1XLNA

Crystal structure of oxidized c73s/c85s putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
molecule tags Oxidoreductase
source organism Pseudomonas putida
publication title Redox-dependent Structural Reorganization in Putidaredoxin, a Vertebrate-type [2Fe-2S] Ferredoxin from Pseudomonas putida.
pubmed doi rcsb
total genus 23
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlnA00
1A70A 2H89B 1TKYA 3NVZA 1E6EB 3FAHA 2W3RA 1VLBA 1L6VA 2WQYB 5EE0A 3B9JA 3FC4A 4JX1C 3AB5A 1FRDA 5H8YE 2OHFA 3SR6A 3AEFB 3VRAB 2DWQA 3P4RB 3LXFA 4WQMA 1DGJA 4YSZB 1FXAA 3PO0A 2WU5B 3RPFC 1WXQA 1N5XA 2W3SA 1JW9D 1DOYA 1N60A 1YQ4B 1XO3A 5EE9A 3W5VB 4ZHOA 1VJKA 1TKEA 5GXGB 5G5GA 1N61A 3AE7B 1NYQA 2CJOA 3ETRA 1TJEA 5G5HA 4YXDB 1E10A 3NRZA 2E3TA 2W55A 1RM6C 3P4QB 4C7ZA 3NS1A 1OQRA 4N58A 2LEKA 4A9AA 3HVZA 3P4SB 1QOAA 2WDVB 2CJNA 1PFDA 1I7HA 1L0VB 3AE9B 4FXCA 1XLQA 3DWGC 4YTNB 1E7PB 1V8CA 2MJDA 1XLPA 1JROA 1JWAD 1JALA 2PVGC 2Q5WD 3NVYA 3WCQA 1GPXA 1N5WA 1QT9A 1E9MA 3L4PA 1KF6B 1FO4A 1YJJA 3CIRB 3ABVB 3P4PB 3KWLA 3LB8C 2ACZB 2K22A 2DBYA 2HTME 3AEGB 3BIID 4C7YA 2WP9B 4JWUC 5EE1A 4YSXB 1AYFA 3SFEB 5EE3A 4C80A 2H88B 4YTMB 1SIJA 1WYGA 4P6VF 1FMAD 2JX5A 2G1EA 1ZOYB 2WDRB 5AUKA 3HUIA 1KRHA 3AEAB 4N59A 2BT6A 1YQ3B 1PDXA 3AEBB 3AE5B 3W9CB 1QOBA 3AE3B 4ZHPA 2QIEB 3EUB2 3W5UB 2W54A 3VRBB 1V97A 1DOIA 1NI3A 2PIAA 1FRRA 1J7BA 3ZYYX 1FXIA 4N6EB 2WS3B 1ZUD2 1NYRA 2WU2B 1SF0A 1ZXIA 3VR8B 1XLNA 3AV8A 3P1MA 4HRSA 3AECB 5H92C 2WDQB 1JWBD 3AE4B 4JWSC 1J7CA 1JRPA 1OFFA 1QOFA 2CU3A 3HRDD 3VR9B 2L52A 2MJ3A 2PVOD 4USAA 1NENB 1T3QA 2BS4B 1R7SA 1OQQA 2Y5CA 1RYJA 2EKIA 3AE1B 1NEKB 2PKOA 1JQ4A 1YJIA 1NVID 1B9RA 3P63A 2FBWB 3CWIA 1F0ZA 1WWTA 2BS2B 3AE6B 2WLBA 1AWDA 1XLOA 3NVVA 3AE8B 4ITKA 4LTUA 1DOXA 2KAJA 3B2FA 1QOGA 1N62A 1ROEA 2K5PA 4KX6B 1IUEA 3NVWA 1WGKA 3AMZA 4IDIA 1VDVA 4US8A 3SFDB 2AX5A 2JQRB 1FM0D 2N0SB 1UWMA 1KFYB 3AM9A 3AEEB 1FIQA 1J7AA 4YSYB 1N63A 3AEDB 1QLBB 4HROA 1QF6A 1FFVA 1E0ZA 3AE2B 1ZP0B 1WRIA 5AUIA 2K9XA 4US9A 1GAQB 3B2GA 2L83A 3AH7A 2MJEA 1L6UA 1TYGB 2BS3B 2M19A 5C3JB 1PUTA 2KMMA 4WWMA 4YTPB 1RWSA 1SB3C 4ZOHC 2M56B 1L5PA 3DWMA 2MH7A 2B76B 1CZPA 4YT0B 5MPOA 1FFUA 3AN1A 1TKGA 5C2TB 1CJEA 1EWYC 1RFKA 2QJLA
chains in the Genus database with same CATH superfamily
2WGSA 1VZ7A 4II3B 1E8XA 3ZTDA 4LNIA 3NUHB 2L7RA 3LXFA 2GBRA 4GU2A 1N5XA 4FBJB 1XO3A 1SIFA 2SEBD 3L13A 4EZKA 4C7ZA 4K1RB 4A9AA 2WXJA 3BYTB 2YLMA 2MX2A 3L17A 1E9MA 1AARA 2C60A 4NAMA 3DVGY 3MP9A 2NBWB 3APDA 1SIJA 1OEYJ 5EDSA 2G1EA 4IM0A 1UH6A 1TBEA 2NBUA 1SBBB 2ZNVB 3PRPB 1A5RA 3W5UB 5HG2A 1KM7A 5D6JB 4I6NB 3RNFC 4ANVA 5LXHA 1IYFA 3AE4B 4TSSA 2WXOA 3P2BA 2RPQA 4HJKA 2BGFA 1S1QB 3KYCD 1P1AA 2FBWB 1WXMA 2UWQA 3CWIA 4XE0A 4ASWC 2UYZB 4KX6B 5KHQA 1WGKA 2V4LA 2K8CA 4G0NB 1V49A 2ICIA 1WE6A 2ZW1A 3QC8B 4E3CA 3ZIMA 4M00A 3RZFA 1TIFA 2OJRA 1LO5D 5T8IA 3SD5A 3EHVA 4W9CA 2JXTA 4P1BC 3AH7A 2J4XA 4BOSC 2KFKA 2RGFA 2JVCA 2MH7A 5MPOA 3QIJA 1FFUA 4YWGG 2BYVE 5EE0A 2KQ7A 5CHFA 3H8HA 3AXCA 2HJ1A 1FXAA 3V60A 1ET6A 3JYUA 1E90A 2RDGA 2LZ6A 4OZAA 4E74A 3BWUD 2GBKA 1TKEA 5GXGB 4JE3B 5G5HA 1TJEA 2E3TA 1QOAA 4A3OA 2O2VA 3RZWC 3PT2B 4N9F4 3Q3OC 3UI3A 1XLPA 3PZDA 1JALA 2J0MA 1GPXA 2K6DB 2NS5A 1N5WA 4HVBA 2V9HA 4KGRA 2WYQA 1KF6B 1FCLA 5BMHA 2D3BA 1OQYA 3H6NA 5AEKB 3AEGB 1GNUA 2NPTB 3PGEA 4XDCA 3GOEA 3TL5A 2WXMA 1ACCA 2WDRB 5AUKA 4WJNA 3HUIA 4EOYA 2KQ4X 3Q14C 4K7WA 3GE8C 4GDKA 1FPYA 2L05A 5DCNA 2CS4A 1ZUD2 2QCZA 4QAYA 2BKFA 4HK2A 3NG0A 3TEZA 2CU3A 1M4VA 2I1KA 2MBOA 3IT6B 3CF6E 4OVVA 3U52E 3V6EB 3ZNHB 2NR2A 3H7SA 2KFKB 1DOXA 3ZTCA 2K5PA 2DZIA 3EA6A 1WE7A 4MGZE 4US8A 4MJSB 1WMHB 1WJUA 3VTUA 3PTFC 1N63A 1PQSA 3L0WB 2KANA 3N1ZC 3PHWB 1E0ZA 3A1QB 1F9JA 3A4RA 3AE2B 3P42A 2K9XA 2BF8B 2W9NA 4RFBA 4ANXA 2HE7A 1TKGA 1CJEA 1UELA 2AEHA 2MQJA 1QILA 1KH0A 2KNBA 3P4RB 2JUOA 3KUCB 4LNFA 3ZO5B 2K0PA 4A8XC 2WXKA 2YEPB 4EZJA 3W5VB 4M02A 4I6PA 4IOIE 4OVZA 4DHJB 3PRMB 1JCKB 2LUMA 3DHGC 3HVZA 1PFDA 4S17A 1E7VA 3JSVB 2LFIA 4WJOA 3L4PA 1FO4A 3CIRB 1Q1OA 5BMIA 1GG3A 1TS5A 1VZ6A 3BIID 2WXHA 2HTME 1AYFA 4ANWA 2WXIA 1C3TA 2KMCA 4P6VF 2K25A 1ZOYB 2JXXA 2ZJDA 2JY6A 2DZMA 2YVCA 2G9HD 2ZCCA 3AE5B 2AYOB 4JL9A 1J8CA 2BTEA 4N6EB 4HCPB 1SF0A 3BZDB 3DCGA 3UGBB 4MM3B 4BKTA 2FCSA 3W1SA 1Q5WB 2LASA 4HPPA 3GS2A 1XEEA 3I63C 4GLSC 2WXFA 4KZCA 1P3QU 3LYYA 1T6BX 4IDIA 1BMLC 2JQRB 2IO1B 3GE3C 3L16A 1QF6A 2KDFB 5AUIA 4US9A 2MP2B 1HE8A 3DOWA 2BS3B 2M19A 3DVNV 2WX1A 2N9PC 1FCCC 4W9IA 4HWIB 2PLPA 4L23A 1STEA 1I42A 2H89B 3NVZA 3TSSA 3Q2AC 2W3RA 3VUWA 4C00A 3NZUA 3VRAB 2OHFA 1HEZE 1QKZA 5CHVC 4GDKB 2LMCA 2REXA 1BT0A 1FNWA 4EEWA 3UINB 2D11A 1L0YB 4GN1A 1IP9A 4IWQA 3P4SB 4P16A 3A9KA 2JRIB 4M01A 2FAZA 2KLGA 1PGBA 2DLBA 3QHTA 3VH4B 2EELA 4ZYNA 4W9EA 2DBYA 2RDBC 4JWUC 3HIZA 3DHIC 5J2RA 1WRDB 2GMIC 1T0YA 4ARIA 3R66C 3VRBB 1EWCA 3UIOB 1YX6B 3RNCC 4JIOU 2LHDA 1WF9A 1P98A 2BYFA 2M8SA 2MJ3A 4G11A 3RCZA 1UZXB 4GOCA 4DXGA 4OHJA 3RNBC 1K53A 1UBQA 1V5OA 4RM8A 2XEWA 3P63A 4MACA 2EMTA 2D3GA 2JYTA 2WLBA 2JZ3B 2NVUI 4W9GA 1E5WA 5D3IB 2EMSA 1UWXA 1WJ4A 2IO3B 3Q3NC 4DWFA 2RPVA 4NAWB 2FE8A 3QK0A 5D2MB 4ZRIA 3QJZA 1GC7A 1WY8A 1MHHE 1SJHD 1T0SC 1C4PA 5HHDG 1PUTA 3FKYA 3U8ZA 3DWMA 4CO7A 2GBNA 3OG5A 3X23A 4XWWA 4ZRKA 1E6EB 4FA6A 1SEBD 1YN5A 1WMHA 1WZ0A 1FEHA 3FC4A 2N1VA 3QAQA 3HK0A 5LNK1 4D2KA 5HFYA 1V6EA 1R4NI 4YXDB 1E10A 4P7IA 4BVUC 2D2QA 5FK9C 4TMAB 2KQSA 2KACA 2GOWA 2BYEA 4FXCA 3VTWA 3Q69A 3UQBA 2BVCA 1WI0A 2NTSA 3PLVA 2LGSA 3V05A 2CHZA 2DYBA 2VZKD 4KKIA 3H7PA 1XD3B 4KGSA 4DXFA 4IM3A 1YN3A 4KGTA 5JHAA 1JRUA 2KDBA 2AL3A 4HRSA 5IP4D 5CHWA 1DYQA 4TQ1A 1KTKA 2ZCBA 3W2DA 2Y5CA 3V61A 1NEKB 1EO6A 1Z5SB 2ZNVC 2I38A 1P7FA 4K81A 3NVVA 4LTUA 2WXPA 5BYSA 3QA8A 2DYOA 3K9OB 1UWMA 1WJ6A 5L83A 2KDEB 1FFVA 1AW7A 1ZP0B 3KVFB 3PRZA 2V1YA 1LGRA 3UIPB 3IBEA 2IBIB 3WA0A 4WWMA 4RF0A 3T9LA 4MGKE 1D5XC 2NCNA 2L8JA 3E56A 2JPHA 2KDIA 3URYA 1EU3A 4MT5A 1VLBA 4H2AA 1TT5B 2AWTA 2N4FA 4M8MA 2CU1A 2LJIA 3BY4B 1YNTE 4C4VA 2LRWA 2W3SA 2WWZA 5LXIB 3C8YA 3AE7B 1P7EA 2KTFA 5JZEB 2GI9A 2MBQA 3P4QB 4WAAA 1OQRA 3PREA 4N58A 3MC8A 4HKQA 4YTNB 1V8CA 1MG4A 2MJDA 2KZRA 4S0RA 2WNMA 1YJJA 4NPNA 2IPKD 2K6QA 2M17A 2ACZB 5IN7A 1G6JA 4HLEA 4MELA 3L08A 4XX5A 1VD2A 4HDOA 1Q0WB 4K3BA 1UD7A 3BVGA 3NS8A 4ZDVA 3AE3B 4FLHA 2ZPYA 3RT3B 1OTRB 1FRRA 1SE3A 2PPHA 1RLFA 1XLNA 4C4VB 4ICVA 1J7CA 3UQAA 2BWES 2BBCA 4OZCA 4PS7A 4RM9A 1TY2A 5DPTA 2IGGA 4MH8A 2A5UA 2NMQA 1SE4A 3M3JA 2C7HA 2INCC 3KH0A 3DBRB 1VDVA 1HZ5A 1FIQA 3NZSA 2N9LA 3JVZX 4UDUC 3O13A 1TYGB 2WXRA 1I4PA 2V3PA 4BBNC 1ZDXA 3FAHA 3BINA 1XF5L 1L4ZB 1LM8B 4GMVA 1DGJA 1JWUD 4WWPA 1UF0A 2LI5A 3IFWB 3NHEB 4EUTA 3R7QA 3QX1A 2MWSB 1ZW7A 5G5GA 1NYQA 1E7UA 3ETRA 3VVWB 1WGRA 3NRZA 4JGHB 4W9HA 2AQ3B 4BBNF 3R7RA 3BVZA 1XLQA 4MM3A 3CMMB 3NVYA 1OGWA 4ANUA 5DPSA 2MW5A 3W1YA 2WP9B 4KZ0A 2NTTA 2C5LC 4IKGA 1V5TA 1YQ3B 2HTHA 3RFZB 4ZRQA 1WGGA 1L7YA 5CTRC 4WAFA 2KMAA 1ZXIA 3NOBA 5E6NA 5TR5A 3AECB 2LXCA 4JWSC 4WQOB 1QOFA 4DHJD 4F7ZA 3NJTA 4LNNA 2HDEA 1P0RA 1SGHA 2KD0A 3ZJUA 3I3TB 2BB6A 1MJDA 1R4NB 3Q8FA 1VZ8A 1C4CA 1K8RB 2Y5BB 3AI5A 2XK5A 4EKUA 3ZNID 1WGDA 3VAWA 2L83A 2Z59B 3ZRCA 3IXSA 4RNAA 2LUEA 4B0EA 1C77A 2JWZA 1CZPA 3ALBA 2M0XA 1HXYD 4DHZE 3ENEA 4LDTD 1H8CA 1SXTA 4J3OD 2LGXA 3AB5A 1WXQA 4M0WB 1MI0A 2G4SA 3HM3A 1D4BA 4KDIC 4FN2A 2CJOA 2N9KA 5BMGA 1TS4A 1CK1A 3GZNI 3B0AA 3DQVA 2KTRB 2GBMA 2LXAA 1OEYA 2KVRA 2INPE 3J9CA 5JH5C 3ABVB 3N1XC 3KWLA 2KJRA 3PPAA 3R3MA 3AU4A 2J53A 4YTMB 2QHOA 2LRUA 4URKA 4ZRPA 1MFWA 1MHXA 3O65B 2RDHA 2MBEA 1MPEA 3W9CB 3EECA 1WXAA 2QIEB 2M0AA 5C23A 4AS1A 1NYRA 1XXGA 4HPLB 2KC1A 4OZBA 3M95A 1BXTA 4RCOA 2NBVB 4USAA 5AZFA 1YJ1A 1I4XA 1WGHA 4C56C 4JLCA 1UGJA 1N62A 2KT7A 2JWUA 2MA9B 2N0SB 2QILA 3AEEB 1J19A 4HROA 4G3XB 3RUIB 4MGIE 1Y8RC 3T3OA 4FHKA 3U4EG 2GLSA 3MHZA 2KMMA 1KLUD 2ZVOA 2IY1B 4NJ7A 4BAXA 1PGAA 4GDLB 1EWYC 2ONQA 4BZAA 2LGYA 5H8YE 2KN4A 3FILA 4WQMA 3PO0A 3RPFC 2G4DB 3DPDA 2FCQA 3HHMA 1N60A 3U7ZA 4Q2JA 1E8ZA 3MC9A 2DNFA 5E6OA 4HJGE 3NS1A 3Q3MC 1WJNA 3DBLB 3ZRFA 2WDVB 3AE9B 2DAFA 2PW9A 3ONSA 2MCNB 4K3CA 2ZPNA 2L0FA 3SFEB 2BWFA 2D3CA 2JX5A 5G2NA 4W9JA 1I4HA 2Z8LA 1PDXA 5I4DA 2K39A 4ZHPA 3ZQ4A 4L2YA 1FXIA 1C76A 2M1MA 3VR8B 3M62B 2DENB 1AN8A 2E6XA 3B08A 1R4MI 2IGDA 3B1LX 1JRPA 3HRDD 2L52A 1NENB 2KK8A 1OQQA 2INNE 3ZLZA 4AP4C 4ITKA 1F52A 2LHEA 4CHKA 3NVWA 1SE9A 1V9JA 5LLIA 1L4DB 3V3XA 2XBBC 2PE9A 2KKCA 3PV1A 4GIVA 1T0QC 3AEDB 1QLBB 3RNAC 2KDMA 1I4QA 1L6UA 3DBHB 5IKCM 2BYTA 5C3JB 3C19A 5D3DA 3LJ3A 3DDCB 2A4ZA 2FCMA 2N9EB 4LJPB 2XNAC 1RFKA 3EGRA 1L6VA 3SR6A 1JW9D 1V80A 1ISNA 2D10A 4LNKA 2LGIA 1YIWA 1HTQA 5IOIA 3ZDMC 2D5GA 4B0MA 3TEWA 1ZE3D 4WJPA 2HJ8A 4W9KA 2LEKA 2O6VD 3QWZB 4GXBA 1TGZB 2FCNA 3AULA 4WWNA 4BKGA 2Q5WD 2O6VA 1M94A 3H7PB 2NPTA 4NNJB 2K22A 2O6VB 4REZA 2BKRB 5EE1A 2MLBA 2MHJA 4LJOB 4CYEA 1BUIC 3QARA 5IO9A 2C7NB 2IGHA 5G55A 4HXDA 1NI3A 3DBSA 1P9DU 1PYWD 4FJZA 2WS3B 3VUYA 2KN5A 1WM3A 5CX3A 4XGAB 1WH3A 1FXTB 2QSDA 3ML8A 4LCDE 4YSXB 4X57B 1RYJA 5AZGA 3W1SC 3CSTA 1VR9A 2JSVX 1NVID 5C1ZA 1B9RA 4RGOS 2N1WA 1MG8A 4XDDA 1AWDA 3X0WA 4XZ4A 1IUEA 3HVDA 1NI2A 2BB5A 2RR9A 2V3NA 1J7AA 5DPRA 3RYTA 4BOZB 1GAQB 4TQ0A 3PS6A 1K52A 2RD0A 2D3AA 2QMTA 2R61A 3DBHI 3AM9A 1SSNA 4IW0A 4IWOA 1FD6A 4J6IA 1VCBA 3B9JA 3OJ3A 4RGNA 3SHQA 3AEFB 1L0XB 2DWQA 2VH2A 2WXQA 3LDZE 3PLUA 1EU4A 1YQ4B 4NZLB 2K3UA 5EE9A 1VJKA 3Q6BA 2YEPF 1YD8U 1PGXA 3N3KB 1JWMD 1WSPA 3IG3A 3OJ4B 1YQBA 1I35A 4NJ6A 5D94A 5GMVA 2CJNA 2ZEQA 4W9DA 3OLMD 1WFYA 3U2SC 1XT9B 1ENFA 1TS2A 1GC6A 4LK0M 4XC2A 1F2RC 3OAWA 2K8HA 4GSWA 4EZLA 2H88B 3KQ4A 3BYYB 1WYGA 1SE2A 1FMAD 4YL8A 3QQ8B 3KYDD 3ZGZA 3L10B 3ECIA 1IGCA 3Q8EA 2JYEA 4DXAB 2ZZPB 2Y3AA 4HDQA 3P1MA 3R8BA 3TBLD 1JWBD 2QEJC 3U7DA 1OFFA 1RAXA 1S3SG 3AE6B 1QOGA 1GUAB 3I9V1 3Q3JA 1XQQA 2K8BA 4ACFA 5L95C 3KUDB 3S2AA 3APFA 4IUMB 3KW5B 4CQNA 1EF1A 3SEBA 3KWVA 2AQ2B 3M63B 3N30A 4I6LB 1C9FA 4GGQA 4YTPB 2PJHA 1L5PA 3Q3FA 3U30A 4RGMA 4B95A 2JRHA 1TKYA 4FJYA 3HM6X 2LVPA 4JX1C 1FRDA 3ZKJC 1KOTA 2FIDA 3MJWA 3CSFA 2SAKA 3MC0B 4A20A 4IG7B 3T8MA 1E8YA 1N61A 1ZGUB 2KYWA 4KKJA 3H1UA 5FR3A 1C78A 3A33B 1IBXB 2Z0DB 3H9DA 1F2RI 1LQBA 1NDDA 1QT9A 4MH0E 1IPGA 3RNGC 3MHSD 1X1MA 4IM2A 4NQLB 2C9WB 4AJWA 2V4IB 3A4SC 5BYQA 2BQQA 3JW0X 1QOBA 3QCAA 1TS3A 2LVQA 3EUB2 2KO3A 5FKAC 3MFGA 2PMVA 4NJCA 5J17A 4F1SA 2JT4B 3AV8A 2DAJA 2N7JA 3E9SA 4LDTB 2AL6A 2WXNA 2IJ0A 3VR9B 4BKSD 4OVUA 2BS4B 2N9XA 4B6WA 1XCTL 4AWJA 2KWCA 1TTNA 1F0ZA 3MJ5A 4NAWA 4PYUA 2KAJA 3ZNGC 3AMZA 4JPSA 3TJPA 3AU5A 3BK1A 1HTOA 4DDGD 4AUQC 3N32A 1L2NA 2MJEA 2KLCA 2XK5B 2AQ1B 1RWSA 1SB3C 4ZOHC 4MJSA 2LD9A 2GBJA 2MSED 1A70A 4PT5A 4ARCA 2L76A 1TY0A 3R2TA 4KVGB 1GJZA 3ZNZB 2WU5B 3ZUNA 1ET9A 2OEDA 2LVOA 2EKEC 2JZPA 3Q8BA 1TZOA 3RMKC 4WIPA 2W55A 4FADA 2J42A 3APCA 2LJ5A 3V6CB 2ZVNA 1U4AA 1J0GA 2OOBB 4MSMB 1E7PB 1JWAD 5HI1A 4HPMB 4KIKB 1WYWB 1EUVB 4DHZB 5JHBA 3LB8C 2KFJA 4MSQB 4TV3A 2FIFA 3SU8X 3ZW3A 1MVKA 3RNEC 1KRHA 4N59A 5BO4B 5HKHA 5AZHA 4NQKE 2O2VB 4NY0A 4WH4A 4KIKA 1WXSA 2HD5B 5H92C 1Z2MA 3SDLC 3PHXB 3VFKA 1T3QA 1LFDA 3AE1B 2XN9C 4WJQA 3WIMA 2KHWB 3MTNB 1UBIA 3Q8CA 3EFUA 1K50A 2L00B 3PZ8A 3VH3B 2K1FA 5EE3A 1KLVA 1XLOA 4PS3A 3AE8B 2KJHB 2KWDA 2MP2A 1R4MB 1B1ZA 2KX3A 4FULA 1KJTA 4O1NA 1KFYB 4KSLC 1VRAB 2OJWA 3ZDTA 3WANA 2J7QB 1WRIA 4KDLB 4IC7B 2KOXA 3L54A 3N20C 1T0RC 1V81A 4RMAA 4DBGA 2B76B 4YT0B 1V1PB 1UUPA 1I4RA 3NZ3A 2QJLA 1WIAA 2V0GA 2L32A 1IGDA 4KV2A 2I1JA 2WQYB 1Y56A 2IY0B 2KWVB 4MGYE 2IZVB 1HZ6A 3DBLI 4XWTA 2QDFA 4G50A 2GRIA 3WAOA 1NBFC 2MBHA 4WWOA 1GOZA 4RH6A 1SJED 2IYDB 3JSVA 4MEMA 3DWGC 1F77A 4ZRJA 5KHOA 2VRRB 2KX0A 1CQVA 3DVGX 1UGMA 3WALA 4C7YA 1V1OA 2FUG1 2L0TA 3UF8A 3RI7C 3IT4B 2IO2B 4P1CC 1YOVB 3AEBB 4AJYB 2I2YA 2IO0B 5DPWA 2GB1A 2PTLA 1V97A 1DOIA 4ICUA 3VTVA 2JZZA 1WX7A 2MRPA 1WM2A 4FJVB 2CHWA 4ZYSA 2RMMA 2PVOD 4RF1A 5E6JA 1V86A 2J0KA 2KJ6A 1YX5B 2TSSA 1C1YB 1TZ1A 2UU7A 2BPSA 3KUZA 4HCNB 1EF5A 1EM7A 4E71A 3ZXVA 2L1AA 2R2QA 1RFAA 4OW0A 4DDID 3D32A 2W82A 1V1PA 4BFRA 1ZDVA 1FNVA 4HKZE 1FM0D 1UNSA 3I5JC 4W9LA 2N7DA 4GDLA 3DBRI 4W9FA 1E8WA 3VDZA 1QQRA 4XYCA 4EFOA 5C2TB 2RSUA 3NY5A 2JF5A 3I57A 4ZHOA 1FNUA 2QC8A 1CMXB 3DVNU 3TMPB 1K51A 2WX0A 3GZNB 2ZW0A 1HA5A 2MBBB 4PS8A 4AQ7A 3IHPC 4R3DA 2X38A 4GB9A 2VZKB 4IWPA 3PVLA 2BW2A 5D7GA 1D6EC 1KLGD 1I7HA 2R2OA 2N7EA 3ZVVA 2IDYA 3T3NA 2FNJB 2DZJA 4C80A 3ML9A 2KVZA 3ZXRA 1WX8A 1Q10A 3A9JB 5IAAC 3ZYYX 3TCAA 4A6QA 2V3SA 4BKSA 4B9KA 2LWPA 1JMLA 2KTRA 3ZJVA 3DHHC 4A3PA 2KXJA 1R7SA 2WXGA 4M8NA 4TUUA 1YJIA 3VHTC 1ESFA 4L1BA 1WWTA 4M0WA 3N1YC 2DHZA 1N6ZA 1ROEA 4EE2A 3K9PB 2CR5A 4A55A 3SFDB 3RULA 3VXWA 1C79A 3N9YC 5E6PA 2ASQA 2C7MB 3C0RB 1ZPSA 1HQRD 2KC2A 4FHJA 4TKNA 1ZXHA 1D3ZA 2J0JA 4RGTA 4WURA 2G3QB 2WDTB 3A1QA 3IAS1 4LNOA 5JXVA 4F8CB 2D07B 2Z0EB 1JWSD 1XCQL 5BYRA 4YSZB 2PEAA 1DOYA 4JQWC 4K7UA 3TIXA 2G45B 4K7SA 2FUHB 4LLGM 1RRBA 3IAM1 1RM6C 3WAPA 1WX9A 1GB1A 1WGYA 2JU6X 1D5MC 3BK2A 1L0VB 5FR6A 1WXVA 2PE6B 2PVGC 1JROA 2Y5PA 3WCQA 5TSSA 3TEXA 3TUOA 3P4PB 2DZKA 3A9JA 3RN9C 3VQIA 1V2YA 1WR1A 1ZKHA 3AEAB 3KLSX 2MEKA 2BT6A 2WXLA 3A9KB 2M4NA 3WAMA 2L3ZA 2CKHB 1IBXA 2B3AA 2PIAA 1J7BA 2DX5B 2INDC 2WU2B 1T5XD 3GB1A 3BVMA 1C4AA 2WDQB 3FILB 2LGDA 3OWEB 3V62A 5IA7A 3Q8AA 2J52A 1YMHE 1I4GA 2EKIA 1LXDA 2CHXA 4HEA1 2PKOA 1JQ4A 2ON8A 4KSKC 1WZ3A 5J18A 3ZJTA 1F1HA 2BS2B 3B2FA 2DYMA 2WHIA 3R2IA 4MDKE 4PK1A 3EC8A 4DK5A 1GB4A 3PZ7A 1H4RA 2AX5A 3EFCA 4YSYB 4AOFA 3IVFA 4A90A 3PSEB 4PYZA 3VUXA 3RD2A 3B2GA 2KWUB 2VH1A 2X8XX 2M56B 1D5ZC 1WR6E 4II2B 3AN1A 4DQOC 1YN4A 3GP7A 1QZEA 3TEYA 2W54A
chains in the Genus database with same CATH topology
1A70A 4PT5A 4ARCA 1E6EB 1SEBD 1VZ7A 1YN5A 1TY0A 1FEHA 3FC4A 5H8YE 3R2TA 3NUHB 2KN4A 3FILA 3LXFA 4WQMA 3PO0A 2WU5B 3RPFC 1N5XA 1ET9A 2OEDA 4D2KA 5LNK1 1N60A 3U7ZA 5HFYA 1XO3A 4Q2JA 2JZPA 3Q8BA 2SEBD 1TZOA 4YXDB 1E10A 4HJGE 4WIPA 2W55A 4C7ZA 5FK9C 2J42A 3NS1A 4TMAB 4A9AA 2KACA 2WXJA 2WDVB 4FXCA 3BYTB 3AE9B 2PW9A 3Q69A 1E7PB 1JWAD 5HI1A 2NTSA 1E9MA 3V05A 4NAMA 3LB8C 3MP9A 3SFEB 2VZKD 4KKIA 1SIJA 2JX5A 2G1EA 1MVKA 1KRHA 1I4HA 4N59A 2Z8LA 4KGSA 1PDXA 4DXFA 1SBBB 1YN3A 5I4DA 4KGTA 4ZHPA 3W5UB 3ZQ4A 5HG2A 4L2YA 1FXIA 1C76A 4WH4A 3VR8B 4HRSA 5H92C 1AN8A 3AE4B 1DYQA 2E6XA 4TSSA 2IGDA 4TQ1A 1JRPA 2WXOA 1KTKA 3HRDD 2L52A 3W2DA 1NENB 1T3QA 2Y5CA 1OQQA 3AE1B 1NEKB 2INNE 2XN9C 2I38A 3Q8CA 1K50A 1P7FA 3PZ8A 2FBWB 3CWIA 5EE3A 4XE0A 4ITKA 3NVVA 4LTUA 1XLOA 3AE8B 2LHEA 4KX6B 3NVWA 1WGKA 2KWDA 2WXPA 5BYSA 1L4DB 2ICIA 2ZW1A 1B1ZA 3V3XA 2DYOA 4O1NA 1UWMA 1KFYB 1VRAB 3AEDB 1QLBB 1FFVA 1LO5D 1AW7A 1ZP0B 1WRIA 5T8IA 2JXTA 2KDMA 3AH7A 1I4QA 1L6UA 2BYTA 2J4XA 5C3JB 4WWMA 4RF0A 5D3DA 2MH7A 2B76B 1D5XC 4YT0B 5MPOA 1FFUA 3E56A 1V1PB 1UUPA 1I4RA 3NZ3A 1EU3A 3URYA 2XNAC 1RFKA 4YWGG 2QJLA 2V0GA 4MT5A 2L32A 1IGDA 1VLBA 3EGRA 1L6VA 2WQYB 4H2AA 5EE0A 1Y56A 3SR6A 3H8HA 2LJIA 1FXAA 1YNTE 1ET6A 2RDGA 2W3SA 1JW9D 1HZ6A 4OZAA 4XWTA 2LGIA 3BWUD 1TKEA 5GXGB 3C8YA 4JE3B 3AE7B 5G5HA 1P7EA 1TJEA 2D5GA 2GI9A 2E3TA 4B0MA 2GRIA 3P4QB 1ZE3D 3TEWA 1OQRA 4N58A 2LEKA 1GOZA 4RH6A 1SJED 1QOAA 3DWGC 4HKQA 1F77A 4YTNB 1V8CA 2Q5WD 2MJDA 1XLPA 3UI3A 1JALA 1GPXA 1N5WA 4KGRA 2WNMA 1KF6B 1CQVA 1YJJA 1FCLA 2IPKD 5BMHA 2ACZB 2K22A 4REZA 3AEGB 4C7YA 5EE1A 4XDCA 1V1OA 2FUG1 2WXMA 1ACCA 2WDRB 3IT4B 5AUKA 3HUIA 1BUIC 3AEBB 2KQ4X 2I2YA 3BVGA 3AE3B 2IGHA 2GB1A 2PTLA 1V97A 1DOIA 1NI3A 1FRRA 1PYWD 1SE3A 2WS3B 1ZUD2 1XLNA 1J7CA 3TEZA 2CU3A 1M4VA 2QSDA 4ZYSA 2RMMA 2PVOD 2BBCA 4RF1A 5E6JA 3IT6B 4YSXB 1RYJA 4OZCA 3U52E 1TY2A 2TSSA 2IGGA 1VR9A 2JSVX 1NVID 4MH8A 1B9RA 4RGOS 1EM7A 4XDDA 1AWDA 1DOXA 2L1AA 2NMQA 4OW0A 1SE4A 2K5PA 1IUEA 3HVDA 2W82A 1V1PA 3EA6A 1ZDVA 2BB5A 1VDVA 4US8A 1HZ5A 1FNVA 4HKZE 1FM0D 1UNSA 2V3NA 1FIQA 1J7AA 1N63A 1E0ZA 3AE2B 3P42A 2K9XA 2N9LA 1GAQB 4TQ0A 1K52A 4UDUC 3O13A 1QQRA 1TYGB 1I4PA 2WXRA 2V3PA 4RFBA 2QMTA 2R61A 1TKGA 1ZDXA 5C2TB 1CJEA 3AM9A 1SSNA 1QILA 3FAHA 3I57A 1FD6A 3B9JA 4RGNA 4ZHOA 1FNUA 1KH0A 1XF5L 3AEFB 1L0XB 2DWQA 1L4ZB 3P4RB 2WXQA 1DGJA 1JWUD 2K0PA 4A8XC 1EU4A 1K51A 2WXKA 2YEPB 1YQ4B 4NZLB 2K3UA 5EE9A 3W5VB 1VJKA 2ZW0A 4IOIE 4OVZA 1HA5A 2YEPF 5G5GA 1PGXA 1NYQA 3ETRA 4AQ7A 4R3DA 1JCKB 2X38A 3NRZA 1JWMD 1WSPA 2AQ3B 2LUMA 2VZKB 5D7GA 2BW2A 3HVZA 1D6EC 1KLGD 1PFDA 1I7HA 2CJNA 3BVZA 1XLQA 3NVYA 2LFIA 3U2SC 3L4PA 1FO4A 3CIRB 1ENFA 5BMIA 1TS5A 1TS2A 1VZ6A 2IDYA 4LK0M 3BIID 1F2RC 2HTME 2WXHA 3T3NA 2WP9B 1AYFA 2NTTA 2H88B 2WXIA 3KQ4A 4C80A 3BYYB 4IKGA 1WYGA 4P6VF 1SE2A 1FMAD 1ZOYB 1YQ3B 2G9HD 3AE5B 1Q10A 3ZGZA 3RFZB 4ZRQA 1IGCA 3Q8EA 3ZYYX 2JYEA 4WAFA 4N6EB 2BTEA 1SF0A 1ZXIA 2Y3AA 3BZDB 4A6QA 3P1MA 3R8BA 4MM3B 3AECB 1JWBD 1JMLA 4JWSC 2QEJC 3ZJVA 1OFFA 1QOFA 3W1SA 1R7SA 2WXGA 1YJIA 2HDEA 3GS2A 1XEEA 4GLSC 1ESFA 4L1BA 1WWTA 3AE6B 2WXFA 4M0WA 3ZJUA 2BB6A 1QOGA 1ROEA 4EE2A 3I9V1 3LYYA 3Q8FA 1VZ8A 1T6BX 1C4CA 4IDIA 4A55A 3SFDB 1BMLC 2JQRB 1C79A 3N9YC 4CQNA 1QF6A 1ZPSA 1HQRD 5AUIA 4US9A 1ZXHA 3SEBA 2L83A 3KWVA 3IXSA 2AQ2B 2BS3B 2M19A 4RNAA 4RGTA 1C9FA 4YTPB 4B0EA 4WURA 1C77A 1L5PA 1FCCC 3IAS1 1CZPA 1HXYD 2PLPA 4RGMA 4L23A 5JXVA 1STEA 2H89B 1TKYA 3NVZA 3TSSA 2W3RA 1JWSD 1SXTA 4J3OD 3AB5A 1FRDA 4JX1C 2OHFA 1XCQL 1HEZE 1QKZA 3VRAB 4GDKB 2LMCA 5BYRA 4YSZB 1FNWA 1WXQA 2SAKA 1DOYA 1MI0A 3MC0B 4LLGM 1D4BA 1N61A 2CJOA 1L0YB 2N9KA 5BMGA 3IAM1 1RM6C 1TS4A 4KKJA 1CK1A 1GB1A 5FR3A 1C78A 2JU6X 3P4SB 1IBXB 4P16A 1D5MC 3BK2A 1L0VB 1F2RI 2PVGC 1JROA 2Y5PA 3WCQA 5TSSA 1PGBA 2DLBA 1QT9A 3TEXA 2INPE 2EELA 3J9CA 3ABVB 3TUOA 3P4PB 3KWLA 2DBYA 4JWUC 2J53A 4YTMB 3VQIA 4ZRPA 1MHXA 2RDHA 2V4IB 3AEAB 3KLSX 5BYQA 2MEKA 2BT6A 2WXLA 1MPEA 3W9CB 1QOBA 1TS3A 4ARIA 2QIEB 3EUB2 2M0AA 5FKAC 3VRBB 3MFGA 1IBXA 1EWCA 2PMVA 2PIAA 4NJCA 1J7BA 4AS1A 2WU2B 1NYRA 1T5XD 1XXGA 3GB1A 3AV8A 2N7JA 3BVMA 2LHDA 3E9SA 1C4AA 2WDQB 3FILB 4OZBA 3OWEB 1BXTA 2WXNA 2IJ0A 3Q8AA 2J52A 3VR9B 4RCOA 2MJ3A 4XWWA 1YMHE 4USAA 2BS4B 1XCTL 1I4GA 2EKIA 4DXGA 1I4XA 4HEA1 4OHJA 2PKOA 1JQ4A 1K53A 2ON8A 3P63A 4MACA 3ZJTA 1F0ZA 2BS2B 2JYTA 2WLBA 3MJ5A 4C56C 1UGJA 2KAJA 2DYMA 3B2FA 1N62A 3R2IA 5D3IB 2JWUA 3AMZA 1GB4A 3PZ7A 4JPSA 2AX5A 1UWXA 3BK1A 2N0SB 2QILA 2RPVA 3AEEB 4NAWB 4YSYB 2FE8A 4HROA 4A90A 3T3OA 1MHHE 3B2GA 2MJEA 3U4EG 1SJHD 3MHZA 1C4PA 5HHDG 1PUTA 2KMMA 1KLUD 2AQ1B 1RWSA 1SB3C 4ZOHC 2M56B 3DWMA 1D5ZC 3AN1A 1PGAA 4GDLB 4DQOC 1EWYC 1YN4A 3GP7A 2ONQA 3TEYA 2W54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A70 A;  2H89 B;  1TKY A;  3NVZ A;  1E6E B;  3FAH A;  2W3R A;  1VLB A;  1L6V A;  2WQY B;  5EE0 A;  3B9J A;  3FC4 A;  4JX1 C;  3AB5 A;  1FRD A;  5H8Y E;  2OHF A;  3SR6 A;  3AEF B;  3VRA B;  2DWQ A;  3P4R B;  3LXF A;  4WQM A;  1DGJ A;  4YSZ B;  1FXA A;  3PO0 A;  2WU5 B;  3RPF C;  1WXQ A;  1N5X A;  2W3S A;  1JW9 D;  1DOY A;  1N60 A;  1YQ4 B;  1XO3 A;  5EE9 A;  3W5V B;  4ZHO A;  1VJK A;  1TKE A;  5GXG B;  5G5G A;  1N61 A;  3AE7 B;  1NYQ A;  2CJO A;  3ETR A;  1TJE A;  5G5H A;  4YXD B;  1E10 A;  3NRZ A;  2E3T A;  2W55 A;  1RM6 C;  3P4Q B;  4C7Z A;  3NS1 A;  1OQR A;  4N58 A;  2LEK A;  4A9A A;  3HVZ A;  3P4S B;  1QOA A;  2WDV B;  2CJN A;  1PFD A;  1I7H A;  1L0V B;  3AE9 B;  4FXC A;  1XLQ A;  3DWG C;  4YTN B;  1E7P B;  1V8C A;  2MJD A;  1XLP A;  1JRO A;  1JWA D;  1JAL A;  2PVG C;  2Q5W D;  3NVY A;  3WCQ A;  1GPX A;  1N5W A;  1QT9 A;  1E9M A;  3L4P A;  1KF6 B;  1FO4 A;  1YJJ A;  3CIR B;  3ABV B;  3P4P B;  3KWL A;  3LB8 C;  2ACZ B;  2K22 A;  2DBY A;  2HTM E;  3AEG B;  3BII D;  4C7Y A;  2WP9 B;  4JWU C;  5EE1 A;  4YSX B;  1AYF A;  3SFE B;  5EE3 A;  4C80 A;  2H88 B;  4YTM B;  1SIJ A;  1WYG A;  4P6V F;  1FMA D;  2JX5 A;  2G1E A;  1ZOY B;  2WDR B;  5AUK A;  3HUI A;  1KRH A;  3AEA B;  4N59 A;  2BT6 A;  1YQ3 B;  1PDX A;  3AEB B;  3AE5 B;  3W9C B;  1QOB A;  3AE3 B;  4ZHP A;  2QIE B;  3EUB 2;  3W5U B;  2W54 A;  3VRB B;  1V97 A;  1DOI A;  1NI3 A;  2PIA A;  1FRR A;  1J7B A;  3ZYY X;  1FXI A;  4N6E B;  2WS3 B;  1ZUD 2;  1NYR A;  2WU2 B;  1SF0 A;  1ZXI A;  3VR8 B;  1XLN A;  3AV8 A;  3P1M A;  4HRS A;  3AEC B;  5H92 C;  2WDQ B;  1JWB D;  3AE4 B;  4JWS C;  1J7C A;  1JRP A;  1OFF A;  1QOF A;  2CU3 A;  3HRD D;  3VR9 B;  2L52 A;  2MJ3 A;  2PVO D;  4USA A;  1NEN B;  1T3Q A;  2BS4 B;  1R7S A;  1OQQ A;  2Y5C A;  1RYJ A;  2EKI A;  3AE1 B;  1NEK B;  2PKO A;  1JQ4 A;  1YJI A;  1NVI D;  1B9R A;  3P63 A;  2FBW B;  3CWI A;  1F0Z A;  1WWT A;  2BS2 B;  3AE6 B;  2WLB A;  1AWD A;  1XLO A;  3NVV A;  3AE8 B;  4ITK A;  4LTU A;  1DOX A;  2KAJ A;  3B2F A;  1QOG A;  1N62 A;  1ROE A;  2K5P A;  4KX6 B;  1IUE A;  3NVW A;  1WGK A;  3AMZ A;  4IDI A;  1VDV A;  4US8 A;  3SFD B;  2AX5 A;  2JQR B;  1FM0 D;  2N0S B;  1UWM A;  1KFY B;  3AM9 A;  3AEE B;  1FIQ A;  1J7A A;  4YSY B;  1N63 A;  3AED B;  1QLB B;  4HRO A;  1QF6 A;  1FFV A;  1E0Z A;  3AE2 B;  1ZP0 B;  1WRI A;  5AUI A;  2K9X A;  4US9 A;  1GAQ B;  3B2G A;  2L83 A;  3AH7 A;  2MJE A;  1L6U A;  1TYG B;  2BS3 B;  2M19 A;  5C3J B;  1PUT A;  2KMM A;  4WWM A;  4YTP B;  1RWS A;  1SB3 C;  4ZOH C;  2M56 B;  1L5P A;  3DWM A;  2MH7 A;  2B76 B;  1CZP A;  4YT0 B;  5MPO A;  1FFU A;  3AN1 A;  1TKG A;  5C2T B;  1CJE A;  1EWY C;  1RFK A;  2QJL A; 
#chains in the Genus database with same CATH topology
 2WGS A;  1VZ7 A;  4II3 B;  1E8X A;  3ZTD A;  4LNI A;  3NUH B;  2L7R A;  3LXF A;  2GBR A;  4GU2 A;  1N5X A;  4FBJ B;  1XO3 A;  1SIF A;  2SEB D;  3L13 A;  4EZK A;  4C7Z A;  4K1R B;  4A9A A;  2WXJ A;  3BYT B;  2YLM A;  2MX2 A;  3L17 A;  1E9M A;  1AAR A;  2C60 A;  4NAM A;  3DVG Y;  3MP9 A;  2NBW B;  3APD A;  1SIJ A;  1OEY J;  5EDS A;  2G1E A;  4IM0 A;  1UH6 A;  1TBE A;  2NBU A;  1SBB B;  2ZNV B;  3PRP B;  1A5R A;  3W5U B;  5HG2 A;  1KM7 A;  5D6J B;  4I6N B;  3RNF C;  4ANV A;  5LXH A;  1IYF A;  3AE4 B;  4TSS A;  2WXO A;  3P2B A;  2RPQ A;  4HJK A;  2BGF A;  1S1Q B;  3KYC D;  1P1A A;  2FBW B;  1WXM A;  2UWQ A;  3CWI A;  4XE0 A;  4ASW C;  2UYZ B;  4KX6 B;  5KHQ A;  1WGK A;  2V4L A;  2K8C A;  4G0N B;  1V49 A;  2ICI A;  1WE6 A;  2ZW1 A;  3QC8 B;  4E3C A;  3ZIM A;  4M00 A;  3RZF A;  1TIF A;  2OJR A;  1LO5 D;  5T8I A;  3SD5 A;  3EHV A;  4W9C A;  2JXT A;  4P1B C;  3AH7 A;  2J4X A;  4BOS C;  2KFK A;  2RGF A;  2JVC A;  2MH7 A;  5MPO A;  3QIJ A;  1FFU A;  4YWG G;  2BYV E;  5EE0 A;  2KQ7 A;  5CHF A;  3H8H A;  3AXC A;  2HJ1 A;  1FXA A;  3V60 A;  1ET6 A;  3JYU A;  1E90 A;  2RDG A;  2LZ6 A;  4OZA A;  4E74 A;  3BWU D;  2GBK A;  1TKE A;  5GXG B;  4JE3 B;  5G5H A;  1TJE A;  2E3T A;  1QOA A;  4A3O A;  2O2V A;  3RZW C;  3PT2 B;  4N9F 4;  3Q3O C;  3UI3 A;  1XLP A;  3PZD A;  1JAL A;  2J0M A;  1GPX A;  2K6D B;  2NS5 A;  1N5W A;  4HVB A;  2V9H A;  4KGR A;  2WYQ A;  1KF6 B;  1FCL A;  5BMH A;  2D3B A;  1OQY A;  3H6N A;  5AEK B;  3AEG B;  1GNU A;  2NPT B;  3PGE A;  4XDC A;  3GOE A;  3TL5 A;  2WXM A;  1ACC A;  2WDR B;  5AUK A;  4WJN A;  3HUI A;  4EOY A;  2KQ4 X;  3Q14 C;  4K7W A;  3GE8 C;  4GDK A;  1FPY A;  2L05 A;  5DCN A;  2CS4 A;  1ZUD 2;  2QCZ A;  4QAY A;  2BKF A;  4HK2 A;  3NG0 A;  3TEZ A;  2CU3 A;  1M4V A;  2I1K A;  2MBO A;  3IT6 B;  3CF6 E;  4OVV A;  3U52 E;  3V6E B;  3ZNH B;  2NR2 A;  3H7S A;  2KFK B;  1DOX A;  3ZTC A;  2K5P A;  2DZI A;  3EA6 A;  1WE7 A;  4MGZ E;  4US8 A;  4MJS B;  1WMH B;  1WJU A;  3VTU A;  3PTF C;  1N63 A;  1PQS A;  3L0W B;  2KAN A;  3N1Z C;  3PHW B;  1E0Z A;  3A1Q B;  1F9J A;  3A4R A;  3AE2 B;  3P42 A;  2K9X A;  2BF8 B;  2W9N A;  4RFB A;  4ANX A;  2HE7 A;  1TKG A;  1CJE A;  1UEL A;  2AEH A;  2MQJ A;  1QIL A;  1KH0 A;  2KNB A;  3P4R B;  2JUO A;  3KUC B;  4LNF A;  3ZO5 B;  2K0P A;  4A8X C;  2WXK A;  2YEP B;  4EZJ A;  3W5V B;  4M02 A;  4I6P A;  4IOI E;  4OVZ A;  4DHJ B;  3PRM B;  1JCK B;  2LUM A;  3DHG C;  3HVZ A;  1PFD A;  4S17 A;  1E7V A;  3JSV B;  2LFI A;  4WJO A;  3L4P A;  1FO4 A;  3CIR B;  1Q1O A;  5BMI A;  1GG3 A;  1TS5 A;  1VZ6 A;  3BII D;  2WXH A;  2HTM E;  1AYF A;  4ANW A;  2WXI A;  1C3T A;  2KMC A;  4P6V F;  2K25 A;  1ZOY B;  2JXX A;  2ZJD A;  2JY6 A;  2DZM A;  2YVC A;  2G9H D;  2ZCC A;  3AE5 B;  2AYO B;  4JL9 A;  1J8C A;  2BTE A;  4N6E B;  4HCP B;  1SF0 A;  3BZD B;  3DCG A;  3UGB B;  4MM3 B;  4BKT A;  2FCS A;  3W1S A;  1Q5W B;  2LAS A;  4HPP A;  3GS2 A;  1XEE A;  3I63 C;  4GLS C;  2WXF A;  4KZC A;  1P3Q U;  3LYY A;  1T6B X;  4IDI A;  1BML C;  2JQR B;  2IO1 B;  3GE3 C;  3L16 A;  1QF6 A;  2KDF B;  5AUI A;  4US9 A;  2MP2 B;  1HE8 A;  3DOW A;  2BS3 B;  2M19 A;  3DVN V;  2WX1 A;  2N9P C;  1FCC C;  4W9I A;  4HWI B;  2PLP A;  4L23 A;  1STE A;  1I42 A;  2H89 B;  3NVZ A;  3TSS A;  3Q2A C;  2W3R A;  3VUW A;  4C00 A;  3NZU A;  3VRA B;  2OHF A;  1HEZ E;  1QKZ A;  5CHV C;  4GDK B;  2LMC A;  2REX A;  1BT0 A;  1FNW A;  4EEW A;  3UIN B;  2D11 A;  1L0Y B;  4GN1 A;  1IP9 A;  4IWQ A;  3P4S B;  4P16 A;  3A9K A;  2JRI B;  4M01 A;  2FAZ A;  2KLG A;  1PGB A;  2DLB A;  3QHT A;  3VH4 B;  2EEL A;  4ZYN A;  4W9E A;  2DBY A;  2RDB C;  4JWU C;  3HIZ A;  3DHI C;  5J2R A;  1WRD B;  2GMI C;  1T0Y A;  4ARI A;  3R66 C;  3VRB B;  1EWC A;  3UIO B;  1YX6 B;  3RNC C;  4JIO U;  2LHD A;  1WF9 A;  1P98 A;  2BYF A;  2M8S A;  2MJ3 A;  4G11 A;  3RCZ A;  1UZX B;  4GOC A;  4DXG A;  4OHJ A;  3RNB C;  1K53 A;  1UBQ A;  1V5O A;  4RM8 A;  2XEW A;  3P63 A;  4MAC A;  2EMT A;  2D3G A;  2JYT A;  2WLB A;  2JZ3 B;  2NVU I;  4W9G A;  1E5W A;  5D3I B;  2EMS A;  1UWX A;  1WJ4 A;  2IO3 B;  3Q3N C;  4DWF A;  2RPV A;  4NAW B;  2FE8 A;  3QK0 A;  5D2M B;  4ZRI A;  3QJZ A;  1GC7 A;  1WY8 A;  1MHH E;  1SJH D;  1T0S C;  1C4P A;  5HHD G;  1PUT A;  3FKY A;  3U8Z A;  3DWM A;  4CO7 A;  2GBN A;  3OG5 A;  3X23 A;  4XWW A;  4ZRK A;  1E6E B;  4FA6 A;  1SEB D;  1YN5 A;  1WMH A;  1WZ0 A;  1FEH A;  3FC4 A;  2N1V A;  3QAQ A;  3HK0 A;  5LNK 1;  4D2K A;  5HFY A;  1V6E A;  1R4N I;  4YXD B;  1E10 A;  4P7I A;  4BVU C;  2D2Q A;  5FK9 C;  4TMA B;  2KQS A;  2KAC A;  2GOW A;  2BYE A;  4FXC A;  3VTW A;  3Q69 A;  3UQB A;  2BVC A;  1WI0 A;  2NTS A;  3PLV A;  2LGS A;  3V05 A;  2CHZ A;  2DYB A;  2VZK D;  4KKI A;  3H7P A;  1XD3 B;  4KGS A;  4DXF A;  4IM3 A;  1YN3 A;  4KGT A;  5JHA A;  1JRU A;  2KDB A;  2AL3 A;  4HRS A;  5IP4 D;  5CHW A;  1DYQ A;  4TQ1 A;  1KTK A;  2ZCB A;  3W2D A;  2Y5C A;  3V61 A;  1NEK B;  1EO6 A;  1Z5S B;  2ZNV C;  2I38 A;  1P7F A;  4K81 A;  3NVV A;  4LTU A;  2WXP A;  5BYS A;  3QA8 A;  2DYO A;  3K9O B;  1UWM A;  1WJ6 A;  5L83 A;  2KDE B;  1FFV A;  1AW7 A;  1ZP0 B;  3KVF B;  3PRZ A;  2V1Y A;  1LGR A;  3UIP B;  3IBE A;  2IBI B;  3WA0 A;  4WWM A;  4RF0 A;  3T9L A;  4MGK E;  1D5X C;  2NCN A;  2L8J A;  3E56 A;  2JPH A;  2KDI A;  3URY A;  1EU3 A;  4MT5 A;  1VLB A;  4H2A A;  1TT5 B;  2AWT A;  2N4F A;  4M8M A;  2CU1 A;  2LJI A;  3BY4 B;  1YNT E;  4C4V A;  2LRW A;  2W3S A;  2WWZ A;  5LXI B;  3C8Y A;  3AE7 B;  1P7E A;  2KTF A;  5JZE B;  2GI9 A;  2MBQ A;  3P4Q B;  4WAA A;  1OQR A;  3PRE A;  4N58 A;  3MC8 A;  4HKQ A;  4YTN B;  1V8C A;  1MG4 A;  2MJD A;  2KZR A;  4S0R A;  2WNM A;  1YJJ A;  4NPN A;  2IPK D;  2K6Q A;  2M17 A;  2ACZ B;  5IN7 A;  1G6J A;  4HLE A;  4MEL A;  3L08 A;  4XX5 A;  1VD2 A;  4HDO A;  1Q0W B;  4K3B A;  1UD7 A;  3BVG A;  3NS8 A;  4ZDV A;  3AE3 B;  4FLH A;  2ZPY A;  3RT3 B;  1OTR B;  1FRR A;  1SE3 A;  2PPH A;  1RLF A;  1XLN A;  4C4V B;  4ICV A;  1J7C A;  3UQA A;  2BWE S;  2BBC A;  4OZC A;  4PS7 A;  4RM9 A;  1TY2 A;  5DPT A;  2IGG A;  4MH8 A;  2A5U A;  2NMQ A;  1SE4 A;  3M3J A;  2C7H A;  2INC C;  3KH0 A;  3DBR B;  1VDV A;  1HZ5 A;  1FIQ A;  3NZS A;  2N9L A;  3JVZ X;  4UDU C;  3O13 A;  1TYG B;  2WXR A;  1I4P A;  2V3P A;  4BBN C;  1ZDX A;  3FAH A;  3BIN A;  1XF5 L;  1L4Z B;  1LM8 B;  4GMV A;  1DGJ A;  1JWU D;  4WWP A;  1UF0 A;  2LI5 A;  3IFW B;  3NHE B;  4EUT A;  3R7Q A;  3QX1 A;  2MWS B;  1ZW7 A;  5G5G A;  1NYQ A;  1E7U A;  3ETR A;  3VVW B;  1WGR A;  3NRZ A;  4JGH B;  4W9H A;  2AQ3 B;  4BBN F;  3R7R A;  3BVZ A;  1XLQ A;  4MM3 A;  3CMM B;  3NVY A;  1OGW A;  4ANU A;  5DPS A;  2MW5 A;  3W1Y A;  2WP9 B;  4KZ0 A;  2NTT A;  2C5L C;  4IKG A;  1V5T A;  1YQ3 B;  2HTH A;  3RFZ B;  4ZRQ A;  1WGG A;  1L7Y A;  5CTR C;  4WAF A;  2KMA A;  1ZXI A;  3NOB A;  5E6N A;  5TR5 A;  3AEC B;  2LXC A;  4JWS C;  4WQO B;  1QOF A;  4DHJ D;  4F7Z A;  3NJT A;  4LNN A;  2HDE A;  1P0R A;  1SGH A;  2KD0 A;  3ZJU A;  3I3T B;  2BB6 A;  1MJD A;  1R4N B;  3Q8F A;  1VZ8 A;  1C4C A;  1K8R B;  2Y5B B;  3AI5 A;  2XK5 A;  4EKU A;  3ZNI D;  1WGD A;  3VAW A;  2L83 A;  2Z59 B;  3ZRC A;  3IXS A;  4RNA A;  2LUE A;  4B0E A;  1C77 A;  2JWZ A;  1CZP A;  3ALB A;  2M0X A;  1HXY D;  4DHZ E;  3ENE A;  4LDT D;  1H8C A;  1SXT A;  4J3O D;  2LGX A;  3AB5 A;  1WXQ A;  4M0W B;  1MI0 A;  2G4S A;  3HM3 A;  1D4B A;  4KDI C;  4FN2 A;  2CJO A;  2N9K A;  5BMG A;  1TS4 A;  1CK1 A;  3GZN I;  3B0A A;  3DQV A;  2KTR B;  2GBM A;  2LXA A;  1OEY A;  2KVR A;  2INP E;  3J9C A;  5JH5 C;  3ABV B;  3N1X C;  3KWL A;  2KJR A;  3PPA A;  3R3M A;  3AU4 A;  2J53 A;  4YTM B;  2QHO A;  2LRU A;  4URK A;  4ZRP A;  1MFW A;  1MHX A;  3O65 B;  2RDH A;  2MBE A;  1MPE A;  3W9C B;  3EEC A;  1WXA A;  2QIE B;  2M0A A;  5C23 A;  4AS1 A;  1NYR A;  1XXG A;  4HPL B;  2KC1 A;  4OZB A;  3M95 A;  1BXT A;  4RCO A;  2NBV B;  4USA A;  5AZF A;  1YJ1 A;  1I4X A;  1WGH A;  4C56 C;  4JLC A;  1UGJ A;  1N62 A;  2KT7 A;  2JWU A;  2MA9 B;  2N0S B;  2QIL A;  3AEE B;  1J19 A;  4HRO A;  4G3X B;  3RUI B;  4MGI E;  1Y8R C;  3T3O A;  4FHK A;  3U4E G;  2GLS A;  3MHZ A;  2KMM A;  1KLU D;  2ZVO A;  2IY1 B;  4NJ7 A;  4BAX A;  1PGA A;  4GDL B;  1EWY C;  2ONQ A;  4BZA A;  2LGY A;  5H8Y E;  2KN4 A;  3FIL A;  4WQM A;  3PO0 A;  3RPF C;  2G4D B;  3DPD A;  2FCQ A;  3HHM A;  1N60 A;  3U7Z A;  4Q2J A;  1E8Z A;  3MC9 A;  2DNF A;  5E6O A;  4HJG E;  3NS1 A;  3Q3M C;  1WJN A;  3DBL B;  3ZRF A;  2WDV B;  3AE9 B;  2DAF A;  2PW9 A;  3ONS A;  2MCN B;  4K3C A;  2ZPN A;  2L0F A;  3SFE B;  2BWF A;  2D3C A;  2JX5 A;  5G2N A;  4W9J A;  1I4H A;  2Z8L A;  1PDX A;  5I4D A;  2K39 A;  4ZHP A;  3ZQ4 A;  4L2Y A;  1FXI A;  1C76 A;  2M1M A;  3VR8 B;  3M62 B;  2DEN B;  1AN8 A;  2E6X A;  3B08 A;  1R4M I;  2IGD A;  3B1L X;  1JRP A;  3HRD D;  2L52 A;  1NEN B;  2KK8 A;  1OQQ A;  2INN E;  3ZLZ A;  4AP4 C;  4ITK A;  1F52 A;  2LHE A;  4CHK A;  3NVW A;  1SE9 A;  1V9J A;  5LLI A;  1L4D B;  3V3X A;  2XBB C;  2PE9 A;  2KKC A;  3PV1 A;  4GIV A;  1T0Q C;  3AED B;  1QLB B;  3RNA C;  2KDM A;  1I4Q A;  1L6U A;  3DBH B;  5IKC M;  2BYT A;  5C3J B;  3C19 A;  5D3D A;  3LJ3 A;  3DDC B;  2A4Z A;  2FCM A;  2N9E B;  4LJP B;  2XNA C;  1RFK A;  3EGR A;  1L6V A;  3SR6 A;  1JW9 D;  1V80 A;  1ISN A;  2D10 A;  4LNK A;  2LGI A;  1YIW A;  1HTQ A;  5IOI A;  3ZDM C;  2D5G A;  4B0M A;  3TEW A;  1ZE3 D;  4WJP A;  2HJ8 A;  4W9K A;  2LEK A;  2O6V D;  3QWZ B;  4GXB A;  1TGZ B;  2FCN A;  3AUL A;  4WWN A;  4BKG A;  2Q5W D;  2O6V A;  1M94 A;  3H7P B;  2NPT A;  4NNJ B;  2K22 A;  2O6V B;  4REZ A;  2BKR B;  5EE1 A;  2MLB A;  2MHJ A;  4LJO B;  4CYE A;  1BUI C;  3QAR A;  5IO9 A;  2C7N B;  2IGH A;  5G55 A;  4HXD A;  1NI3 A;  3DBS A;  1P9D U;  1PYW D;  4FJZ A;  2WS3 B;  3VUY A;  2KN5 A;  1WM3 A;  5CX3 A;  4XGA B;  1WH3 A;  1FXT B;  2QSD A;  3ML8 A;  4LCD E;  4YSX B;  4X57 B;  1RYJ A;  5AZG A;  3W1S C;  3CST A;  1VR9 A;  2JSV X;  1NVI D;  5C1Z A;  1B9R A;  4RGO S;  2N1W A;  1MG8 A;  4XDD A;  1AWD A;  3X0W A;  4XZ4 A;  1IUE A;  3HVD A;  1NI2 A;  2BB5 A;  2RR9 A;  2V3N A;  1J7A A;  5DPR A;  3RYT A;  4BOZ B;  1GAQ B;  4TQ0 A;  3PS6 A;  1K52 A;  2RD0 A;  2D3A A;  2QMT A;  2R61 A;  3DBH I;  3AM9 A;  1SSN A;  4IW0 A;  4IWO A;  1FD6 A;  4J6I A;  1VCB A;  3B9J A;  3OJ3 A;  4RGN A;  3SHQ A;  3AEF B;  1L0X B;  2DWQ A;  2VH2 A;  2WXQ A;  3LDZ E;  3PLU A;  1EU4 A;  1YQ4 B;  4NZL B;  2K3U A;  5EE9 A;  1VJK A;  3Q6B A;  2YEP F;  1YD8 U;  1PGX A;  3N3K B;  1JWM D;  1WSP A;  3IG3 A;  3OJ4 B;  1YQB A;  1I35 A;  4NJ6 A;  5D94 A;  5GMV A;  2CJN A;  2ZEQ A;  4W9D A;  3OLM D;  1WFY A;  3U2S C;  1XT9 B;  1ENF A;  1TS2 A;  1GC6 A;  4LK0 M;  4XC2 A;  1F2R C;  3OAW A;  2K8H A;  4GSW A;  4EZL A;  2H88 B;  3KQ4 A;  3BYY B;  1WYG A;  1SE2 A;  1FMA D;  4YL8 A;  3QQ8 B;  3KYD D;  3ZGZ A;  3L10 B;  3ECI A;  1IGC A;  3Q8E A;  2JYE A;  4DXA B;  2ZZP B;  2Y3A A;  4HDQ A;  3P1M A;  3R8B A;  3TBL D;  1JWB D;  2QEJ C;  3U7D A;  1OFF A;  1RAX A;  1S3S G;  3AE6 B;  1QOG A;  1GUA B;  3I9V 1;  3Q3J A;  1XQQ A;  2K8B A;  4ACF A;  5L95 C;  3KUD B;  3S2A A;  3APF A;  4IUM B;  3KW5 B;  4CQN A;  1EF1 A;  3SEB A;  3KWV A;  2AQ2 B;  3M63 B;  3N30 A;  4I6L B;  1C9F A;  4GGQ A;  4YTP B;  2PJH A;  1L5P A;  3Q3F A;  3U30 A;  4RGM A;  4B95 A;  2JRH A;  1TKY A;  4FJY A;  3HM6 X;  2LVP A;  4JX1 C;  1FRD A;  3ZKJ C;  1KOT A;  2FID A;  3MJW A;  3CSF A;  2SAK A;  3MC0 B;  4A20 A;  4IG7 B;  3T8M A;  1E8Y A;  1N61 A;  1ZGU B;  2KYW A;  4KKJ A;  3H1U A;  5FR3 A;  1C78 A;  3A33 B;  1IBX B;  2Z0D B;  3H9D A;  1F2R I;  1LQB A;  1NDD A;  1QT9 A;  4MH0 E;  1IPG A;  3RNG C;  3MHS D;  1X1M A;  4IM2 A;  4NQL B;  2C9W B;  4AJW A;  2V4I B;  3A4S C;  5BYQ A;  2BQQ A;  3JW0 X;  1QOB A;  3QCA A;  1TS3 A;  2LVQ A;  3EUB 2;  2KO3 A;  5FKA C;  3MFG A;  2PMV A;  4NJC A;  5J17 A;  4F1S A;  2JT4 B;  3AV8 A;  2DAJ A;  2N7J A;  3E9S A;  4LDT B;  2AL6 A;  2WXN A;  2IJ0 A;  3VR9 B;  4BKS D;  4OVU A;  2BS4 B;  2N9X A;  4B6W A;  1XCT L;  4AWJ A;  2KWC A;  1TTN A;  1F0Z A;  3MJ5 A;  4NAW A;  4PYU A;  2KAJ A;  3ZNG C;  3AMZ A;  4JPS A;  3TJP A;  3AU5 A;  3BK1 A;  1HTO A;  4DDG D;  4AUQ C;  3N32 A;  1L2N A;  2MJE A;  2KLC A;  2XK5 B;  2AQ1 B;  1RWS A;  1SB3 C;  4ZOH C;  4MJS A;  2LD9 A;  2GBJ A;  2MSE D;  1A70 A;  4PT5 A;  4ARC A;  2L76 A;  1TY0 A;  3R2T A;  4KVG B;  1GJZ A;  3ZNZ B;  2WU5 B;  3ZUN A;  1ET9 A;  2OED A;  2LVO A;  2EKE C;  2JZP A;  3Q8B A;  1TZO A;  3RMK C;  4WIP A;  2W55 A;  4FAD A;  2J42 A;  3APC A;  2LJ5 A;  3V6C B;  2ZVN A;  1U4A A;  1J0G A;  2OOB B;  4MSM B;  1E7P B;  1JWA D;  5HI1 A;  4HPM B;  4KIK B;  1WYW B;  1EUV B;  4DHZ B;  5JHB A;  3LB8 C;  2KFJ A;  4MSQ B;  4TV3 A;  2FIF A;  3SU8 X;  3ZW3 A;  1MVK A;  3RNE C;  1KRH A;  4N59 A;  5BO4 B;  5HKH A;  5AZH A;  4NQK E;  2O2V B;  4NY0 A;  4WH4 A;  4KIK A;  1WXS A;  2HD5 B;  5H92 C;  1Z2M A;  3SDL C;  3PHX B;  3VFK A;  1T3Q A;  1LFD A;  3AE1 B;  2XN9 C;  4WJQ A;  3WIM A;  2KHW B;  3MTN B;  1UBI A;  3Q8C A;  3EFU A;  1K50 A;  2L00 B;  3PZ8 A;  3VH3 B;  2K1F A;  5EE3 A;  1KLV A;  1XLO A;  4PS3 A;  3AE8 B;  2KJH B;  2KWD A;  2MP2 A;  1R4M B;  1B1Z A;  2KX3 A;  4FUL A;  1KJT A;  4O1N A;  1KFY B;  4KSL C;  1VRA B;  2OJW A;  3ZDT A;  3WAN A;  2J7Q B;  1WRI A;  4KDL B;  4IC7 B;  2KOX A;  3L54 A;  3N20 C;  1T0R C;  1V81 A;  4RMA A;  4DBG A;  2B76 B;  4YT0 B;  1V1P B;  1UUP A;  1I4R A;  3NZ3 A;  2QJL A;  1WIA A;  2V0G A;  2L32 A;  1IGD A;  4KV2 A;  2I1J A;  2WQY B;  1Y56 A;  2IY0 B;  2KWV B;  4MGY E;  2IZV B;  1HZ6 A;  3DBL I;  4XWT A;  2QDF A;  4G50 A;  2GRI A;  3WAO A;  1NBF C;  2MBH A;  4WWO A;  1GOZ A;  4RH6 A;  1SJE D;  2IYD B;  3JSV A;  4MEM A;  3DWG C;  1F77 A;  4ZRJ A;  5KHO A;  2VRR B;  2KX0 A;  1CQV A;  3DVG X;  1UGM A;  3WAL A;  4C7Y A;  1V1O A;  2FUG 1;  2L0T A;  3UF8 A;  3RI7 C;  3IT4 B;  2IO2 B;  4P1C C;  1YOV B;  3AEB B;  4AJY B;  2I2Y A;  2IO0 B;  5DPW A;  2GB1 A;  2PTL A;  1V97 A;  1DOI A;  4ICU A;  3VTV A;  2JZZ A;  1WX7 A;  2MRP A;  1WM2 A;  4FJV B;  2CHW A;  4ZYS A;  2RMM A;  2PVO D;  4RF1 A;  5E6J A;  1V86 A;  2J0K A;  2KJ6 A;  1YX5 B;  2TSS A;  1C1Y B;  1TZ1 A;  2UU7 A;  2BPS A;  3KUZ A;  4HCN B;  1EF5 A;  1EM7 A;  4E71 A;  3ZXV A;  2L1A A;  2R2Q A;  1RFA A;  4OW0 A;  4DDI D;  3D32 A;  2W82 A;  1V1P A;  4BFR A;  1ZDV A;  1FNV A;  4HKZ E;  1FM0 D;  1UNS A;  3I5J C;  4W9L A;  2N7D A;  4GDL A;  3DBR I;  4W9F A;  1E8W A;  3VDZ A;  1QQR A;  4XYC A;  4EFO A;  5C2T B;  2RSU A;  3NY5 A;  2JF5 A;  3I57 A;  4ZHO A;  1FNU A;  2QC8 A;  1CMX B;  3DVN U;  3TMP B;  1K51 A;  2WX0 A;  3GZN B;  2ZW0 A;  1HA5 A;  2MBB B;  4PS8 A;  4AQ7 A;  3IHP C;  4R3D A;  2X38 A;  4GB9 A;  2VZK B;  4IWP A;  3PVL A;  2BW2 A;  5D7G A;  1D6E C;  1KLG D;  1I7H A;  2R2O A;  2N7E A;  3ZVV A;  2IDY A;  3T3N A;  2FNJ B;  2DZJ A;  4C80 A;  3ML9 A;  2KVZ A;  3ZXR A;  1WX8 A;  1Q10 A;  3A9J B;  5IAA C;  3ZYY X;  3TCA A;  4A6Q A;  2V3S A;  4BKS A;  4B9K A;  2LWP A;  1JML A;  2KTR A;  3ZJV A;  3DHH C;  4A3P A;  2KXJ A;  1R7S A;  2WXG A;  4M8N A;  4TUU A;  1YJI A;  3VHT C;  1ESF A;  4L1B A;  1WWT A;  4M0W A;  3N1Y C;  2DHZ A;  1N6Z A;  1ROE A;  4EE2 A;  3K9P B;  2CR5 A;  4A55 A;  3SFD B;  3RUL A;  3VXW A;  1C79 A;  3N9Y C;  5E6P A;  2ASQ A;  2C7M B;  3C0R B;  1ZPS A;  1HQR D;  2KC2 A;  4FHJ A;  4TKN A;  1ZXH A;  1D3Z A;  2J0J A;  4RGT A;  4WUR A;  2G3Q B;  2WDT B;  3A1Q A;  3IAS 1;  4LNO A;  5JXV A;  4F8C B;  2D07 B;  2Z0E B;  1JWS D;  1XCQ L;  5BYR A;  4YSZ B;  2PEA A;  1DOY A;  4JQW C;  4K7U A;  3TIX A;  2G45 B;  4K7S A;  2FUH B;  4LLG M;  1RRB A;  3IAM 1;  1RM6 C;  3WAP A;  1WX9 A;  1GB1 A;  1WGY A;  2JU6 X;  1D5M C;  3BK2 A;  1L0V B;  5FR6 A;  1WXV A;  2PE6 B;  2PVG C;  1JRO A;  2Y5P A;  3WCQ A;  5TSS A;  3TEX A;  3TUO A;  3P4P B;  2DZK A;  3A9J A;  3RN9 C;  3VQI A;  1V2Y A;  1WR1 A;  1ZKH A;  3AEA B;  3KLS X;  2MEK A;  2BT6 A;  2WXL A;  3A9K B;  2M4N A;  3WAM A;  2L3Z A;  2CKH B;  1IBX A;  2B3A A;  2PIA A;  1J7B A;  2DX5 B;  2IND C;  2WU2 B;  1T5X D;  3GB1 A;  3BVM A;  1C4A A;  2WDQ B;  3FIL B;  2LGD A;  3OWE B;  3V62 A;  5IA7 A;  3Q8A A;  2J52 A;  1YMH E;  1I4G A;  2EKI A;  1LXD A;  2CHX A;  4HEA 1;  2PKO A;  1JQ4 A;  2ON8 A;  4KSK C;  1WZ3 A;  5J18 A;  3ZJT A;  1F1H A;  2BS2 B;  3B2F A;  2DYM A;  2WHI A;  3R2I A;  4MDK E;  4PK1 A;  3EC8 A;  4DK5 A;  1GB4 A;  3PZ7 A;  1H4R A;  2AX5 A;  3EFC A;  4YSY B;  4AOF A;  3IVF A;  4A90 A;  3PSE B;  4PYZ A;  3VUX A;  3RD2 A;  3B2G A;  2KWU B;  2VH1 A;  2X8X X;  2M56 B;  1D5Z C;  1WR6 E;  4II2 B;  3AN1 A;  4DQO C;  1YN4 A;  3GP7 A;  1QZE A;  3TEY A;  2W54 A; 
#chains in the Genus database with same CATH homology
 1A70 A;  4PT5 A;  4ARC A;  1E6E B;  1SEB D;  1VZ7 A;  1YN5 A;  1TY0 A;  1FEH A;  3FC4 A;  5H8Y E;  3R2T A;  3NUH B;  2KN4 A;  3FIL A;  3LXF A;  4WQM A;  3PO0 A;  2WU5 B;  3RPF C;  1N5X A;  1ET9 A;  2OED A;  4D2K A;  5LNK 1;  1N60 A;  3U7Z A;  5HFY A;  1XO3 A;  4Q2J A;  2JZP A;  3Q8B A;  2SEB D;  1TZO A;  4YXD B;  1E10 A;  4HJG E;  4WIP A;  2W55 A;  4C7Z A;  5FK9 C;  2J42 A;  3NS1 A;  4TMA B;  4A9A A;  2KAC A;  2WXJ A;  2WDV B;  4FXC A;  3BYT B;  3AE9 B;  2PW9 A;  3Q69 A;  1E7P B;  1JWA D;  5HI1 A;  2NTS A;  1E9M A;  3V05 A;  4NAM A;  3LB8 C;  3MP9 A;  3SFE B;  2VZK D;  4KKI A;  1SIJ A;  2JX5 A;  2G1E A;  1MVK A;  1KRH A;  1I4H A;  4N59 A;  2Z8L A;  4KGS A;  1PDX A;  4DXF A;  1SBB B;  1YN3 A;  5I4D A;  4KGT A;  4ZHP A;  3W5U B;  3ZQ4 A;  5HG2 A;  4L2Y A;  1FXI A;  1C76 A;  4WH4 A;  3VR8 B;  4HRS A;  5H92 C;  1AN8 A;  3AE4 B;  1DYQ A;  2E6X A;  4TSS A;  2IGD A;  4TQ1 A;  1JRP A;  2WXO A;  1KTK A;  3HRD D;  2L52 A;  3W2D A;  1NEN B;  1T3Q A;  2Y5C A;  1OQQ A;  3AE1 B;  1NEK B;  2INN E;  2XN9 C;  2I38 A;  3Q8C A;  1K50 A;  1P7F A;  3PZ8 A;  2FBW B;  3CWI A;  5EE3 A;  4XE0 A;  4ITK A;  3NVV A;  4LTU A;  1XLO A;  3AE8 B;  2LHE A;  4KX6 B;  3NVW A;  1WGK A;  2KWD A;  2WXP A;  5BYS A;  1L4D B;  2ICI A;  2ZW1 A;  1B1Z A;  3V3X A;  2DYO A;  4O1N A;  1UWM A;  1KFY B;  1VRA B;  3AED B;  1QLB B;  1FFV A;  1LO5 D;  1AW7 A;  1ZP0 B;  1WRI A;  5T8I A;  2JXT A;  2KDM A;  3AH7 A;  1I4Q A;  1L6U A;  2BYT A;  2J4X A;  5C3J B;  4WWM A;  4RF0 A;  5D3D A;  2MH7 A;  2B76 B;  1D5X C;  4YT0 B;  5MPO A;  1FFU A;  3E56 A;  1V1P B;  1UUP A;  1I4R A;  3NZ3 A;  1EU3 A;  3URY A;  2XNA C;  1RFK A;  4YWG G;  2QJL A;  2V0G A;  4MT5 A;  2L32 A;  1IGD A;  1VLB A;  3EGR A;  1L6V A;  2WQY B;  4H2A A;  5EE0 A;  1Y56 A;  3SR6 A;  3H8H A;  2LJI A;  1FXA A;  1YNT E;  1ET6 A;  2RDG A;  2W3S A;  1JW9 D;  1HZ6 A;  4OZA A;  4XWT A;  2LGI A;  3BWU D;  1TKE A;  5GXG B;  3C8Y A;  4JE3 B;  3AE7 B;  5G5H A;  1P7E A;  1TJE A;  2D5G A;  2GI9 A;  2E3T A;  4B0M A;  2GRI A;  3P4Q B;  1ZE3 D;  3TEW A;  1OQR A;  4N58 A;  2LEK A;  1GOZ A;  4RH6 A;  1SJE D;  1QOA A;  3DWG C;  4HKQ A;  1F77 A;  4YTN B;  1V8C A;  2Q5W D;  2MJD A;  1XLP A;  3UI3 A;  1JAL A;  1GPX A;  1N5W A;  4KGR A;  2WNM A;  1KF6 B;  1CQV A;  1YJJ A;  1FCL A;  2IPK D;  5BMH A;  2ACZ B;  2K22 A;  4REZ A;  3AEG B;  4C7Y A;  5EE1 A;  4XDC A;  1V1O A;  2FUG 1;  2WXM A;  1ACC A;  2WDR B;  3IT4 B;  5AUK A;  3HUI A;  1BUI C;  3AEB B;  2KQ4 X;  2I2Y A;  3BVG A;  3AE3 B;  2IGH A;  2GB1 A;  2PTL A;  1V97 A;  1DOI A;  1NI3 A;  1FRR A;  1PYW D;  1SE3 A;  2WS3 B;  1ZUD 2;  1XLN A;  1J7C A;  3TEZ A;  2CU3 A;  1M4V A;  2QSD A;  4ZYS A;  2RMM A;  2PVO D;  2BBC A;  4RF1 A;  5E6J A;  3IT6 B;  4YSX B;  1RYJ A;  4OZC A;  3U52 E;  1TY2 A;  2TSS A;  2IGG A;  1VR9 A;  2JSV X;  1NVI D;  4MH8 A;  1B9R A;  4RGO S;  1EM7 A;  4XDD A;  1AWD A;  1DOX A;  2L1A A;  2NMQ A;  4OW0 A;  1SE4 A;  2K5P A;  1IUE A;  3HVD A;  2W82 A;  1V1P A;  3EA6 A;  1ZDV A;  2BB5 A;  1VDV A;  4US8 A;  1HZ5 A;  1FNV A;  4HKZ E;  1FM0 D;  1UNS A;  2V3N A;  1FIQ A;  1J7A A;  1N63 A;  1E0Z A;  3AE2 B;  3P42 A;  2K9X A;  2N9L A;  1GAQ B;  4TQ0 A;  1K52 A;  4UDU C;  3O13 A;  1QQR A;  1TYG B;  1I4P A;  2WXR A;  2V3P A;  4RFB A;  2QMT A;  2R61 A;  1TKG A;  1ZDX A;  5C2T B;  1CJE A;  3AM9 A;  1SSN A;  1QIL A;  3FAH A;  3I57 A;  1FD6 A;  3B9J A;  4RGN A;  4ZHO A;  1FNU A;  1KH0 A;  1XF5 L;  3AEF B;  1L0X B;  2DWQ A;  1L4Z B;  3P4R B;  2WXQ A;  1DGJ A;  1JWU D;  2K0P A;  4A8X C;  1EU4 A;  1K51 A;  2WXK A;  2YEP B;  1YQ4 B;  4NZL B;  2K3U A;  5EE9 A;  3W5V B;  1VJK A;  2ZW0 A;  4IOI E;  4OVZ A;  1HA5 A;  2YEP F;  5G5G A;  1PGX A;  1NYQ A;  3ETR A;  4AQ7 A;  4R3D A;  1JCK B;  2X38 A;  3NRZ A;  1JWM D;  1WSP A;  2AQ3 B;  2LUM A;  2VZK B;  5D7G A;  2BW2 A;  3HVZ A;  1D6E C;  1KLG D;  1PFD A;  1I7H A;  2CJN A;  3BVZ A;  1XLQ A;  3NVY A;  2LFI A;  3U2S C;  3L4P A;  1FO4 A;  3CIR B;  1ENF A;  5BMI A;  1TS5 A;  1TS2 A;  1VZ6 A;  2IDY A;  4LK0 M;  3BII D;  1F2R C;  2HTM E;  2WXH A;  3T3N A;  2WP9 B;  1AYF A;  2NTT A;  2H88 B;  2WXI A;  3KQ4 A;  4C80 A;  3BYY B;  4IKG A;  1WYG A;  4P6V F;  1SE2 A;  1FMA D;  1ZOY B;  1YQ3 B;  2G9H D;  3AE5 B;  1Q10 A;  3ZGZ A;  3RFZ B;  4ZRQ A;  1IGC A;  3Q8E A;  3ZYY X;  2JYE A;  4WAF A;  4N6E B;  2BTE A;  1SF0 A;  1ZXI A;  2Y3A A;  3BZD B;  4A6Q A;  3P1M A;  3R8B A;  4MM3 B;  3AEC B;  1JWB D;  1JML A;  4JWS C;  2QEJ C;  3ZJV A;  1OFF A;  1QOF A;  3W1S A;  1R7S A;  2WXG A;  1YJI A;  2HDE A;  3GS2 A;  1XEE A;  4GLS C;  1ESF A;  4L1B A;  1WWT A;  3AE6 B;  2WXF A;  4M0W A;  3ZJU A;  2BB6 A;  1QOG A;  1ROE A;  4EE2 A;  3I9V 1;  3LYY A;  3Q8F A;  1VZ8 A;  1T6B X;  1C4C A;  4IDI A;  4A55 A;  3SFD B;  1BML C;  2JQR B;  1C79 A;  3N9Y C;  4CQN A;  1QF6 A;  1ZPS A;  1HQR D;  5AUI A;  4US9 A;  1ZXH A;  3SEB A;  2L83 A;  3KWV A;  3IXS A;  2AQ2 B;  2BS3 B;  2M19 A;  4RNA A;  4RGT A;  1C9F A;  4YTP B;  4B0E A;  4WUR A;  1C77 A;  1L5P A;  1FCC C;  3IAS 1;  1CZP A;  1HXY D;  2PLP A;  4RGM A;  4L23 A;  5JXV A;  1STE A;  2H89 B;  1TKY A;  3NVZ A;  3TSS A;  2W3R A;  1JWS D;  1SXT A;  4J3O D;  3AB5 A;  1FRD A;  4JX1 C;  2OHF A;  1XCQ L;  1HEZ E;  1QKZ A;  3VRA B;  4GDK B;  2LMC A;  5BYR A;  4YSZ B;  1FNW A;  1WXQ A;  2SAK A;  1DOY A;  1MI0 A;  3MC0 B;  4LLG M;  1D4B A;  1N61 A;  2CJO A;  1L0Y B;  2N9K A;  5BMG A;  3IAM 1;  1RM6 C;  1TS4 A;  4KKJ A;  1CK1 A;  1GB1 A;  5FR3 A;  1C78 A;  2JU6 X;  3P4S B;  1IBX B;  4P16 A;  1D5M C;  3BK2 A;  1L0V B;  1F2R I;  2PVG C;  1JRO A;  2Y5P A;  3WCQ A;  5TSS A;  1PGB A;  2DLB A;  1QT9 A;  3TEX A;  2INP E;  2EEL A;  3J9C A;  3ABV B;  3TUO A;  3P4P B;  3KWL A;  2DBY A;  4JWU C;  2J53 A;  4YTM B;  3VQI A;  4ZRP A;  1MHX A;  2RDH A;  2V4I B;  3AEA B;  3KLS X;  5BYQ A;  2MEK A;  2BT6 A;  2WXL A;  1MPE A;  3W9C B;  1QOB A;  1TS3 A;  4ARI A;  2QIE B;  3EUB 2;  2M0A A;  5FKA C;  3VRB B;  3MFG A;  1IBX A;  1EWC A;  2PMV A;  2PIA A;  4NJC A;  1J7B A;  4AS1 A;  2WU2 B;  1NYR A;  1T5X D;  1XXG A;  3GB1 A;  3AV8 A;  2N7J A;  3BVM A;  2LHD A;  3E9S A;  1C4A A;  2WDQ B;  3FIL B;  4OZB A;  3OWE B;  1BXT A;  2WXN A;  2IJ0 A;  3Q8A A;  2J52 A;  3VR9 B;  4RCO A;  2MJ3 A;  4XWW A;  1YMH E;  4USA A;  2BS4 B;  1XCT L;  1I4G A;  2EKI A;  4DXG A;  1I4X A;  4HEA 1;  4OHJ A;  2PKO A;  1JQ4 A;  1K53 A;  2ON8 A;  3P63 A;  4MAC A;  3ZJT A;  1F0Z A;  2BS2 B;  2JYT A;  2WLB A;  3MJ5 A;  4C56 C;  1UGJ A;  2KAJ A;  2DYM A;  3B2F A;  1N62 A;  3R2I A;  5D3I B;  2JWU A;  3AMZ A;  1GB4 A;  3PZ7 A;  4JPS A;  2AX5 A;  1UWX A;  3BK1 A;  2N0S B;  2QIL A;  2RPV A;  3AEE B;  4NAW B;  4YSY B;  2FE8 A;  4HRO A;  4A90 A;  3T3O A;  1MHH E;  3B2G A;  2MJE A;  3U4E G;  1SJH D;  3MHZ A;  1C4P A;  5HHD G;  1PUT A;  2KMM A;  1KLU D;  2AQ1 B;  1RWS A;  1SB3 C;  4ZOH C;  2M56 B;  3DWM A;  1D5Z C;  3AN1 A;  1PGA A;  4GDL B;  4DQO C;  1EWY C;  1YN4 A;  3GP7 A;  2ONQ A;  3TEY A;  2W54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...