1XMHE

Structure of co(ii) reconstituted methane monooxygenase hydroxylase from m. capsulatus (bath)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
167
structure length
167
Chain Sequence
AKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preparation and X-ray Structures of Metal-Free, Dicobalt and Dimanganese Forms of Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath)
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
total genus 63
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmhE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmhE02
1FZ1E 1FZ3E 1MHYG 1FZ0E 1XVDE 1XVFE 1FYZE 1MMOG 4GAMC 1XU5E 1XVEE 1FZ5E 1XU3E 1XMHE 1MTYG 1FZ7E 1XMGE 1XVBE 1XVGE 1FZ4E 1FZIE 1FZ8E 1MHZG 1FZ6E 1FZ9E 1XMFE 1FZ2E 1FZHE 1XVCE
chains in the Genus database with same CATH superfamily
3NGIA 4FJKA 1MHYG 4I6JB 3L1NA 2RCUA 2QXFA 2OVQB 4DTSA 2K5SA 3LD8A 2VIXA 3BVOA 3QNNA 1JW2A 1MMOG 3SUOA 2DEBA 4AI6A 4FJMA 3QEPA 4M3TA 2DTUA 2P1MB 4EPHA 2JHAA 3SUNA 3CQ8A 3UO2A 5IBKB 3L8BA 4JS5A 3SCXA 4M45A 1IG9A 4IT5A 4EYWA 2OZSA 3SVIA 3MKSB 3NCIA 3CFPA 2OVPB 3SPZA 4HCCA 4DTPA 3SQ4A 2FW3A 2JH9A 2OZMA 4KI6A 4EP9A 4ADNA 3S9HA 5IREA 1FZIE 2MZWB 4X5NA 3HGLA 4JRQA 2P1OB 3RMAA 3HP9A 4DTMA 3QEWA 1FZ2E 1XVCE 2JH8A 3LZIA 4J2AA 4FJ5A 4FVMA 3TJYA 4I9LA 2JHPA 4KHWA 2JHCA 1Q9YA 2P5GA 1XVFE 3NHGA 3QEIA 3QESA 4M3ZA 3UIQA 2E31A 4RL5A 3QEVA 2P5OA 4DU4A 4KHYA 4FJ8A 3QERA 2RKHA 4AKGA 1IH7A 1FZ5E 2MW2A 1NEXB 3TAEA 3TABA 2PFTA 4FJXA 4KI4A 4QNDA 2LF3A 4ADOA 3SUQA 4M3WA 4M3XA 2OYQA 1FZ7E 4FJGA 4DTRA 3RMCA 2FYOA 2PFVA 4JS4A 4FJ7A 3LDSA 3J2PA 4DTNA 2P1NB 3SQ0A 2VJ5A 1MHZG 3NAEA 4AKIA 3RMDA 4J2EA 4KHNA 4KHQA 3HL8A 3C95A 4M41A 2B8IA 4FJNA 4M3YA 1P22A 3N1EA 1FZ1E 2E32A 5IZ7A 1FZ3E 1XL3C 3N1BA 4DTOA 3TAFA 3SQ2A 4DU1A 3SJJA 3SNNA 3RWUA 4DTXA 4KHSA 4AKHA 1XVDE 3SPYA 4FK2A 1WAFA 4RG8A 2YB5A 2HD0A 3E4WA 3QEXA 4GAMC 3CFOA 3SUPA 1XU5E 4QNCA 3KD1E 4FJ9A 3C6PB 3NE6A 1XU3E 4KHUA 3SQ1A 2P1PB 2H4TA 1LDKE 4X5MA 1XMGE 1XVBE 4M3UA 4FJJA 4FJHA 4I9QA 4J2DA 4FJLA 1FZ6E 3L0MA 2P1QB 1FZ9E 2MMBA 1FXXA 1XMFE 4B08A 1FZHE 3CFRA 3WSOA 4FK4A 2JPNA 1CLQA 3LZJA 3TL8B 1Q9XA 1FZ0E 2OVRB 1WAJA 5H37A 3J27A 2B1EA 1FYZE 3SI6A 4J2BA 3L2OB 4DTJA 3LDBA 3C6NB 2LF6A 4JRPA 3OGLB 2VJ4A 1XVEE 2JQTA 4RNGA 3NDKA 4DU3A 1FS1A 3QETA 3C94A 1MTYG 1XMHE 3UO3A 4FJIA 3E4YA 3HGKE 3K2OA 3TAGA 3KD5E 3V7DB 2B7MA 1XVGE 2DY4A 1FZ4E 4M3RA 3QNOA 1FPOA 1FZ8E 4DTUA 3RMBA 4HCBA 4M42A 3C6OB 3OGMB 4ICGC 4E3SA 2ATQA 3OGKB 4E4BA 1N1CA 4FK0A
chains in the Genus database with same CATH topology
3NGIA 4FJKA 1MHYG 4I6JB 3L1NA 2RCUA 2QXFA 2OVQB 4DTSA 3LD8A 2VIXA 3QNNA 1MMOG 3SUOA 2DEBA 4AI6A 4FJMA 3QEPA 4M3TA 2DTUA 2P1MB 4EPHA 2JHAA 3SUNA 3CQ8A 1IG9A 5IBKB 3L8BA 4JS5A 3SCXA 4M45A 4EYWA 2OZSA 3SVIA 3MKSB 3NCIA 3CFPA 2OVPB 3SPZA 4HCCA 4DTPA 3SQ4A 2FW3A 2JH9A 2OZMA 4KI6A 4EP9A 4ADNA 3S9HA 5IREA 1FZIE 2MZWB 4X5NA 3HGLA 4JRQA 2P1OB 3RMAA 3HP9A 4DTMA 3QEWA 1FZ2E 1XVCE 2JH8A 3LZIA 4J2AA 4FJ5A 4FVMA 3TJYA 4I9LA 2JHPA 4KHWA 2JHCA 1Q9YA 2P5GA 1XVFE 3NHGA 3QEIA 3QESA 4M3ZA 3UIQA 2E31A 4RL5A 3QEVA 2P5OA 4DU4A 4KHYA 4FJ8A 3QERA 4AKGA 1IH7A 1FZ5E 3TAEA 1NEXB 4KI4A 3TABA 2PFTA 4FJXA 4M3WA 4QNDA 2LF3A 4ADOA 3SUQA 4M3XA 2OYQA 1FZ7E 4FJGA 4DTRA 3RMCA 2FYOA 2PFVA 4JS4A 4FJ7A 3LDSA 3J2PA 4DTNA 2P1NB 3SQ0A 2VJ5A 1MHZG 3NAEA 4AKIA 3RMDA 4J2EA 4KHNA 4KHQA 3HL8A 3C95A 4M41A 2B8IA 4FJNA 4M3YA 1P22A 3N1EA 1FZ1E 2E32A 5IZ7A 1FZ3E 1XL3C 3N1BA 4DTOA 3TAFA 3SQ2A 4DU1A 3SJJA 3SNNA 3RWUA 4DTXA 4KHSA 4AKHA 1XVDE 3SPYA 4FK2A 1WAFA 4RG8A 2YB5A 2HD0A 3E4WA 3QEXA 4GAMC 3CFOA 3SUPA 1XU5E 4QNCA 3KD1E 4FJ9A 3C6PB 3NE6A 1XU3E 4KHUA 3SQ1A 2P1PB 2H4TA 1LDKE 4X5MA 1XMGE 1XVBE 4M3UA 4FJJA 4FJHA 4I9QA 4J2DA 4FJLA 1FZ6E 3L0MA 2P1QB 1FZ9E 2MMBA 1FXXA 1XMFE 4B08A 1FZHE 3CFRA 3WSOA 4FK4A 2JPNA 1CLQA 3LZJA 3TL8B 1Q9XA 1FZ0E 2OVRB 1WAJA 5H37A 3J27A 2B1EA 1FYZE 3SI6A 4J2BA 3L2OB 4DTJA 3LDBA 3C6NB 2LF6A 4JRPA 3OGLB 2VJ4A 1XVEE 4DU3A 4RNGA 3NDKA 1FS1A 3QETA 3C94A 1MTYG 1XMHE 4FJIA 3E4YA 3HGKE 3K2OA 3TAGA 3KD5E 3V7DB 2B7MA 1XVGE 2DY4A 1FZ4E 4M3RA 3QNOA 1FZ8E 3RMBA 4DTUA 4HCBA 4M42A 3C6OB 3OGMB 4E3SA 2ATQA 3OGKB 4E4BA 4FK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ1 E;  1FZ3 E;  1MHY G;  1FZ0 E;  1XVD E;  1XVF E;  1FYZ E;  1MMO G;  4GAM C;  1XU5 E;  1XVE E;  1FZ5 E;  1XU3 E;  1XMH E;  1MTY G;  1FZ7 E;  1XMG E;  1XVB E;  1XVG E;  1FZ4 E;  1FZI E;  1FZ8 E;  1MHZ G;  1FZ6 E;  1FZ9 E;  1XMF E;  1FZ2 E;  1FZH E;  1XVC E; 
#chains in the Genus database with same CATH topology
 3NGI A;  4FJK A;  1MHY G;  4I6J B;  3L1N A;  2RCU A;  2QXF A;  2OVQ B;  4DTS A;  2K5S A;  3LD8 A;  2VIX A;  3BVO A;  3QNN A;  1JW2 A;  1MMO G;  3SUO A;  2DEB A;  4AI6 A;  4FJM A;  3QEP A;  4M3T A;  2DTU A;  2P1M B;  4EPH A;  2JHA A;  3SUN A;  3CQ8 A;  3UO2 A;  5IBK B;  3L8B A;  4JS5 A;  3SCX A;  4M45 A;  1IG9 A;  4IT5 A;  4EYW A;  2OZS A;  3SVI A;  3MKS B;  3NCI A;  3CFP A;  2OVP B;  3SPZ A;  4HCC A;  4DTP A;  3SQ4 A;  2FW3 A;  2JH9 A;  2OZM A;  4KI6 A;  4EP9 A;  4ADN A;  3S9H A;  5IRE A;  1FZI E;  2MZW B;  4X5N A;  3HGL A;  4JRQ A;  2P1O B;  3RMA A;  3HP9 A;  4DTM A;  3QEW A;  1FZ2 E;  1XVC E;  2JH8 A;  3LZI A;  4J2A A;  4FJ5 A;  4FVM A;  3TJY A;  4I9L A;  2JHP A;  4KHW A;  2JHC A;  1Q9Y A;  2P5G A;  1XVF E;  3NHG A;  3QEI A;  3QES A;  4M3Z A;  3UIQ A;  2E31 A;  4RL5 A;  3QEV A;  2P5O A;  4DU4 A;  4KHY A;  4FJ8 A;  3QER A;  2RKH A;  4AKG A;  1IH7 A;  1FZ5 E;  2MW2 A;  1NEX B;  3TAE A;  3TAB A;  2PFT A;  4FJX A;  4KI4 A;  4QND A;  2LF3 A;  4ADO A;  3SUQ A;  4M3W A;  4M3X A;  2OYQ A;  1FZ7 E;  4FJG A;  4DTR A;  3RMC A;  2FYO A;  2PFV A;  4JS4 A;  4FJ7 A;  3LDS A;  3J2P A;  4DTN A;  2P1N B;  3SQ0 A;  2VJ5 A;  1MHZ G;  3NAE A;  4AKI A;  3RMD A;  4J2E A;  4KHN A;  4KHQ A;  3HL8 A;  3C95 A;  4M41 A;  2B8I A;  4FJN A;  4M3Y A;  1P22 A;  3N1E A;  1FZ1 E;  2E32 A;  5IZ7 A;  1FZ3 E;  1XL3 C;  3N1B A;  4DTO A;  3TAF A;  3SQ2 A;  4DU1 A;  3SJJ A;  3SNN A;  3RWU A;  4DTX A;  4KHS A;  4AKH A;  1XVD E;  3SPY A;  4FK2 A;  1WAF A;  4RG8 A;  2YB5 A;  2HD0 A;  3E4W A;  3QEX A;  4GAM C;  3CFO A;  3SUP A;  1XU5 E;  4QNC A;  3KD1 E;  4FJ9 A;  3C6P B;  3NE6 A;  1XU3 E;  4KHU A;  3SQ1 A;  2P1P B;  2H4T A;  1LDK E;  4X5M A;  1XMG E;  1XVB E;  4M3U A;  4FJJ A;  4FJH A;  4I9Q A;  4J2D A;  4FJL A;  1FZ6 E;  3L0M A;  2P1Q B;  1FZ9 E;  2MMB A;  1FXX A;  1XMF E;  4B08 A;  1FZH E;  3CFR A;  3WSO A;  4FK4 A;  2JPN A;  1CLQ A;  3LZJ A;  3TL8 B;  1Q9X A;  1FZ0 E;  2OVR B;  1WAJ A;  5H37 A;  3J27 A;  2B1E A;  1FYZ E;  3SI6 A;  4J2B A;  3L2O B;  4DTJ A;  3LDB A;  3C6N B;  2LF6 A;  4JRP A;  3OGL B;  2VJ4 A;  1XVE E;  2JQT A;  4RNG A;  3NDK A;  4DU3 A;  1FS1 A;  3QET A;  3C94 A;  1MTY G;  1XMH E;  3UO3 A;  4FJI A;  3E4Y A;  3HGK E;  3K2O A;  3TAG A;  3KD5 E;  3V7D B;  2B7M A;  1XVG E;  2DY4 A;  1FZ4 E;  4M3R A;  3QNO A;  1FPO A;  1FZ8 E;  4DTU A;  3RMB A;  4HCB A;  4M42 A;  3C6O B;  3OGM B;  4ICG C;  4E3S A;  2ATQ A;  3OGK B;  4E4B A;  1N1C A;  4FK0 A; 
#chains in the Genus database with same CATH homology
 3NGI A;  4FJK A;  1MHY G;  4I6J B;  3L1N A;  2RCU A;  2QXF A;  2OVQ B;  4DTS A;  3LD8 A;  2VIX A;  3QNN A;  1MMO G;  3SUO A;  2DEB A;  4AI6 A;  4FJM A;  3QEP A;  4M3T A;  2DTU A;  2P1M B;  4EPH A;  2JHA A;  3SUN A;  3CQ8 A;  1IG9 A;  5IBK B;  3L8B A;  4JS5 A;  3SCX A;  4M45 A;  4EYW A;  2OZS A;  3SVI A;  3MKS B;  3NCI A;  3CFP A;  2OVP B;  3SPZ A;  4HCC A;  4DTP A;  3SQ4 A;  2FW3 A;  2JH9 A;  2OZM A;  4KI6 A;  4EP9 A;  4ADN A;  3S9H A;  5IRE A;  1FZI E;  2MZW B;  4X5N A;  3HGL A;  4JRQ A;  2P1O B;  3RMA A;  3HP9 A;  4DTM A;  3QEW A;  1FZ2 E;  1XVC E;  2JH8 A;  3LZI A;  4J2A A;  4FJ5 A;  4FVM A;  3TJY A;  4I9L A;  2JHP A;  4KHW A;  2JHC A;  1Q9Y A;  2P5G A;  1XVF E;  3NHG A;  3QEI A;  3QES A;  4M3Z A;  3UIQ A;  2E31 A;  4RL5 A;  3QEV A;  2P5O A;  4DU4 A;  4KHY A;  4FJ8 A;  3QER A;  4AKG A;  1IH7 A;  1FZ5 E;  3TAE A;  1NEX B;  4KI4 A;  3TAB A;  2PFT A;  4FJX A;  4M3W A;  4QND A;  2LF3 A;  4ADO A;  3SUQ A;  4M3X A;  2OYQ A;  1FZ7 E;  4FJG A;  4DTR A;  3RMC A;  2FYO A;  2PFV A;  4JS4 A;  4FJ7 A;  3LDS A;  3J2P A;  4DTN A;  2P1N B;  3SQ0 A;  2VJ5 A;  1MHZ G;  3NAE A;  4AKI A;  3RMD A;  4J2E A;  4KHN A;  4KHQ A;  3HL8 A;  3C95 A;  4M41 A;  2B8I A;  4FJN A;  4M3Y A;  1P22 A;  3N1E A;  1FZ1 E;  2E32 A;  5IZ7 A;  1FZ3 E;  1XL3 C;  3N1B A;  4DTO A;  3TAF A;  3SQ2 A;  4DU1 A;  3SJJ A;  3SNN A;  3RWU A;  4DTX A;  4KHS A;  4AKH A;  1XVD E;  3SPY A;  4FK2 A;  1WAF A;  4RG8 A;  2YB5 A;  2HD0 A;  3E4W A;  3QEX A;  4GAM C;  3CFO A;  3SUP A;  1XU5 E;  4QNC A;  3KD1 E;  4FJ9 A;  3C6P B;  3NE6 A;  1XU3 E;  4KHU A;  3SQ1 A;  2P1P B;  2H4T A;  1LDK E;  4X5M A;  1XMG E;  1XVB E;  4M3U A;  4FJJ A;  4FJH A;  4I9Q A;  4J2D A;  4FJL A;  1FZ6 E;  3L0M A;  2P1Q B;  1FZ9 E;  2MMB A;  1FXX A;  1XMF E;  4B08 A;  1FZH E;  3CFR A;  3WSO A;  4FK4 A;  2JPN A;  1CLQ A;  3LZJ A;  3TL8 B;  1Q9X A;  1FZ0 E;  2OVR B;  1WAJ A;  5H37 A;  3J27 A;  2B1E A;  1FYZ E;  3SI6 A;  4J2B A;  3L2O B;  4DTJ A;  3LDB A;  3C6N B;  2LF6 A;  4JRP A;  3OGL B;  2VJ4 A;  1XVE E;  4DU3 A;  4RNG A;  3NDK A;  1FS1 A;  3QET A;  3C94 A;  1MTY G;  1XMH E;  4FJI A;  3E4Y A;  3HGK E;  3K2O A;  3TAG A;  3KD5 E;  3V7D B;  2B7M A;  1XVG E;  2DY4 A;  1FZ4 E;  4M3R A;  3QNO A;  1FZ8 E;  3RMB A;  4DTU A;  4HCB A;  4M42 A;  3C6O B;  3OGM B;  4E3S A;  2ATQ A;  3OGK B;  4E4B A;  4FK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...