1XLNA

Crystal structure of oxidized c73s/c85s putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-dependent Structural Reorganization in Putidaredoxin, a Vertebrate-type [2Fe-2S] Ferredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Putidaredoxin
total genus 23
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.9.3.2: Transferred entry: 1.7.2.1.
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xlnA00
1QT9A 3AB5A 3AE1B 2QJLA 3P4SB 3P63A 4YTNB 1E7PB 2KAJA 2WQYB 3AV8A 2L83A 4YTPB 2MH7A 2WLBA 1KF6B 3AH7A 1UWMA 3NVVA 1ZUD2 1IUEA 3P4RB 1XLOA 2CU3A 2WU5B 1ROEA 4YT0B 3SFDB 1L6VA 1OQQA 1CJEA 2Y5CA 1E9MA 4HRSA 3AM9A 4LTUA 3AEBB 1N63A 2FBWB 5G5GA 5C3JB 1J7CA 4ITKA 1E10A 1QF6A 3ETRA 3P4QB 1JQ4A 3AEDB 1N5XA 1VDVA 2K22A 3AE2B 3AMZA 1WRIA 1FMAD 2ACZB 2B76B 1T3QA 1PFDA 2HTME 1TKEA 3DWGC 1GAQB 5GXGB 2EKIA 3CWIA 3NVZA 1L0VB 1QLBB 2MJDA 3FAHA 4YXDB 1WWTA 1FRRA 2PIAA 1TYGB 1FFVA 2N0SB 4FXCA 1FIQA 2WU2B 4P6VF 2BT6A 1TKGA 2W3RA 1E6EB 4C80A 1PDXA 1N61A 2W3SA 1TJEA 1KRHA 1SB3C 2K9XA 1DOIA 1FXAA 3SR6A 1JROA 1NYRA 2G1EA 3KWLA 5EE0A 2K5PA 1RWSA 1SF0A 2L52A 5EE3A 4ZHPA 1FXIA 1ZXIA 3AE8B 4C7ZA 1XLNA 2W55A 3W9CB 2JX5A 4HROA 2MJ3A 2WDRB 3B9JA 1CZPA 1XLPA 2KMMA 3NS1A 3HUIA 1VJKA 1E0ZA 2M19A 1JW9D 1JWBD 4US9A 1NI3A 1RM6C 3AE5B 4WWMA 3VR8B 3AEFB 2JQRB 1XLQA 5EE9A 2H88B 1YQ4B 1ZOYB 1KFYB 5AUIA 1A70A 1JRPA 3DWMA 2W54A 4YTMB 1B9RA 5EE1A 3PO0A 1XO3A 3CIRB 1YJJA 2WDVB 4ZOHC 5G5HA 1NYQA 1RYJA 1YJIA 3P4PB 5AUKA 4N59A 5MPOA 2BS4B 1I7HA 2PVOD 3FC4A 1NENB 3L4PA 1JALA 4N58A 3AE9B 3W5VB 1AWDA 1R7SA 4YSZB 1F0ZA 1J7BA 2QIEB 4ZHOA 1WYGA 1TKYA 1FO4A 1RFKA 1V8CA 3AEGB 3AEEB 3NVWA 4WQMA 4JX1C 1L6UA 1WXQA 3VRAB 2CJOA 3VRBB 1FFUA 1WGKA 3W5UB 3ZYYX 1EWYC 1GPXA 3AECB 3WCQA 3B2FA 2LEKA 2PKOA 3HVZA 1PUTA 1VLBA 3B2GA 1JWAD 5H8YE 1ZP0B 1SIJA 2MJEA 3AEAB 3NVYA 3AE6B 3LXFA 1QOBA 3HRDD 2DWQA 1OQRA 2M56B 2AX5A 5H92C 1N5WA 1NVID 4YSYB 4USAA 1QOGA 3ABVB 2OHFA 3RPFC 3AE4B 2BS2B 1J7AA 3BIID 2DBYA 4JWSC 1DOXA 5C2TB 2WP9B 1N60A 2CJNA 3AE3B 4KX6B 4YSXB 2H89B 1V97A 4N6EB 2WS3B 2BS3B 3LB8C 2WDQB 3EUB2 3NRZA 3P1MA 4C7YA 4US8A 1L5PA 1NEKB 1QOAA 3SFEB 4A9AA 2Q5WD 4IDIA 1AYFA 3AN1A 2E3TA 1YQ3B 3VR9B 1DOYA 3AE7B 1FRDA 1DGJA 1N62A 1OFFA 1QOFA 1FM0D 2PVGC 4JWUC
chains in the Genus database with same CATH superfamily
4YTNB 3Q3FA 1STEA 2INNE 3ZVVA 2V3NA 1DYQA 1F1HA 5HG2A 1FD6A 3U7DA 2YEPF 2WU5B 1ROEA 1TZOA 1CJEA 2Y5CA 2KDEB 1SE9A 2VRRB 4TUUA 2GI9A 1UELA 1KTKA 2JXXA 1VRAB 3TSSA 3UINB 4WJNA 1UZXB 4OVZA 1K50A 3NVZA 5BO4B 2BYFA 2FCMA 2VZKD 3N30A 2IJ0A 1FIQA 2L8JA 1NYRA 3L17A 3VDZA 3PZ8A 3NS1A 4S17A 2NVUI 1HXYD 5AUIA 2I1KA 1EU3A 1GNUA 2BGFA 2INDC 3TJPA 4FULA 2RD0A 2O2VA 2KDFB 2KVZA 4N58A 1XCQL 2WXNA 1TKYA 4W9EA 3AEEB 2LVQA 4M8MA 4WQMA 4YWGG 1WGDA 1C78A 1YQBA 4A90A 3W2DA 4IM2A 5G2NA 4WQOB 1MHXA 4RGTA 1P7FA 2LHEA 2EMSA 1F77A 1F2RC 2FAZA 3LB8C 3EUB2 1L5PA 3RN9C 4E71A 1K52A 2E3TA 1YQ3B 2BTEA 1N62A 4W9LA 4EFOA 2MHJA 2NPTB 2L7RA 2QJLA 3MHSD 4YTPB 1UGMA 2MH7A 3JSVB 4FHKA 2NBVB 1XLOA 3PZ7A 4YT0B 1Y8RC 4W9DA 4KGRA 4LTUA 5G5GA 2KTRA 4RM9A 2WNMA 2B76B 1V9JA 2FUHB 1SJHD 2MJDA 3DDCB 1P0RA 3QARA 4AS1A 4FLHA 2J4XA 1KRHA 3H7PB 1FXAA 3GZNB 3KWLA 4H2AA 3T9LA 2IBIB 3W9CB 2G3QB 3A33B 3KQ4A 2KANA 2ZJDA 4ZYNA 1ZDXA 2DZKA 4ZRJA 4ANUA 5EE9A 2H88B 1KFYB 2J42A 2LUEA 4HXDA 1ZDVA 2N9KA 1WZ3A 5EE1A 3VUWA 3CIRB 4ZRPA 3H7PA 2RPVA 5GMVA 1RYJA 1LO5D 4C4VA 2UYZB 3AXCA 2RDGA 4REZA 1R7SA 4ASWC 4FADA 2MX2A 3TUOA 3VUYA 3NVWA 4A6QA 4JX1C 2LVOA 3BVGA 2BYTA 2HTHA 1GPXA 4MH0E 1I42A 2MJEA 4G11A 3Q3MC 3BY4B 3AU5A 1FNUA 2IY0B 1QOGA 1TZ1A 3ABVB 4RFBA 5LXIB 3AE4B 1J7AA 4JWSC 3UQAA 2ZPNA 2PE9A 1N60A 3TMPB 1S1QB 1FNWA 2WS3B 2NR2A 2D2QA 2KQ7A 3BVMA 1AYFA 3AN1A 1BUIC 1SJED 3AE7B 5HHDG 3RNBC 3C19A 3R7QA 2MP2A 4M0WB 2XN9C 5BMGA 4F7ZA 2ZW0A 1R4MI 1L6VA 3O13A 3AM9A 5DPTA 3PHXB 2MWSB 2FIFA 1FMAD 2WXKA 4G0NB 2W3RA 2L0FA 4LDTB 3MTNB 2W3SA 4GLSC 2M0AA 1OGWA 2N7EA 2KDMA 5E6JA 2QSDA 1OEYJ 1WX7A 4AOFA 3Q8EA 3A4RA 4Q2JA 2KMMA 1E0ZA 1VJKA 1E7UA 4IWPA 2JXTA 4AJWA 3Q2AC 5JXVA 2W54A 2HE7A 4XGAB 2MBHA 4MELA 2OEDA 5G5HA 1WY8A 1P98A 3IVFA 1C76A 1BT0A 1AWDA 1SE4A 3B08A 1YMHE 4IOIE 3VXWA 3H1UA 2N9PC 1EF5A 2VH1A 1SE3A 2LXAA 3VRBB 1HA5A 1M94A 3RYTA 3AULA 1ACCA 2ZNVB 1WGHA 1SIJA 4RM8A 2M56B 2QDFA 4DXFA 3ZNZB 3Q8FA 2M4NA 2WXMA 3V05A 4ACFA 1XEEA 3ZO5B 1I4RA 4W9JA 2LGIA 3PLUA 2BQQA 3NOBA 5JHAA 1NEKB 1QOAA 4O1NA 3FILB 2GBNA 3P4SB 2L83A 2RPQA 4JWUC 4ANVA 4X57B 4RNAA 3KUDB 1IUEA 3WAPA 2MQJA 3VFKA 4W9IA 1C1YB 1KJTA 2FBWB 2ZCCA 3EC8A 4ITKA 1WMHB 4RMAA 4WJQA 3ETRA 3X0WA 4RGOS 1WRIA 1TIFA 4XDDA 4YXDB 3X23A 4B0MA 4MT5A 4XYCA 1DOIA 4J3OD 1WZ0A 1XQQA 2WXLA 3ZNID 1KOTA 3GE8C 3QJZA 4BKTA 1SEBD 1VR9A 1T0QC 3AEFB 1C4AA 1GG3A 3ZNHB 3EA6A 3EECA 5HI1A 1FCLA 2DX5B 1B9RA 3BK2A 2NTSA 1EM7A 2V4IB 2CHZA 5D3IB 3PVLA 4C00A 3OAWA 4WWNA 1I4PA 2LJ5A 5EDSA 2C60A 5KHOA 3B2GA 1X1MA 2LD9A 2IDYA 2IO2B 4C4VB 3D32A 3L13A 3H8HA 4USAA 2KOXA 2GBRA 4GDLA 1D5XC 4N9F4 2ZZPB 5TR5A 2BKRB 4R3DA 3DHGC 3P1MA 4NQKE 3MJWA 2SEBD 1R4MB 2KKCA 2LVPA 3T3OA 1IBXA 5MPOA 2KX3A 2BYVE 1KF6B 4OZAA 3PRZA 3PGEA 1ZUD2 4PS8A 3P4RB 3DBLB 3MC0B 1GUAB 2CU3A 3Q3NC 2G45B 3AEDB 1NDDA 3AMZA 1YX5B 2HTME 2JWUA 1GAQB 3UGBB 3J9CA 5CHVC 1OTRB 1FRRA 3I3TB 4P6VF 1WJ6A 2BT6A 1Z5SB 3RI7C 3L54A 4A3PA 3BINA 4CYEA 4XX5A 2C7HA 1LQBA 1JROA 4I6PA 1L2NA 2JVCA 1MG4A 2UWQA 2D11A 5JZEB 2CU1A 2K3UA 3VUXA 1D4BA 4FJZA 4WWMA 3VR8B 5D6JB 2C5LC 2KZRA 4DK5A 1LGRA 2XEWA 2V3SA 2KXJA 3ZDTA 4G50A 2I1JA 4TV3A 2JSVX 4F8CB 1F0ZA 3IXSA 5T8IA 3HVDA 3UF8A 1YJ1A 2KLCA 2MEKA 4AJYB 3PT2B 3DVNU 2LEKA 1UNSA 1UUPA 2N1WA 4ZDVA 2WXGA 3LXFA 4XC2A 5IO9A 3VVWB 1HEZE 2KK8A 3S2AA 2QMTA 2IO1B 4GIVA 1DOXA 5KHQA 2ZCBA 5C2TB 1OQYA 3ZGZA 1C4PA 2H89B 4DQOC 2LGXA 4LK0M 3SHQA 4KDLB 4C7YA 4US8A 2KLGA 1SIFA 2GBKA 3VTVA 5BYRA 3R8BA 3KLSX 3JSVA 1OEYA 3U7ZA 3FKYA 1OFFA 4A20A 2KAJA 1B1ZA 3AH7A 4JPSA 5E6NA 2KTRB 4C56C 4ZRKA 4BBNF 4B9KA 1OQQA 4IUMB 1AARA 1N63A 5C3JB 2GMIC 4URKA 2KVRA 4LLGM 1QF6A 2XK5A 1KLUD 2REXA 1TS5A 5FK9C 3NZ3A 1QILA 1TYGB 1MJDA 4II3B 4FXCA 4C80A 3IFWB 2NMQA 1SB3C 2WWZA 2N7DA 1XT9B 3DVGY 4DDID 1TY2A 5DCNA 2MJ3A 2WDRB 3E56A 4E3CA 1VCBA 2KDIA 1V5OA 4LNIA 3Q3OC 2M19A 4MGKE 2KDBA 5CTRC 1D3ZA 3TEZA 2C7MB 3L0WB 4MGYE 3ZLZA 1NBFC 2WXJA 1JMLA 2DZJA 2KHWB 1A70A 1T0SC 1YX6B 2L32A 1XXGA 4S0RA 2ZVOA 4NY0A 3ZKJC 2QEJC 4MM3A 5AUKA 5L95C 3DQVA 3IBEA 4LJPB 1EO6A 4HEA1 4CQNA 1XD3B 4EKUA 3RNEC 1R4NB 3TEXA 1IGDA 2BPSA 2RR9A 4HJGE 2CJOA 4KV2A 1FFUA 1TGZB 1SBBB 1A5RA 3U8ZA 4M00A 4HLEA 3R66C 3HVZA 5FKAC 2CR5A 2PW9A 2FCSA 3V62A 2N4FA 4KZCA 4IWOA 2J0JA 1C77A 5G55A 2IGHA 3RPFC 3EFUA 3TEYA 2D3BA 2K8HA 4NQLB 3NUHB 3AE3B 4TQ1A 3NRZA 4K7SA 1Y56A 3N32A 2JYEA 4DWFA 1QOFA 1FM0D 4XE0A 1ISNA 3AE1B 3P63A 2IY1B 2LXCA 3QIJA 2NPTA 4NAWB 1T0RC 2N1VA 3M62B 2WX1A 3AEBB 1L7YA 2GOWA 1E5WA 4TKNA 3ZRCA 4GB9A 1WI0A 2BVCA 4WAFA 3ZXVA 1TJEA 2IZVB 1D6EC 2DNFA 4W9GA 4OVVA 3DBLI 4TMAB 3PLVA 3Q8CA 3AE8B 2NS5A 2KQ4X 1U4AA 2RMMA 2EMTA 2MBBB 2FE8A 2DHZA 1PGXA 2RDHA 1YQ4B 1JRPA 2TSSA 1SXTA 1P7EA 4HPMB 1ET6A 2NBUA 5IOIA 3UI3A 2C9WB 3Q8BA 1V86A 3RT3B 1WXAA 3ALBA 2L0TA 4P16A 2PPHA 4RCOA 5C23A 2LASA 3MFGA 2I38A 1QZEA 1Z2MA 4BKSA 4WAAA 3ZYYX 1EWYC 4W9CA 3QWZB 4B6WA 4ICVA 1I4GA 2ZEQA 3K9OB 1P9DU 1E8YA 4K1RB 1MFWA 2WP9B 4KX6B 4M02A 2WDQB 1ENFA 3HM3A 2L00B 3NS8A 4A9AA 4IDIA 5DPSA 1FRDA 3LYYA 3KYDD 1KLGD 4AQ7A 1UWMA 1WMHA 3A1QB 3WAMA 3N1ZC 4K7WA 2QILA 4KIKB 3MC8A 4DXGA 2UU7A 1EUVB 3Q3JA 2DLBA 3KW5B 2KWDA 2IGDA 1L0VB 1HTOA 3WALA 1D5MC 1FFVA 1TKGA 4JGHB 1PDXA 3AI5A 4A3OA 4FHJA 1PYWD 3PPAA 3NY5A 3V3XA 4OW0A 1PGBA 4A55A 1SSNA 1XLPA 2IYDB 2D3AA 4US9A 4BBNC 3AE5B 4IW0A 1TT5B 2DAFA 2BB6A 2WHIA 1C79A 2KC1A 1HZ6A 1UBIA 1FNVA 2IO0B 3B1LX 4BVUC 1WJ4A 3NZUA 3PO0A 3PHWB 2JYTA 3P4PB 4KZ0A 3ECIA 5IKCM 3H9DA 4ZHOA 3AEGB 1SE2A 3RNGC 1I4HA 4W9HA 3AECB 3WCQA 2GBMA 1Q1OA 3RNAC 5H8YE 4D2KA 3VH3B 3AE6B 1RLFA 4RF0A 2R61A 2MSED 1TBEA 4EZJA 3CF6E 1T6BX 5IAAC 1UWXA 3VAWA 1S3SG 2XK5B 1WXSA 3ZTCA 2CJNA 3U2SC 2JF5A 1MVKA 3RD2A 3SFEB 5C1ZA 3JYUA 3DOWA 1F9JA 3SD5A 3PV1A 4RGMA 1EU4A 1QT9A 4BZAA 1WRDB 1IP9A 5DPRA 1K51A 1WXMA 3KH0A 1GC6A 4ZRIA 1VZ6A 2KACA 4XDCA 1UH6A 2AQ3B 2Z8LA 1TKEA 3CWIA 2L05A 3SEBA 3HK0A 2ONQA 4PK1A 1I35A 1WM2A 2LGSA 5EE0A 2LFIA 4LNKA 2FUG1 1KH0A 3N1YC 3OLMD 2BKFA 4IM0A 4IKGA 2RGFA 3ONSA 1BMLC 3PRMB 2C7NB 2HJ8A 3DWMA 3R3MA 4AWJA 3KVFB 2WXRA 2PVOD 2SAKA 4XWTA 2LZ6A 1J7BA 3M63B 4AUQC 1V8CA 3SDLC 1T0YA 3HHMA 4DHJB 3MHZA 2KN4A 1WGKA 2CKHB 4HKQA 2WYQA 1NI2A 3B0AA 1PUTA 1VLBA 4BKSD 3HRDD 5J17A 1V1OA 2AX5A 4HK2A 2OHFA 2KN5A 4MH8A 3BIID 1PGAA 2DBYA 1V5TA 2J53A 2J7QB 1WYWB 1E7VA 2DZMA 3ZTDA 4FBJB 1JWSD 3KWVA 3TBLD 3IHPC 5LLIA 4DDGD 4ANWA 1C3TA 1Q5WB 3AB5A 4MEMA 2XBBC 1CQVA 1JCKB 4FJVB 1MHHE 2G9HD 2EKEC 3EHVA 1UD7A 2L76A 4LJOB 4JIOU 4P1CC 1JQ4A 1VDVA 3AE2B 2ACZB 3MP9A 4HPLB 1GB1A 4WURA 5BMHA 3RULA 2JY6A 2N9XA 2BBCA 4WWPA 2KD0A 2WU2B 2O2VB 4XZ4A 2FNJB 2V9HA 2M0XA 1RAXA 2MP2B 2PLPA 3ZNGC 1WM3A 4P1BC 4MJSB 1QQRA 4C7ZA 1T5XD 4CO7A 3B9JA 1WGYA 4L1BA 1UF0A 1JW9D 1JWBD 1TS4A 3NJTA 2Z0DB 3P2BA 2A4ZA 5CX3A 4IG7B 1Q10A 4B0EA 4NZLB 1I7HA 3FC4A 3TIXA 4YL8A 3DCGA 2AQ2B 5AEKB 4LDTD 2KMCA 3GB1A 3QX1A 4HPPA 4HDQA 4ICUA 2BW2A 5BYQA 3U52E 3N1XC 1IBXB 3AEAB 1WR1A 3N3KB 3VH4B 4OVUA 1GC7A 2LWPA 2KNBA 5H92C 1N5WA 5I4DA 1L4ZB 3ZW3A 4EZLA 4ZRQA 3A9KB 2WXFA 4YSXB 4EOYA 4N6EB 3DVNV 3GS2A 1KM7A 5D3DA 3CSTA 2FIDA 4ANXA 4FJYA 4NAWA 3VR9B 3QK0A 1L0YB 2DENB 4EZKA 4EE2A 1PQSA 1WGGA 3JW0X 2GBJA 2X38A 3GZNI 2Z59B 3NVVA 3CMMB 1FPYA 1WH3A 3EGRA 3ML8A 2JU6X 4LNNA 3DBRB 2B3AA 4ARIA 2RSUA 2KC2A 4WH4A 2NTTA 5D94A 4KIKA 2MA9B 2ZNVC 4EUTA 3KYCD 4MACA 4K7UA 1V49A 2AL3A 2ZVNA 4ZHPA 2R2QA 2M1MA 2W55A 1MI0A 1YN3A 1JWMD 2WXPA 4MGIE 1AN8A 1WFYA 3OG5A 3BYTB 2KWUB 2M17A 2R2OA 3IT4B 1XO3A 2Y5BB 1YJJA 3Q69A 4BOSC 2J0MA 3TCAA 4JQWC 5D7GA 1J8CA 1ZW7A 1V80A 4CHKA 3M95A 5J18A 3QQ8B 4L23A 2LI5A 1FXTB 4KKIA 2ICIA 2PKOA 3NHEB 2YVCA 1G6JA 4AP4C 1OQRA 2CHWA 3P42A 1K8RB 3I5JC 3UQBA 1IYFA 4MGZE 4K3BA 1JWUD 3BWUD 2PE6B 4GDLB 5JHBA 2D5GA 1V97A 2BS3B 3HIZA 1V2YA 2J0KA 1L4DB 2DYBA 3PRPB 1DOYA 2PMVA 4K81A 4GN1A 3VHTC 2WLBA 2KYWA 4K3CA 5D2MB 4OHJA 3SFDB 2DZIA 3PZDA 4HRSA 1GOZA 4MSMB 4W9KA 3V6CB 3VTWA 1N5XA 2K39A 2G4SA 1PFDA 1V6EA 3ZIMA 2JZZA 3DHIC 1RFAA 1QLBB 1UGJA 4L2YA 1WWTA 2GLSA 1R4NI 2M8SA 5FR3A 1V81A 3QCAA 3SR6A 5EE3A 1HQRD 3ML9A 1ZXIA 4DHZB 3O65B 4QAYA 4DHZE 2DYMA 4J6IA 1J19A 3HUIA 1ZGUB 3URYA 1WJUA 4I6NB 2CHXA 2DAJA 3ZUNA 3BZDB 3PSEB 2NCNA 2A5UA 4HCNB 3IAS1 1FCCC 1NYQA 3M3JA 4RF1A 2KFJA 3L10B 2BS4B 5AZFA 1Q0WB 2XNAC 4GU2A 5AZGA 1WGRA 1WYGA 3JVZX 3OWEB 4HJKA 4BFRA 1L6UA 1YIWA 3W5UB 5HFYA 2QC8A 1GB4A 1WX9A 3B2FA 4HKZE 1J0GA 3A9JA 4ZYSA 1ZP0B 3AU4A 4B95A 3NVYA 2DWQA 4M0WA 4ARCA 1F2RI 2AWTA 1CK1A 2KTFA 4PS3A 4HVBA 3RUIB 3R2TA 1E90A 3APDA 2K6QA 2D3CA 2IGGA 3PREA 2O6VD 2ZPYA 2LRWA 5IN7A 4GMVA 4MSQB 4PYZA 1K53A 2BWES 2PVGC 3W1SC 4HDOA 4TQ0A 2I2YA 4EEWA 2AQ1B 2L1AA 1VZ8A 2JPHA 1WX8A 3L16A 1V1PA 2KJRA 1H8CA 3IT6B 1HE8A 2ON8A 4NJ7A 2EKIA 4WJPA 2ZW1A 2YEPB 2PIAA 3LDZE 1N61A 3MC9A 3BYYB 1SF0A 3OJ3A 2QCZA 1EF1A 3ZXRA 2IO3B 2JZPA 3GOEA 1NI3A 1RM6C 1E8WA 2HD5B 5E6OA 3GP7A 1WE6A 1H4RA 4YTMB 1I4XA 4JL9A 1HZ5A 4ZOHC 1YJIA 5L83A 5E6PA 1WJNA 4WJOA 3L4PA 3QA8A 5IP4D 3C0RB 1RFKA 1WXQA 2FCQA 4JLCA 2OJRA 5IA7A 4KGTA 4BOZB 1JWAD 2Y5PA 3WAOA 4OZCA 3CSFA 4BKGA 1ZXHA 3Q14C 2QHOA 2W82A 2BS2B 3NG0A 1GJZA 1C9FA 1XF5L 2INPE 3PS6A 3DHHC 4NNJB 4RH6A 2AYOB 1L0XB 4MM3B 4GXBA 5JH5C 1E7PB 3AV8A 1SGHA 3SU8X 4NPNA 2JWZA 2BYEA 3RNFC 2JRIB 3R2IA 1RRBA 1CMXB 2WX0A 2BB5A 5LXHA 2JT4B 1KLVA 3ZJTA 3APFA 2Z0EB 2K22A 2ASQA 2KQSA 3DWGC 2KT7A 5GXGB 3FAHA 1YOVB 1M4VA 2PEAA 4KSKC 4I6LB 1E6EB 3TEWA 2MBOA 4GGQA 3V60A 4E74A 4P7IA 3QAQA 2KO3A 3I9V1 1XLNA 2JX5A 2GB1A 5AZHA 3T8MA 3Q6BA 2MLBA 3HM6X 3RZWC 2JQRB 1ZOYB 3IAM1 4WIPA 3PTFC 2WDVB 2RDBC 2O6VB 3WA0A 1ET9A 3IG3A 1NENB 2HJ1A 3W5VB 2QIEB 3ZRFA 2D3GA 3RCZA 1IGCA 3VRAB 1WF9A 3E9SA 2KJHB 2KFKA 2MBQA 4F1SA 2MBEA 2N9LA 3RMKC 1TY0A 2OOBB 2WDTB 2L3ZA 2V1YA 2WXHA 4KVGB 3C8YA 3KUZA 4YSYB 2V0GA 2KMAA 4OZBA 2K0PA 3DBSA 4NAMA 2AL6A 2WGSA 4DBGA 4FN2A 3QC8B 1MPEA 4KSLC 2NBWB 1DGJA 5TSSA 1P3QU 4PS7A 2YLMA 2WQYB 2WXOA 3BVZA 4JE3B 2KJ6A 2PJHA 2MCNB 4LNFA 2X8XX 4IC7B 3A9JB 2DYOA 3VTUA 1E10A 2N9EB 1WE7A 2KWCA 2V3PA 1T3QA 1WIAA 3DBHB 3ZQ4A 1ESFA 3ZJVA 2BF8B 1N6ZA 2N0SB 2CS4A 1LXDA 2K9XA 3KUCB 2G1EA 1TS2A 2INCC 3A4SC 1C4CA 1RWSA 2L52A 3V61A 1FEHA 1YNTE 1P1AA 4HROA 4MJSA 1CZPA 1LM8B 4HWIB 3I63C 2HDEA 3VQIA 2J52A 3OJ4B 1XLQA 4MDKE 2G4DB 3GE3C 1ZKHA 2WXIA 4WWOA 2MRPA 2MW5A 4N59A 3FILA 1JALA 4NJ6A 5CHWA 3DVGX 1FO4A 2K25A 2PTLA 3UIOB 2VZKB 1IPGA 4M01A 3U30A 2N7JA 2JRHA 5CHFA 3DPDA 2K6DB 1YN5A 3DBRI 3Q8AA 1YD8U 3T3NA 1QOBA 5HKHA 3I57A 3H6NA 1WXVA 4NJCA 3BK1A 3R7RA 5FR6A 2K8CA 2LUMA 3N20C 2JZ3B 2LJIA 4IWQA 2GRIA 4FA6A 2W9NA 1TS3A 1WR6E 1ZE3D 5DPWA 2Q5WD 2JUOA 1D5ZC 4KDIC 4DHJD 2D10A 3MJ5A 2AEHA 2WXQA 3LJ3A 1V1PB 4LCDE 4GSWA 1ZPSA 1WSPA 2FCNA 1HTQA 4XWWA 4HCPB 1E9MA 1J7CA 3P4QB 1VD2A 3A9KA 4W9FA 4LNOA 3ZDMC 4M8NA 3WIMA 2LGYA 1YN4A 3N9YC 3APCA 1EWCA 1TTNA 2EELA 4UDUC 4KGSA 4GOCA 2K5PA 2KFKB 1FXIA 4II2B 2LMCA 2LGDA 2BWFA 3U4EG 3ZJUA 3RFZB 2OJWA 1VZ7A 4PT5A 3W1SA 3W1YA 2O6VA 4GDKA 1E8XA 4DXAB 1QKZA 2VH2A 4PYUA 3WANA 3K9PB 3A1QA 3TL5A 4RGNA 3AE9B 4YSZB 3NZSA 1F52A 1BXTA 3H7SA 5BYSA 2KWVB 3L08A 3V6EB 4A8XC 2LRUA 1E8ZA 2KX0A 4GDKB 2V4LA 4KKJA 5BMIA 2D07B 1LFDA 3RNCC 2K8BA 1AW7A 4TSSA 2E6XA 2Y3AA 1NVID 3DBHI 1I4QA 4BAXA 4IM3A 1MG8A 3QHTA 1JRUA 2LHDA 3UIPB 1XCTL 5LNK1 3ENEA 2K1FA 3EFCA 5J2RA 4G3XB 1UBQA 3RZFA 2IPKD
chains in the Genus database with same CATH topology
1QT9A 4YTNB 1STEA 2INNE 4TQ0A 2I2YA 1KF6B 1K51A 4OZAA 2V3NA 1DYQA 1ZUD2 3P4RB 5HG2A 1FD6A 2AQ1B 3MC0B 2CU3A 2WU5B 2YEPF 1ROEA 2L1AA 1TZOA 1CJEA 1VZ8A 2Y5CA 1VZ6A 1V1PA 2KACA 4XDCA 2GI9A 2AQ3B 3AEDB 3IT6B 2Z8LA 3AMZA 1KTKA 3TSSA 1VRAB 2ON8A 2HTME 1TKEA 2JWUA 1GAQB 4OVZA 2EKIA 3CWIA 1K50A 3NVZA 3J9CA 3SEBA 2VZKD 2YEPB 1FRRA 2PIAA 2ZW1A 2IJ0A 1FIQA 4P6VF 2BT6A 2ONQA 1N61A 1JROA 1NYRA 3BYYB 5EE0A 2LFIA 1SF0A 2FUG1 1KH0A 3PZ8A 2K3UA 2JZPA 3NS1A 1HXYD 1D4BA 1NI3A 4IKGA 1RM6C 4WWMA 3VR8B 1BMLC 5AUIA 3DWMA 1EU3A 3GP7A 4YTMB 1I4XA 1HZ5A 4ZOHC 1YJIA 2JSVX 2WXRA 2PVOD 2SAKA 4XWTA 3L4PA 4N58A 1F0ZA 3IXSA 1J7BA 1XCQL 2WXNA 5T8IA 3HVDA 1TKYA 1RFKA 1V8CA 3AEEB 2MEKA 4WQMA 4YWGG 1WXQA 3MHZA 2KN4A 1WGKA 1C78A 4HKQA 2LEKA 4KGTA 1UNSA 1UUPA 1PUTA 1VLBA 1JWAD 2Y5PA 4A90A 2WXGA 4OZCA 3LXFA 3HRDD 3W2DA 1HEZE 1V1OA 2AX5A 1ZXHA 2QMTA 1MHXA 2OHFA 2W82A 4RGTA 4MH8A 3BIID 2BS2B 1P7FA 1PGAA 2DBYA 2J53A 1DOXA 5C2TB 2LHEA 3ZGZA 1F77A 1C4PA 1F2RC 2H89B 4DQOC 4LK0M 3LB8C 1C9FA 1XF5L 4C7YA 3EUB2 4US8A 1JWSD 1L5PA 3KWVA 2INPE 5BYRA 3R8BA 1K52A 3KLSX 2E3TA 1YQ3B 3U7ZA 2BTEA 1N62A 1OFFA 4RH6A 1L0XB 4MM3B 3AB5A 2QJLA 1E7PB 2KAJA 3AV8A 1CQVA 4YTPB 1B1ZA 2MH7A 1JCKB 3AH7A 4JPSA 3R2IA 4C56C 1MHHE 1XLOA 2G9HD 3PZ7A 4YT0B 1OQQA 2BB5A 4KGRA 4LTUA 3ZJTA 1N63A 5G5GA 5C3JB 4LLGM 1QF6A 1JQ4A 2WNMA 1VDVA 2K22A 3AE2B 1KLUD 2ACZB 2B76B 3MP9A 3DWGC 5GXGB 1TS5A 4WURA 1GB1A 1SJHD 5FK9C 2MJDA 3FAHA 5BMHA 3NZ3A 1QILA 2BBCA 1TYGB 1M4VA 4FXCA 4AS1A 2WU2B 4C80A 2NMQA 1E6EB 2J4XA 3TEWA 1KRHA 1SB3C 1FXAA 3KWLA 2PLPA 4H2AA 1TY2A 1QQRA 4C7ZA 3I9V1 1XLNA 3W9CB 2JX5A 2MJ3A 1T5XD 2WDRB 3E56A 2GB1A 3B9JA 4L1BA 3KQ4A 2M19A 1JW9D 1JWBD 1TS4A 1ZDXA 3TEZA 2JQRB 2WXJA 1JMLA 2H88B 1ZOYB 5EE9A 1KFYB 2J42A 3IAM1 4WIPA 1A70A 1ZDVA 2N9KA 2L32A 1XXGA 5EE1A 2QEJC 3CIRB 2WDVB 4ZRPA 2RPVA 1RYJA 5AUKA 1LO5D 1Q10A 4B0EA 4NZLB 1I7HA 1ET9A 3FC4A 1NENB 2RDGA 4HEA1 4REZA 1R7SA 3W5VB 4CQNA 2AQ2B 2QIEB 3TUOA 3TEXA 1IGDA 3GB1A 3NVWA 4A6QA 4JX1C 1IGCA 4HJGE 3VRAB 2CJOA 3BVGA 2BYTA 3E9SA 1FFUA 1SBBB 1GPXA 2BW2A 5BYQA 3U52E 2N9LA 3HVZA 5FKAC 2PW9A 1IBXB 2MJEA 3AEAB 1TY0A 5H92C 1N5WA 5I4DA 2WXHA 1L4ZB 3C8YA 4YSYB 1FNUA 1C77A 1QOGA 2IGHA 3ABVB 4RFBA 4ZRQA 2V0GA 3RPFC 3AE4B 3TEYA 1J7AA 4JWSC 2WXFA 4OZBA 2K0PA 3NUHB 1N60A 3AE3B 4NAMA 4YSXB 1FNWA 4N6EB 2WS3B 4TQ1A 3NRZA 3GS2A 5D3DA 1Y56A 3BVMA 1AYFA 2JYEA 1BUIC 3AN1A 3VR9B 1MPEA 1SJED 3AE7B 1QOFA 1DGJA 5HHDG 5TSSA 1L0YB 1FM0D 4XE0A 3AE1B 3P63A 4EE2A 2WQYB 2X38A 5BMGA 2XN9C 2WXOA 3BVZA 3NVVA 4NAWB 4JE3B 2ZW0A 3EGRA 1L6VA 2JU6X 2DYOA 3O13A 3AM9A 3AEBB 4ARIA 1E10A 2V3PA 1FMAD 1T3QA 3ZQ4A 4WH4A 1ESFA 2NTTA 3ZJVA 2WXKA 2N0SB 2W3RA 4WAFA 2W3SA 4GLSC 1TJEA 2M0AA 1D6EC 4MACA 2K9XA 2G1EA 1TS2A 2KDMA 4TMAB 5E6JA 1C4CA 1RWSA 2L52A 4ZHPA 1FEHA 3Q8CA 2QSDA 3AE8B 1YNTE 2W55A 4HROA 1MI0A 1YN3A 3Q8EA 2KQ4X 1CZPA 4Q2JA 2KMMA 2RMMA 1E0ZA 1VJKA 1JWMD 2WXPA 2HDEA 3VQIA 1AN8A 2FE8A 2J52A 1PGXA 2RDHA 1XLQA 1YQ4B 2JXTA 3BYTB 1JRPA 2TSSA 1SXTA 1P7EA 5JXVA 2W54A 2WXIA 1ET6A 3IT4B 1XO3A 3UI3A 1YJJA 3Q69A 3Q8BA 2OEDA 5G5HA 1C76A 4N59A 4P16A 5D7GA 3FILA 4RCOA 1JALA 1AWDA 1SE4A 3MFGA 1YMHE 2I38A 1FO4A 4IOIE 2PTLA 2VZKB 1SE3A 4L23A 3VRBB 1HA5A 2N7JA 3ZYYX 1EWYC 4KKIA 2ICIA 1ACCA 2PKOA 1YN5A 3Q8AA 1SIJA 3T3NA 1QOBA 1OQRA 2M56B 3P42A 1I4GA 3I57A 4DXFA 3Q8FA 1JWUD 3BWUD 4NJCA 2WXMA 3BK1A 4GDLB 3V05A 1XEEA 2WP9B 1I4RA 4KX6B 2D5GA 2LUMA 1V97A 2LGIA 2BS3B 2WDQB 1ENFA 2LJIA 1NEKB 2GRIA 1QOAA 4O1NA 1L4DB 1TS3A 1ZE3D 4A9AA 3FILB 2Q5WD 4IDIA 1D5ZC 1DOYA 1FRDA 3P4SB 2L83A 3MJ5A 2PMVA 2WXQA 4JWUC 1V1PB 3LYYA 1KLGD 2WLBA 4RNAA 4AQ7A 1ZPSA 1UWMA 1WSPA 1IUEA 4OHJA 3SFDB 4XWWA 2QILA 4DXGA 1E9MA 4HRSA 1GOZA 2FBWB 1J7CA 4ITKA 2DLBA 3ETRA 3P4QB 1N5XA 4RGOS 1WRIA 1PFDA 2KWDA 2IGDA 4XDDA 1YN4A 1L0VB 1QLBB 1UGJA 4L2YA 1D5MC 4YXDB 1WWTA 3N9YC 1FFVA 4B0MA 1TKGA 4MT5A 5FR3A 1EWCA 1PDXA 2EELA 4UDUC 1DOIA 4J3OD 3SR6A 4KGSA 2K5PA 1PYWD 5EE3A 1HQRD 1FXIA 1ZXIA 2LMCA 3V3XA 2WXLA 4OW0A 1PGBA 4A55A 2DYMA 1SSNA 1XLPA 3HUIA 1SEBD 3URYA 4US9A 1VR9A 3U4EG 3ZJUA 3AE5B 3RFZB 3AEFB 1C4AA 1VZ7A 2BB6A 4PT5A 1C79A 3W1SA 3BZDB 1HZ6A 3EA6A 1FNVA 5HI1A 1FCLA 3IAS1 1B9RA 3BK2A 3PO0A 1FCCC 1QKZA 2JYTA 2NTSA 1NYQA 1EM7A 3P4PB 4RF1A 2BS4B 2V4IB 2XNAC 4RGNA 3AE9B 5D3IB 4YSZB 4ZHOA 1WYGA 1BXTA 3AEGB 3OWEB 1SE2A 1I4PA 5BYSA 1I4HA 1L6UA 4A8XC 3W5UB 5HFYA 3AECB 3WCQA 1GB4A 3B2FA 4HKZE 4GDKB 4KKJA 3B2GA 4ZYSA 5H8YE 4D2KA 5BMIA 1ZP0B 3NVYA 3AE6B 2IDYA 2DWQA 4RF0A 2R61A 1AW7A 4M0WA 4ARCA 4TSSA 1F2RI 2E6XA 2Y3AA 1NVID 3H8HA 4USAA 1I4QA 1CK1A 1T6BX 1UWXA 1D5XC 3R2TA 2CJNA 3U2SC 2IGGA 2LHDA 4R3DA 3P1MA 1MVKA 2SEBD 1XCTL 3SFEB 5LNK1 3T3OA 1IBXA 2IPKD 1K53A 4RGMA 5MPOA 1EU4A 2PVGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QT9 A;  3AB5 A;  3AE1 B;  2QJL A;  3P4S B;  3P63 A;  4YTN B;  1E7P B;  2KAJ A;  2WQY B;  3AV8 A;  2L83 A;  4YTP B;  2MH7 A;  2WLB A;  1KF6 B;  3AH7 A;  1UWM A;  3NVV A;  1ZUD 2;  1IUE A;  3P4R B;  1XLO A;  2CU3 A;  2WU5 B;  1ROE A;  4YT0 B;  3SFD B;  1L6V A;  1OQQ A;  1CJE A;  2Y5C A;  1E9M A;  4HRS A;  3AM9 A;  4LTU A;  3AEB B;  1N63 A;  2FBW B;  5G5G A;  5C3J B;  1J7C A;  4ITK A;  1E10 A;  1QF6 A;  3ETR A;  3P4Q B;  1JQ4 A;  3AED B;  1N5X A;  1VDV A;  2K22 A;  3AE2 B;  3AMZ A;  1WRI A;  1FMA D;  2ACZ B;  2B76 B;  1T3Q A;  1PFD A;  2HTM E;  1TKE A;  3DWG C;  1GAQ B;  5GXG B;  2EKI A;  3CWI A;  3NVZ A;  1L0V B;  1QLB B;  2MJD A;  3FAH A;  4YXD B;  1WWT A;  1FRR A;  2PIA A;  1TYG B;  1FFV A;  2N0S B;  4FXC A;  1FIQ A;  2WU2 B;  4P6V F;  2BT6 A;  1TKG A;  2W3R A;  1E6E B;  4C80 A;  1PDX A;  1N61 A;  2W3S A;  1TJE A;  1KRH A;  1SB3 C;  2K9X A;  1DOI A;  1FXA A;  3SR6 A;  1JRO A;  1NYR A;  2G1E A;  3KWL A;  5EE0 A;  2K5P A;  1RWS A;  1SF0 A;  2L52 A;  5EE3 A;  4ZHP A;  1FXI A;  1ZXI A;  3AE8 B;  4C7Z A;  1XLN A;  2W55 A;  3W9C B;  2JX5 A;  4HRO A;  2MJ3 A;  2WDR B;  3B9J A;  1CZP A;  1XLP A;  2KMM A;  3NS1 A;  3HUI A;  1VJK A;  1E0Z A;  2M19 A;  1JW9 D;  1JWB D;  4US9 A;  1NI3 A;  1RM6 C;  3AE5 B;  4WWM A;  3VR8 B;  3AEF B;  2JQR B;  1XLQ A;  5EE9 A;  2H88 B;  1YQ4 B;  1ZOY B;  1KFY B;  5AUI A;  1A70 A;  1JRP A;  3DWM A;  2W54 A;  4YTM B;  1B9R A;  5EE1 A;  3PO0 A;  1XO3 A;  3CIR B;  1YJJ A;  2WDV B;  4ZOH C;  5G5H A;  1NYQ A;  1RYJ A;  1YJI A;  3P4P B;  5AUK A;  4N59 A;  5MPO A;  2BS4 B;  1I7H A;  2PVO D;  3FC4 A;  1NEN B;  3L4P A;  1JAL A;  4N58 A;  3AE9 B;  3W5V B;  1AWD A;  1R7S A;  4YSZ B;  1F0Z A;  1J7B A;  2QIE B;  4ZHO A;  1WYG A;  1TKY A;  1FO4 A;  1RFK A;  1V8C A;  3AEG B;  3AEE B;  3NVW A;  4WQM A;  4JX1 C;  1L6U A;  1WXQ A;  3VRA B;  2CJO A;  3VRB B;  1FFU A;  1WGK A;  3W5U B;  3ZYY X;  1EWY C;  1GPX A;  3AEC B;  3WCQ A;  3B2F A;  2LEK A;  2PKO A;  3HVZ A;  1PUT A;  1VLB A;  3B2G A;  1JWA D;  5H8Y E;  1ZP0 B;  1SIJ A;  2MJE A;  3AEA B;  3NVY A;  3AE6 B;  3LXF A;  1QOB A;  3HRD D;  2DWQ A;  1OQR A;  2M56 B;  2AX5 A;  5H92 C;  1N5W A;  1NVI D;  4YSY B;  4USA A;  1QOG A;  3ABV B;  2OHF A;  3RPF C;  3AE4 B;  2BS2 B;  1J7A A;  3BII D;  2DBY A;  4JWS C;  1DOX A;  5C2T B;  2WP9 B;  1N60 A;  2CJN A;  3AE3 B;  4KX6 B;  4YSX B;  2H89 B;  1V97 A;  4N6E B;  2WS3 B;  2BS3 B;  3LB8 C;  2WDQ B;  3EUB 2;  3NRZ A;  3P1M A;  4C7Y A;  4US8 A;  1L5P A;  1NEK B;  1QOA A;  3SFE B;  4A9A A;  2Q5W D;  4IDI A;  1AYF A;  3AN1 A;  2E3T A;  1YQ3 B;  3VR9 B;  1DOY A;  3AE7 B;  1FRD A;  1DGJ A;  1N62 A;  1OFF A;  1QOF A;  1FM0 D;  2PVG C;  4JWU C; 
#chains in the Genus database with same CATH topology
 4YTN B;  3Q3F A;  1STE A;  2INN E;  3ZVV A;  2V3N A;  1DYQ A;  1F1H A;  5HG2 A;  1FD6 A;  3U7D A;  2YEP F;  2WU5 B;  1ROE A;  1TZO A;  1CJE A;  2Y5C A;  2KDE B;  1SE9 A;  2VRR B;  4TUU A;  2GI9 A;  1UEL A;  1KTK A;  2JXX A;  1VRA B;  3TSS A;  3UIN B;  4WJN A;  1UZX B;  4OVZ A;  1K50 A;  3NVZ A;  5BO4 B;  2BYF A;  2FCM A;  2VZK D;  3N30 A;  2IJ0 A;  1FIQ A;  2L8J A;  1NYR A;  3L17 A;  3VDZ A;  3PZ8 A;  3NS1 A;  4S17 A;  2NVU I;  1HXY D;  5AUI A;  2I1K A;  1EU3 A;  1GNU A;  2BGF A;  2IND C;  3TJP A;  4FUL A;  2RD0 A;  2O2V A;  2KDF B;  2KVZ A;  4N58 A;  1XCQ L;  2WXN A;  1TKY A;  4W9E A;  3AEE B;  2LVQ A;  4M8M A;  4WQM A;  4YWG G;  1WGD A;  1C78 A;  1YQB A;  4A90 A;  3W2D A;  4IM2 A;  5G2N A;  4WQO B;  1MHX A;  4RGT A;  1P7F A;  2LHE A;  2EMS A;  1F77 A;  1F2R C;  2FAZ A;  3LB8 C;  3EUB 2;  1L5P A;  3RN9 C;  4E71 A;  1K52 A;  2E3T A;  1YQ3 B;  2BTE A;  1N62 A;  4W9L A;  4EFO A;  2MHJ A;  2NPT B;  2L7R A;  2QJL A;  3MHS D;  4YTP B;  1UGM A;  2MH7 A;  3JSV B;  4FHK A;  2NBV B;  1XLO A;  3PZ7 A;  4YT0 B;  1Y8R C;  4W9D A;  4KGR A;  4LTU A;  5G5G A;  2KTR A;  4RM9 A;  2WNM A;  2B76 B;  1V9J A;  2FUH B;  1SJH D;  2MJD A;  3DDC B;  1P0R A;  3QAR A;  4AS1 A;  4FLH A;  2J4X A;  1KRH A;  3H7P B;  1FXA A;  3GZN B;  3KWL A;  4H2A A;  3T9L A;  2IBI B;  3W9C B;  2G3Q B;  3A33 B;  3KQ4 A;  2KAN A;  2ZJD A;  4ZYN A;  1ZDX A;  2DZK A;  4ZRJ A;  4ANU A;  5EE9 A;  2H88 B;  1KFY B;  2J42 A;  2LUE A;  4HXD A;  1ZDV A;  2N9K A;  1WZ3 A;  5EE1 A;  3VUW A;  3CIR B;  4ZRP A;  3H7P A;  2RPV A;  5GMV A;  1RYJ A;  1LO5 D;  4C4V A;  2UYZ B;  3AXC A;  2RDG A;  4REZ A;  1R7S A;  4ASW C;  4FAD A;  2MX2 A;  3TUO A;  3VUY A;  3NVW A;  4A6Q A;  4JX1 C;  2LVO A;  3BVG A;  2BYT A;  2HTH A;  1GPX A;  4MH0 E;  1I42 A;  2MJE A;  4G11 A;  3Q3M C;  3BY4 B;  3AU5 A;  1FNU A;  2IY0 B;  1QOG A;  1TZ1 A;  3ABV B;  4RFB A;  5LXI B;  3AE4 B;  1J7A A;  4JWS C;  3UQA A;  2ZPN A;  2PE9 A;  1N60 A;  3TMP B;  1S1Q B;  1FNW A;  2WS3 B;  2NR2 A;  2D2Q A;  2KQ7 A;  3BVM A;  1AYF A;  3AN1 A;  1BUI C;  1SJE D;  3AE7 B;  5HHD G;  3RNB C;  3C19 A;  3R7Q A;  2MP2 A;  4M0W B;  2XN9 C;  5BMG A;  4F7Z A;  2ZW0 A;  1R4M I;  1L6V A;  3O13 A;  3AM9 A;  5DPT A;  3PHX B;  2MWS B;  2FIF A;  1FMA D;  2WXK A;  4G0N B;  2W3R A;  2L0F A;  4LDT B;  3MTN B;  2W3S A;  4GLS C;  2M0A A;  1OGW A;  2N7E A;  2KDM A;  5E6J A;  2QSD A;  1OEY J;  1WX7 A;  4AOF A;  3Q8E A;  3A4R A;  4Q2J A;  2KMM A;  1E0Z A;  1VJK A;  1E7U A;  4IWP A;  2JXT A;  4AJW A;  3Q2A C;  5JXV A;  2W54 A;  2HE7 A;  4XGA B;  2MBH A;  4MEL A;  2OED A;  5G5H A;  1WY8 A;  1P98 A;  3IVF A;  1C76 A;  1BT0 A;  1AWD A;  1SE4 A;  3B08 A;  1YMH E;  4IOI E;  3VXW A;  3H1U A;  2N9P C;  1EF5 A;  2VH1 A;  1SE3 A;  2LXA A;  3VRB B;  1HA5 A;  1M94 A;  3RYT A;  3AUL A;  1ACC A;  2ZNV B;  1WGH A;  1SIJ A;  4RM8 A;  2M56 B;  2QDF A;  4DXF A;  3ZNZ B;  3Q8F A;  2M4N A;  2WXM A;  3V05 A;  4ACF A;  1XEE A;  3ZO5 B;  1I4R A;  4W9J A;  2LGI A;  3PLU A;  2BQQ A;  3NOB A;  5JHA A;  1NEK B;  1QOA A;  4O1N A;  3FIL B;  2GBN A;  3P4S B;  2L83 A;  2RPQ A;  4JWU C;  4ANV A;  4X57 B;  4RNA A;  3KUD B;  1IUE A;  3WAP A;  2MQJ A;  3VFK A;  4W9I A;  1C1Y B;  1KJT A;  2FBW B;  2ZCC A;  3EC8 A;  4ITK A;  1WMH B;  4RMA A;  4WJQ A;  3ETR A;  3X0W A;  4RGO S;  1WRI A;  1TIF A;  4XDD A;  4YXD B;  3X23 A;  4B0M A;  4MT5 A;  4XYC A;  1DOI A;  4J3O D;  1WZ0 A;  1XQQ A;  2WXL A;  3ZNI D;  1KOT A;  3GE8 C;  3QJZ A;  4BKT A;  1SEB D;  1VR9 A;  1T0Q C;  3AEF B;  1C4A A;  1GG3 A;  3ZNH B;  3EA6 A;  3EEC A;  5HI1 A;  1FCL A;  2DX5 B;  1B9R A;  3BK2 A;  2NTS A;  1EM7 A;  2V4I B;  2CHZ A;  5D3I B;  3PVL A;  4C00 A;  3OAW A;  4WWN A;  1I4P A;  2LJ5 A;  5EDS A;  2C60 A;  5KHO A;  3B2G A;  1X1M A;  2LD9 A;  2IDY A;  2IO2 B;  4C4V B;  3D32 A;  3L13 A;  3H8H A;  4USA A;  2KOX A;  2GBR A;  4GDL A;  1D5X C;  4N9F 4;  2ZZP B;  5TR5 A;  2BKR B;  4R3D A;  3DHG C;  3P1M A;  4NQK E;  3MJW A;  2SEB D;  1R4M B;  2KKC A;  2LVP A;  3T3O A;  1IBX A;  5MPO A;  2KX3 A;  2BYV E;  1KF6 B;  4OZA A;  3PRZ A;  3PGE A;  1ZUD 2;  4PS8 A;  3P4R B;  3DBL B;  3MC0 B;  1GUA B;  2CU3 A;  3Q3N C;  2G45 B;  3AED B;  1NDD A;  3AMZ A;  1YX5 B;  2HTM E;  2JWU A;  1GAQ B;  3UGB B;  3J9C A;  5CHV C;  1OTR B;  1FRR A;  3I3T B;  4P6V F;  1WJ6 A;  2BT6 A;  1Z5S B;  3RI7 C;  3L54 A;  4A3P A;  3BIN A;  4CYE A;  4XX5 A;  2C7H A;  1LQB A;  1JRO A;  4I6P A;  1L2N A;  2JVC A;  1MG4 A;  2UWQ A;  2D11 A;  5JZE B;  2CU1 A;  2K3U A;  3VUX A;  1D4B A;  4FJZ A;  4WWM A;  3VR8 B;  5D6J B;  2C5L C;  2KZR A;  4DK5 A;  1LGR A;  2XEW A;  2V3S A;  2KXJ A;  3ZDT A;  4G50 A;  2I1J A;  4TV3 A;  2JSV X;  4F8C B;  1F0Z A;  3IXS A;  5T8I A;  3HVD A;  3UF8 A;  1YJ1 A;  2KLC A;  2MEK A;  4AJY B;  3PT2 B;  3DVN U;  2LEK A;  1UNS A;  1UUP A;  2N1W A;  4ZDV A;  2WXG A;  3LXF A;  4XC2 A;  5IO9 A;  3VVW B;  1HEZ E;  2KK8 A;  3S2A A;  2QMT A;  2IO1 B;  4GIV A;  1DOX A;  5KHQ A;  2ZCB A;  5C2T B;  1OQY A;  3ZGZ A;  1C4P A;  2H89 B;  4DQO C;  2LGX A;  4LK0 M;  3SHQ A;  4KDL B;  4C7Y A;  4US8 A;  2KLG A;  1SIF A;  2GBK A;  3VTV A;  5BYR A;  3R8B A;  3KLS X;  3JSV A;  1OEY A;  3U7Z A;  3FKY A;  1OFF A;  4A20 A;  2KAJ A;  1B1Z A;  3AH7 A;  4JPS A;  5E6N A;  2KTR B;  4C56 C;  4ZRK A;  4BBN F;  4B9K A;  1OQQ A;  4IUM B;  1AAR A;  1N63 A;  5C3J B;  2GMI C;  4URK A;  2KVR A;  4LLG M;  1QF6 A;  2XK5 A;  1KLU D;  2REX A;  1TS5 A;  5FK9 C;  3NZ3 A;  1QIL A;  1TYG B;  1MJD A;  4II3 B;  4FXC A;  4C80 A;  3IFW B;  2NMQ A;  1SB3 C;  2WWZ A;  2N7D A;  1XT9 B;  3DVG Y;  4DDI D;  1TY2 A;  5DCN A;  2MJ3 A;  2WDR B;  3E56 A;  4E3C A;  1VCB A;  2KDI A;  1V5O A;  4LNI A;  3Q3O C;  2M19 A;  4MGK E;  2KDB A;  5CTR C;  1D3Z A;  3TEZ A;  2C7M B;  3L0W B;  4MGY E;  3ZLZ A;  1NBF C;  2WXJ A;  1JML A;  2DZJ A;  2KHW B;  1A70 A;  1T0S C;  1YX6 B;  2L32 A;  1XXG A;  4S0R A;  2ZVO A;  4NY0 A;  3ZKJ C;  2QEJ C;  4MM3 A;  5AUK A;  5L95 C;  3DQV A;  3IBE A;  4LJP B;  1EO6 A;  4HEA 1;  4CQN A;  1XD3 B;  4EKU A;  3RNE C;  1R4N B;  3TEX A;  1IGD A;  2BPS A;  2RR9 A;  4HJG E;  2CJO A;  4KV2 A;  1FFU A;  1TGZ B;  1SBB B;  1A5R A;  3U8Z A;  4M00 A;  4HLE A;  3R66 C;  3HVZ A;  5FKA C;  2CR5 A;  2PW9 A;  2FCS A;  3V62 A;  2N4F A;  4KZC A;  4IWO A;  2J0J A;  1C77 A;  5G55 A;  2IGH A;  3RPF C;  3EFU A;  3TEY A;  2D3B A;  2K8H A;  4NQL B;  3NUH B;  3AE3 B;  4TQ1 A;  3NRZ A;  4K7S A;  1Y56 A;  3N32 A;  2JYE A;  4DWF A;  1QOF A;  1FM0 D;  4XE0 A;  1ISN A;  3AE1 B;  3P63 A;  2IY1 B;  2LXC A;  3QIJ A;  2NPT A;  4NAW B;  1T0R C;  2N1V A;  3M62 B;  2WX1 A;  3AEB B;  1L7Y A;  2GOW A;  1E5W A;  4TKN A;  3ZRC A;  4GB9 A;  1WI0 A;  2BVC A;  4WAF A;  3ZXV A;  1TJE A;  2IZV B;  1D6E C;  2DNF A;  4W9G A;  4OVV A;  3DBL I;  4TMA B;  3PLV A;  3Q8C A;  3AE8 B;  2NS5 A;  2KQ4 X;  1U4A A;  2RMM A;  2EMT A;  2MBB B;  2FE8 A;  2DHZ A;  1PGX A;  2RDH A;  1YQ4 B;  1JRP A;  2TSS A;  1SXT A;  1P7E A;  4HPM B;  1ET6 A;  2NBU A;  5IOI A;  3UI3 A;  2C9W B;  3Q8B A;  1V86 A;  3RT3 B;  1WXA A;  3ALB A;  2L0T A;  4P16 A;  2PPH A;  4RCO A;  5C23 A;  2LAS A;  3MFG A;  2I38 A;  1QZE A;  1Z2M A;  4BKS A;  4WAA A;  3ZYY X;  1EWY C;  4W9C A;  3QWZ B;  4B6W A;  4ICV A;  1I4G A;  2ZEQ A;  3K9O B;  1P9D U;  1E8Y A;  4K1R B;  1MFW A;  2WP9 B;  4KX6 B;  4M02 A;  2WDQ B;  1ENF A;  3HM3 A;  2L00 B;  3NS8 A;  4A9A A;  4IDI A;  5DPS A;  1FRD A;  3LYY A;  3KYD D;  1KLG D;  4AQ7 A;  1UWM A;  1WMH A;  3A1Q B;  3WAM A;  3N1Z C;  4K7W A;  2QIL A;  4KIK B;  3MC8 A;  4DXG A;  2UU7 A;  1EUV B;  3Q3J A;  2DLB A;  3KW5 B;  2KWD A;  2IGD A;  1L0V B;  1HTO A;  3WAL A;  1D5M C;  1FFV A;  1TKG A;  4JGH B;  1PDX A;  3AI5 A;  4A3O A;  4FHJ A;  1PYW D;  3PPA A;  3NY5 A;  3V3X A;  4OW0 A;  1PGB A;  4A55 A;  1SSN A;  1XLP A;  2IYD B;  2D3A A;  4US9 A;  4BBN C;  3AE5 B;  4IW0 A;  1TT5 B;  2DAF A;  2BB6 A;  2WHI A;  1C79 A;  2KC1 A;  1HZ6 A;  1UBI A;  1FNV A;  2IO0 B;  3B1L X;  4BVU C;  1WJ4 A;  3NZU A;  3PO0 A;  3PHW B;  2JYT A;  3P4P B;  4KZ0 A;  3ECI A;  5IKC M;  3H9D A;  4ZHO A;  3AEG B;  1SE2 A;  3RNG C;  1I4H A;  4W9H A;  3AEC B;  3WCQ A;  2GBM A;  1Q1O A;  3RNA C;  5H8Y E;  4D2K A;  3VH3 B;  3AE6 B;  1RLF A;  4RF0 A;  2R61 A;  2MSE D;  1TBE A;  4EZJ A;  3CF6 E;  1T6B X;  5IAA C;  1UWX A;  3VAW A;  1S3S G;  2XK5 B;  1WXS A;  3ZTC A;  2CJN A;  3U2S C;  2JF5 A;  1MVK A;  3RD2 A;  3SFE B;  5C1Z A;  3JYU A;  3DOW A;  1F9J A;  3SD5 A;  3PV1 A;  4RGM A;  1EU4 A;  1QT9 A;  4BZA A;  1WRD B;  1IP9 A;  5DPR A;  1K51 A;  1WXM A;  3KH0 A;  1GC6 A;  4ZRI A;  1VZ6 A;  2KAC A;  4XDC A;  1UH6 A;  2AQ3 B;  2Z8L A;  1TKE A;  3CWI A;  2L05 A;  3SEB A;  3HK0 A;  2ONQ A;  4PK1 A;  1I35 A;  1WM2 A;  2LGS A;  5EE0 A;  2LFI A;  4LNK A;  2FUG 1;  1KH0 A;  3N1Y C;  3OLM D;  2BKF A;  4IM0 A;  4IKG A;  2RGF A;  3ONS A;  1BML C;  3PRM B;  2C7N B;  2HJ8 A;  3DWM A;  3R3M A;  4AWJ A;  3KVF B;  2WXR A;  2PVO D;  2SAK A;  4XWT A;  2LZ6 A;  1J7B A;  3M63 B;  4AUQ C;  1V8C A;  3SDL C;  1T0Y A;  3HHM A;  4DHJ B;  3MHZ A;  2KN4 A;  1WGK A;  2CKH B;  4HKQ A;  2WYQ A;  1NI2 A;  3B0A A;  1PUT A;  1VLB A;  4BKS D;  3HRD D;  5J17 A;  1V1O A;  2AX5 A;  4HK2 A;  2OHF A;  2KN5 A;  4MH8 A;  3BII D;  1PGA A;  2DBY A;  1V5T A;  2J53 A;  2J7Q B;  1WYW B;  1E7V A;  2DZM A;  3ZTD A;  4FBJ B;  1JWS D;  3KWV A;  3TBL D;  3IHP C;  5LLI A;  4DDG D;  4ANW A;  1C3T A;  1Q5W B;  3AB5 A;  4MEM A;  2XBB C;  1CQV A;  1JCK B;  4FJV B;  1MHH E;  2G9H D;  2EKE C;  3EHV A;  1UD7 A;  2L76 A;  4LJO B;  4JIO U;  4P1C C;  1JQ4 A;  1VDV A;  3AE2 B;  2ACZ B;  3MP9 A;  4HPL B;  1GB1 A;  4WUR A;  5BMH A;  3RUL A;  2JY6 A;  2N9X A;  2BBC A;  4WWP A;  2KD0 A;  2WU2 B;  2O2V B;  4XZ4 A;  2FNJ B;  2V9H A;  2M0X A;  1RAX A;  2MP2 B;  2PLP A;  3ZNG C;  1WM3 A;  4P1B C;  4MJS B;  1QQR A;  4C7Z A;  1T5X D;  4CO7 A;  3B9J A;  1WGY A;  4L1B A;  1UF0 A;  1JW9 D;  1JWB D;  1TS4 A;  3NJT A;  2Z0D B;  3P2B A;  2A4Z A;  5CX3 A;  4IG7 B;  1Q10 A;  4B0E A;  4NZL B;  1I7H A;  3FC4 A;  3TIX A;  4YL8 A;  3DCG A;  2AQ2 B;  5AEK B;  4LDT D;  2KMC A;  3GB1 A;  3QX1 A;  4HPP A;  4HDQ A;  4ICU A;  2BW2 A;  5BYQ A;  3U52 E;  3N1X C;  1IBX B;  3AEA B;  1WR1 A;  3N3K B;  3VH4 B;  4OVU A;  1GC7 A;  2LWP A;  2KNB A;  5H92 C;  1N5W A;  5I4D A;  1L4Z B;  3ZW3 A;  4EZL A;  4ZRQ A;  3A9K B;  2WXF A;  4YSX B;  4EOY A;  4N6E B;  3DVN V;  3GS2 A;  1KM7 A;  5D3D A;  3CST A;  2FID A;  4ANX A;  4FJY A;  4NAW A;  3VR9 B;  3QK0 A;  1L0Y B;  2DEN B;  4EZK A;  4EE2 A;  1PQS A;  1WGG A;  3JW0 X;  2GBJ A;  2X38 A;  3GZN I;  2Z59 B;  3NVV A;  3CMM B;  1FPY A;  1WH3 A;  3EGR A;  3ML8 A;  2JU6 X;  4LNN A;  3DBR B;  2B3A A;  4ARI A;  2RSU A;  2KC2 A;  4WH4 A;  2NTT A;  5D94 A;  4KIK A;  2MA9 B;  2ZNV C;  4EUT A;  3KYC D;  4MAC A;  4K7U A;  1V49 A;  2AL3 A;  2ZVN A;  4ZHP A;  2R2Q A;  2M1M A;  2W55 A;  1MI0 A;  1YN3 A;  1JWM D;  2WXP A;  4MGI E;  1AN8 A;  1WFY A;  3OG5 A;  3BYT B;  2KWU B;  2M17 A;  2R2O A;  3IT4 B;  1XO3 A;  2Y5B B;  1YJJ A;  3Q69 A;  4BOS C;  2J0M A;  3TCA A;  4JQW C;  5D7G A;  1J8C A;  1ZW7 A;  1V80 A;  4CHK A;  3M95 A;  5J18 A;  3QQ8 B;  4L23 A;  2LI5 A;  1FXT B;  4KKI A;  2ICI A;  2PKO A;  3NHE B;  2YVC A;  1G6J A;  4AP4 C;  1OQR A;  2CHW A;  3P42 A;  1K8R B;  3I5J C;  3UQB A;  1IYF A;  4MGZ E;  4K3B A;  1JWU D;  3BWU D;  2PE6 B;  4GDL B;  5JHB A;  2D5G A;  1V97 A;  2BS3 B;  3HIZ A;  1V2Y A;  2J0K A;  1L4D B;  2DYB A;  3PRP B;  1DOY A;  2PMV A;  4K81 A;  4GN1 A;  3VHT C;  2WLB A;  2KYW A;  4K3C A;  5D2M B;  4OHJ A;  3SFD B;  2DZI A;  3PZD A;  4HRS A;  1GOZ A;  4MSM B;  4W9K A;  3V6C B;  3VTW A;  1N5X A;  2K39 A;  2G4S A;  1PFD A;  1V6E A;  3ZIM A;  2JZZ A;  3DHI C;  1RFA A;  1QLB B;  1UGJ A;  4L2Y A;  1WWT A;  2GLS A;  1R4N I;  2M8S A;  5FR3 A;  1V81 A;  3QCA A;  3SR6 A;  5EE3 A;  1HQR D;  3ML9 A;  1ZXI A;  4DHZ B;  3O65 B;  4QAY A;  4DHZ E;  2DYM A;  4J6I A;  1J19 A;  3HUI A;  1ZGU B;  3URY A;  1WJU A;  4I6N B;  2CHX A;  2DAJ A;  3ZUN A;  3BZD B;  3PSE B;  2NCN A;  2A5U A;  4HCN B;  3IAS 1;  1FCC C;  1NYQ A;  3M3J A;  4RF1 A;  2KFJ A;  3L10 B;  2BS4 B;  5AZF A;  1Q0W B;  2XNA C;  4GU2 A;  5AZG A;  1WGR A;  1WYG A;  3JVZ X;  3OWE B;  4HJK A;  4BFR A;  1L6U A;  1YIW A;  3W5U B;  5HFY A;  2QC8 A;  1GB4 A;  1WX9 A;  3B2F A;  4HKZ E;  1J0G A;  3A9J A;  4ZYS A;  1ZP0 B;  3AU4 A;  4B95 A;  3NVY A;  2DWQ A;  4M0W A;  4ARC A;  1F2R I;  2AWT A;  1CK1 A;  2KTF A;  4PS3 A;  4HVB A;  3RUI B;  3R2T A;  1E90 A;  3APD A;  2K6Q A;  2D3C A;  2IGG A;  3PRE A;  2O6V D;  2ZPY A;  2LRW A;  5IN7 A;  4GMV A;  4MSQ B;  4PYZ A;  1K53 A;  2BWE S;  2PVG C;  3W1S C;  4HDO A;  4TQ0 A;  2I2Y A;  4EEW A;  2AQ1 B;  2L1A A;  1VZ8 A;  2JPH A;  1WX8 A;  3L16 A;  1V1P A;  2KJR A;  1H8C A;  3IT6 B;  1HE8 A;  2ON8 A;  4NJ7 A;  2EKI A;  4WJP A;  2ZW1 A;  2YEP B;  2PIA A;  3LDZ E;  1N61 A;  3MC9 A;  3BYY B;  1SF0 A;  3OJ3 A;  2QCZ A;  1EF1 A;  3ZXR A;  2IO3 B;  2JZP A;  3GOE A;  1NI3 A;  1RM6 C;  1E8W A;  2HD5 B;  5E6O A;  3GP7 A;  1WE6 A;  1H4R A;  4YTM B;  1I4X A;  4JL9 A;  1HZ5 A;  4ZOH C;  1YJI A;  5L83 A;  5E6P A;  1WJN A;  4WJO A;  3L4P A;  3QA8 A;  5IP4 D;  3C0R B;  1RFK A;  1WXQ A;  2FCQ A;  4JLC A;  2OJR A;  5IA7 A;  4KGT A;  4BOZ B;  1JWA D;  2Y5P A;  3WAO A;  4OZC A;  3CSF A;  4BKG A;  1ZXH A;  3Q14 C;  2QHO A;  2W82 A;  2BS2 B;  3NG0 A;  1GJZ A;  1C9F A;  1XF5 L;  2INP E;  3PS6 A;  3DHH C;  4NNJ B;  4RH6 A;  2AYO B;  1L0X B;  4MM3 B;  4GXB A;  5JH5 C;  1E7P B;  3AV8 A;  1SGH A;  3SU8 X;  4NPN A;  2JWZ A;  2BYE A;  3RNF C;  2JRI B;  3R2I A;  1RRB A;  1CMX B;  2WX0 A;  2BB5 A;  5LXH A;  2JT4 B;  1KLV A;  3ZJT A;  3APF A;  2Z0E B;  2K22 A;  2ASQ A;  2KQS A;  3DWG C;  2KT7 A;  5GXG B;  3FAH A;  1YOV B;  1M4V A;  2PEA A;  4KSK C;  4I6L B;  1E6E B;  3TEW A;  2MBO A;  4GGQ A;  3V60 A;  4E74 A;  4P7I A;  3QAQ A;  2KO3 A;  3I9V 1;  1XLN A;  2JX5 A;  2GB1 A;  5AZH A;  3T8M A;  3Q6B A;  2MLB A;  3HM6 X;  3RZW C;  2JQR B;  1ZOY B;  3IAM 1;  4WIP A;  3PTF C;  2WDV B;  2RDB C;  2O6V B;  3WA0 A;  1ET9 A;  3IG3 A;  1NEN B;  2HJ1 A;  3W5V B;  2QIE B;  3ZRF A;  2D3G A;  3RCZ A;  1IGC A;  3VRA B;  1WF9 A;  3E9S A;  2KJH B;  2KFK A;  2MBQ A;  4F1S A;  2MBE A;  2N9L A;  3RMK C;  1TY0 A;  2OOB B;  2WDT B;  2L3Z A;  2V1Y A;  2WXH A;  4KVG B;  3C8Y A;  3KUZ A;  4YSY B;  2V0G A;  2KMA A;  4OZB A;  2K0P A;  3DBS A;  4NAM A;  2AL6 A;  2WGS A;  4DBG A;  4FN2 A;  3QC8 B;  1MPE A;  4KSL C;  2NBW B;  1DGJ A;  5TSS A;  1P3Q U;  4PS7 A;  2YLM A;  2WQY B;  2WXO A;  3BVZ A;  4JE3 B;  2KJ6 A;  2PJH A;  2MCN B;  4LNF A;  2X8X X;  4IC7 B;  3A9J B;  2DYO A;  3VTU A;  1E10 A;  2N9E B;  1WE7 A;  2KWC A;  2V3P A;  1T3Q A;  1WIA A;  3DBH B;  3ZQ4 A;  1ESF A;  3ZJV A;  2BF8 B;  1N6Z A;  2N0S B;  2CS4 A;  1LXD A;  2K9X A;  3KUC B;  2G1E A;  1TS2 A;  2INC C;  3A4S C;  1C4C A;  1RWS A;  2L52 A;  3V61 A;  1FEH A;  1YNT E;  1P1A A;  4HRO A;  4MJS A;  1CZP A;  1LM8 B;  4HWI B;  3I63 C;  2HDE A;  3VQI A;  2J52 A;  3OJ4 B;  1XLQ A;  4MDK E;  2G4D B;  3GE3 C;  1ZKH A;  2WXI A;  4WWO A;  2MRP A;  2MW5 A;  4N59 A;  3FIL A;  1JAL A;  4NJ6 A;  5CHW A;  3DVG X;  1FO4 A;  2K25 A;  2PTL A;  3UIO B;  2VZK B;  1IPG A;  4M01 A;  3U30 A;  2N7J A;  2JRH A;  5CHF A;  3DPD A;  2K6D B;  1YN5 A;  3DBR I;  3Q8A A;  1YD8 U;  3T3N A;  1QOB A;  5HKH A;  3I57 A;  3H6N A;  1WXV A;  4NJC A;  3BK1 A;  3R7R A;  5FR6 A;  2K8C A;  2LUM A;  3N20 C;  2JZ3 B;  2LJI A;  4IWQ A;  2GRI A;  4FA6 A;  2W9N A;  1TS3 A;  1WR6 E;  1ZE3 D;  5DPW A;  2Q5W D;  2JUO A;  1D5Z C;  4KDI C;  4DHJ D;  2D10 A;  3MJ5 A;  2AEH A;  2WXQ A;  3LJ3 A;  1V1P B;  4LCD E;  4GSW A;  1ZPS A;  1WSP A;  2FCN A;  1HTQ A;  4XWW A;  4HCP B;  1E9M A;  1J7C A;  3P4Q B;  1VD2 A;  3A9K A;  4W9F A;  4LNO A;  3ZDM C;  4M8N A;  3WIM A;  2LGY A;  1YN4 A;  3N9Y C;  3APC A;  1EWC A;  1TTN A;  2EEL A;  4UDU C;  4KGS A;  4GOC A;  2K5P A;  2KFK B;  1FXI A;  4II2 B;  2LMC A;  2LGD A;  2BWF A;  3U4E G;  3ZJU A;  3RFZ B;  2OJW A;  1VZ7 A;  4PT5 A;  3W1S A;  3W1Y A;  2O6V A;  4GDK A;  1E8X A;  4DXA B;  1QKZ A;  2VH2 A;  4PYU A;  3WAN A;  3K9P B;  3A1Q A;  3TL5 A;  4RGN A;  3AE9 B;  4YSZ B;  3NZS A;  1F52 A;  1BXT A;  3H7S A;  5BYS A;  2KWV B;  3L08 A;  3V6E B;  4A8X C;  2LRU A;  1E8Z A;  2KX0 A;  4GDK B;  2V4L A;  4KKJ A;  5BMI A;  2D07 B;  1LFD A;  3RNC C;  2K8B A;  1AW7 A;  4TSS A;  2E6X A;  2Y3A A;  1NVI D;  3DBH I;  1I4Q A;  4BAX A;  4IM3 A;  1MG8 A;  3QHT A;  1JRU A;  2LHD A;  3UIP B;  1XCT L;  5LNK 1;  3ENE A;  2K1F A;  3EFC A;  5J2R A;  4G3X B;  1UBQ A;  3RZF A;  2IPK D; 
#chains in the Genus database with same CATH homology
 1QT9 A;  4YTN B;  1STE A;  2INN E;  4TQ0 A;  2I2Y A;  1KF6 B;  1K51 A;  4OZA A;  2V3N A;  1DYQ A;  1ZUD 2;  3P4R B;  5HG2 A;  1FD6 A;  2AQ1 B;  3MC0 B;  2CU3 A;  2WU5 B;  2YEP F;  1ROE A;  2L1A A;  1TZO A;  1CJE A;  1VZ8 A;  2Y5C A;  1VZ6 A;  1V1P A;  2KAC A;  4XDC A;  2GI9 A;  2AQ3 B;  3AED B;  3IT6 B;  2Z8L A;  3AMZ A;  1KTK A;  3TSS A;  1VRA B;  2ON8 A;  2HTM E;  1TKE A;  2JWU A;  1GAQ B;  4OVZ A;  2EKI A;  3CWI A;  1K50 A;  3NVZ A;  3J9C A;  3SEB A;  2VZK D;  2YEP B;  1FRR A;  2PIA A;  2ZW1 A;  2IJ0 A;  1FIQ A;  4P6V F;  2BT6 A;  2ONQ A;  1N61 A;  1JRO A;  1NYR A;  3BYY B;  5EE0 A;  2LFI A;  1SF0 A;  2FUG 1;  1KH0 A;  3PZ8 A;  2K3U A;  2JZP A;  3NS1 A;  1HXY D;  1D4B A;  1NI3 A;  4IKG A;  1RM6 C;  4WWM A;  3VR8 B;  1BML C;  5AUI A;  3DWM A;  1EU3 A;  3GP7 A;  4YTM B;  1I4X A;  1HZ5 A;  4ZOH C;  1YJI A;  2JSV X;  2WXR A;  2PVO D;  2SAK A;  4XWT A;  3L4P A;  4N58 A;  1F0Z A;  3IXS A;  1J7B A;  1XCQ L;  2WXN A;  5T8I A;  3HVD A;  1TKY A;  1RFK A;  1V8C A;  3AEE B;  2MEK A;  4WQM A;  4YWG G;  1WXQ A;  3MHZ A;  2KN4 A;  1WGK A;  1C78 A;  4HKQ A;  2LEK A;  4KGT A;  1UNS A;  1UUP A;  1PUT A;  1VLB A;  1JWA D;  2Y5P A;  4A90 A;  2WXG A;  4OZC A;  3LXF A;  3HRD D;  3W2D A;  1HEZ E;  1V1O A;  2AX5 A;  1ZXH A;  2QMT A;  1MHX A;  2OHF A;  2W82 A;  4RGT A;  4MH8 A;  3BII D;  2BS2 B;  1P7F A;  1PGA A;  2DBY A;  2J53 A;  1DOX A;  5C2T B;  2LHE A;  3ZGZ A;  1F77 A;  1C4P A;  1F2R C;  2H89 B;  4DQO C;  4LK0 M;  3LB8 C;  1C9F A;  1XF5 L;  4C7Y A;  3EUB 2;  4US8 A;  1JWS D;  1L5P A;  3KWV A;  2INP E;  5BYR A;  3R8B A;  1K52 A;  3KLS X;  2E3T A;  1YQ3 B;  3U7Z A;  2BTE A;  1N62 A;  1OFF A;  4RH6 A;  1L0X B;  4MM3 B;  3AB5 A;  2QJL A;  1E7P B;  2KAJ A;  3AV8 A;  1CQV A;  4YTP B;  1B1Z A;  2MH7 A;  1JCK B;  3AH7 A;  4JPS A;  3R2I A;  4C56 C;  1MHH E;  1XLO A;  2G9H D;  3PZ7 A;  4YT0 B;  1OQQ A;  2BB5 A;  4KGR A;  4LTU A;  3ZJT A;  1N63 A;  5G5G A;  5C3J B;  4LLG M;  1QF6 A;  1JQ4 A;  2WNM A;  1VDV A;  2K22 A;  3AE2 B;  1KLU D;  2ACZ B;  2B76 B;  3MP9 A;  3DWG C;  5GXG B;  1TS5 A;  4WUR A;  1GB1 A;  1SJH D;  5FK9 C;  2MJD A;  3FAH A;  5BMH A;  3NZ3 A;  1QIL A;  2BBC A;  1TYG B;  1M4V A;  4FXC A;  4AS1 A;  2WU2 B;  4C80 A;  2NMQ A;  1E6E B;  2J4X A;  3TEW A;  1KRH A;  1SB3 C;  1FXA A;  3KWL A;  2PLP A;  4H2A A;  1TY2 A;  1QQR A;  4C7Z A;  3I9V 1;  1XLN A;  3W9C B;  2JX5 A;  2MJ3 A;  1T5X D;  2WDR B;  3E56 A;  2GB1 A;  3B9J A;  4L1B A;  3KQ4 A;  2M19 A;  1JW9 D;  1JWB D;  1TS4 A;  1ZDX A;  3TEZ A;  2JQR B;  2WXJ A;  1JML A;  2H88 B;  1ZOY B;  5EE9 A;  1KFY B;  2J42 A;  3IAM 1;  4WIP A;  1A70 A;  1ZDV A;  2N9K A;  2L32 A;  1XXG A;  5EE1 A;  2QEJ C;  3CIR B;  2WDV B;  4ZRP A;  2RPV A;  1RYJ A;  5AUK A;  1LO5 D;  1Q10 A;  4B0E A;  4NZL B;  1I7H A;  1ET9 A;  3FC4 A;  1NEN B;  2RDG A;  4HEA 1;  4REZ A;  1R7S A;  3W5V B;  4CQN A;  2AQ2 B;  2QIE B;  3TUO A;  3TEX A;  1IGD A;  3GB1 A;  3NVW A;  4A6Q A;  4JX1 C;  1IGC A;  4HJG E;  3VRA B;  2CJO A;  3BVG A;  2BYT A;  3E9S A;  1FFU A;  1SBB B;  1GPX A;  2BW2 A;  5BYQ A;  3U52 E;  2N9L A;  3HVZ A;  5FKA C;  2PW9 A;  1IBX B;  2MJE A;  3AEA B;  1TY0 A;  5H92 C;  1N5W A;  5I4D A;  2WXH A;  1L4Z B;  3C8Y A;  4YSY B;  1FNU A;  1C77 A;  1QOG A;  2IGH A;  3ABV B;  4RFB A;  4ZRQ A;  2V0G A;  3RPF C;  3AE4 B;  3TEY A;  1J7A A;  4JWS C;  2WXF A;  4OZB A;  2K0P A;  3NUH B;  1N60 A;  3AE3 B;  4NAM A;  4YSX B;  1FNW A;  4N6E B;  2WS3 B;  4TQ1 A;  3NRZ A;  3GS2 A;  5D3D A;  1Y56 A;  3BVM A;  1AYF A;  2JYE A;  1BUI C;  3AN1 A;  3VR9 B;  1MPE A;  1SJE D;  3AE7 B;  1QOF A;  1DGJ A;  5HHD G;  5TSS A;  1L0Y B;  1FM0 D;  4XE0 A;  3AE1 B;  3P63 A;  4EE2 A;  2WQY B;  2X38 A;  5BMG A;  2XN9 C;  2WXO A;  3BVZ A;  3NVV A;  4NAW B;  4JE3 B;  2ZW0 A;  3EGR A;  1L6V A;  2JU6 X;  2DYO A;  3O13 A;  3AM9 A;  3AEB B;  4ARI A;  1E10 A;  2V3P A;  1FMA D;  1T3Q A;  3ZQ4 A;  4WH4 A;  1ESF A;  2NTT A;  3ZJV A;  2WXK A;  2N0S B;  2W3R A;  4WAF A;  2W3S A;  4GLS C;  1TJE A;  2M0A A;  1D6E C;  4MAC A;  2K9X A;  2G1E A;  1TS2 A;  2KDM A;  4TMA B;  5E6J A;  1C4C A;  1RWS A;  2L52 A;  4ZHP A;  1FEH A;  3Q8C A;  2QSD A;  3AE8 B;  1YNT E;  2W55 A;  4HRO A;  1MI0 A;  1YN3 A;  3Q8E A;  2KQ4 X;  1CZP A;  4Q2J A;  2KMM A;  2RMM A;  1E0Z A;  1VJK A;  1JWM D;  2WXP A;  2HDE A;  3VQI A;  1AN8 A;  2FE8 A;  2J52 A;  1PGX A;  2RDH A;  1XLQ A;  1YQ4 B;  2JXT A;  3BYT B;  1JRP A;  2TSS A;  1SXT A;  1P7E A;  5JXV A;  2W54 A;  2WXI A;  1ET6 A;  3IT4 B;  1XO3 A;  3UI3 A;  1YJJ A;  3Q69 A;  3Q8B A;  2OED A;  5G5H A;  1C76 A;  4N59 A;  4P16 A;  5D7G A;  3FIL A;  4RCO A;  1JAL A;  1AWD A;  1SE4 A;  3MFG A;  1YMH E;  2I38 A;  1FO4 A;  4IOI E;  2PTL A;  2VZK B;  1SE3 A;  4L23 A;  3VRB B;  1HA5 A;  2N7J A;  3ZYY X;  1EWY C;  4KKI A;  2ICI A;  1ACC A;  2PKO A;  1YN5 A;  3Q8A A;  1SIJ A;  3T3N A;  1QOB A;  1OQR A;  2M56 B;  3P42 A;  1I4G A;  3I57 A;  4DXF A;  3Q8F A;  1JWU D;  3BWU D;  4NJC A;  2WXM A;  3BK1 A;  4GDL B;  3V05 A;  1XEE A;  2WP9 B;  1I4R A;  4KX6 B;  2D5G A;  2LUM A;  1V97 A;  2LGI A;  2BS3 B;  2WDQ B;  1ENF A;  2LJI A;  1NEK B;  2GRI A;  1QOA A;  4O1N A;  1L4D B;  1TS3 A;  1ZE3 D;  4A9A A;  3FIL B;  2Q5W D;  4IDI A;  1D5Z C;  1DOY A;  1FRD A;  3P4S B;  2L83 A;  3MJ5 A;  2PMV A;  2WXQ A;  4JWU C;  1V1P B;  3LYY A;  1KLG D;  2WLB A;  4RNA A;  4AQ7 A;  1ZPS A;  1UWM A;  1WSP A;  1IUE A;  4OHJ A;  3SFD B;  4XWW A;  2QIL A;  4DXG A;  1E9M A;  4HRS A;  1GOZ A;  2FBW B;  1J7C A;  4ITK A;  2DLB A;  3ETR A;  3P4Q B;  1N5X A;  4RGO S;  1WRI A;  1PFD A;  2KWD A;  2IGD A;  4XDD A;  1YN4 A;  1L0V B;  1QLB B;  1UGJ A;  4L2Y A;  1D5M C;  4YXD B;  1WWT A;  3N9Y C;  1FFV A;  4B0M A;  1TKG A;  4MT5 A;  5FR3 A;  1EWC A;  1PDX A;  2EEL A;  4UDU C;  1DOI A;  4J3O D;  3SR6 A;  4KGS A;  2K5P A;  1PYW D;  5EE3 A;  1HQR D;  1FXI A;  1ZXI A;  2LMC A;  3V3X A;  2WXL A;  4OW0 A;  1PGB A;  4A55 A;  2DYM A;  1SSN A;  1XLP A;  3HUI A;  1SEB D;  3URY A;  4US9 A;  1VR9 A;  3U4E G;  3ZJU A;  3AE5 B;  3RFZ B;  3AEF B;  1C4A A;  1VZ7 A;  2BB6 A;  4PT5 A;  1C79 A;  3W1S A;  3BZD B;  1HZ6 A;  3EA6 A;  1FNV A;  5HI1 A;  1FCL A;  3IAS 1;  1B9R A;  3BK2 A;  3PO0 A;  1FCC C;  1QKZ A;  2JYT A;  2NTS A;  1NYQ A;  1EM7 A;  3P4P B;  4RF1 A;  2BS4 B;  2V4I B;  2XNA C;  4RGN A;  3AE9 B;  5D3I B;  4YSZ B;  4ZHO A;  1WYG A;  1BXT A;  3AEG B;  3OWE B;  1SE2 A;  1I4P A;  5BYS A;  1I4H A;  1L6U A;  4A8X C;  3W5U B;  5HFY A;  3AEC B;  3WCQ A;  1GB4 A;  3B2F A;  4HKZ E;  4GDK B;  4KKJ A;  3B2G A;  4ZYS A;  5H8Y E;  4D2K A;  5BMI A;  1ZP0 B;  3NVY A;  3AE6 B;  2IDY A;  2DWQ A;  4RF0 A;  2R61 A;  1AW7 A;  4M0W A;  4ARC A;  4TSS A;  1F2R I;  2E6X A;  2Y3A A;  1NVI D;  3H8H A;  4USA A;  1I4Q A;  1CK1 A;  1T6B X;  1UWX A;  1D5X C;  3R2T A;  2CJN A;  3U2S C;  2IGG A;  2LHD A;  4R3D A;  3P1M A;  1MVK A;  2SEB D;  1XCT L;  3SFE B;  5LNK 1;  3T3O A;  1IBX A;  2IPK D;  1K53 A;  4RGM A;  5MPO A;  1EU4 A;  2PVG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...