1XLNA

Crystal structure of oxidized c73s/c85s putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Redox-dependent Structural Reorganization in Putidaredoxin, a Vertebrate-type [2Fe-2S] Ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 23
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlnA00
1L5PA 3P1MA 1JWBD 1JWAD 3DWMA 2PVGC 1SF0A 1TJEA 2MJ3A 4ZHOA 3ABVB 4YTPB 3DWGC 3NVZA 2H88B 1TKGA 1N61A 2WDRB 3EUB2 3CIRB 1E9MA 2LEKA 2WU2B 3AMZA 1VJKA 4P6VF 3ZYYX 1GAQB 3B2FA 1JQ4A 2CJNA 1J7AA 1FXAA 1PDXA 1QLBB 1RM6C 2JQRB 1OQRA 2WS3B 1RFKA 1YQ3B 3ETRA 1J7BA 3FAHA 3HVZA 3NVYA 3AE9B 1GPXA 3AH7A 1N63A 3AM9A 3FC4A 4ZHPA 1SB3C 1FMAD 4ITKA 3B9JA 1FO4A 1FXIA 3W5UB 1V8CA 5H92C 2CJOA 1KFYB 1ZXIA 2WDVB 2E3TA 3L4PA 4N58A 2KAJA 1I7HA 2PKOA 2WDQB 4JX1C 1E0ZA 2PIAA 2DWQA 2W3SA 4HRSA 3CWIA 4YSYB 1FIQA 3AE1B 1B9RA 3AE6B 2K5PA 1XO3A 1QOFA 1PUTA 1VLBA 2G1EA 2KMMA 3KWLA 3LXFA 5C2TB 5AUKA 1QT9A 1VDVA 2W54A 4YTNB 3W5VB 4US8A 3AE8B 1FM0D 3AEGB 2B76B 1A70A 5G5GA 5H8YE 1DOIA 1TYGB 2K22A 2MJDA 1DOXA 5MPOA 4C80A 1JW9D 2H89B 2ACZB 1F0ZA 2EKIA 4YSXB 3HRDD 1E7PB 3P4SB 5AUIA 1DOYA 1FFUA 1FFVA 2WU5B 1XLQA 1XLNA 5EE3A 1J7CA 1OQQA 4N59A 3AE3B 1T3QA 1DGJA 4FXCA 3VRBB 4C7YA 1N62A 1L6UA 2Q5WD 2CU3A 3HUIA 5EE0A 2L52A 2WQYB 3WCQA 1L6VA 1N60A 2DBYA 1L0VB 1SIJA 2QJLA 4JWSC 1WRIA 1AYFA 5GXGB 2WP9B 2W3RA 1ZOYB 1AWDA 1JRPA 1NYRA 3NS1A 3P4RB 3AEEB 3W9CB 1RYJA 2K9XA 4HROA 1FRDA 1WXQA 1V97A 4ZOHC 4YXDB 3B2GA 2BT6A 1N5WA 1E6EB 3AE4B 2FBWB 1IUEA 1N5XA 1UWMA 2N0SB 2Y5CA 3NVWA 2BS2B 5G5HA 3VRAB 3AV8A 1WWTA 4YTMB 1FRRA 3AE2B 1QOBA 1TKEA 3AEAB 2M56B 3AECB 1YJIA 3AE5B 3P4PB 1YJJA 4N6EB 3AEBB 3SR6A 1YQ4B 1OFFA 3AEFB 1EWYC 1TKYA 2JX5A 1CZPA 2PVOD 1QOAA 4JWUC 2BS4B 2WLBA 2MJEA 1JALA 4LTUA 3VR9B 5C3JB 1ROEA 3SFEB 4KX6B 5EE1A 2M19A 3P4QB 2QIEB 3AB5A 1PFDA 5EE9A 1KF6B 2OHFA 4USAA 1QF6A 3NVVA 1RWSA 2AX5A 2L83A 1CJEA 4WQMA 3PO0A 4YT0B 4YSZB 3P63A 1NI3A 3RPFC 3NRZA 1ZP0B 2HTME 1R7SA 4IDIA 4WWMA 4C7ZA 3AE7B 3AEDB 1WYGA 3VR8B 1WGKA 1KRHA 1JROA 1ZUD2 1NENB 3BIID 3SFDB 1NEKB 2MH7A 3AN1A 4US9A 1XLOA 2W55A 1NVID 1NYQA 1QOGA 3LB8C 4A9AA 1E10A 1XLPA 2BS3B
chains in the Genus database with same CATH superfamily
4NZLB 3UIPB 2INNE 3DHHC 3N1ZC 1R4MI 4A20A 4M00A 2MBEA 1VJKA 1WI0A 3Q3NC 1FXAA 2WS3B 2MP2A 3ETRA 1UD7A 1RFAA 1JMLA 2K6DB 3Q2AC 3DBSA 5HG2A 3LJ3A 1LO5D 4IC7B 1J19A 2KQSA 2N7JA 4BOZB 4N58A 2WNMA 2JU6X 2JWZA 3CWIA 2ZNVC 4EOYA 1JQ4A 4TQ0A 5H8YE 2LVQA 2ONQA 1FFVA 3PT2B 1XLQA 3CSTA 2RMMA 2RD0A 1F1HA 4NNJB 2O2VA 2UU7A 1ZOYB 1JRPA 3DHIC 1ZPSA 3RYTA 1FRDA 4RMAA 2WWZA 3DPDA 4YTMB 3VUWA 1TKEA 3PZ8A 5HI1A 3IT4B 3VUYA 2NPTB 1TKYA 1E8YA 2KJHB 3M95A 5KHOA 3U2SC 4MDKE 1D5XC 4II3B 4L23A 1M94A 2C60A 2M8SA 1L2NA 4HJGE 2MX2A 1WMHA 4RFBA 5IOIA 3QX1A 4XE0A 5I4DA 2HTHA 4HJKA 1IP9A 2MCNB 1RLFA 1QILA 1S3SG 3TBLD 1QLBB 2LI5A 5C3JB 3HVZA 4I6PA 2MSED 1EM7A 3LDZE 4HDOA 1EU3A 3PSEB 4GU2A 2YEPB 2RGFA 1LFDA 3ECIA 5CHWA 3KLSX 1F2RC 4HRSA 5DPSA 4DXGA 3IAS1 1GPXA 3IAM1 5C2TB 5L83A 1FXTB 3SU8X 2WGSA 3AE8B 4NPNA 1E90A 1Z5SB 5GMVA 1JW9D 4JIOU 1NBFC 4DXFA 2EKIA 3UQAA 3ZJVA 3APFA 3A1QB 1D6EC 5BYRA 2O2VB 3ZW3A 2PEAA 2KT7A 1HTQA 3BK2A 2GBKA 3CMMB 2LRUA 2FCSA 1N60A 2Z59B 4KDLB 5GXGB 2W3RA 3IHPC 1C3TA 1RYJA 2WXNA 1V1OA 1FNUA 1V97A 2A4ZA 3TCAA 2Y5CA 2BKRB 3V6EB 1WX9A 4P16A 1JWSD 2QHOA 3R3MA 4OZBA 2G3QB 2JPHA 2Z8LA 1JALA 3H1UA 5D7GA 2MLBA 2JYEA 2Y5PA 2M19A 3DBHB 2L7RA 1WX7A 1WMHB 3VXWA 4G0NB 1MG4A 3QK0A 4HPLB 3AEDB 4D2KA 1UBIA 5AEKB 3JW0X 3BIID 1WR6E 5IN7A 3BYYB 2KK8A 4BZAA 2KX0A 2IO3B 4J3OD 3VH3B 5C1ZA 3GP7A 2BWFA 1E7UA 2YVCA 4FJYA 1GG3A 3DBRB 3RD2A 1HXYD 3FC4A 1FMAD 2KFKA 2BYTA 1V8CA 5FR6A 4WQOB 5D2MB 4IOIE 1ENFA 1PQSA 2W3SA 1TT5B 5L95C 4NJCA 1VDVA 1FEHA 3ZNHB 1DOXA 1C78A 4ACFA 3HRDD 1VR9A 2WXIA 3I3TB 3T3OA 1DGJA 1WM2A 5LLIA 4DHJB 1E5WA 1PGXA 1L0VB 4JWSC 2X38A 2KQ7A 4KGSA 1FCLA 1SJHD 3A9KB 2WHIA 2ZJDA 2N9XA 3RN9C 2MBHA 4AS1A 4PYZA 4O1NA 2KDIA 4ASWC 3WAMA 2IBIB 1WFYA 4G3XB 1QF6A 2L83A 1IYFA 2JF5A 3OAWA 2KDEB 1C4PA 1ZGUB 2ASQA 3NZSA 4RF0A 3DBLI 1XEEA 3ALBA 1ZKHA 1GJZA 1XCQL 2JZPA 3UIOB 3A4RA 3U7ZA 4C4VA 1OQRA 1LGRA 4I6LB 1J7BA 4K7SA 4LNKA 1WH3A 3IG3A 1FO4A 2K8HA 4A8XC 3BZDB 2IDYA 4P7IA 5AZGA 3BYTB 4MACA 4RF1A 2AWTA 2G1EA 4RM8A 3H7PA 4M02A 4HKZE 4EKUA 3DVGX 2DAFA 2QSDA 2ACZB 4HCNB 2DENB 2DZKA 2X8XX 1J7CA 1V80A 3I57A 1OQYA 1WM3A 4WH4A 4DHZB 3ZUNA 2GBRA 2DYBA 2V4IB 3MP9A 3N9YC 4YWGG 1ISNA 2INPE 3AE4B 4GMVA 3IXSA 3J9CA 2WXGA 1JRUA 2M56B 2D3BA 5D6JB 3IBEA 1WGYA 1BT0A 2KMCA 2MJEA 3DVGY 4BVUC 2IZVB 2JYTA 3HM3A 4AJYB 3KYDD 2OHFA 2MA9B 2AL6A 1HZ5A 2V3SA 3ZNZB 4WWMA 3U4EG 3TEWA 2OJRA 4TKNA 3AN1A 1QOGA 4NAWB 4A9AA 2BS3B 1WGRA 2LGSA 4MJSB 4NQLB 4W9HA 4DK5A 2XK5A 2WXRA 3APCA 2MJ3A 1GC6A 2BBCA 1SJED 2J52A 3O65B 2KHWB 4II2B 1GAQB 3A33B 1RM6C 1RFKA 3R2IA 4ANVA 3AM9A 2RDBC 1HZ6A 5FK9C 2KAJA 2KYWA 4W9LA 2KQ4X 2KWCA 2KD0A 2KZRA 1YNTE 1C9FA 1PGBA 4K3BA 4W9GA 1I4QA 3ZDMC 5E6OA 3ZRCA 3NZUA 4YTNB 2BQQA 4I6NB 1DOIA 1TYGB 2LUMA 3M3JA 4G11A 3SD5A 2W82A 4MSMB 5J2RA 3RFZB 2L76A 2FNJB 3OWEB 3Q3FA 1MJDA 2QJLA 4DWFA 3KYCD 1WE7A 1UWXA 1ET6A 3P4RB 2FUG1 3JVZX 5HFYA 1I4HA 3Q8BA 4K1RB 4QAYA 1I4XA 1SIFA 1XD3B 1UUPA 1WR1A 3AV8A 1T0YA 1YOVB 3KWVA 1MHHE 2MHJA 1C76A 2M4NA 4N6EB 4S0RA 3AEFB 4FN2A 4KVGB 3DOWA 2WLBA 3MJ5A 3V6CB 3SHQA 2I1JA 4LDTB 5EDSA 2HTME 2LMCA 1R7SA 2KDFB 3M63B 4ARCA 1WGDA 2JWUA 2JSVX 1NVID 2L8JA 1I4PA 2WXHA 1L5PA 5IA7A 3ZXVA 1WJNA 5BMGA 1UGMA 1CMXB 4XGAB 2KDMA 1HEZE 1WXAA 2ZPYA 1N61A 2WU2B 3B2FA 5DPWA 4MGKE 5TR5A 4WWNA 1ZDVA 1N63A 3ZDTA 1ZXHA 3WANA 1SE4A 1FXIA 3NUHB 3Q8EA 4EFOA 4G50A 2NBWB 1E8ZA 2KVRA 5AUKA 3C8YA 1GUAB 1Q0WB 3GS2A 2BF8B 3EGRA 1F0ZA 3W1YA 4K7WA 1DOYA 4M8MA 2K0PA 4XWTA 4FXCA 4W9KA 2WXLA 3H6NA 2RPVA 1N6ZA 3QCAA 4M0WA 1KLVA 3LYYA 4LNIA 2PE9A 4HROA 3GB1A 5G2NA 4F1SA 2MQJA 2HDEA 2ON8A 2IO2B 2I1KA 3NVWA 4HKQA 3KUZA 1AARA 1F52A 1J8CA 3TEYA 1YQ4B 2QMTA 3MC8A 4JE3B 1OFFA 4CYEA 5LXHA 2V3NA 3PRZA 1QOAA 5BO4B 2KTRA 2KX3A 4IM2A 4PS8A 4RGOS 1WJ4A 3FILA 4YT0B 4KV2A 1ZUD2 3HK0A 5AZHA 1EF1A 2CHWA 4HK2A 3ONSA 1MVKA 3PLVA 2BKFA 4RGNA 3VQIA 1D4BA 3GZNB 1F77A 3KH0A 2NMQA 4OVZA 3N20C 1K53A 2AQ1B 3QHTA 3AMZA 3ZYYX 2J0KA 3ZJTA 3BINA 4ZRPA 1C79A 2C7MB 4DDGD 4K81A 3OG5A 2OOBB 3PREA 2XNAC 1Y56A 4A3OA 2V0GA 4XZ4A 2J7QB 3ZKJC 5JHAA 3KWLA 2MP2B 3WAPA 2RPQA 4FJVB 1HE8A 1YJ1A 5HKHA 1LM8B 2O6VA 3BVMA 4YSXB 2WXOA 2LGXA 1TY0A 4KKJA 2GMIC 1ACCA 1AYFA 4ZRIA 1WGGA 2GBMA 3ENEA 3AEEB 3BVZA 3ZGZA 4WJNA 1ZE3D 2R61A 2MBQA 2MRPA 4IWQA 3NZ3A 2IGGA 2HE7A 2NTTA 1YN5A 2W9NA 3P2BA 2D10A 1WJ6A 4LK0M 1YJJA 5IP4D 1VZ8A 3URYA 2J42A 3EFCA 4A90A 1XF5L 2Y3AA 3P4QB 3KQ4A 4FADA 2HD5B 3PPAA 2NCNA 1K51A 3L10B 4JL9A 1GC7A 3K9OB 1TZOA 2IYDB 2KVZA 4WAFA 2MW5A 4TMAB 2D07B 5FR3A 3ABVB 4ARIA 2H88B 3RZWC 1WE6A 3DBHI 1UH6A 2NVUI 4TV3A 4FBJB 3Q69A 2IY1B 3EA6A 3L17A 4JX1C 2BB5A 3Q6BA 1T0SC 4OVUA 1QOFA 1VLBA 3APDA 2N7DA 1EF5A 4B95A 4US8A 4JLCA 1Q10A 3QA8A 4REZA 4XX5A 4DQOC 2CU1A 4PT5A 3RNEC 2UYZB 3DHGC 3KUCB 2C7NB 2G4DB 3U52E 2PMVA 3ZVVA 1Q5WB 1P98A 3X23A 3DBRI 1EU4A 1H4RA 4ICUA 2WQYB 5E6NA 1TGZB 3V3XA 4MT5A 2MWSB 2Z0DB 3QIJA 1K52A 1WXQA 1XXGA 4ICVA 1MFWA 4M8NA 3M62B 3KW5B 1OGWA 5G5HA 4XWWA 2D3GA 3AEAB 4MH0E 3P4PB 3AEBB 2K39A 4IG7B 1FCCC 2JUOA 5BYSA 1UELA 5BMHA 3PGEA 3R7RA 3AXCA 5EE1A 1WSPA 1P7EA 4B0EA 4EE2A 1WJUA 3NVVA 1YMHE 4JQWC 4WQMA 3P63A 3W2DA 1HTOA 1C77A 2LD9A 2MH7A 5FKAC 4BKTA 1WXSA 2BB6A 1YN3A 1BXTA 2D3CA 1KOTA 1T0RC 1WZ0A 1SGHA 4ZRKA 4PK1A 3EUB2 3CIRB 3I5JC 2CS4A 4HLEA 2FAZA 4EZLA 3DVNV 4IM3A 4YL8A 4GDKA 3E9SA 5BMIA 3ZTDA 2AQ3B 3B9JA 5LNK1 3W5UB 1AN8A 2R2QA 4E74A 1JCKB 2N1VA 2E3TA 2LVOA 1I7HA 3RULA 2WDQB 4IUMB 2BYEA 4BKSD 3LXFA 3VTVA 1D5ZC 1QT9A 3TJPA 5G5GA 4HXDA 5E6PA 2ICIA 2M0XA 1IGDA 2KFKB 3L08A 4M01A 3JSVA 3UI3A 2REXA 3B1LX 3PZDA 2D11A 1SE3A 2LJIA 2KC2A 5EE3A 1OQQA 1WGHA 4N59A 5BYQA 1Z2MA 2Q5WD 3IFWB 3TMPB 1L6VA 1YX5B 2WP9B 2EMTA 1LXDA 2JZZA 2K25A 2TSSA 1GOZA 2BWES 4HEA1 3QARA 1V6EA 2N0SB 1IGCA 1TIFA 3TEZA 3HM6X 4MM3A 1QOBA 4TQ1A 3PRMB 2DHZA 1TS2A 2OEDA 3RCZA 4BFRA 1EWYC 4X57B 2EMSA 3ZRFA 4WWPA 1V9JA 4H2AA 2I38A 2K6QA 2QIEB 1ET9A 4R3DA 4AJWA 4BAXA 4W9JA 2ZW0A 5J18A 1NDDA 1ZP0B 4IKGA 4C7ZA 4EZJA 5HHDG 5TSSA 2RDGA 4MELA 2DZJA 2W55A 1NYQA 1PYWD 4GLSC 4K3CA 2KWDA 3OLMD 3DWMA 1SF0A 3PZ7A 1HA5A 3NVZA 2IGDA 4MGZE 1TKGA 4FA6A 2E6XA 1E9MA 2CHXA 4RM9A 2ZNVB 4GDKB 4RH6A 1OEYA 1YD8U 1C4CA 2PE6B 2JQRB 2GB1A 4E3CA 3AH7A 2JT4B 4ZHPA 4ZRJA 5IO9A 2FCNA 2ZW1A 1P9DU 1FD6A 1L4DB 3L4PA 4AQ7A 2L3ZA 2PKOA 1K8RB 2DWQA 4E71A 3KUDB 1B9RA 3AE6B 1KM7A 1PUTA 3JSVB 4C4VB 4OZCA 2JVCA 2CHZA 2K22A 5CHFA 3ZNID 1V86A 1BMLC 3DCGA 1OTRB 1FPYA 2WU5B 4OW0A 1Y8RC 3ZIMA 1N62A 3EECA 3H7PB 1MG8A 4NJ7A 1SIJA 2V4LA 4LCDE 2CKHB 4FHKA 4GB9A 1ZW7A 3RNBC 4MM3B 2FCQA 1PGAA 2BT6A 2FBWB 1YN4A 3VRAB 3AE2B 4MSQB 2KWUB 1KLUD 1YJIA 3SR6A 2JX5A 2PVOD 1CZPA 3QC8B 4KGTA 1KJTA 1R4NB 3V05A 4MGYE 1D3ZA 1K50A 1T0QC 2QEJC 1PFDA 1VCBA 5EE9A 2NTSA 2ZCCA 3MHZA 2BW2A 3PLUA 2BYFA 1NI3A 3HIZA 3NRZA 4IWPA 4ANUA 3AE7B 3UINB 3BY4B 3BWUD 3IT6B 4BKSA 2N9KA 3ZTCA 2ZVNA 2O6VD 1YX6B 4GIVA 3U8ZA 2WX0A 4DDID 2KO3A 2WDRB 3NJTA 3OJ4B 3GOEA 4RCOA 1LQBA 4CQNA 3QQ8B 5T8IA 1YQ3B 2DX5B 2DYMA 5JXVA 2NS5A 1AW7A 4AOFA 2KWVB 2XK5B 5CHVC 4ITKA 3ZO5B 1V5TA 3V62A 2DAJA 4UDUC 1JWMD 1FNVA 2DNFA 4URKA 2WX1A 2K8BA 2KXJA 3PVLA 2LUEA 3CSFA 2EKEC 3TIXA 2L0TA 4ZRQA 1CQVA 1FM0D 1A70A 2OJWA 2KDBA 3R7QA 3T9LA 1FFUA 2RDHA 2JXTA 2LASA 2V3PA 1E8WA 3PTFC 2LZ6A 2CU3A 2DBYA 2NPTA 4LJOB 1L0YB 4AP4C 1J0GA 3MFGA 3ZNGC 2WXFA 4GGQA 3GE3C 4FJZA 3DQVA 1WXVA 3R2TA 1E6EB 3AULA 1UWMA 4DHJD 2L1AA 1WWTA 2D5GA 2FUHB 4WIPA 4B6WA 1R4MB 2D3AA 1SBBB 1V2YA 3B08A 5AZFA 2XN9C 1RWSA 2FIDA 1TS5A 4IDIA 2LVPA 1WY8A 1WYGA 4KKIA 1JROA 1EUVB 4NY0A 4DXAB 3PV1A 2YEPF 2KLCA 4OZAA 2KN4A 2JZ3B 4YTPB 2LRWA 1XT9B 2JXXA 4GN1A 2J0JA 1QZEA 2GOWA 2C7HA 2N1WA 2J4XA 3Q3OC 4LJPB 5G55A 2GI9A 2K3UA 3ML8A 3AE9B 1V49A 2ZZPB 1X1MA 1MPEA 5J17A 2AL3A 3A1QA 2WDVB 4P1BC 3Q8CA 2KANA 5IKCM 3K9PB 2PPHA 4IW0A 4C00A 2K5PA 3BVGA 1QQRA 2DYOA 2KMMA 1TS3A 1L4ZB 3GZNI 4GSWA 2C9WB 3VDZA 3SDLC 3AEGB 5JZEB 2MEKA 2K1FA 1S1QB 3Q8AA 3QJZA 5MPOA 2H89B 4ANWA 1RRBA 1XLNA 3AE3B 2INCC 1H8CA 1L6UA 3ZJUA 2L52A 5D3DA 3WCQA 1Q1OA 3H8HA 4B0MA 3P42A 4HDQA 3V60A 1WYWB 2VH2A 1NYRA 3NS1A 4JPSA 3W9CB 4HPMB 2WXJA 5CX3A 2KJ6A 2LJ5A 3B2GA 2NR2A 3U30A 4PS3A 1C4AA 3E56A 2JY6A 4LNOA 4M0WB 4LTUA 3MC0B 2ZPNA 1ROEA 3RI7C 1UBQA 4KX6B 2DLBA 2GLSA 3KVFB 4XYCA 2LFIA 3UGBB 3C0RB 3NHEB 3VFKA 3I9V1 2SEBD 1IBXA 2KNBA 2L0FA 2VRRB 5E6JA 1XLPA 2KTRB 4AWJA 5D94A 1JWBD 1JWAD 3PHWB 2K8CA 3ZLZA 1HQRD 3DWGC 3FILB 2KN5A 2PTLA 1L0XB 3QWZB 3RUIB 5CTRC 2FIFA 1WX8A 3S2AA 3IVFA 2FCMA 4HWIB 4HCPB 4GXBA 2VZKD 3NVYA 2PW9A 2QC8A 1I4RA 2IPKD 1EWCA 2ZCBA 2L32A 4L2YA 4S17A 2J53A 2ZVOA 1KFYB 4BOSC 3WALA 2QILA 1P1AA 3PHXB 2WXPA 1UNSA 3DDCB 3W5VB 3VHTC 4BBNF 4C80A 2BVCA 1WF9A 4GDLA 5JHBA 3A9KA 2PLPA 3L16A 3H7SA 3HUIA 2KFJA 2M1MA 4KZCA 3OJ3A 4FLHA 3NY5A 2A5UA 2KMAA 3WIMA 3A9JA 3NS8A 4LNFA 2O6VB 4W9CA 3W1SC 1QKZA 2SAKA 2LGDA 3Q8FA 3EHVA 1IUEA 2INDC 1XQQA 4ZYSA 2WDTB 3B0AA 1FRRA 1TS4A 2KJRA 2R2OA 3H9DA 2JRIB 1V81A 5DPTA 1UF0A 2IJ0A 1IBXB 4LNNA 4RGTA 2N9LA 4B9KA 3AI5A 1BUIC 2GRIA 4N9F4 3FKYA 3TL5A 4US9A 4A55A 1VD2A 3QAQA 3VTWA 4LDTD 3T8MA 4F8CB 1TJEA 2MBBB 2AEHA 2KLGA 1GB4A 2G9HD 1SE9A 2M0AA 3O13A 2NBUA 3ZXRA 2RSUA 2CJNA 4A6QA 3ML9A 2YLMA 3Q3JA 4PS7A 4JGHB 1SB3C 2IO1B 1TBEA 2DZMA 2LHEA 1SEBD 3Q14C 3RNFC 3L13A 1UGJA 1UZXB 1FIQA 4WJPA 1XO3A 3AU5A 2WXKA 4ZDVA 4GDLB 3RMKC 2XEWA 4WWOA 1G6JA 3P4SB 1NI2A 1T3QA 4BKGA 3A9JB 5EE0A 3RNAC 3WAOA 4F7ZA 1RAXA 3A4SC 2KC1A 3R8BA 4TSSA 4IM0A 4W9IA 4W9EA 3N32A 1E0ZA 2G4SA 1GB1A 4NAMA 3DBLB 1SSNA 3AE5B 3WA0A 4DHZE 4DBGA 1M4VA 3Q3MC 2LHDA 5LXIB 2Y5BB 4JWUC 2BS4B 4OHJA 3VR9B 1D5MC 4NAWA 1TZ1A 1P3QU 4CO7A 4WJOA 1T5XD 4MJSA 1I42A 1VRAB 4NQKE 4EZKA 1EO6A 5D3IB 3TSSA 3C19A 5DCNA 3NOBA 4YSZB 3PO0A 1JWUD 3RPFC 2VH1A 4XDCA 1WGKA 1KRHA 3SFDB 1NEKB 3EFUA 1XLOA 2G45B 2L00B 2V1YA 3GE8C 1VZ7A 2BGFA 1ZDXA 2AQ2B 4KSLC 2LGIA 1E7VA 2N7EA 4EEWA 4KIKA 4CHKA 2HJ8A 1TY2A 1PDXA 2GBJA 4WURA 3FAHA 4MH8A 4RNAA 4W9FA 4L1BA 2KOXA 5H92C 2CJOA 2HJ1A 3CF6E 2GBNA 3N3KB 1VZ6A 4YSYB 4Q2JA 2QCZA 3AE1B 4FHJA 3RNGC 2W54A 3RT3B 2B76B 1XCTL 4J6IA 2MJDA 3D32A 4PYUA 3MTNB 1L7YA 2PJHA 1E7PB 3VVWB 3EC8A 2LXAA 2DZIA 3VRBB 4GOCA 1STEA 1WIAA 3MHSD 1AWDA 4A3PA 2ZEQA 1WRDB 3HHMA 4ZOHC 4YXDB 1N5WA 2WXQA 4KZ0A 1U4AA 2BS2B 1KLGD 2C5LC 3TEXA 1V5OA 4ZYNA 4KDIC 4WAAA 2VZKB 3AU4A 1P0RA 4KSKC 1OEYJ 2BYVE 3VTUA 1GNUA 3MC9A 2IO0B 3SFEB 1MI0A 3UF8A 2RR9A 3AB5A 1KF6B 4USAA 2AX5A 2M17A 2FE8A 1SXTA 1C1YB 4XDDA 4WJQA 3RZFA 3TUOA 3V61A 1YIWA 2WYQA 1NENB 4P1CC 2J0MA 3LB8C 1E10A 2AYOB 2IGHA 4K7UA 3U7DA 3P1MA 4MGIE 2V9HA 4KIKB 2B3AA 2PVGC 1V1PA 4ZHOA 1YQBA 2KKCA 4BBNC 1TTNA 3I63C 2LGYA 2LEKA 1R4NI 4OVVA 2MBOA 3T3NA 4P6VF 3N1XC 5JH5C 4FULA 3ZQ4A 1J7AA 2I2YA 4HPPA 2EELA 2WXMA 1WZ3A 3L0WB 2JRHA 2Z0EB 3W1SA 1ZXIA 4XC2A 4ANXA 3VUXA 3L54A 1P7FA 1SE2A 2PIAA 3N30A 4EUTA 2N4FA 1CK1A 3PRPB 4HVBA 3DVNU 3VAWA 2BPSA 1T6BX 1F2RI 4NJ6A 2KACA 4AUQC 2L05A 5AUIA 3MJWA 4KGRA 1DYQA 1FNWA 2NBVB 1KTKA 2KTFA 4C7YA 3BK1A 2N9EB 2BTEA 3N1YC 2XBBC 1WRIA 4RGMA 3SEBA 2CR5A 1I35A 4IWOA 2K9XA 2LXCA 2D2QA 1KH0A 4TUUA 1N5XA 3RNCC 1ESFA 3PS6A 2N9PC 4W9DA 1B1ZA 3AECB 3NG0A 1A5RA 3UQBA 4C56C 3JYUA 1WXMA 4MEMA 1I4GA 5KHQA 1IPGA 2IY0B 1MHXA 1CJEA 5IAAC 1E8XA 2UWQA 3X0WA 3VR8B 2LWPA 3R66C 2QDFA 3VH4B 3HVDA 5DPRA 1V1PB 5C23A 1F9JA 4LLGM
chains in the Genus database with same CATH topology
4NZLB 1JWBD 1JWAD 1YN3A 2INNE 1BXTA 2WXRA 1HQRD 2MJ3A 3DWGC 3FILB 2PTLA 1L0XB 2BBCA 1SJED 3EUB2 3CIRB 2J52A 1VJKA 1GAQB 1FXAA 2WS3B 1RM6C 1RFKA 3ETRA 3R2IA 2VZKD 3NVYA 2PW9A 3AM9A 1JMLA 3E9SA 1I4RA 2IPKD 5BMIA 1EWCA 2AQ3B 3B9JA 1HZ6A 5LNK1 5HG2A 3W5UB 5FK9C 1LO5D 1AN8A 2L32A 4L2YA 2J53A 1KFYB 1JCKB 2N7JA 2E3TA 4N58A 2KAJA 2QILA 1I7HA 2WNMA 2WDQB 2JU6X 2KQ4X 3CWIA 3LXFA 1JQ4A 1YNTE 1C9FA 1PGBA 2WXPA 1UNSA 1D5ZC 1I4QA 1QT9A 4YTNB 3W5VB 5G5GA 4TQ0A 2ICIA 5H8YE 1DOIA 1TYGB 1IGDA 4C80A 2LUMA 3UI3A 2ONQA 2W82A 1FFVA 1XLQA 1SE3A 2LJIA 5EE3A 1OQQA 2RMMA 4N59A 2PLPA 5BYQA 2Q5WD 3HUIA 3RFZB 3OWEB 1L6VA 2QJLA 2WP9B 1UWXA 1ET6A 1ZOYB 1JRPA 3P4RB 1ZPSA 2TSSA 2FUG1 1GOZA 1FRDA 5HFYA 1I4HA 4HEA1 3Q8BA 1QKZA 2SAKA 1I4XA 1UUPA 3Q8FA 1IUEA 2N0SB 1IGCA 4YTMB 4ZYSA 3TEZA 3AV8A 1FRRA 1QOBA 1TKEA 3KWVA 3PZ8A 1MHHE 4TQ1A 1C76A 1TS2A 3IT4B 5HI1A 1TS4A 4N6EB 2OEDA 3AEFB 1EWYC 1TKYA 2WLBA 3MJ5A 3U2SC 1D5XC 4H2AA 2I38A 2QIEB 1ET9A 4R3DA 2IJ0A 4L23A 2ZW0A 1IBXB 4RGTA 2N9LA 1ZP0B 2HTME 2LMCA 1R7SA 4IKGA 4C7ZA 1BUIC 4ARCA 5HHDG 2JWUA 2GRIA 4HJGE 2JSVX 5TSSA 2RDGA 4RFBA 4US9A 4A55A 2W55A 1NVID 1NYQA 1PYWD 4GLSC 1I4PA 2KWDA 4XE0A 2WXHA 1L5PA 5I4DA 3DWMA 5BMGA 1SF0A 3PZ7A 1HA5A 1TJEA 2KDMA 3NVZA 2IGDA 1HEZE 1GB4A 1TKGA 1QILA 1N61A 2E6XA 2G9HD 1E9MA 2WU2B 2M0AA 3B2FA 4GDKB 3O13A 4RH6A 4A6QA 2CJNA 1C4CA 1QLBB 2JQRB 5C3JB 2GB1A 3HVZA 1ZDVA 1EM7A 1N63A 3AH7A 1ZXHA 4ZHPA 1EU3A 1SB3C 1SE4A 1FXIA 2YEPB 2ZW1A 1FD6A 1L4DB 3NUHB 3Q8EA 2LHEA 1SEBD 3L4PA 3KLSX 1F2RC 4AQ7A 2PKOA 2DWQA 4HRSA 1UGJA 4DXGA 1FIQA 1B9RA 3IAS1 3AE6B 1GPXA 1XO3A 3IAM1 1PUTA 5C2TB 2WXKA 4OZCA 5AUKA 3C8YA 4GDLB 3AE8B 2K22A 3GS2A 1JW9D 3EGRA 1F0ZA 4DXFA 2EKIA 1BMLC 3ZJVA 3P4SB 1D6EC 1DOYA 2WU5B 4OW0A 5BYRA 2K0PA 4XWTA 1T3QA 4FXCA 1N62A 3BK2A 5EE0A 2WXLA 1N60A 1SIJA 2RPVA 4M0WA 5GXGB 2W3RA 3LYYA 1RYJA 2WXNA 1V1OA 4HROA 4MM3B 3GB1A 1FNUA 1V97A 2HDEA 3R8BA 1PGAA 2BT6A 2ON8A 4TSSA 4HKQA 3NVWA 1GB1A 2FBWB 1YN4A 3VRAB 2Y5CA 1E0ZA 4P16A 3AE2B 4NAMA 1JWSD 1KLUD 1SSNA 1YJIA 3AE5B 3SR6A 4OZBA 3TEYA 1YQ4B 2QMTA 1M4VA 1OFFA 2Z8LA 4JE3B 2JX5A 2LHDA 1CZPA 2PVOD 2V3NA 1QOAA 4JWUC 2BS4B 4KGTA 4OHJA 1JALA 1D5MC 3VR9B 3V05A 5D7GA 1T5XD 2JYEA 2Y5PA 1K50A 2M19A 1VRAB 4RGOS 2QEJC 1PFDA 5EE9A 5D3IB 2NTSA 3MHZA 3TSSA 4YSZB 2BW2A 3FILA 3PO0A 4YT0B 1JWUD 1NI3A 3RPFC 3NRZA 4XDCA 3AE7B 3AEDB 4D2KA 1WGKA 1KRHA 1ZUD2 3BIID 3SFDB 1NEKB 1XLOA 3BWUD 1MVKA 3IT6B 2N9KA 3BYYB 1VZ7A 4RGNA 3VQIA 1D4BA 1ZDXA 2AQ2B 1F77A 2NMQA 2LGIA 4J3OD 4OVZA 1K53A 2AQ1B 2WDRB 3AMZA 3ZYYX 3ZJTA 3GP7A 4RCOA 1TY2A 1PDXA 4CQNA 5T8IA 1YQ3B 2DYMA 3FAHA 4MH8A 4WURA 5JXVA 4RNAA 1AW7A 1HXYD 3FC4A 4L1BA 1FMAD 4ITKA 4ZRPA 1C79A 2BYTA 4UDUC 1V8CA 5H92C 2CJOA 1JWMD 2XNAC 1FNVA 1Y56A 4IOIE 2V0GA 1ENFA 1VZ6A 2W3SA 4YSYB 4Q2JA 3AE1B 3KWLA 4NJCA 4ZRQA 1VDVA 2W54A 1CQVA 1FEHA 1FM0D 2B76B 1A70A 1XCTL 2MJDA 1DOXA 1C78A 3BVMA 4YSXB 2WXOA 1E7PB 3HRDD 1VR9A 2WXIA 1FFUA 1TY0A 4KKJA 2RDHA 2JXTA 3T3OA 1DGJA 2V3PA 3VRBB 2CU3A 1ACCA 1PGXA 1STEA 1L0VB 2DBYA 2X38A 4JWSC 1L0YB 1AYFA 3MFGA 4KGSA 1AWDA 1FCLA 3AEEB 3BVZA 2WXFA 3ZGZA 1ZE3D 2R61A 1SJHD 3NZ3A 4ZOHC 4YXDB 2IGGA 2NTTA 1YN5A 1N5WA 3R2TA 1E6EB 2WXQA 1UWMA 2BS2B 1KLGD 2L1AA 1WWTA 2D5GA 3TEXA 4AS1A 4LK0M 4WIPA 1YJJA 4O1NA 1SBBB 1VZ8A 2VZKB 3URYA 2J42A 4A90A 1XF5L 3SFEB 2Y3AA 1MI0A 2XN9C 3P4QB 3AB5A 3KQ4A 1KF6B 4USAA 1QF6A 1RWSA 2AX5A 2L83A 2FE8A 1K51A 1SXTA 4XDDA 1TS5A 3TUOA 4IDIA 1WYGA 4KKIA 1JROA 1NENB 3LB8C 1TZOA 1E10A 1C4PA 2IGHA 3P1MA 2YEPF 4WAFA 4TMAB 4RF0A 2PVGC 4OZAA 2KN4A 1V1PA 1XEEA 5FR3A 4ZHOA 3ABVB 4YTPB 4ARIA 1XCQL 2H88B 2JZPA 2LEKA 3T3NA 4P6VF 2J4XA 3ZQ4A 3U7ZA 2GI9A 1J7AA 2K3UA 2I2YA 1OQRA 1J7BA 3AE9B 3Q69A 2EELA 2WXMA 1FO4A 1MPEA 3EA6A 4A8XC 3BZDB 2IDYA 1ZXIA 3W1SA 2WDVB 3Q8CA 3BYTB 4JX1C 4MACA 1P7FA 1SE2A 2PIAA 4RF1A 2BB5A 1CK1A 2K5PA 2G1EA 1QOFA 1QQRA 1VLBA 2DYOA 2KMMA 1TS3A 3BVGA 1L4ZB 4HKZE 4US8A 3AEGB 1Q10A 1T6BX 2MEKA 1F2RI 4REZA 2QSDA 4DQOC 3Q8AA 5MPOA 4PT5A 2KACA 2H89B 2ACZB 5AUIA 4KGRA 3U52E 1DYQA 2PMVA 1FNWA 1XLNA 1J7CA 3AE3B 1KTKA 1EU4A 4C7YA 1L6UA 3BK1A 3I57A 3ZJUA 2L52A 2WQYB 5D3DA 3WCQA 4WH4A 3H8HA 4B0MA 3P42A 3V3XA 2BTEA 4MT5A 1WRIA 4RGMA 3SEBA 2V4IB 3NS1A 1NYRA 3MP9A 4JPSA 3W9CB 3N9YC 2K9XA 2WXJA 1K52A 1WXQA 1XXGA 4YWGG 3B2GA 1KH0A 2INPE 3AE4B 5G5HA 1N5XA 4XWWA 3IXSA 3J9CA 1ESFA 2WXGA 3AEAB 1C4AA 2M56B 1B1ZA 3AECB 3E56A 3P4PB 3AEBB 4C56C 4LTUA 2MJEA 3MC0B 1FCCC 1ROEA 5BYSA 1I4GA 5BMHA 4KX6B 2JYTA 2DLBA 1WSPA 5EE1A 1P7EA 4B0EA 4EE2A 1MHXA 2OHFA 3NVVA 1YMHE 2LFIA 1CJEA 1HZ5A 4WQMA 3P63A 3W2DA 4WWMA 3U4EG 3VR8B 1C77A 2SEBD 3I9V1 3TEWA 1IBXA 3HVDA 2MH7A 3AN1A 5FKAC 1V1PB 5E6JA 1QOGA 4NAWB 4A9AA 1XLPA 2BB6A 2BS3B 4LLGM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L5P A;  3P1M A;  1JWB D;  1JWA D;  3DWM A;  2PVG C;  1SF0 A;  1TJE A;  2MJ3 A;  4ZHO A;  3ABV B;  4YTP B;  3DWG C;  3NVZ A;  2H88 B;  1TKG A;  1N61 A;  2WDR B;  3EUB 2;  3CIR B;  1E9M A;  2LEK A;  2WU2 B;  3AMZ A;  1VJK A;  4P6V F;  3ZYY X;  1GAQ B;  3B2F A;  1JQ4 A;  2CJN A;  1J7A A;  1FXA A;  1PDX A;  1QLB B;  1RM6 C;  2JQR B;  1OQR A;  2WS3 B;  1RFK A;  1YQ3 B;  3ETR A;  1J7B A;  3FAH A;  3HVZ A;  3NVY A;  3AE9 B;  1GPX A;  3AH7 A;  1N63 A;  3AM9 A;  3FC4 A;  4ZHP A;  1SB3 C;  1FMA D;  4ITK A;  3B9J A;  1FO4 A;  1FXI A;  3W5U B;  1V8C A;  5H92 C;  2CJO A;  1KFY B;  1ZXI A;  2WDV B;  2E3T A;  3L4P A;  4N58 A;  2KAJ A;  1I7H A;  2PKO A;  2WDQ B;  4JX1 C;  1E0Z A;  2PIA A;  2DWQ A;  2W3S A;  4HRS A;  3CWI A;  4YSY B;  1FIQ A;  3AE1 B;  1B9R A;  3AE6 B;  2K5P A;  1XO3 A;  1QOF A;  1PUT A;  1VLB A;  2G1E A;  2KMM A;  3KWL A;  3LXF A;  5C2T B;  5AUK A;  1QT9 A;  1VDV A;  2W54 A;  4YTN B;  3W5V B;  4US8 A;  3AE8 B;  1FM0 D;  3AEG B;  2B76 B;  1A70 A;  5G5G A;  5H8Y E;  1DOI A;  1TYG B;  2K22 A;  2MJD A;  1DOX A;  5MPO A;  4C80 A;  1JW9 D;  2H89 B;  2ACZ B;  1F0Z A;  2EKI A;  4YSX B;  3HRD D;  1E7P B;  3P4S B;  5AUI A;  1DOY A;  1FFU A;  1FFV A;  2WU5 B;  1XLQ A;  1XLN A;  5EE3 A;  1J7C A;  1OQQ A;  4N59 A;  3AE3 B;  1T3Q A;  1DGJ A;  4FXC A;  3VRB B;  4C7Y A;  1N62 A;  1L6U A;  2Q5W D;  2CU3 A;  3HUI A;  5EE0 A;  2L52 A;  2WQY B;  3WCQ A;  1L6V A;  1N60 A;  2DBY A;  1L0V B;  1SIJ A;  2QJL A;  4JWS C;  1WRI A;  1AYF A;  5GXG B;  2WP9 B;  2W3R A;  1ZOY B;  1AWD A;  1JRP A;  1NYR A;  3NS1 A;  3P4R B;  3AEE B;  3W9C B;  1RYJ A;  2K9X A;  4HRO A;  1FRD A;  1WXQ A;  1V97 A;  4ZOH C;  4YXD B;  3B2G A;  2BT6 A;  1N5W A;  1E6E B;  3AE4 B;  2FBW B;  1IUE A;  1N5X A;  1UWM A;  2N0S B;  2Y5C A;  3NVW A;  2BS2 B;  5G5H A;  3VRA B;  3AV8 A;  1WWT A;  4YTM B;  1FRR A;  3AE2 B;  1QOB A;  1TKE A;  3AEA B;  2M56 B;  3AEC B;  1YJI A;  3AE5 B;  3P4P B;  1YJJ A;  4N6E B;  3AEB B;  3SR6 A;  1YQ4 B;  1OFF A;  3AEF B;  1EWY C;  1TKY A;  2JX5 A;  1CZP A;  2PVO D;  1QOA A;  4JWU C;  2BS4 B;  2WLB A;  2MJE A;  1JAL A;  4LTU A;  3VR9 B;  5C3J B;  1ROE A;  3SFE B;  4KX6 B;  5EE1 A;  2M19 A;  3P4Q B;  2QIE B;  3AB5 A;  1PFD A;  5EE9 A;  1KF6 B;  2OHF A;  4USA A;  1QF6 A;  3NVV A;  1RWS A;  2AX5 A;  2L83 A;  1CJE A;  4WQM A;  3PO0 A;  4YT0 B;  4YSZ B;  3P63 A;  1NI3 A;  3RPF C;  3NRZ A;  1ZP0 B;  2HTM E;  1R7S A;  4IDI A;  4WWM A;  4C7Z A;  3AE7 B;  3AED B;  1WYG A;  3VR8 B;  1WGK A;  1KRH A;  1JRO A;  1ZUD 2;  1NEN B;  3BII D;  3SFD B;  1NEK B;  2MH7 A;  3AN1 A;  4US9 A;  1XLO A;  2W55 A;  1NVI D;  1NYQ A;  1QOG A;  3LB8 C;  4A9A A;  1E10 A;  1XLP A;  2BS3 B; 
#chains in the Genus database with same CATH topology
 4NZL B;  3UIP B;  2INN E;  3DHH C;  3N1Z C;  1R4M I;  4A20 A;  4M00 A;  2MBE A;  1VJK A;  1WI0 A;  3Q3N C;  1FXA A;  2WS3 B;  2MP2 A;  3ETR A;  1UD7 A;  1RFA A;  1JML A;  2K6D B;  3Q2A C;  3DBS A;  5HG2 A;  3LJ3 A;  1LO5 D;  4IC7 B;  1J19 A;  2KQS A;  2N7J A;  4BOZ B;  4N58 A;  2WNM A;  2JU6 X;  2JWZ A;  3CWI A;  2ZNV C;  4EOY A;  1JQ4 A;  4TQ0 A;  5H8Y E;  2LVQ A;  2ONQ A;  1FFV A;  3PT2 B;  1XLQ A;  3CST A;  2RMM A;  2RD0 A;  1F1H A;  4NNJ B;  2O2V A;  2UU7 A;  1ZOY B;  1JRP A;  3DHI C;  1ZPS A;  3RYT A;  1FRD A;  4RMA A;  2WWZ A;  3DPD A;  4YTM B;  3VUW A;  1TKE A;  3PZ8 A;  5HI1 A;  3IT4 B;  3VUY A;  2NPT B;  1TKY A;  1E8Y A;  2KJH B;  3M95 A;  5KHO A;  3U2S C;  4MDK E;  1D5X C;  4II3 B;  4L23 A;  1M94 A;  2C60 A;  2M8S A;  1L2N A;  4HJG E;  2MX2 A;  1WMH A;  4RFB A;  5IOI A;  3QX1 A;  4XE0 A;  5I4D A;  2HTH A;  4HJK A;  1IP9 A;  2MCN B;  1RLF A;  1QIL A;  1S3S G;  3TBL D;  1QLB B;  2LI5 A;  5C3J B;  3HVZ A;  4I6P A;  2MSE D;  1EM7 A;  3LDZ E;  4HDO A;  1EU3 A;  3PSE B;  4GU2 A;  2YEP B;  2RGF A;  1LFD A;  3ECI A;  5CHW A;  3KLS X;  1F2R C;  4HRS A;  5DPS A;  4DXG A;  3IAS 1;  1GPX A;  3IAM 1;  5C2T B;  5L83 A;  1FXT B;  3SU8 X;  2WGS A;  3AE8 B;  4NPN A;  1E90 A;  1Z5S B;  5GMV A;  1JW9 D;  4JIO U;  1NBF C;  4DXF A;  2EKI A;  3UQA A;  3ZJV A;  3APF A;  3A1Q B;  1D6E C;  5BYR A;  2O2V B;  3ZW3 A;  2PEA A;  2KT7 A;  1HTQ A;  3BK2 A;  2GBK A;  3CMM B;  2LRU A;  2FCS A;  1N60 A;  2Z59 B;  4KDL B;  5GXG B;  2W3R A;  3IHP C;  1C3T A;  1RYJ A;  2WXN A;  1V1O A;  1FNU A;  1V97 A;  2A4Z A;  3TCA A;  2Y5C A;  2BKR B;  3V6E B;  1WX9 A;  4P16 A;  1JWS D;  2QHO A;  3R3M A;  4OZB A;  2G3Q B;  2JPH A;  2Z8L A;  1JAL A;  3H1U A;  5D7G A;  2MLB A;  2JYE A;  2Y5P A;  2M19 A;  3DBH B;  2L7R A;  1WX7 A;  1WMH B;  3VXW A;  4G0N B;  1MG4 A;  3QK0 A;  4HPL B;  3AED B;  4D2K A;  1UBI A;  5AEK B;  3JW0 X;  3BII D;  1WR6 E;  5IN7 A;  3BYY B;  2KK8 A;  4BZA A;  2KX0 A;  2IO3 B;  4J3O D;  3VH3 B;  5C1Z A;  3GP7 A;  2BWF A;  1E7U A;  2YVC A;  4FJY A;  1GG3 A;  3DBR B;  3RD2 A;  1HXY D;  3FC4 A;  1FMA D;  2KFK A;  2BYT A;  1V8C A;  5FR6 A;  4WQO B;  5D2M B;  4IOI E;  1ENF A;  1PQS A;  2W3S A;  1TT5 B;  5L95 C;  4NJC A;  1VDV A;  1FEH A;  3ZNH B;  1DOX A;  1C78 A;  4ACF A;  3HRD D;  1VR9 A;  2WXI A;  3I3T B;  3T3O A;  1DGJ A;  1WM2 A;  5LLI A;  4DHJ B;  1E5W A;  1PGX A;  1L0V B;  4JWS C;  2X38 A;  2KQ7 A;  4KGS A;  1FCL A;  1SJH D;  3A9K B;  2WHI A;  2ZJD A;  2N9X A;  3RN9 C;  2MBH A;  4AS1 A;  4PYZ A;  4O1N A;  2KDI A;  4ASW C;  3WAM A;  2IBI B;  1WFY A;  4G3X B;  1QF6 A;  2L83 A;  1IYF A;  2JF5 A;  3OAW A;  2KDE B;  1C4P A;  1ZGU B;  2ASQ A;  3NZS A;  4RF0 A;  3DBL I;  1XEE A;  3ALB A;  1ZKH A;  1GJZ A;  1XCQ L;  2JZP A;  3UIO B;  3A4R A;  3U7Z A;  4C4V A;  1OQR A;  1LGR A;  4I6L B;  1J7B A;  4K7S A;  4LNK A;  1WH3 A;  3IG3 A;  1FO4 A;  2K8H A;  4A8X C;  3BZD B;  2IDY A;  4P7I A;  5AZG A;  3BYT B;  4MAC A;  4RF1 A;  2AWT A;  2G1E A;  4RM8 A;  3H7P A;  4M02 A;  4HKZ E;  4EKU A;  3DVG X;  2DAF A;  2QSD A;  2ACZ B;  4HCN B;  2DEN B;  2DZK A;  2X8X X;  1J7C A;  1V80 A;  3I57 A;  1OQY A;  1WM3 A;  4WH4 A;  4DHZ B;  3ZUN A;  2GBR A;  2DYB A;  2V4I B;  3MP9 A;  3N9Y C;  4YWG G;  1ISN A;  2INP E;  3AE4 B;  4GMV A;  3IXS A;  3J9C A;  2WXG A;  1JRU A;  2M56 B;  2D3B A;  5D6J B;  3IBE A;  1WGY A;  1BT0 A;  2KMC A;  2MJE A;  3DVG Y;  4BVU C;  2IZV B;  2JYT A;  3HM3 A;  4AJY B;  3KYD D;  2OHF A;  2MA9 B;  2AL6 A;  1HZ5 A;  2V3S A;  3ZNZ B;  4WWM A;  3U4E G;  3TEW A;  2OJR A;  4TKN A;  3AN1 A;  1QOG A;  4NAW B;  4A9A A;  2BS3 B;  1WGR A;  2LGS A;  4MJS B;  4NQL B;  4W9H A;  4DK5 A;  2XK5 A;  2WXR A;  3APC A;  2MJ3 A;  1GC6 A;  2BBC A;  1SJE D;  2J52 A;  3O65 B;  2KHW B;  4II2 B;  1GAQ B;  3A33 B;  1RM6 C;  1RFK A;  3R2I A;  4ANV A;  3AM9 A;  2RDB C;  1HZ6 A;  5FK9 C;  2KAJ A;  2KYW A;  4W9L A;  2KQ4 X;  2KWC A;  2KD0 A;  2KZR A;  1YNT E;  1C9F A;  1PGB A;  4K3B A;  4W9G A;  1I4Q A;  3ZDM C;  5E6O A;  3ZRC A;  3NZU A;  4YTN B;  2BQQ A;  4I6N B;  1DOI A;  1TYG B;  2LUM A;  3M3J A;  4G11 A;  3SD5 A;  2W82 A;  4MSM B;  5J2R A;  3RFZ B;  2L76 A;  2FNJ B;  3OWE B;  3Q3F A;  1MJD A;  2QJL A;  4DWF A;  3KYC D;  1WE7 A;  1UWX A;  1ET6 A;  3P4R B;  2FUG 1;  3JVZ X;  5HFY A;  1I4H A;  3Q8B A;  4K1R B;  4QAY A;  1I4X A;  1SIF A;  1XD3 B;  1UUP A;  1WR1 A;  3AV8 A;  1T0Y A;  1YOV B;  3KWV A;  1MHH E;  2MHJ A;  1C76 A;  2M4N A;  4N6E B;  4S0R A;  3AEF B;  4FN2 A;  4KVG B;  3DOW A;  2WLB A;  3MJ5 A;  3V6C B;  3SHQ A;  2I1J A;  4LDT B;  5EDS A;  2HTM E;  2LMC A;  1R7S A;  2KDF B;  3M63 B;  4ARC A;  1WGD A;  2JWU A;  2JSV X;  1NVI D;  2L8J A;  1I4P A;  2WXH A;  1L5P A;  5IA7 A;  3ZXV A;  1WJN A;  5BMG A;  1UGM A;  1CMX B;  4XGA B;  2KDM A;  1HEZ E;  1WXA A;  2ZPY A;  1N61 A;  2WU2 B;  3B2F A;  5DPW A;  4MGK E;  5TR5 A;  4WWN A;  1ZDV A;  1N63 A;  3ZDT A;  1ZXH A;  3WAN A;  1SE4 A;  1FXI A;  3NUH B;  3Q8E A;  4EFO A;  4G50 A;  2NBW B;  1E8Z A;  2KVR A;  5AUK A;  3C8Y A;  1GUA B;  1Q0W B;  3GS2 A;  2BF8 B;  3EGR A;  1F0Z A;  3W1Y A;  4K7W A;  1DOY A;  4M8M A;  2K0P A;  4XWT A;  4FXC A;  4W9K A;  2WXL A;  3H6N A;  2RPV A;  1N6Z A;  3QCA A;  4M0W A;  1KLV A;  3LYY A;  4LNI A;  2PE9 A;  4HRO A;  3GB1 A;  5G2N A;  4F1S A;  2MQJ A;  2HDE A;  2ON8 A;  2IO2 B;  2I1K A;  3NVW A;  4HKQ A;  3KUZ A;  1AAR A;  1F52 A;  1J8C A;  3TEY A;  1YQ4 B;  2QMT A;  3MC8 A;  4JE3 B;  1OFF A;  4CYE A;  5LXH A;  2V3N A;  3PRZ A;  1QOA A;  5BO4 B;  2KTR A;  2KX3 A;  4IM2 A;  4PS8 A;  4RGO S;  1WJ4 A;  3FIL A;  4YT0 B;  4KV2 A;  1ZUD 2;  3HK0 A;  5AZH A;  1EF1 A;  2CHW A;  4HK2 A;  3ONS A;  1MVK A;  3PLV A;  2BKF A;  4RGN A;  3VQI A;  1D4B A;  3GZN B;  1F77 A;  3KH0 A;  2NMQ A;  4OVZ A;  3N20 C;  1K53 A;  2AQ1 B;  3QHT A;  3AMZ A;  3ZYY X;  2J0K A;  3ZJT A;  3BIN A;  4ZRP A;  1C79 A;  2C7M B;  4DDG D;  4K81 A;  3OG5 A;  2OOB B;  3PRE A;  2XNA C;  1Y56 A;  4A3O A;  2V0G A;  4XZ4 A;  2J7Q B;  3ZKJ C;  5JHA A;  3KWL A;  2MP2 B;  3WAP A;  2RPQ A;  4FJV B;  1HE8 A;  1YJ1 A;  5HKH A;  1LM8 B;  2O6V A;  3BVM A;  4YSX B;  2WXO A;  2LGX A;  1TY0 A;  4KKJ A;  2GMI C;  1ACC A;  1AYF A;  4ZRI A;  1WGG A;  2GBM A;  3ENE A;  3AEE B;  3BVZ A;  3ZGZ A;  4WJN A;  1ZE3 D;  2R61 A;  2MBQ A;  2MRP A;  4IWQ A;  3NZ3 A;  2IGG A;  2HE7 A;  2NTT A;  1YN5 A;  2W9N A;  3P2B A;  2D10 A;  1WJ6 A;  4LK0 M;  1YJJ A;  5IP4 D;  1VZ8 A;  3URY A;  2J42 A;  3EFC A;  4A90 A;  1XF5 L;  2Y3A A;  3P4Q B;  3KQ4 A;  4FAD A;  2HD5 B;  3PPA A;  2NCN A;  1K51 A;  3L10 B;  4JL9 A;  1GC7 A;  3K9O B;  1TZO A;  2IYD B;  2KVZ A;  4WAF A;  2MW5 A;  4TMA B;  2D07 B;  5FR3 A;  3ABV B;  4ARI A;  2H88 B;  3RZW C;  1WE6 A;  3DBH I;  1UH6 A;  2NVU I;  4TV3 A;  4FBJ B;  3Q69 A;  2IY1 B;  3EA6 A;  3L17 A;  4JX1 C;  2BB5 A;  3Q6B A;  1T0S C;  4OVU A;  1QOF A;  1VLB A;  3APD A;  2N7D A;  1EF5 A;  4B95 A;  4US8 A;  4JLC A;  1Q10 A;  3QA8 A;  4REZ A;  4XX5 A;  4DQO C;  2CU1 A;  4PT5 A;  3RNE C;  2UYZ B;  3DHG C;  3KUC B;  2C7N B;  2G4D B;  3U52 E;  2PMV A;  3ZVV A;  1Q5W B;  1P98 A;  3X23 A;  3DBR I;  1EU4 A;  1H4R A;  4ICU A;  2WQY B;  5E6N A;  1TGZ B;  3V3X A;  4MT5 A;  2MWS B;  2Z0D B;  3QIJ A;  1K52 A;  1WXQ A;  1XXG A;  4ICV A;  1MFW A;  4M8N A;  3M62 B;  3KW5 B;  1OGW A;  5G5H A;  4XWW A;  2D3G A;  3AEA B;  4MH0 E;  3P4P B;  3AEB B;  2K39 A;  4IG7 B;  1FCC C;  2JUO A;  5BYS A;  1UEL A;  5BMH A;  3PGE A;  3R7R A;  3AXC A;  5EE1 A;  1WSP A;  1P7E A;  4B0E A;  4EE2 A;  1WJU A;  3NVV A;  1YMH E;  4JQW C;  4WQM A;  3P63 A;  3W2D A;  1HTO A;  1C77 A;  2LD9 A;  2MH7 A;  5FKA C;  4BKT A;  1WXS A;  2BB6 A;  1YN3 A;  1BXT A;  2D3C A;  1KOT A;  1T0R C;  1WZ0 A;  1SGH A;  4ZRK A;  4PK1 A;  3EUB 2;  3CIR B;  3I5J C;  2CS4 A;  4HLE A;  2FAZ A;  4EZL A;  3DVN V;  4IM3 A;  4YL8 A;  4GDK A;  3E9S A;  5BMI A;  3ZTD A;  2AQ3 B;  3B9J A;  5LNK 1;  3W5U B;  1AN8 A;  2R2Q A;  4E74 A;  1JCK B;  2N1V A;  2E3T A;  2LVO A;  1I7H A;  3RUL A;  2WDQ B;  4IUM B;  2BYE A;  4BKS D;  3LXF A;  3VTV A;  1D5Z C;  1QT9 A;  3TJP A;  5G5G A;  4HXD A;  5E6P A;  2ICI A;  2M0X A;  1IGD A;  2KFK B;  3L08 A;  4M01 A;  3JSV A;  3UI3 A;  2REX A;  3B1L X;  3PZD A;  2D11 A;  1SE3 A;  2LJI A;  2KC2 A;  5EE3 A;  1OQQ A;  1WGH A;  4N59 A;  5BYQ A;  1Z2M A;  2Q5W D;  3IFW B;  3TMP B;  1L6V A;  1YX5 B;  2WP9 B;  2EMT A;  1LXD A;  2JZZ A;  2K25 A;  2TSS A;  1GOZ A;  2BWE S;  4HEA 1;  3QAR A;  1V6E A;  2N0S B;  1IGC A;  1TIF A;  3TEZ A;  3HM6 X;  4MM3 A;  1QOB A;  4TQ1 A;  3PRM B;  2DHZ A;  1TS2 A;  2OED A;  3RCZ A;  4BFR A;  1EWY C;  4X57 B;  2EMS A;  3ZRF A;  4WWP A;  1V9J A;  4H2A A;  2I38 A;  2K6Q A;  2QIE B;  1ET9 A;  4R3D A;  4AJW A;  4BAX A;  4W9J A;  2ZW0 A;  5J18 A;  1NDD A;  1ZP0 B;  4IKG A;  4C7Z A;  4EZJ A;  5HHD G;  5TSS A;  2RDG A;  4MEL A;  2DZJ A;  2W55 A;  1NYQ A;  1PYW D;  4GLS C;  4K3C A;  2KWD A;  3OLM D;  3DWM A;  1SF0 A;  3PZ7 A;  1HA5 A;  3NVZ A;  2IGD A;  4MGZ E;  1TKG A;  4FA6 A;  2E6X A;  1E9M A;  2CHX A;  4RM9 A;  2ZNV B;  4GDK B;  4RH6 A;  1OEY A;  1YD8 U;  1C4C A;  2PE6 B;  2JQR B;  2GB1 A;  4E3C A;  3AH7 A;  2JT4 B;  4ZHP A;  4ZRJ A;  5IO9 A;  2FCN A;  2ZW1 A;  1P9D U;  1FD6 A;  1L4D B;  3L4P A;  4AQ7 A;  2L3Z A;  2PKO A;  1K8R B;  2DWQ A;  4E71 A;  3KUD B;  1B9R A;  3AE6 B;  1KM7 A;  1PUT A;  3JSV B;  4C4V B;  4OZC A;  2JVC A;  2CHZ A;  2K22 A;  5CHF A;  3ZNI D;  1V86 A;  1BML C;  3DCG A;  1OTR B;  1FPY A;  2WU5 B;  4OW0 A;  1Y8R C;  3ZIM A;  1N62 A;  3EEC A;  3H7P B;  1MG8 A;  4NJ7 A;  1SIJ A;  2V4L A;  4LCD E;  2CKH B;  4FHK A;  4GB9 A;  1ZW7 A;  3RNB C;  4MM3 B;  2FCQ A;  1PGA A;  2BT6 A;  2FBW B;  1YN4 A;  3VRA B;  3AE2 B;  4MSQ B;  2KWU B;  1KLU D;  1YJI A;  3SR6 A;  2JX5 A;  2PVO D;  1CZP A;  3QC8 B;  4KGT A;  1KJT A;  1R4N B;  3V05 A;  4MGY E;  1D3Z A;  1K50 A;  1T0Q C;  2QEJ C;  1PFD A;  1VCB A;  5EE9 A;  2NTS A;  2ZCC A;  3MHZ A;  2BW2 A;  3PLU A;  2BYF A;  1NI3 A;  3HIZ A;  3NRZ A;  4IWP A;  4ANU A;  3AE7 B;  3UIN B;  3BY4 B;  3BWU D;  3IT6 B;  4BKS A;  2N9K A;  3ZTC A;  2ZVN A;  2O6V D;  1YX6 B;  4GIV A;  3U8Z A;  2WX0 A;  4DDI D;  2KO3 A;  2WDR B;  3NJT A;  3OJ4 B;  3GOE A;  4RCO A;  1LQB A;  4CQN A;  3QQ8 B;  5T8I A;  1YQ3 B;  2DX5 B;  2DYM A;  5JXV A;  2NS5 A;  1AW7 A;  4AOF A;  2KWV B;  2XK5 B;  5CHV C;  4ITK A;  3ZO5 B;  1V5T A;  3V62 A;  2DAJ A;  4UDU C;  1JWM D;  1FNV A;  2DNF A;  4URK A;  2WX1 A;  2K8B A;  2KXJ A;  3PVL A;  2LUE A;  3CSF A;  2EKE C;  3TIX A;  2L0T A;  4ZRQ A;  1CQV A;  1FM0 D;  1A70 A;  2OJW A;  2KDB A;  3R7Q A;  3T9L A;  1FFU A;  2RDH A;  2JXT A;  2LAS A;  2V3P A;  1E8W A;  3PTF C;  2LZ6 A;  2CU3 A;  2DBY A;  2NPT A;  4LJO B;  1L0Y B;  4AP4 C;  1J0G A;  3MFG A;  3ZNG C;  2WXF A;  4GGQ A;  3GE3 C;  4FJZ A;  3DQV A;  1WXV A;  3R2T A;  1E6E B;  3AUL A;  1UWM A;  4DHJ D;  2L1A A;  1WWT A;  2D5G A;  2FUH B;  4WIP A;  4B6W A;  1R4M B;  2D3A A;  1SBB B;  1V2Y A;  3B08 A;  5AZF A;  2XN9 C;  1RWS A;  2FID A;  1TS5 A;  4IDI A;  2LVP A;  1WY8 A;  1WYG A;  4KKI A;  1JRO A;  1EUV B;  4NY0 A;  4DXA B;  3PV1 A;  2YEP F;  2KLC A;  4OZA A;  2KN4 A;  2JZ3 B;  4YTP B;  2LRW A;  1XT9 B;  2JXX A;  4GN1 A;  2J0J A;  1QZE A;  2GOW A;  2C7H A;  2N1W A;  2J4X A;  3Q3O C;  4LJP B;  5G55 A;  2GI9 A;  2K3U A;  3ML8 A;  3AE9 B;  1V49 A;  2ZZP B;  1X1M A;  1MPE A;  5J17 A;  2AL3 A;  3A1Q A;  2WDV B;  4P1B C;  3Q8C A;  2KAN A;  5IKC M;  3K9P B;  2PPH A;  4IW0 A;  4C00 A;  2K5P A;  3BVG A;  1QQR A;  2DYO A;  2KMM A;  1TS3 A;  1L4Z B;  3GZN I;  4GSW A;  2C9W B;  3VDZ A;  3SDL C;  3AEG B;  5JZE B;  2MEK A;  2K1F A;  1S1Q B;  3Q8A A;  3QJZ A;  5MPO A;  2H89 B;  4ANW A;  1RRB A;  1XLN A;  3AE3 B;  2INC C;  1H8C A;  1L6U A;  3ZJU A;  2L52 A;  5D3D A;  3WCQ A;  1Q1O A;  3H8H A;  4B0M A;  3P42 A;  4HDQ A;  3V60 A;  1WYW B;  2VH2 A;  1NYR A;  3NS1 A;  4JPS A;  3W9C B;  4HPM B;  2WXJ A;  5CX3 A;  2KJ6 A;  2LJ5 A;  3B2G A;  2NR2 A;  3U30 A;  4PS3 A;  1C4A A;  3E56 A;  2JY6 A;  4LNO A;  4M0W B;  4LTU A;  3MC0 B;  2ZPN A;  1ROE A;  3RI7 C;  1UBQ A;  4KX6 B;  2DLB A;  2GLS A;  3KVF B;  4XYC A;  2LFI A;  3UGB B;  3C0R B;  3NHE B;  3VFK A;  3I9V 1;  2SEB D;  1IBX A;  2KNB A;  2L0F A;  2VRR B;  5E6J A;  1XLP A;  2KTR B;  4AWJ A;  5D94 A;  1JWB D;  1JWA D;  3PHW B;  2K8C A;  3ZLZ A;  1HQR D;  3DWG C;  3FIL B;  2KN5 A;  2PTL A;  1L0X B;  3QWZ B;  3RUI B;  5CTR C;  2FIF A;  1WX8 A;  3S2A A;  3IVF A;  2FCM A;  4HWI B;  4HCP B;  4GXB A;  2VZK D;  3NVY A;  2PW9 A;  2QC8 A;  1I4R A;  2IPK D;  1EWC A;  2ZCB A;  2L32 A;  4L2Y A;  4S17 A;  2J53 A;  2ZVO A;  1KFY B;  4BOS C;  3WAL A;  2QIL A;  1P1A A;  3PHX B;  2WXP A;  1UNS A;  3DDC B;  3W5V B;  3VHT C;  4BBN F;  4C80 A;  2BVC A;  1WF9 A;  4GDL A;  5JHB A;  3A9K A;  2PLP A;  3L16 A;  3H7S A;  3HUI A;  2KFJ A;  2M1M A;  4KZC A;  3OJ3 A;  4FLH A;  3NY5 A;  2A5U A;  2KMA A;  3WIM A;  3A9J A;  3NS8 A;  4LNF A;  2O6V B;  4W9C A;  3W1S C;  1QKZ A;  2SAK A;  2LGD A;  3Q8F A;  3EHV A;  1IUE A;  2IND C;  1XQQ A;  4ZYS A;  2WDT B;  3B0A A;  1FRR A;  1TS4 A;  2KJR A;  2R2O A;  3H9D A;  2JRI B;  1V81 A;  5DPT A;  1UF0 A;  2IJ0 A;  1IBX B;  4LNN A;  4RGT A;  2N9L A;  4B9K A;  3AI5 A;  1BUI C;  2GRI A;  4N9F 4;  3FKY A;  3TL5 A;  4US9 A;  4A55 A;  1VD2 A;  3QAQ A;  3VTW A;  4LDT D;  3T8M A;  4F8C B;  1TJE A;  2MBB B;  2AEH A;  2KLG A;  1GB4 A;  2G9H D;  1SE9 A;  2M0A A;  3O13 A;  2NBU A;  3ZXR A;  2RSU A;  2CJN A;  4A6Q A;  3ML9 A;  2YLM A;  3Q3J A;  4PS7 A;  4JGH B;  1SB3 C;  2IO1 B;  1TBE A;  2DZM A;  2LHE A;  1SEB D;  3Q14 C;  3RNF C;  3L13 A;  1UGJ A;  1UZX B;  1FIQ A;  4WJP A;  1XO3 A;  3AU5 A;  2WXK A;  4ZDV A;  4GDL B;  3RMK C;  2XEW A;  4WWO A;  1G6J A;  3P4S B;  1NI2 A;  1T3Q A;  4BKG A;  3A9J B;  5EE0 A;  3RNA C;  3WAO A;  4F7Z A;  1RAX A;  3A4S C;  2KC1 A;  3R8B A;  4TSS A;  4IM0 A;  4W9I A;  4W9E A;  3N32 A;  1E0Z A;  2G4S A;  1GB1 A;  4NAM A;  3DBL B;  1SSN A;  3AE5 B;  3WA0 A;  4DHZ E;  4DBG A;  1M4V A;  3Q3M C;  2LHD A;  5LXI B;  2Y5B B;  4JWU C;  2BS4 B;  4OHJ A;  3VR9 B;  1D5M C;  4NAW A;  1TZ1 A;  1P3Q U;  4CO7 A;  4WJO A;  1T5X D;  4MJS A;  1I42 A;  1VRA B;  4NQK E;  4EZK A;  1EO6 A;  5D3I B;  3TSS A;  3C19 A;  5DCN A;  3NOB A;  4YSZ B;  3PO0 A;  1JWU D;  3RPF C;  2VH1 A;  4XDC A;  1WGK A;  1KRH A;  3SFD B;  1NEK B;  3EFU A;  1XLO A;  2G45 B;  2L00 B;  2V1Y A;  3GE8 C;  1VZ7 A;  2BGF A;  1ZDX A;  2AQ2 B;  4KSL C;  2LGI A;  1E7V A;  2N7E A;  4EEW A;  4KIK A;  4CHK A;  2HJ8 A;  1TY2 A;  1PDX A;  2GBJ A;  4WUR A;  3FAH A;  4MH8 A;  4RNA A;  4W9F A;  4L1B A;  2KOX A;  5H92 C;  2CJO A;  2HJ1 A;  3CF6 E;  2GBN A;  3N3K B;  1VZ6 A;  4YSY B;  4Q2J A;  2QCZ A;  3AE1 B;  4FHJ A;  3RNG C;  2W54 A;  3RT3 B;  2B76 B;  1XCT L;  4J6I A;  2MJD A;  3D32 A;  4PYU A;  3MTN B;  1L7Y A;  2PJH A;  1E7P B;  3VVW B;  3EC8 A;  2LXA A;  2DZI A;  3VRB B;  4GOC A;  1STE A;  1WIA A;  3MHS D;  1AWD A;  4A3P A;  2ZEQ A;  1WRD B;  3HHM A;  4ZOH C;  4YXD B;  1N5W A;  2WXQ A;  4KZ0 A;  1U4A A;  2BS2 B;  1KLG D;  2C5L C;  3TEX A;  1V5O A;  4ZYN A;  4KDI C;  4WAA A;  2VZK B;  3AU4 A;  1P0R A;  4KSK C;  1OEY J;  2BYV E;  3VTU A;  1GNU A;  3MC9 A;  2IO0 B;  3SFE B;  1MI0 A;  3UF8 A;  2RR9 A;  3AB5 A;  1KF6 B;  4USA A;  2AX5 A;  2M17 A;  2FE8 A;  1SXT A;  1C1Y B;  4XDD A;  4WJQ A;  3RZF A;  3TUO A;  3V61 A;  1YIW A;  2WYQ A;  1NEN B;  4P1C C;  2J0M A;  3LB8 C;  1E10 A;  2AYO B;  2IGH A;  4K7U A;  3U7D A;  3P1M A;  4MGI E;  2V9H A;  4KIK B;  2B3A A;  2PVG C;  1V1P A;  4ZHO A;  1YQB A;  2KKC A;  4BBN C;  1TTN A;  3I63 C;  2LGY A;  2LEK A;  1R4N I;  4OVV A;  2MBO A;  3T3N A;  4P6V F;  3N1X C;  5JH5 C;  4FUL A;  3ZQ4 A;  1J7A A;  2I2Y A;  4HPP A;  2EEL A;  2WXM A;  1WZ3 A;  3L0W B;  2JRH A;  2Z0E B;  3W1S A;  1ZXI A;  4XC2 A;  4ANX A;  3VUX A;  3L54 A;  1P7F A;  1SE2 A;  2PIA A;  3N30 A;  4EUT A;  2N4F A;  1CK1 A;  3PRP B;  4HVB A;  3DVN U;  3VAW A;  2BPS A;  1T6B X;  1F2R I;  4NJ6 A;  2KAC A;  4AUQ C;  2L05 A;  5AUI A;  3MJW A;  4KGR A;  1DYQ A;  1FNW A;  2NBV B;  1KTK A;  2KTF A;  4C7Y A;  3BK1 A;  2N9E B;  2BTE A;  3N1Y C;  2XBB C;  1WRI A;  4RGM A;  3SEB A;  2CR5 A;  1I35 A;  4IWO A;  2K9X A;  2LXC A;  2D2Q A;  1KH0 A;  4TUU A;  1N5X A;  3RNC C;  1ESF A;  3PS6 A;  2N9P C;  4W9D A;  1B1Z A;  3AEC B;  3NG0 A;  1A5R A;  3UQB A;  4C56 C;  3JYU A;  1WXM A;  4MEM A;  1I4G A;  5KHQ A;  1IPG A;  2IY0 B;  1MHX A;  1CJE A;  5IAA C;  1E8X A;  2UWQ A;  3X0W A;  3VR8 B;  2LWP A;  3R66 C;  2QDF A;  3VH4 B;  3HVD A;  5DPR A;  1V1P B;  5C23 A;  1F9J A;  4LLG M; 
#chains in the Genus database with same CATH homology
 4NZL B;  1JWB D;  1JWA D;  1YN3 A;  2INN E;  1BXT A;  2WXR A;  1HQR D;  2MJ3 A;  3DWG C;  3FIL B;  2PTL A;  1L0X B;  2BBC A;  1SJE D;  3EUB 2;  3CIR B;  2J52 A;  1VJK A;  1GAQ B;  1FXA A;  2WS3 B;  1RM6 C;  1RFK A;  3ETR A;  3R2I A;  2VZK D;  3NVY A;  2PW9 A;  3AM9 A;  1JML A;  3E9S A;  1I4R A;  2IPK D;  5BMI A;  1EWC A;  2AQ3 B;  3B9J A;  1HZ6 A;  5LNK 1;  5HG2 A;  3W5U B;  5FK9 C;  1LO5 D;  1AN8 A;  2L32 A;  4L2Y A;  2J53 A;  1KFY B;  1JCK B;  2N7J A;  2E3T A;  4N58 A;  2KAJ A;  2QIL A;  1I7H A;  2WNM A;  2WDQ B;  2JU6 X;  2KQ4 X;  3CWI A;  3LXF A;  1JQ4 A;  1YNT E;  1C9F A;  1PGB A;  2WXP A;  1UNS A;  1D5Z C;  1I4Q A;  1QT9 A;  4YTN B;  3W5V B;  5G5G A;  4TQ0 A;  2ICI A;  5H8Y E;  1DOI A;  1TYG B;  1IGD A;  4C80 A;  2LUM A;  3UI3 A;  2ONQ A;  2W82 A;  1FFV A;  1XLQ A;  1SE3 A;  2LJI A;  5EE3 A;  1OQQ A;  2RMM A;  4N59 A;  2PLP A;  5BYQ A;  2Q5W D;  3HUI A;  3RFZ B;  3OWE B;  1L6V A;  2QJL A;  2WP9 B;  1UWX A;  1ET6 A;  1ZOY B;  1JRP A;  3P4R B;  1ZPS A;  2TSS A;  2FUG 1;  1GOZ A;  1FRD A;  5HFY A;  1I4H A;  4HEA 1;  3Q8B A;  1QKZ A;  2SAK A;  1I4X A;  1UUP A;  3Q8F A;  1IUE A;  2N0S B;  1IGC A;  4YTM B;  4ZYS A;  3TEZ A;  3AV8 A;  1FRR A;  1QOB A;  1TKE A;  3KWV A;  3PZ8 A;  1MHH E;  4TQ1 A;  1C76 A;  1TS2 A;  3IT4 B;  5HI1 A;  1TS4 A;  4N6E B;  2OED A;  3AEF B;  1EWY C;  1TKY A;  2WLB A;  3MJ5 A;  3U2S C;  1D5X C;  4H2A A;  2I38 A;  2QIE B;  1ET9 A;  4R3D A;  2IJ0 A;  4L23 A;  2ZW0 A;  1IBX B;  4RGT A;  2N9L A;  1ZP0 B;  2HTM E;  2LMC A;  1R7S A;  4IKG A;  4C7Z A;  1BUI C;  4ARC A;  5HHD G;  2JWU A;  2GRI A;  4HJG E;  2JSV X;  5TSS A;  2RDG A;  4RFB A;  4US9 A;  4A55 A;  2W55 A;  1NVI D;  1NYQ A;  1PYW D;  4GLS C;  1I4P A;  2KWD A;  4XE0 A;  2WXH A;  1L5P A;  5I4D A;  3DWM A;  5BMG A;  1SF0 A;  3PZ7 A;  1HA5 A;  1TJE A;  2KDM A;  3NVZ A;  2IGD A;  1HEZ E;  1GB4 A;  1TKG A;  1QIL A;  1N61 A;  2E6X A;  2G9H D;  1E9M A;  2WU2 B;  2M0A A;  3B2F A;  4GDK B;  3O13 A;  4RH6 A;  4A6Q A;  2CJN A;  1C4C A;  1QLB B;  2JQR B;  5C3J B;  2GB1 A;  3HVZ A;  1ZDV A;  1EM7 A;  1N63 A;  3AH7 A;  1ZXH A;  4ZHP A;  1EU3 A;  1SB3 C;  1SE4 A;  1FXI A;  2YEP B;  2ZW1 A;  1FD6 A;  1L4D B;  3NUH B;  3Q8E A;  2LHE A;  1SEB D;  3L4P A;  3KLS X;  1F2R C;  4AQ7 A;  2PKO A;  2DWQ A;  4HRS A;  1UGJ A;  4DXG A;  1FIQ A;  1B9R A;  3IAS 1;  3AE6 B;  1GPX A;  1XO3 A;  3IAM 1;  1PUT A;  5C2T B;  2WXK A;  4OZC A;  5AUK A;  3C8Y A;  4GDL B;  3AE8 B;  2K22 A;  3GS2 A;  1JW9 D;  3EGR A;  1F0Z A;  4DXF A;  2EKI A;  1BML C;  3ZJV A;  3P4S B;  1D6E C;  1DOY A;  2WU5 B;  4OW0 A;  5BYR A;  2K0P A;  4XWT A;  1T3Q A;  4FXC A;  1N62 A;  3BK2 A;  5EE0 A;  2WXL A;  1N60 A;  1SIJ A;  2RPV A;  4M0W A;  5GXG B;  2W3R A;  3LYY A;  1RYJ A;  2WXN A;  1V1O A;  4HRO A;  4MM3 B;  3GB1 A;  1FNU A;  1V97 A;  2HDE A;  3R8B A;  1PGA A;  2BT6 A;  2ON8 A;  4TSS A;  4HKQ A;  3NVW A;  1GB1 A;  2FBW B;  1YN4 A;  3VRA B;  2Y5C A;  1E0Z A;  4P16 A;  3AE2 B;  4NAM A;  1JWS D;  1KLU D;  1SSN A;  1YJI A;  3AE5 B;  3SR6 A;  4OZB A;  3TEY A;  1YQ4 B;  2QMT A;  1M4V A;  1OFF A;  2Z8L A;  4JE3 B;  2JX5 A;  2LHD A;  1CZP A;  2PVO D;  2V3N A;  1QOA A;  4JWU C;  2BS4 B;  4KGT A;  4OHJ A;  1JAL A;  1D5M C;  3VR9 B;  3V05 A;  5D7G A;  1T5X D;  2JYE A;  2Y5P A;  1K50 A;  2M19 A;  1VRA B;  4RGO S;  2QEJ C;  1PFD A;  5EE9 A;  5D3I B;  2NTS A;  3MHZ A;  3TSS A;  4YSZ B;  2BW2 A;  3FIL A;  3PO0 A;  4YT0 B;  1JWU D;  1NI3 A;  3RPF C;  3NRZ A;  4XDC A;  3AE7 B;  3AED B;  4D2K A;  1WGK A;  1KRH A;  1ZUD 2;  3BII D;  3SFD B;  1NEK B;  1XLO A;  3BWU D;  1MVK A;  3IT6 B;  2N9K A;  3BYY B;  1VZ7 A;  4RGN A;  3VQI A;  1D4B A;  1ZDX A;  2AQ2 B;  1F77 A;  2NMQ A;  2LGI A;  4J3O D;  4OVZ A;  1K53 A;  2AQ1 B;  2WDR B;  3AMZ A;  3ZYY X;  3ZJT A;  3GP7 A;  4RCO A;  1TY2 A;  1PDX A;  4CQN A;  5T8I A;  1YQ3 B;  2DYM A;  3FAH A;  4MH8 A;  4WUR A;  5JXV A;  4RNA A;  1AW7 A;  1HXY D;  3FC4 A;  4L1B A;  1FMA D;  4ITK A;  4ZRP A;  1C79 A;  2BYT A;  4UDU C;  1V8C A;  5H92 C;  2CJO A;  1JWM D;  2XNA C;  1FNV A;  1Y56 A;  4IOI E;  2V0G A;  1ENF A;  1VZ6 A;  2W3S A;  4YSY B;  4Q2J A;  3AE1 B;  3KWL A;  4NJC A;  4ZRQ A;  1VDV A;  2W54 A;  1CQV A;  1FEH A;  1FM0 D;  2B76 B;  1A70 A;  1XCT L;  2MJD A;  1DOX A;  1C78 A;  3BVM A;  4YSX B;  2WXO A;  1E7P B;  3HRD D;  1VR9 A;  2WXI A;  1FFU A;  1TY0 A;  4KKJ A;  2RDH A;  2JXT A;  3T3O A;  1DGJ A;  2V3P A;  3VRB B;  2CU3 A;  1ACC A;  1PGX A;  1STE A;  1L0V B;  2DBY A;  2X38 A;  4JWS C;  1L0Y B;  1AYF A;  3MFG A;  4KGS A;  1AWD A;  1FCL A;  3AEE B;  3BVZ A;  2WXF A;  3ZGZ A;  1ZE3 D;  2R61 A;  1SJH D;  3NZ3 A;  4ZOH C;  4YXD B;  2IGG A;  2NTT A;  1YN5 A;  1N5W A;  3R2T A;  1E6E B;  2WXQ A;  1UWM A;  2BS2 B;  1KLG D;  2L1A A;  1WWT A;  2D5G A;  3TEX A;  4AS1 A;  4LK0 M;  4WIP A;  1YJJ A;  4O1N A;  1SBB B;  1VZ8 A;  2VZK B;  3URY A;  2J42 A;  4A90 A;  1XF5 L;  3SFE B;  2Y3A A;  1MI0 A;  2XN9 C;  3P4Q B;  3AB5 A;  3KQ4 A;  1KF6 B;  4USA A;  1QF6 A;  1RWS A;  2AX5 A;  2L83 A;  2FE8 A;  1K51 A;  1SXT A;  4XDD A;  1TS5 A;  3TUO A;  4IDI A;  1WYG A;  4KKI A;  1JRO A;  1NEN B;  3LB8 C;  1TZO A;  1E10 A;  1C4P A;  2IGH A;  3P1M A;  2YEP F;  4WAF A;  4TMA B;  4RF0 A;  2PVG C;  4OZA A;  2KN4 A;  1V1P A;  1XEE A;  5FR3 A;  4ZHO A;  3ABV B;  4YTP B;  4ARI A;  1XCQ L;  2H88 B;  2JZP A;  2LEK A;  3T3N A;  4P6V F;  2J4X A;  3ZQ4 A;  3U7Z A;  2GI9 A;  1J7A A;  2K3U A;  2I2Y A;  1OQR A;  1J7B A;  3AE9 B;  3Q69 A;  2EEL A;  2WXM A;  1FO4 A;  1MPE A;  3EA6 A;  4A8X C;  3BZD B;  2IDY A;  1ZXI A;  3W1S A;  2WDV B;  3Q8C A;  3BYT B;  4JX1 C;  4MAC A;  1P7F A;  1SE2 A;  2PIA A;  4RF1 A;  2BB5 A;  1CK1 A;  2K5P A;  2G1E A;  1QOF A;  1QQR A;  1VLB A;  2DYO A;  2KMM A;  1TS3 A;  3BVG A;  1L4Z B;  4HKZ E;  4US8 A;  3AEG B;  1Q10 A;  1T6B X;  2MEK A;  1F2R I;  4REZ A;  2QSD A;  4DQO C;  3Q8A A;  5MPO A;  4PT5 A;  2KAC A;  2H89 B;  2ACZ B;  5AUI A;  4KGR A;  3U52 E;  1DYQ A;  2PMV A;  1FNW A;  1XLN A;  1J7C A;  3AE3 B;  1KTK A;  1EU4 A;  4C7Y A;  1L6U A;  3BK1 A;  3I57 A;  3ZJU A;  2L52 A;  2WQY B;  5D3D A;  3WCQ A;  4WH4 A;  3H8H A;  4B0M A;  3P42 A;  3V3X A;  2BTE A;  4MT5 A;  1WRI A;  4RGM A;  3SEB A;  2V4I B;  3NS1 A;  1NYR A;  3MP9 A;  4JPS A;  3W9C B;  3N9Y C;  2K9X A;  2WXJ A;  1K52 A;  1WXQ A;  1XXG A;  4YWG G;  3B2G A;  1KH0 A;  2INP E;  3AE4 B;  5G5H A;  1N5X A;  4XWW A;  3IXS A;  3J9C A;  1ESF A;  2WXG A;  3AEA B;  1C4A A;  2M56 B;  1B1Z A;  3AEC B;  3E56 A;  3P4P B;  3AEB B;  4C56 C;  4LTU A;  2MJE A;  3MC0 B;  1FCC C;  1ROE A;  5BYS A;  1I4G A;  5BMH A;  4KX6 B;  2JYT A;  2DLB A;  1WSP A;  5EE1 A;  1P7E A;  4B0E A;  4EE2 A;  1MHX A;  2OHF A;  3NVV A;  1YMH E;  2LFI A;  1CJE A;  1HZ5 A;  4WQM A;  3P63 A;  3W2D A;  4WWM A;  3U4E G;  3VR8 B;  1C77 A;  2SEB D;  3I9V 1;  3TEW A;  1IBX A;  3HVD A;  2MH7 A;  3AN1 A;  5FKA C;  1V1P B;  5E6J A;  1QOG A;  4NAW B;  4A9A A;  1XLP A;  2BB6 A;  2BS3 B;  4LLG M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...