1XKUA

Crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
305
structure length
305
Chain Sequence
GPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Decorin
publication title Crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 107
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xkuA00
2Z81A 1W8AA 3OJAB 2V9TB 1FQVA 4EZGA 2RA8A 4MN8B 3W3JA 1M10B 4QBZA 1IO0A 1XEUA 4Z94G 1XWDC 4Q3GA 1P8VA 3REZA 4PERA 2WQUA 2OMTA 4CNCA 4XSQA 3VQ2A 3WPCA 3E6JA 3ZYIA 4MQWX 5HDHA 5IJCA 4FD0A 5A5CA 4ECNA 3E2JA 5HZLB 3FXIA 3OJAA 5CMNA 4R6JA 4LXRA 2JE1A 4LSXC 4R09A 4CC4A 1FS2A 4RWTC 3RIZA 2P1NB 5FTTB 4LSAA 4TZHA 4I6JB 5GMFA 4CNMA 5B4PA 2OMXA 1DS9A 2JQDA 1M0ZA 4Q62A 4U09A 1KOOA 3C6PB 3W3NA 1M9LA 4KNGA 1OGQA 5GS0A 4ECOA 2O6SA 2OMYA 1H6TA 5AZ5A 2Z7XB 2OMUA 2IFGA 2ELLA 3WN4A 2Z64A 3W3LA 4AW4A 1M9SA 1K5DC 2A0ZA 1OOKG 3OGMB 4CP6A 3WPHA 4BSUA 3DZEA 5B0NA 2O6QA 4PEQB 5GMGA 3UN9A 2OMWA 4KT1A 4Z64C 2FT3A 5AWBA 2O6RA 2P1MB 4K17A 1DCEA 5IJDA 2Z66A 4J0MA 3G3BA 3RFJA 4IM6A 3ULUA 2Z7XA 4B8CD 4RCWA 1P9AG 1U0ND 2ID5A 1QYYA 4P91A 4V2DA 1XKUA 3RGXA 2Z82A 3RJ0A 4H09A 2XOTA 1FT8A 3M18A 2Q4GW 2Y5QA 4YEBB 4R08A 2WQVA 4Z61C 1H6UA 3ZYJA 3BZ5A 4R6GA 1A9NA 4WP6A 3W3KA 4U7LA 4P8SA 4AY9X 4LXSA 3E4GA 1PGVA 4Z8GA 3WPIA 3ULAA 2BEXA 2OMVA 4U06A 5LFNA 1O6TA 1XECA 3W3GA 3OGKB 3G06A 4LI1A 3W3MA 4FMZA 4LSCA 3PMHG 4R5DA 4FDWA 1OZNA 3ZYOA 3M19A 3JB9j 5CMPA 4M7EC 4LSXA 4V2EA 4L3AA 3G39A 5GMHA 1YRGA 2UZYA 2WQXA 3UL7A 4R6FA 3RFSA 2RR6A 3WPBA 5AWDA 4BV4R 1G9UA 3G04C 3RGZA 4LI2A 1GWBA 4V2CA 2V9SA 1OTOA 5AWAA 3GOZA 1SQ0B 1OTMA 4CILA 4ARNA 3WPDA 4Z79A 5GQRK 1DFJI 4XOSA 1D0BA 2JE0A 3OGLB 3RW7A 1O6VA 4R0AA 2P1OB 4Q3IA 5AWCA 2Z65A 4WYKA 2WFHA 4L3FA 3TSRE 4QC0A 4PQ8A 4FHOA 4NKHA 4R58A 1K5GC 2P1QB 4ARRA 4UFRA 4G8AA 2P1PB 3C6OB 4RCAB 3CIGA 3O53A 5IJBA 4OQTA 4PSJA 3RW6A 4CC4C 4BSRA 3E3ZA 2BNHA 4R07A 3UL9A 3KJ4A 4KXFB 1P8TA 3P72A 3ULVA 2ASSB 3G3AA 4GLPA 4PKIG 4GT6A 4QXEA 4FS7A 4FCGA 3UL8A 3A79B 1FO1A 4HQ1A 4C2AB 2V70A 4J4LA 1Z7XW 3RFEA 3ZYNA 5GS2B 3CVRA 3C6NB 3CIYA 2Z63A 3SB4A 1O6SA 2OMZA 2UZXA 3WPEA 4R6AA 1A4YA 2WQWA 4U08A 5D3IA 2XWTC 4XGOA 1LTXA 2R9UA 1XCDA 1JL5A 5B0TA 4NKGA 4M7EA 3O6NA 2Z62A 4BSSA 1WWLA 4R5CA 1KOHA 1ZIWA 3WPFA 2CA6A 5IYXC 2ASTB 3VQ1A 4C2BB 1OTNA 3WPGA 4Y61B
chains in the Genus database with same CATH superfamily
2Z81A 1W8AA 3OJAB 2V9TB 1FQVA 4EZGA 2RA8A 4MN8B 3W3JA 1M10B 4QBZA 1IO0A 1XEUA 4Z94G 1XWDC 4Q3GA 1P8VA 3REZA 4PERA 2WQUA 2OMTA 4CNCA 4XSQA 3VQ2A 3WPCA 3E6JA 3ZYIA 4MQWX 5HDHA 5IJCA 4FD0A 5A5CA 4NZTM 4ECNA 3E2JA 5HZLB 3FXIA 3OJAA 5CMNA 4R6JA 4LXRA 2JE1A 4LSXC 4R09A 4CC4A 1FS2A 4RWTC 3RIZA 2P1NB 5FTTB 4LSAA 4TZHA 4I6JB 5GMFA 4CNMA 5B4PA 2OMXA 1DS9A 2JQDA 1M0ZA 4Q62A 4U09A 1KOOA 3C6PB 3W3NA 1M9LA 4KNGA 1OGQA 5GS0A 4ECOA 2O6SA 2OMYA 1H6TA 5AZ5A 2Z7XB 2OMUA 2IFGA 2ELLA 3WN4A 2Z64A 3W3LA 4AW4A 1M9SA 1K5DC 2A0ZA 1OOKG 3OGMB 4CP6A 3WPHA 4BSUA 3DZEA 5B0NA 2O6QA 4PEQB 5GMGA 3UN9A 2OMWA 4KT1A 4Z64C 2FT3A 5AWBA 2O6RA 2P1MB 4K17A 1DCEA 5IJDA 2Z66A 4J0MA 3G3BA 3RFJA 4IM6A 3ULUA 2Z7XA 4B8CD 4RCWA 1P9AG 1U0ND 2ID5A 1QYYA 4P91A 4V2DA 1XKUA 3RGXA 2Z82A 3RJ0A 4H09A 2XOTA 1FT8A 3M18A 2Q4GW 2Y5QA 4YEBB 4R08A 2WQVA 4Z61C 1H6UA 3ZYJA 3BZ5A 4R6GA 1A9NA 4WP6A 3W3KA 4U7LA 4P8SA 4AY9X 4LXSA 3E4GA 1PGVA 4Z8GA 3WPIA 3ULAA 2BEXA 2OMVA 4U06A 5LFNA 1O6TA 1XECA 3W3GA 3OGKB 3G06A 4LI1A 3W3MA 4FMZA 4LSCA 3PMHG 4R5DA 4FDWA 1OZNA 3ZYOA 3M19A 3JB9j 5CMPA 4M7EC 4LSXA 4V2EA 4L3AA 3G39A 5GMHA 1YRGA 2UZYA 2WQXA 3UL7A 4R6FA 3RFSA 2RR6A 3WPBA 5AWDA 4NZRM 4BV4R 1G9UA 3G04C 3RGZA 4LI2A 1GWBA 4V2CA 2V9SA 1OTOA 5AWAA 3GOZA 1SQ0B 1OTMA 4CILA 4ARNA 3WPDA 4Z79A 5GQRK 1DFJI 4XOSA 1D0BA 2JE0A 3OGLB 3RW7A 1O6VA 4R0AA 2P1OB 4Q3IA 5AWCA 2Z65A 4WYKA 2WFHA 4L3FA 3TSRE 4QC0A 4PQ8A 4FHOA 4NKHA 4R58A 1K5GC 2P1QB 4ARRA 4UFRA 4G8AA 2P1PB 3C6OB 4RCAB 3CIGA 3O53A 5IJBA 4OQTA 4PSJA 3RW6A 4CC4C 4BSRA 3E3ZA 2BNHA 4R07A 3UL9A 3KJ4A 4KXFB 1P8TA 3P72A 3ULVA 2ASSB 3G3AA 4GLPA 4PKIG 4GT6A 4QXEA 4FS7A 4FCGA 3UL8A 3A79B 1FO1A 4HQ1A 4C2AB 2V70A 4J4LA 1Z7XW 3RFEA 3ZYNA 5GS2B 3CVRA 3C6NB 3CIYA 2Z63A 3SB4A 1O6SA 2OMZA 2UZXA 3WPEA 4R6AA 1A4YA 2WQWA 4U08A 5D3IA 2XWTC 4XGOA 1LTXA 2R9UA 1XCDA 1JL5A 5B0TA 4NKGA 4M7EA 3O6NA 2Z62A 4BSSA 1WWLA 4R5CA 1KOHA 1ZIWA 3WPFA 2CA6A 5IYXC 2ASTB 3VQ1A 4C2BB 1OTNA 3WPGA 4Y61B
chains in the Genus database with same CATH topology
2Z81A 1W8AA 3OJAB 2V9TB 1FQVA 4EZGA 2RA8A 4MN8B 3W3JA 1M10B 4QBZA 1IO0A 1XEUA 4Z94G 1XWDC 4Q3GA 1P8VA 3REZA 4PERA 2WQUA 2OMTA 4CNCA 4XSQA 3VQ2A 3WPCA 3E6JA 3ZYIA 4MQWX 5HDHA 5IJCA 4FD0A 5A5CA 4ECNA 3E2JA 5HZLB 3FXIA 3OJAA 5CMNA 4R6JA 4LXRA 2JE1A 4LSXC 4R09A 4CC4A 1FS2A 4RWTC 3RIZA 2P1NB 5FTTB 4LSAA 4TZHA 4I6JB 5GMFA 4CNMA 5B4PA 2OMXA 1DS9A 2JQDA 1M0ZA 4Q62A 4U09A 1KOOA 3C6PB 3W3NA 1M9LA 4KNGA 1OGQA 5GS0A 4ECOA 2O6SA 2OMYA 1H6TA 5AZ5A 2Z7XB 2OMUA 2IFGA 2ELLA 3WN4A 2Z64A 3W3LA 4AW4A 1M9SA 1K5DC 2A0ZA 1OOKG 3OGMB 4CP6A 3WPHA 4BSUA 3DZEA 5B0NA 2O6QA 4PEQB 5GMGA 3UN9A 2OMWA 4KT1A 4Z64C 2FT3A 5AWBA 2O6RA 2P1MB 4K17A 1DCEA 5IJDA 2Z66A 4J0MA 3G3BA 3RFJA 4IM6A 3ULUA 2Z7XA 4B8CD 4RCWA 1P9AG 1U0ND 2ID5A 1QYYA 4P91A 4V2DA 1XKUA 3RGXA 2Z82A 3RJ0A 4H09A 2XOTA 1FT8A 3M18A 2Q4GW 2Y5QA 4YEBB 4R08A 2WQVA 4Z61C 1H6UA 3ZYJA 3BZ5A 4R6GA 1A9NA 4WP6A 3W3KA 4U7LA 4P8SA 4AY9X 4LXSA 3E4GA 1PGVA 4Z8GA 3WPIA 3ULAA 2BEXA 2OMVA 4U06A 5LFNA 1O6TA 1XECA 3W3GA 3OGKB 3G06A 4LI1A 3W3MA 4FMZA 4LSCA 3PMHG 4R5DA 4FDWA 1OZNA 3ZYOA 3M19A 3JB9j 5CMPA 4M7EC 4LSXA 4V2EA 4L3AA 3G39A 5GMHA 1YRGA 2UZYA 2WQXA 3UL7A 4R6FA 3RFSA 2RR6A 3WPBA 5AWDA 4BV4R 1G9UA 3G04C 3RGZA 4LI2A 1GWBA 4V2CA 2V9SA 1OTOA 5AWAA 3GOZA 1SQ0B 1OTMA 4CILA 4ARNA 3WPDA 4Z79A 5GQRK 1DFJI 4XOSA 1D0BA 2JE0A 3OGLB 3RW7A 1O6VA 4R0AA 2P1OB 4Q3IA 5AWCA 2Z65A 4WYKA 2WFHA 4L3FA 3TSRE 4QC0A 4PQ8A 4FHOA 4NKHA 4R58A 1K5GC 2P1QB 4ARRA 4UFRA 4G8AA 2P1PB 3C6OB 4RCAB 3CIGA 3O53A 5IJBA 4OQTA 4PSJA 3RW6A 4CC4C 4BSRA 3E3ZA 2BNHA 4R07A 3UL9A 3KJ4A 4KXFB 1P8TA 3P72A 3ULVA 2ASSB 3G3AA 4GLPA 4PKIG 4GT6A 4QXEA 4FS7A 4FCGA 3UL8A 3A79B 1FO1A 4HQ1A 4C2AB 2V70A 4J4LA 1Z7XW 3RFEA 3ZYNA 5GS2B 3CVRA 3C6NB 3CIYA 2Z63A 3SB4A 1O6SA 2OMZA 2UZXA 3WPEA 4R6AA 1A4YA 2WQWA 4U08A 5D3IA 2XWTC 4XGOA 1LTXA 2R9UA 1XCDA 1JL5A 5B0TA 4NKGA 4M7EA 3O6NA 2Z62A 4BSSA 1WWLA 4R5CA 1KOHA 1ZIWA 3WPFA 2CA6A 5IYXC 2ASTB 3VQ1A 4C2BB 1OTNA 3WPGA 4Y61B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z81 A;  1W8A A;  3OJA B;  2V9T B;  1FQV A;  4EZG A;  2RA8 A;  4MN8 B;  3W3J A;  1M10 B;  4QBZ A;  1IO0 A;  1XEU A;  4Z94 G;  1XWD C;  4Q3G A;  1P8V A;  3REZ A;  4PER A;  2WQU A;  2OMT A;  4CNC A;  4XSQ A;  3VQ2 A;  3WPC A;  3E6J A;  3ZYI A;  4MQW X;  5HDH A;  5IJC A;  4FD0 A;  5A5C A;  4ECN A;  3E2J A;  5HZL B;  3FXI A;  3OJA A;  5CMN A;  4R6J A;  4LXR A;  2JE1 A;  4LSX C;  4R09 A;  4CC4 A;  1FS2 A;  4RWT C;  3RIZ A;  2P1N B;  5FTT B;  4LSA A;  4TZH A;  4I6J B;  5GMF A;  4CNM A;  5B4P A;  2OMX A;  1DS9 A;  2JQD A;  1M0Z A;  4Q62 A;  4U09 A;  1KOO A;  3C6P B;  3W3N A;  1M9L A;  4KNG A;  1OGQ A;  5GS0 A;  4ECO A;  2O6S A;  2OMY A;  1H6T A;  5AZ5 A;  2Z7X B;  2OMU A;  2IFG A;  2ELL A;  3WN4 A;  2Z64 A;  3W3L A;  4AW4 A;  1M9S A;  1K5D C;  2A0Z A;  1OOK G;  3OGM B;  4CP6 A;  3WPH A;  4BSU A;  3DZE A;  5B0N A;  2O6Q A;  4PEQ B;  5GMG A;  3UN9 A;  2OMW A;  4KT1 A;  4Z64 C;  2FT3 A;  5AWB A;  2O6R A;  2P1M B;  4K17 A;  1DCE A;  5IJD A;  2Z66 A;  4J0M A;  3G3B A;  3RFJ A;  4IM6 A;  3ULU A;  2Z7X A;  4B8C D;  4RCW A;  1P9A G;  1U0N D;  2ID5 A;  1QYY A;  4P91 A;  4V2D A;  1XKU A;  3RGX A;  2Z82 A;  3RJ0 A;  4H09 A;  2XOT A;  1FT8 A;  3M18 A;  2Q4G W;  2Y5Q A;  4YEB B;  4R08 A;  2WQV A;  4Z61 C;  1H6U A;  3ZYJ A;  3BZ5 A;  4R6G A;  1A9N A;  4WP6 A;  3W3K A;  4U7L A;  4P8S A;  4AY9 X;  4LXS A;  3E4G A;  1PGV A;  4Z8G A;  3WPI A;  3ULA A;  2BEX A;  2OMV A;  4U06 A;  5LFN A;  1O6T A;  1XEC A;  3W3G A;  3OGK B;  3G06 A;  4LI1 A;  3W3M A;  4FMZ A;  4LSC A;  3PMH G;  4R5D A;  4FDW A;  1OZN A;  3ZYO A;  3M19 A;  3JB9 j;  5CMP A;  4M7E C;  4LSX A;  4V2E A;  4L3A A;  3G39 A;  5GMH A;  1YRG A;  2UZY A;  2WQX A;  3UL7 A;  4R6F A;  3RFS A;  2RR6 A;  3WPB A;  5AWD A;  4BV4 R;  1G9U A;  3G04 C;  3RGZ A;  4LI2 A;  1GWB A;  4V2C A;  2V9S A;  1OTO A;  5AWA A;  3GOZ A;  1SQ0 B;  1OTM A;  4CIL A;  4ARN A;  3WPD A;  4Z79 A;  5GQR K;  1DFJ I;  4XOS A;  1D0B A;  2JE0 A;  3OGL B;  3RW7 A;  1O6V A;  4R0A A;  2P1O B;  4Q3I A;  5AWC A;  2Z65 A;  4WYK A;  2WFH A;  4L3F A;  3TSR E;  4QC0 A;  4PQ8 A;  4FHO A;  4NKH A;  4R58 A;  1K5G C;  2P1Q B;  4ARR A;  4UFR A;  4G8A A;  2P1P B;  3C6O B;  4RCA B;  3CIG A;  3O53 A;  5IJB A;  4OQT A;  4PSJ A;  3RW6 A;  4CC4 C;  4BSR A;  3E3Z A;  2BNH A;  4R07 A;  3UL9 A;  3KJ4 A;  4KXF B;  1P8T A;  3P72 A;  3ULV A;  2ASS B;  3G3A A;  4GLP A;  4PKI G;  4GT6 A;  4QXE A;  4FS7 A;  4FCG A;  3UL8 A;  3A79 B;  1FO1 A;  4HQ1 A;  4C2A B;  2V70 A;  4J4L A;  1Z7X W;  3RFE A;  3ZYN A;  5GS2 B;  3CVR A;  3C6N B;  3CIY A;  2Z63 A;  3SB4 A;  1O6S A;  2OMZ A;  2UZX A;  3WPE A;  4R6A A;  1A4Y A;  2WQW A;  4U08 A;  5D3I A;  2XWT C;  4XGO A;  1LTX A;  2R9U A;  1XCD A;  1JL5 A;  5B0T A;  4NKG A;  4M7E A;  3O6N A;  2Z62 A;  4BSS A;  1WWL A;  4R5C A;  1KOH A;  1ZIW A;  3WPF A;  2CA6 A;  5IYX C;  2AST B;  3VQ1 A;  4C2B B;  1OTN A;  3WPG A;  4Y61 B; 
#chains in the Genus database with same CATH topology
 2Z81 A;  1W8A A;  3OJA B;  2V9T B;  1FQV A;  4EZG A;  2RA8 A;  4MN8 B;  3W3J A;  1M10 B;  4QBZ A;  1IO0 A;  1XEU A;  4Z94 G;  1XWD C;  4Q3G A;  1P8V A;  3REZ A;  4PER A;  2WQU A;  2OMT A;  4CNC A;  4XSQ A;  3VQ2 A;  3WPC A;  3E6J A;  3ZYI A;  4MQW X;  5HDH A;  5IJC A;  4FD0 A;  5A5C A;  4NZT M;  4ECN A;  3E2J A;  5HZL B;  3FXI A;  3OJA A;  5CMN A;  4R6J A;  4LXR A;  2JE1 A;  4LSX C;  4R09 A;  4CC4 A;  1FS2 A;  4RWT C;  3RIZ A;  2P1N B;  5FTT B;  4LSA A;  4TZH A;  4I6J B;  5GMF A;  4CNM A;  5B4P A;  2OMX A;  1DS9 A;  2JQD A;  1M0Z A;  4Q62 A;  4U09 A;  1KOO A;  3C6P B;  3W3N A;  1M9L A;  4KNG A;  1OGQ A;  5GS0 A;  4ECO A;  2O6S A;  2OMY A;  1H6T A;  5AZ5 A;  2Z7X B;  2OMU A;  2IFG A;  2ELL A;  3WN4 A;  2Z64 A;  3W3L A;  4AW4 A;  1M9S A;  1K5D C;  2A0Z A;  1OOK G;  3OGM B;  4CP6 A;  3WPH A;  4BSU A;  3DZE A;  5B0N A;  2O6Q A;  4PEQ B;  5GMG A;  3UN9 A;  2OMW A;  4KT1 A;  4Z64 C;  2FT3 A;  5AWB A;  2O6R A;  2P1M B;  4K17 A;  1DCE A;  5IJD A;  2Z66 A;  4J0M A;  3G3B A;  3RFJ A;  4IM6 A;  3ULU A;  2Z7X A;  4B8C D;  4RCW A;  1P9A G;  1U0N D;  2ID5 A;  1QYY A;  4P91 A;  4V2D A;  1XKU A;  3RGX A;  2Z82 A;  3RJ0 A;  4H09 A;  2XOT A;  1FT8 A;  3M18 A;  2Q4G W;  2Y5Q A;  4YEB B;  4R08 A;  2WQV A;  4Z61 C;  1H6U A;  3ZYJ A;  3BZ5 A;  4R6G A;  1A9N A;  4WP6 A;  3W3K A;  4U7L A;  4P8S A;  4AY9 X;  4LXS A;  3E4G A;  1PGV A;  4Z8G A;  3WPI A;  3ULA A;  2BEX A;  2OMV A;  4U06 A;  5LFN A;  1O6T A;  1XEC A;  3W3G A;  3OGK B;  3G06 A;  4LI1 A;  3W3M A;  4FMZ A;  4LSC A;  3PMH G;  4R5D A;  4FDW A;  1OZN A;  3ZYO A;  3M19 A;  3JB9 j;  5CMP A;  4M7E C;  4LSX A;  4V2E A;  4L3A A;  3G39 A;  5GMH A;  1YRG A;  2UZY A;  2WQX A;  3UL7 A;  4R6F A;  3RFS A;  2RR6 A;  3WPB A;  5AWD A;  4NZR M;  4BV4 R;  1G9U A;  3G04 C;  3RGZ A;  4LI2 A;  1GWB A;  4V2C A;  2V9S A;  1OTO A;  5AWA A;  3GOZ A;  1SQ0 B;  1OTM A;  4CIL A;  4ARN A;  3WPD A;  4Z79 A;  5GQR K;  1DFJ I;  4XOS A;  1D0B A;  2JE0 A;  3OGL B;  3RW7 A;  1O6V A;  4R0A A;  2P1O B;  4Q3I A;  5AWC A;  2Z65 A;  4WYK A;  2WFH A;  4L3F A;  3TSR E;  4QC0 A;  4PQ8 A;  4FHO A;  4NKH A;  4R58 A;  1K5G C;  2P1Q B;  4ARR A;  4UFR A;  4G8A A;  2P1P B;  3C6O B;  4RCA B;  3CIG A;  3O53 A;  5IJB A;  4OQT A;  4PSJ A;  3RW6 A;  4CC4 C;  4BSR A;  3E3Z A;  2BNH A;  4R07 A;  3UL9 A;  3KJ4 A;  4KXF B;  1P8T A;  3P72 A;  3ULV A;  2ASS B;  3G3A A;  4GLP A;  4PKI G;  4GT6 A;  4QXE A;  4FS7 A;  4FCG A;  3UL8 A;  3A79 B;  1FO1 A;  4HQ1 A;  4C2A B;  2V70 A;  4J4L A;  1Z7X W;  3RFE A;  3ZYN A;  5GS2 B;  3CVR A;  3C6N B;  3CIY A;  2Z63 A;  3SB4 A;  1O6S A;  2OMZ A;  2UZX A;  3WPE A;  4R6A A;  1A4Y A;  2WQW A;  4U08 A;  5D3I A;  2XWT C;  4XGO A;  1LTX A;  2R9U A;  1XCD A;  1JL5 A;  5B0T A;  4NKG A;  4M7E A;  3O6N A;  2Z62 A;  4BSS A;  1WWL A;  4R5C A;  1KOH A;  1ZIW A;  3WPF A;  2CA6 A;  5IYX C;  2AST B;  3VQ1 A;  4C2B B;  1OTN A;  3WPG A;  4Y61 B; 
#chains in the Genus database with same CATH homology
 2Z81 A;  1W8A A;  3OJA B;  2V9T B;  1FQV A;  4EZG A;  2RA8 A;  4MN8 B;  3W3J A;  1M10 B;  4QBZ A;  1IO0 A;  1XEU A;  4Z94 G;  1XWD C;  4Q3G A;  1P8V A;  3REZ A;  4PER A;  2WQU A;  2OMT A;  4CNC A;  4XSQ A;  3VQ2 A;  3WPC A;  3E6J A;  3ZYI A;  4MQW X;  5HDH A;  5IJC A;  4FD0 A;  5A5C A;  4ECN A;  3E2J A;  5HZL B;  3FXI A;  3OJA A;  5CMN A;  4R6J A;  4LXR A;  2JE1 A;  4LSX C;  4R09 A;  4CC4 A;  1FS2 A;  4RWT C;  3RIZ A;  2P1N B;  5FTT B;  4LSA A;  4TZH A;  4I6J B;  5GMF A;  4CNM A;  5B4P A;  2OMX A;  1DS9 A;  2JQD A;  1M0Z A;  4Q62 A;  4U09 A;  1KOO A;  3C6P B;  3W3N A;  1M9L A;  4KNG A;  1OGQ A;  5GS0 A;  4ECO A;  2O6S A;  2OMY A;  1H6T A;  5AZ5 A;  2Z7X B;  2OMU A;  2IFG A;  2ELL A;  3WN4 A;  2Z64 A;  3W3L A;  4AW4 A;  1M9S A;  1K5D C;  2A0Z A;  1OOK G;  3OGM B;  4CP6 A;  3WPH A;  4BSU A;  3DZE A;  5B0N A;  2O6Q A;  4PEQ B;  5GMG A;  3UN9 A;  2OMW A;  4KT1 A;  4Z64 C;  2FT3 A;  5AWB A;  2O6R A;  2P1M B;  4K17 A;  1DCE A;  5IJD A;  2Z66 A;  4J0M A;  3G3B A;  3RFJ A;  4IM6 A;  3ULU A;  2Z7X A;  4B8C D;  4RCW A;  1P9A G;  1U0N D;  2ID5 A;  1QYY A;  4P91 A;  4V2D A;  1XKU A;  3RGX A;  2Z82 A;  3RJ0 A;  4H09 A;  2XOT A;  1FT8 A;  3M18 A;  2Q4G W;  2Y5Q A;  4YEB B;  4R08 A;  2WQV A;  4Z61 C;  1H6U A;  3ZYJ A;  3BZ5 A;  4R6G A;  1A9N A;  4WP6 A;  3W3K A;  4U7L A;  4P8S A;  4AY9 X;  4LXS A;  3E4G A;  1PGV A;  4Z8G A;  3WPI A;  3ULA A;  2BEX A;  2OMV A;  4U06 A;  5LFN A;  1O6T A;  1XEC A;  3W3G A;  3OGK B;  3G06 A;  4LI1 A;  3W3M A;  4FMZ A;  4LSC A;  3PMH G;  4R5D A;  4FDW A;  1OZN A;  3ZYO A;  3M19 A;  3JB9 j;  5CMP A;  4M7E C;  4LSX A;  4V2E A;  4L3A A;  3G39 A;  5GMH A;  1YRG A;  2UZY A;  2WQX A;  3UL7 A;  4R6F A;  3RFS A;  2RR6 A;  3WPB A;  5AWD A;  4BV4 R;  1G9U A;  3G04 C;  3RGZ A;  4LI2 A;  1GWB A;  4V2C A;  2V9S A;  1OTO A;  5AWA A;  3GOZ A;  1SQ0 B;  1OTM A;  4CIL A;  4ARN A;  3WPD A;  4Z79 A;  5GQR K;  1DFJ I;  4XOS A;  1D0B A;  2JE0 A;  3OGL B;  3RW7 A;  1O6V A;  4R0A A;  2P1O B;  4Q3I A;  5AWC A;  2Z65 A;  4WYK A;  2WFH A;  4L3F A;  3TSR E;  4QC0 A;  4PQ8 A;  4FHO A;  4NKH A;  4R58 A;  1K5G C;  2P1Q B;  4ARR A;  4UFR A;  4G8A A;  2P1P B;  3C6O B;  4RCA B;  3CIG A;  3O53 A;  5IJB A;  4OQT A;  4PSJ A;  3RW6 A;  4CC4 C;  4BSR A;  3E3Z A;  2BNH A;  4R07 A;  3UL9 A;  3KJ4 A;  4KXF B;  1P8T A;  3P72 A;  3ULV A;  2ASS B;  3G3A A;  4GLP A;  4PKI G;  4GT6 A;  4QXE A;  4FS7 A;  4FCG A;  3UL8 A;  3A79 B;  1FO1 A;  4HQ1 A;  4C2A B;  2V70 A;  4J4L A;  1Z7X W;  3RFE A;  3ZYN A;  5GS2 B;  3CVR A;  3C6N B;  3CIY A;  2Z63 A;  3SB4 A;  1O6S A;  2OMZ A;  2UZX A;  3WPE A;  4R6A A;  1A4Y A;  2WQW A;  4U08 A;  5D3I A;  2XWT C;  4XGO A;  1LTX A;  2R9U A;  1XCD A;  1JL5 A;  5B0T A;  4NKG A;  4M7E A;  3O6N A;  2Z62 A;  4BSS A;  1WWL A;  4R5C A;  1KOH A;  1ZIW A;  3WPF A;  2CA6 A;  5IYX C;  2AST B;  3VQ1 A;  4C2B B;  1OTN A;  3WPG A;  4Y61 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...