1IM8A 4EG1A 2J08A 3FW1A 1P4JA 3SC3A 3A58B 4L57A 1CBUA 3TOVA 1U0GA 3WRYC 4KPUB 4E4YA 1NE7A 1B93A 3LIIA 4UNSA 4DMRA 3CC8A 4J9UE 1B8NA 3BJIC 3ELUA 4LWQA 4KE8A 4MOWA 3STTA 1SIWA 4EA8A 1YZQA 3OZIA 4ZOLA 4KTVE 1EX7A 1IK4A 3GPIA 2VCEA 3BMQB 3OOSA 1KIAA 1P6QA 1QCYA 2J5KA 4W63A 5EZYB 2QMZA 4KUHA 1NNEA 2GJ9A 5K20A 1T25A 3FHJA 1UPFA 1IZYA 2YXDA 1FRFS 1Q3HA 1WMDA 2QR3A 1M1YE 3MA0A 4QOJA 4BP8A 1NI3A 2BSAA 3PGMA 4G23A 1CF9A 4YV0A 5LP6B 5G4KA 4C3ZA 1VI5A 4A0SA 3U81A 4OFXA 2VTBA 1VPDA 3AUJB 3E03A 3VUFA 3PQ5A 4ITRC 2QL7A 4XDHA 3ZDFA 2HADA 2IYXA 4KQ6A 5BXYA 3IKLA 5A9TA 3ROGA 1OA1A 3IAHA 3VPCA 4QUIA 3I5XA 4BWYA 2GCOB 3C8DA 5BO5A 4ZI7B 4AS1A 4I55F 3AFMA 5HIJA 2X4GA 4UM9B 2ZREA 4LTDA 1QS0A 1TAGA 2SECE 2X6TA 3JVIA 4S1PA 3TJMA 1HETA 2GLXA 3G5TA 4HGQA 1ZD8A 2ZE6A 3GQVA 2PJZA 2W2MA 3JZIA 4LZJA 4RY9A 3K70B 3LVFO 1GTRA 1V9SA 3AG5A 3DB2A 2OV2A 3SZMA 1QH0A 1ZFNA 1H5NA 2X2OA 3DKIA 1T3TA 3KVYA 2PZFA 1SKAA 1VI6A 1AA9A 1KA9H 3UZUA 5LP1A 4FUTA 4R41A 4X7RA 4X64B 1KDPA 1V35A 3NXSA 3OT1B 2EU8A 4P4TA 5LMNB 4DABA 1JHDA 3FI9A 2KQUA 4AKGA 2WV9A 4V39A 5GGYA 3DL0A 3UCFA 1QC5A 1YBAA 2QEQA 1P2DA 4C78A 1D6MA 1FVOA 1Z6TA 4MJXA 3WNCA 2H5JA 5AW7A 1ITZA 4X66B 1WPXA 2VDLB 1EFRA 1TE2A 3FWKA 3F96A 4FN5A 2C2XA 3ASZA 1OZAA 4BFUA 1NPYA 2HRQA 3EC7A 3M2TA 3RS3A 2ADFA 1JL3A 2FH5B 1Q1NA 3GD7A 1IRXA 3G17A 3H5LA 4DILA 2J0UA 5IKEA 2ACWA 5HQJA 3BH6A 2YWGA 4IHJF 1CCWA 1X74A 2J85A 2RC6A 2XDQA 4YJ2B 5AICA 5CA0B 4Y2SA 4QFBA 2O2HA 2IV3A 4QM7A 2FWRA 3NYWA 4BXOA 2FKAA 1G5FA 4I2VA 4LRYA 4PAGA 4S1TA 1HLPA 1YS2X 4IDDA 4OB8A 5EKUA 1TW3A 3B60A 2NU9B 4FDAA 3C3AA 3DZKA 4MJ7A 4ILEA 5CCDA 3KPYA 5HZGA 2O8FA 3IJPA 4B4UA 3RAJA 1VE6A 2VK8A 3WZMA 2QQ0A 2QTGA 3ACDA 1M2GA 4UTZA 1M72A 3VR3A 1O08A 2XT6A 1UIRA 4DZTA 3BORA 3QNMA 3V8VA 5LBUA 4JWTA 3P9ZA 4Z99A 4ZJPA 3KFLA 1KO7A 1E2LA 2RKBA 3PQ7A 5CFRA 1FDSA 3R3WA 5KYNA 1OWNA 4P9NA 4F4DA 1V1JA 1ZOPA 3SEZA 3L6RA 5A5GA 2XE4A 3DJFA 5EEGA 2VH5R 2W2KB 3T5AA 2RGDA 4U4AA 5ALXA 3TUIC 1D2MA 4HRYA 3IV7A 3HY6A 1CETA 3GCXA 3QTTA 3GLKA 2C8KA 5DGIA 6PFKA 4B3BA 1EXWA 2HCFA 2NYAA 3EUWA 4YA6A 1TMOA 2K87A 1UK7A 1IONA 1WR8A 4X97A 1OY1A 4L0CA 3P4UA 5HK9A 5I7VA 4OQPA 5DOZA 4LRWA 2C84A 3OEYA 1U8YA 5NLLA 5DKFA 2ANCA 1CIVA 5HG0A 1W9MA 5DNCA 3M6UA 1TVMA 1OXMA 5AI6A 3QV1A 4R0NA 4WLFA 3H16A 1JFLA 1EX9A 4OHVA 2I4RA 3AVPA 3COPA 4N9WA 4OO3A 4TMKA 2V03A 3EGDB 4J3JA 3CR7A 1JV2B 1F6WA 2JIZA 3CUWA 3OH8A 4M98A 2ECQA 1ZOIA 3EGXA 1NDQA 5SZIA 5CFOA 2V7VA 2ZSUA 3PHCA 1QP4A 3C24A 1CUGA 4PF1A 2QTLA 5EHNA 4ASUA 5I3ZA 2YW2A 3S70A 2AVDA 1G42A 3A6EA 5K8CA 5EIXA 3COJA 1NM5C 2JJ2A 3UVEA 4ZI2A 3U4CA 1YQEA 4NRDA 3O4IA 1K98A 2PQ0A 3GCWA 3NT2A 1FSGA 4QBKA 4Q9DA 3RS9A 1CJCA 2PL1A 2JLZA 1Y3HA 2JJQA 3TZKA 3FB1A 2ZJZA 1VJGA 1GEGA 1JXMA 1ZJJA 2BC9A 3OA0A 3PP8A 3QXHA 4FB4A 2YIJA 3K32A 2NADA 1PS8A 1XRQA 2YWFA 1I4LD 3MGAA 4QVKA 1FU8A 1LPSA 3W5CA 5TQ2A 4C14A 2ZRAA 2ZZKA 4GPAA 2MYUA 4LV6A 4ZODA 2ZETA 4BLQA 3UXEA 4CIBA 3TOSA 3I6MA 4CCYB 4MWZA 4REOA 3UC5A 4UHDA 3FDJA 3IDSA 3GZNB 3BEDA 2J9FA 5DW3A 4D0RA 4J0HA 4DC1A 1KVUA 1S3IA 3O1HB 4XGNA 1WBBA 5NULA 3HACA 5KWSA 2KJQA 1QX3A 4M1YA 2C7BA 2QRKA 4ENUA 4QJ5A 1TX4B 4L8YA 5EAIA 1J90A 5AHOA 3DW3X 3ZE2B 1AKWA 4BKOA 3R9IA 3TE6A 4KPFC 4AQDA 5LDHA 2VJBA 1XK6A 5L3QA 3ZV7A 1I9CA 1QHSA 2GEJA 1DBSA 1HTBA 1BS2A 5E4TA 1KTIA 2WDPA 3E9QA 4BVGA 4ER6A 4AX8A 3U0BA 1L5HB 3GCDA 3KWMA 5FHRA 3TOZA 1H94A 4EJMA 3EYAA 3C7AA 3CX3A 3HO6A 4LYAA 4NLLA 2RH8A 2YWHA 4KLZA 3VH4A 1KKLA 4R83A 4B32A 5JCPA 1XLUA 4YQFA 4ZVNA 2GEBA 3RK1A 3Q7EA 4JH0A 3MUOA 3W6ZA 4TWZA 3E2PA 1Y7LA 2HU7A 1FFBA 3G9QA 4G8DA 1X7DA 1A8UA 4TUYF 1NZFA 2BEVA 1SPXA 3X1YA 1QU2A 2VYCA 3FSRA 2P4SA 1LLCA 2PRZA 1N0IA