1XMGE

Crystal structure of apo methane monooxygenase hydroxylase from m. capsulatus (bath)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Preparation and X-ray Structures of Metal-Free, Dicobalt and Dimanganese Forms of Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath)
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmgE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmgE02
1FZ8E 1XU3E 1FZ0E 1FZ4E 1FYZE 1FZIE 1FZ3E 1MHYG 1MHZG 1XU5E 1XMHE 1MMOG 1XVEE 1FZHE 1FZ5E 1XVDE 1FZ6E 1XMGE 1FZ1E 1XMFE 4GAMC 1XVCE 1FZ2E 1XVBE 1FZ7E 1FZ9E 1XVGE 1MTYG 1XVFE
chains in the Genus database with same CATH superfamily
3TAGA 4M3WA 1IH7A 3OGKB 4RL5A 4DTRA 1FZ4E 4DTUA 3QNNA 3TAFA 3C6PB 3N1BA 2LF6A 4M3YA 2JPNA 3SQ0A 4I9QA 3LDSA 4FJ7A 1XU5E 3C94A 4FJGA 1WAFA 4M41A 2B1EA 2K5SA 3SUQA 3NHGA 4M3TA 2JHCA 2B7MA 3RMDA 2B8IA 3HGLA 3KD1E 4FJNA 1XVDE 2YB5A 3E4YA 4X5MA 2VJ5A 2OZMA 4HCBA 3CQ8A 4ADNA 3QEXA 4DTOA 3KD5E 4M3UA 3J2PA 4DU4A 3NE6A 2HD0A 3TAEA 4IT5A 2OZSA 1XMFE 3QERA 1XVCE 2RCUA 2ATQA 3UO3A 4E3SA 3SQ2A 4AKGA 4FK2A 3RMAA 3RMCA 3LZIA 2VIXA 3SI6A 4DU1A 4QNCA 4M3ZA 2PFTA 1MTYG 1XVFE 3WSOA 2JHAA 3C95A 3C6OB 1FXXA 1XU3E 5IZ7A 3RMBA 1LDKE 3UO2A 1FYZE 3QNOA 1FZ3E 1MHYG 4RG8A 4JS5A 4DTJA 3L0MA 4I9LA 2MZWB 4FK0A 1MMOG 4M3XA 1CLQA 1XVEE 1FZHE 4J2EA 3SCXA 4I6JB 2DTUA 2P1OB 4M3RA 4DTSA 2OYQA 4M42A 4FJXA 1FPOA 4B08A 4J2BA 4E4BA 3L1NA 3LD8A 3QEIA 4EYWA 1JW2A 4FK4A 4FJIA 3QEWA 4JS4A 3HP9A 5H37A 4AKHA 1FZ7E 2OVQB 4AKIA 3LDBA 4DTNA 2PFVA 4ICGC 2H4TA 1FZ8E 4JRQA 3SQ1A 3NDKA 3L8BA 1FZ0E 2P5OA 4JRPA 2JH9A 4FVMA 4FJHA 4FJJA 4KHYA 2JH8A 4X5NA 3K2OA 3LZJA 1XMHE 3MKSB 3L2OB 3QETA 2LF3A 4HCCA 4KI4A 4DTPA 1Q9YA 1FZ5E 3C6NB 4DU3A 3TL8B 3SJJA 1P22A 2MMBA 1N1CA 4FJMA 3NCIA 3SUNA 4FJ9A 3SQ4A 4GAMC 3SVIA 3NAEA 4DTMA 3SUPA 3TABA 1FZ2E 4ADOA 4FJ8A 4KHUA 3J27A 1XVBE 3UIQA 1IG9A 3QEVA 2E32A 4FJ5A 4J2AA 3TJYA 1FZ9E 2VJ4A 2OVPB 2P1QB 4M45A 3S9HA 4J2DA 2P1PB 2P1NB 3E4WA 3HL8A 3N1EA 4QNDA 3SPZA 4KHSA 2FYOA 1NEXB 2JQTA 3CFPA 4RNGA 2MW2A 3CFOA 1FZIE 2OVRB 4DTXA 3QESA 1MHZG 1WAJA 5IBKB 2RKHA 3QEPA 4FJLA 2E31A 4KI6A 2P1MB 2FW3A 2QXFA 4AI6A 3SUOA 3V7DB 3HGKE 1XL3C 3SNNA 2P5GA 1FS1A 3OGLB 1FZ6E 1XMGE 3CFRA 4FJKA 1FZ1E 1Q9XA 2DEBA 4KHNA 2JHPA 4EPHA 2DY4A 3NGIA 3OGMB 1XVGE 3BVOA 4KHWA 4EP9A 3RWUA 3SPYA 5IREA 4KHQA
chains in the Genus database with same CATH topology
3TAGA 4M3WA 1IH7A 3OGKB 4RL5A 4DTRA 1FZ4E 4DTUA 3QNNA 3TAFA 3C6PB 3N1BA 2LF6A 4M3YA 2JPNA 3SQ0A 4I9QA 3LDSA 4FJ7A 1XU5E 3C94A 4FJGA 1WAFA 4M41A 2B1EA 3SUQA 3NHGA 4M3TA 2JHCA 2B7MA 3RMDA 2B8IA 3HGLA 3KD1E 4FJNA 1XVDE 2YB5A 3E4YA 4X5MA 2VJ5A 2OZMA 4HCBA 3CQ8A 4ADNA 3QEXA 4DTOA 3KD5E 4M3UA 3J2PA 4DU4A 3NE6A 2HD0A 3TAEA 2OZSA 1XMFE 3QERA 1XVCE 2RCUA 2ATQA 4E3SA 3SQ2A 4AKGA 4FK2A 3RMAA 3RMCA 3LZIA 2VIXA 3SI6A 4DU1A 4QNCA 4M3ZA 2PFTA 1MTYG 1XVFE 3WSOA 3C95A 2JHAA 3C6OB 1FXXA 1XU3E 5IZ7A 3RMBA 1LDKE 1FYZE 3QNOA 1FZ3E 1MHYG 4RG8A 4JS5A 4DTJA 3L0MA 4I9LA 2MZWB 4FK0A 1MMOG 4M3XA 1CLQA 1XVEE 1FZHE 4J2EA 3SCXA 4I6JB 2DTUA 2P1OB 4M3RA 4DTSA 2OYQA 4M42A 4FJXA 4B08A 4J2BA 4E4BA 3L1NA 3LD8A 3QEIA 4EYWA 4FK4A 4FJIA 3QEWA 4JS4A 3HP9A 5H37A 4AKHA 1FZ7E 2OVQB 4AKIA 3LDBA 4DTNA 2PFVA 2H4TA 1FZ8E 4JRQA 3SQ1A 3NDKA 3L8BA 1FZ0E 2P5OA 4JRPA 2JH9A 4FVMA 4FJHA 4FJJA 4KHYA 2JH8A 4X5NA 3K2OA 3LZJA 1XMHE 3MKSB 3L2OB 3QETA 2LF3A 4HCCA 4KI4A 4DTPA 1Q9YA 1FZ5E 3C6NB 4DU3A 3TL8B 3SJJA 1P22A 2MMBA 4FJMA 3NCIA 3SUNA 4FJ9A 3SQ4A 4GAMC 3SVIA 3NAEA 4DTMA 3SUPA 3TABA 1FZ2E 4ADOA 4FJ8A 4KHUA 3J27A 1XVBE 3UIQA 1IG9A 3QEVA 2E32A 4FJ5A 4J2AA 3TJYA 1FZ9E 2VJ4A 2OVPB 2P1QB 4M45A 3S9HA 4J2DA 2P1PB 2P1NB 3E4WA 3HL8A 3N1EA 4QNDA 3SPZA 4KHSA 2FYOA 1NEXB 3CFPA 4RNGA 3CFOA 1FZIE 2OVRB 4DTXA 3QESA 1MHZG 1WAJA 5IBKB 3QEPA 4FJLA 2E31A 4KI6A 2P1MB 2FW3A 2QXFA 4AI6A 3SUOA 3V7DB 3HGKE 1XL3C 3SNNA 2P5GA 1FS1A 3OGLB 1FZ6E 1XMGE 3CFRA 4FJKA 1FZ1E 1Q9XA 2DEBA 4KHNA 2JHPA 4EPHA 2DY4A 3NGIA 3OGMB 1XVGE 4KHWA 4EP9A 3RWUA 3SPYA 5IREA 4KHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  1XU3 E;  1FZ0 E;  1FZ4 E;  1FYZ E;  1FZI E;  1FZ3 E;  1MHY G;  1MHZ G;  1XU5 E;  1XMH E;  1MMO G;  1XVE E;  1FZH E;  1FZ5 E;  1XVD E;  1FZ6 E;  1XMG E;  1FZ1 E;  1XMF E;  4GAM C;  1XVC E;  1FZ2 E;  1XVB E;  1FZ7 E;  1FZ9 E;  1XVG E;  1MTY G;  1XVF E; 
#chains in the Genus database with same CATH topology
 3TAG A;  4M3W A;  1IH7 A;  3OGK B;  4RL5 A;  4DTR A;  1FZ4 E;  4DTU A;  3QNN A;  3TAF A;  3C6P B;  3N1B A;  2LF6 A;  4M3Y A;  2JPN A;  3SQ0 A;  4I9Q A;  3LDS A;  4FJ7 A;  1XU5 E;  3C94 A;  4FJG A;  1WAF A;  4M41 A;  2B1E A;  2K5S A;  3SUQ A;  3NHG A;  4M3T A;  2JHC A;  2B7M A;  3RMD A;  2B8I A;  3HGL A;  3KD1 E;  4FJN A;  1XVD E;  2YB5 A;  3E4Y A;  4X5M A;  2VJ5 A;  2OZM A;  4HCB A;  3CQ8 A;  4ADN A;  3QEX A;  4DTO A;  3KD5 E;  4M3U A;  3J2P A;  4DU4 A;  3NE6 A;  2HD0 A;  3TAE A;  4IT5 A;  2OZS A;  1XMF E;  3QER A;  1XVC E;  2RCU A;  2ATQ A;  3UO3 A;  4E3S A;  3SQ2 A;  4AKG A;  4FK2 A;  3RMA A;  3RMC A;  3LZI A;  2VIX A;  3SI6 A;  4DU1 A;  4QNC A;  4M3Z A;  2PFT A;  1MTY G;  1XVF E;  3WSO A;  2JHA A;  3C95 A;  3C6O B;  1FXX A;  1XU3 E;  5IZ7 A;  3RMB A;  1LDK E;  3UO2 A;  1FYZ E;  3QNO A;  1FZ3 E;  1MHY G;  4RG8 A;  4JS5 A;  4DTJ A;  3L0M A;  4I9L A;  2MZW B;  4FK0 A;  1MMO G;  4M3X A;  1CLQ A;  1XVE E;  1FZH E;  4J2E A;  3SCX A;  4I6J B;  2DTU A;  2P1O B;  4M3R A;  4DTS A;  2OYQ A;  4M42 A;  4FJX A;  1FPO A;  4B08 A;  4J2B A;  4E4B A;  3L1N A;  3LD8 A;  3QEI A;  4EYW A;  1JW2 A;  4FK4 A;  4FJI A;  3QEW A;  4JS4 A;  3HP9 A;  5H37 A;  4AKH A;  1FZ7 E;  2OVQ B;  4AKI A;  3LDB A;  4DTN A;  2PFV A;  4ICG C;  2H4T A;  1FZ8 E;  4JRQ A;  3SQ1 A;  3NDK A;  3L8B A;  1FZ0 E;  2P5O A;  4JRP A;  2JH9 A;  4FVM A;  4FJH A;  4FJJ A;  4KHY A;  2JH8 A;  4X5N A;  3K2O A;  3LZJ A;  1XMH E;  3MKS B;  3L2O B;  3QET A;  2LF3 A;  4HCC A;  4KI4 A;  4DTP A;  1Q9Y A;  1FZ5 E;  3C6N B;  4DU3 A;  3TL8 B;  3SJJ A;  1P22 A;  2MMB A;  1N1C A;  4FJM A;  3NCI A;  3SUN A;  4FJ9 A;  3SQ4 A;  4GAM C;  3SVI A;  3NAE A;  4DTM A;  3SUP A;  3TAB A;  1FZ2 E;  4ADO A;  4FJ8 A;  4KHU A;  3J27 A;  1XVB E;  3UIQ A;  1IG9 A;  3QEV A;  2E32 A;  4FJ5 A;  4J2A A;  3TJY A;  1FZ9 E;  2VJ4 A;  2OVP B;  2P1Q B;  4M45 A;  3S9H A;  4J2D A;  2P1P B;  2P1N B;  3E4W A;  3HL8 A;  3N1E A;  4QND A;  3SPZ A;  4KHS A;  2FYO A;  1NEX B;  2JQT A;  3CFP A;  4RNG A;  2MW2 A;  3CFO A;  1FZI E;  2OVR B;  4DTX A;  3QES A;  1MHZ G;  1WAJ A;  5IBK B;  2RKH A;  3QEP A;  4FJL A;  2E31 A;  4KI6 A;  2P1M B;  2FW3 A;  2QXF A;  4AI6 A;  3SUO A;  3V7D B;  3HGK E;  1XL3 C;  3SNN A;  2P5G A;  1FS1 A;  3OGL B;  1FZ6 E;  1XMG E;  3CFR A;  4FJK A;  1FZ1 E;  1Q9X A;  2DEB A;  4KHN A;  2JHP A;  4EPH A;  2DY4 A;  3NGI A;  3OGM B;  1XVG E;  3BVO A;  4KHW A;  4EP9 A;  3RWU A;  3SPY A;  5IRE A;  4KHQ A; 
#chains in the Genus database with same CATH homology
 3TAG A;  4M3W A;  1IH7 A;  3OGK B;  4RL5 A;  4DTR A;  1FZ4 E;  4DTU A;  3QNN A;  3TAF A;  3C6P B;  3N1B A;  2LF6 A;  4M3Y A;  2JPN A;  3SQ0 A;  4I9Q A;  3LDS A;  4FJ7 A;  1XU5 E;  3C94 A;  4FJG A;  1WAF A;  4M41 A;  2B1E A;  3SUQ A;  3NHG A;  4M3T A;  2JHC A;  2B7M A;  3RMD A;  2B8I A;  3HGL A;  3KD1 E;  4FJN A;  1XVD E;  2YB5 A;  3E4Y A;  4X5M A;  2VJ5 A;  2OZM A;  4HCB A;  3CQ8 A;  4ADN A;  3QEX A;  4DTO A;  3KD5 E;  4M3U A;  3J2P A;  4DU4 A;  3NE6 A;  2HD0 A;  3TAE A;  2OZS A;  1XMF E;  3QER A;  1XVC E;  2RCU A;  2ATQ A;  4E3S A;  3SQ2 A;  4AKG A;  4FK2 A;  3RMA A;  3RMC A;  3LZI A;  2VIX A;  3SI6 A;  4DU1 A;  4QNC A;  4M3Z A;  2PFT A;  1MTY G;  1XVF E;  3WSO A;  3C95 A;  2JHA A;  3C6O B;  1FXX A;  1XU3 E;  5IZ7 A;  3RMB A;  1LDK E;  1FYZ E;  3QNO A;  1FZ3 E;  1MHY G;  4RG8 A;  4JS5 A;  4DTJ A;  3L0M A;  4I9L A;  2MZW B;  4FK0 A;  1MMO G;  4M3X A;  1CLQ A;  1XVE E;  1FZH E;  4J2E A;  3SCX A;  4I6J B;  2DTU A;  2P1O B;  4M3R A;  4DTS A;  2OYQ A;  4M42 A;  4FJX A;  4B08 A;  4J2B A;  4E4B A;  3L1N A;  3LD8 A;  3QEI A;  4EYW A;  4FK4 A;  4FJI A;  3QEW A;  4JS4 A;  3HP9 A;  5H37 A;  4AKH A;  1FZ7 E;  2OVQ B;  4AKI A;  3LDB A;  4DTN A;  2PFV A;  2H4T A;  1FZ8 E;  4JRQ A;  3SQ1 A;  3NDK A;  3L8B A;  1FZ0 E;  2P5O A;  4JRP A;  2JH9 A;  4FVM A;  4FJH A;  4FJJ A;  4KHY A;  2JH8 A;  4X5N A;  3K2O A;  3LZJ A;  1XMH E;  3MKS B;  3L2O B;  3QET A;  2LF3 A;  4HCC A;  4KI4 A;  4DTP A;  1Q9Y A;  1FZ5 E;  3C6N B;  4DU3 A;  3TL8 B;  3SJJ A;  1P22 A;  2MMB A;  4FJM A;  3NCI A;  3SUN A;  4FJ9 A;  3SQ4 A;  4GAM C;  3SVI A;  3NAE A;  4DTM A;  3SUP A;  3TAB A;  1FZ2 E;  4ADO A;  4FJ8 A;  4KHU A;  3J27 A;  1XVB E;  3UIQ A;  1IG9 A;  3QEV A;  2E32 A;  4FJ5 A;  4J2A A;  3TJY A;  1FZ9 E;  2VJ4 A;  2OVP B;  2P1Q B;  4M45 A;  3S9H A;  4J2D A;  2P1P B;  2P1N B;  3E4W A;  3HL8 A;  3N1E A;  4QND A;  3SPZ A;  4KHS A;  2FYO A;  1NEX B;  3CFP A;  4RNG A;  3CFO A;  1FZI E;  2OVR B;  4DTX A;  3QES A;  1MHZ G;  1WAJ A;  5IBK B;  3QEP A;  4FJL A;  2E31 A;  4KI6 A;  2P1M B;  2FW3 A;  2QXF A;  4AI6 A;  3SUO A;  3V7D B;  3HGK E;  1XL3 C;  3SNN A;  2P5G A;  1FS1 A;  3OGL B;  1FZ6 E;  1XMG E;  3CFR A;  4FJK A;  1FZ1 E;  1Q9X A;  2DEB A;  4KHN A;  2JHP A;  4EPH A;  2DY4 A;  3NGI A;  3OGM B;  1XVG E;  4KHW A;  4EP9 A;  3RWU A;  3SPY A;  5IRE A;  4KHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...