1XMHE

Structure of co(ii) reconstituted methane monooxygenase hydroxylase from m. capsulatus (bath)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
167
structure length
167
Chain Sequence
b'AKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Preparation and X-ray Structures of Metal-Free, Dicobalt and Dimanganese Forms of Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath)
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmhE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmhE02
1MMOG 1FZ4E 1XMGE 1FZ9E 1XMFE 1FZ6E 1FYZE 1FZ3E 1FZ7E 1XVEE 1XVFE 4GAMC 1MHYG 1MTYG 1FZ2E 1XU3E 1FZ1E 1FZHE 1FZIE 1FZ0E 1XVBE 1XVDE 1MHZG 1XMHE 1XU5E 1XVCE 1FZ5E 1FZ8E 1XVGE
chains in the Genus database with same CATH superfamily
3NCIA 3C6OB 1XMFE 2JHAA 4J2DA 2YB5A 4B08A 4RNGA 3L8BA 4EPHA 3SJJA 3SQ1A 1XVEE 4I9LA 2JQTA 1LDKE 2FYOA 3HGLA 2JH8A 1XU3E 3N1EA 1FPOA 3RMAA 4FJKA 3RWUA 3NDKA 3UO3A 4M45A 2OVPB 1FZ0E 1XVBE 4KHYA 3SUQA 2OVQB 3TABA 4ICGC 4FJXA 5H37A 4FJ9A 3HL8A 1FZ5E 3L2OB 4KHWA 4RL5A 4FVMA 4KHQA 1XVGE 1MMOG 1FS1A 1FZ4E 1FZ9E 3NHGA 4EP9A 1FZ6E 2E32A 3E4WA 3WSOA 3SQ2A 2B8IA 3NAEA 4JRPA 4DU1A 1NEXB 3NGIA 4DTXA 2JHPA 2OVRB 1Q9YA 4FK2A 2P1NB 4DTSA 3CFPA 4FJJA 2E31A 4M41A 3QEWA 4J2EA 4KHNA 4M3TA 3V7DB 2JPNA 3NE6A 2HD0A 2QXFA 3C6NB 3HGKE 1FZ2E 4JS4A 3UIQA 4KHSA 4ADOA 2DTUA 4DTOA 3TAFA 1WAFA 4M3RA 1JW2A 1FZ1E 1FZHE 3SQ4A 2P1MB 2PFVA 4IT5A 1XU5E 4JRQA 1XVCE 4QNCA 3CFRA 3QNOA 4M3WA 3OGLB 3QEPA 5IBKB 4J2AA 2LF3A 2PFTA 4KHUA 3QEVA 1Q9XA 3BVOA 2MZWB 1XMGE 3LZJA 4AI6A 4FJGA 3C95A 1FZ3E 3L0MA 3QNNA 1FZ7E 3N1BA 3TL8B 4DTJA 4FJIA 1FXXA 3QESA 1IG9A 4FK0A 3TAEA 4FJLA 1CLQA 4E3SA 3L1NA 4FK4A 3SCXA 1XVFE 4GAMC 4X5NA 1WAJA 1MHYG 3SUOA 2K5SA 1MTYG 4DTRA 4KI6A 1XL3C 2MW2A 3QETA 2B7MA 5IZ7A 2MMBA 3J2PA 1FZIE 4FJNA 4AKGA 2P1OB 4FJMA 4M3YA 1XVDE 1N1CA 4M3ZA 1MHZG 1XMHE 4FJ7A 3HP9A 3OGMB 1P22A 3RMDA 4J2BA 2FW3A 3KD5E 2VJ4A 5IREA 2P1PB 3LDSA 3SPZA 4M3UA 2P5GA 4QNDA 3C94A 4M42A 4AKIA 3KD1E 2B1EA 4RG8A 2P5OA 4I9QA 1FYZE 3QEXA 3SQ0A 4AKHA 4FJ5A 4DU3A 3QEIA 4FJHA 3SUNA 4DTPA 3C6PB 3OGKB 3RMBA 3SVIA 3SI6A 2ATQA 3MKSB 2OZSA 2OZMA 4DTMA 2LF6A 4ADNA 4FJ8A 1IH7A 4JS5A 3SUPA 2VIXA 2H4TA 3CFOA 4HCBA 3TJYA 4E4BA 2JHCA 2JH9A 2RCUA 3TAGA 2DEBA 4DU4A 4HCCA 4M3XA 4EYWA 4X5MA 3LZIA 2DY4A 3K2OA 2VJ5A 3SNNA 3LDBA 4DTUA 2OYQA 1FZ8E 3J27A 3LD8A 3UO2A 2P1QB 3CQ8A 4DTNA 3QERA 3RMCA 3S9HA 3SPYA 2RKHA 4KI4A 3E4YA 4I6JB
chains in the Genus database with same CATH topology
3NCIA 3C6OB 1XMFE 2JHAA 4J2DA 2YB5A 4B08A 4RNGA 3L8BA 4EPHA 3SJJA 3SQ1A 1XVEE 4I9LA 1LDKE 2FYOA 3HGLA 2JH8A 1XU3E 3N1EA 3RMAA 4FJKA 3RWUA 3NDKA 4M45A 2OVPB 1FZ0E 1XVBE 4KHYA 3SUQA 2OVQB 3TABA 4FJXA 5H37A 4FJ9A 3HL8A 1FZ5E 3L2OB 4KHWA 4RL5A 4FVMA 1XVGE 1MMOG 1FS1A 1FZ4E 1FZ9E 3NHGA 4EP9A 1FZ6E 2E32A 3E4WA 3WSOA 3SQ2A 2B8IA 3NAEA 4JRPA 4DU1A 1NEXB 3NGIA 4DTXA 2JHPA 2OVRB 1Q9YA 4FK2A 2P1NB 4DTSA 3CFPA 4FJJA 2E31A 4M41A 3QEWA 4J2EA 4KHNA 4M3TA 3V7DB 2JPNA 3NE6A 2HD0A 2QXFA 3C6NB 3HGKE 1FZ2E 4JS4A 3UIQA 4KHSA 4ADOA 2DTUA 4DTOA 3TAFA 1WAFA 4M3RA 1FZ1E 1FZHE 3SQ4A 2P1MB 2PFVA 1XU5E 4JRQA 1XVCE 4QNCA 3CFRA 3QNOA 4M3WA 3OGLB 3QEPA 5IBKB 4J2AA 2LF3A 2PFTA 4KHUA 3QEVA 1Q9XA 2MZWB 1XMGE 3LZJA 4AI6A 4FJGA 3C95A 1FZ3E 3L0MA 3QNNA 1FZ7E 3N1BA 3TL8B 4DTJA 4FJIA 1FXXA 3QESA 1IG9A 4FK0A 3TAEA 4FJLA 1CLQA 4E3SA 3L1NA 4FK4A 3SCXA 1XVFE 4GAMC 4X5NA 1WAJA 1MHYG 3SUOA 1MTYG 4DTRA 4KI6A 1XL3C 3QETA 2B7MA 5IZ7A 2MMBA 3J2PA 1FZIE 4FJNA 4AKGA 2P1OB 4FJMA 4M3YA 1XVDE 4M3ZA 1MHZG 1XMHE 4FJ7A 3HP9A 3OGMB 1P22A 3RMDA 4J2BA 2FW3A 3KD5E 2VJ4A 5IREA 2P1PB 3LDSA 3SPZA 4M3UA 2P5GA 4QNDA 3C94A 4M42A 4AKIA 3KD1E 2B1EA 4RG8A 2P5OA 4I9QA 1FYZE 3QEXA 3SQ0A 4AKHA 4FJ5A 4DU3A 3QEIA 4FJHA 3SUNA 4DTPA 3C6PB 3OGKB 3RMBA 3SVIA 3SI6A 2ATQA 3MKSB 2OZSA 2OZMA 4DTMA 2LF6A 4ADNA 4FJ8A 1IH7A 4JS5A 3SUPA 2VIXA 2H4TA 4HCBA 3TJYA 4E4BA 2JHCA 2JH9A 2RCUA 3TAGA 2DEBA 4DU4A 4HCCA 4M3XA 4EYWA 4X5MA 3LZIA 2DY4A 3K2OA 2VJ5A 3SNNA 3LDBA 4DTUA 2OYQA 1FZ8E 3J27A 3LD8A 3CQ8A 2P1QB 4DTNA 3QERA 3S9HA 3RMCA 3SPYA 4KI4A 3CFOA 4KHQA 3E4YA 4I6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMO G;  1FZ4 E;  1XMG E;  1FZ9 E;  1XMF E;  1FZ6 E;  1FYZ E;  1FZ3 E;  1FZ7 E;  1XVE E;  1XVF E;  4GAM C;  1MHY G;  1MTY G;  1FZ2 E;  1XU3 E;  1FZ1 E;  1FZH E;  1FZI E;  1FZ0 E;  1XVB E;  1XVD E;  1MHZ G;  1XMH E;  1XU5 E;  1XVC E;  1FZ5 E;  1FZ8 E;  1XVG E; 
#chains in the Genus database with same CATH topology
 3NCI A;  3C6O B;  1XMF E;  2JHA A;  4J2D A;  2YB5 A;  4B08 A;  4RNG A;  3L8B A;  4EPH A;  3SJJ A;  3SQ1 A;  1XVE E;  4I9L A;  2JQT A;  1LDK E;  2FYO A;  3HGL A;  2JH8 A;  1XU3 E;  3N1E A;  1FPO A;  3RMA A;  4FJK A;  3RWU A;  3NDK A;  3UO3 A;  4M45 A;  2OVP B;  1FZ0 E;  1XVB E;  4KHY A;  3SUQ A;  2OVQ B;  3TAB A;  4ICG C;  4FJX A;  5H37 A;  4FJ9 A;  3HL8 A;  1FZ5 E;  3L2O B;  4KHW A;  4RL5 A;  4FVM A;  4KHQ A;  1XVG E;  1MMO G;  1FS1 A;  1FZ4 E;  1FZ9 E;  3NHG A;  4EP9 A;  1FZ6 E;  2E32 A;  3E4W A;  3WSO A;  3SQ2 A;  2B8I A;  3NAE A;  4JRP A;  4DU1 A;  1NEX B;  3NGI A;  4DTX A;  2JHP A;  2OVR B;  1Q9Y A;  4FK2 A;  2P1N B;  4DTS A;  3CFP A;  4FJJ A;  2E31 A;  4M41 A;  3QEW A;  4J2E A;  4KHN A;  4M3T A;  3V7D B;  2JPN A;  3NE6 A;  2HD0 A;  2QXF A;  3C6N B;  3HGK E;  1FZ2 E;  4JS4 A;  3UIQ A;  4KHS A;  4ADO A;  2DTU A;  4DTO A;  3TAF A;  1WAF A;  4M3R A;  1JW2 A;  1FZ1 E;  1FZH E;  3SQ4 A;  2P1M B;  2PFV A;  4IT5 A;  1XU5 E;  4JRQ A;  1XVC E;  4QNC A;  3CFR A;  3QNO A;  4M3W A;  3OGL B;  3QEP A;  5IBK B;  4J2A A;  2LF3 A;  2PFT A;  4KHU A;  3QEV A;  1Q9X A;  3BVO A;  2MZW B;  1XMG E;  3LZJ A;  4AI6 A;  4FJG A;  3C95 A;  1FZ3 E;  3L0M A;  3QNN A;  1FZ7 E;  3N1B A;  3TL8 B;  4DTJ A;  4FJI A;  1FXX A;  3QES A;  1IG9 A;  4FK0 A;  3TAE A;  4FJL A;  1CLQ A;  4E3S A;  3L1N A;  4FK4 A;  3SCX A;  1XVF E;  4GAM C;  4X5N A;  1WAJ A;  1MHY G;  3SUO A;  2K5S A;  1MTY G;  4DTR A;  4KI6 A;  1XL3 C;  2MW2 A;  3QET A;  2B7M A;  5IZ7 A;  2MMB A;  3J2P A;  1FZI E;  4FJN A;  4AKG A;  2P1O B;  4FJM A;  4M3Y A;  1XVD E;  1N1C A;  4M3Z A;  1MHZ G;  1XMH E;  4FJ7 A;  3HP9 A;  3OGM B;  1P22 A;  3RMD A;  4J2B A;  2FW3 A;  3KD5 E;  2VJ4 A;  5IRE A;  2P1P B;  3LDS A;  3SPZ A;  4M3U A;  2P5G A;  4QND A;  3C94 A;  4M42 A;  4AKI A;  3KD1 E;  2B1E A;  4RG8 A;  2P5O A;  4I9Q A;  1FYZ E;  3QEX A;  3SQ0 A;  4AKH A;  4FJ5 A;  4DU3 A;  3QEI A;  4FJH A;  3SUN A;  4DTP A;  3C6P B;  3OGK B;  3RMB A;  3SVI A;  3SI6 A;  2ATQ A;  3MKS B;  2OZS A;  2OZM A;  4DTM A;  2LF6 A;  4ADN A;  4FJ8 A;  1IH7 A;  4JS5 A;  3SUP A;  2VIX A;  2H4T A;  3CFO A;  4HCB A;  3TJY A;  4E4B A;  2JHC A;  2JH9 A;  2RCU A;  3TAG A;  2DEB A;  4DU4 A;  4HCC A;  4M3X A;  4EYW A;  4X5M A;  3LZI A;  2DY4 A;  3K2O A;  2VJ5 A;  3SNN A;  3LDB A;  4DTU A;  2OYQ A;  1FZ8 E;  3J27 A;  3LD8 A;  3UO2 A;  2P1Q B;  3CQ8 A;  4DTN A;  3QER A;  3RMC A;  3S9H A;  3SPY A;  2RKH A;  4KI4 A;  3E4Y A;  4I6J B; 
#chains in the Genus database with same CATH homology
 3NCI A;  3C6O B;  1XMF E;  2JHA A;  4J2D A;  2YB5 A;  4B08 A;  4RNG A;  3L8B A;  4EPH A;  3SJJ A;  3SQ1 A;  1XVE E;  4I9L A;  1LDK E;  2FYO A;  3HGL A;  2JH8 A;  1XU3 E;  3N1E A;  3RMA A;  4FJK A;  3RWU A;  3NDK A;  4M45 A;  2OVP B;  1FZ0 E;  1XVB E;  4KHY A;  3SUQ A;  2OVQ B;  3TAB A;  4FJX A;  5H37 A;  4FJ9 A;  3HL8 A;  1FZ5 E;  3L2O B;  4KHW A;  4RL5 A;  4FVM A;  1XVG E;  1MMO G;  1FS1 A;  1FZ4 E;  1FZ9 E;  3NHG A;  4EP9 A;  1FZ6 E;  2E32 A;  3E4W A;  3WSO A;  3SQ2 A;  2B8I A;  3NAE A;  4JRP A;  4DU1 A;  1NEX B;  3NGI A;  4DTX A;  2JHP A;  2OVR B;  1Q9Y A;  4FK2 A;  2P1N B;  4DTS A;  3CFP A;  4FJJ A;  2E31 A;  4M41 A;  3QEW A;  4J2E A;  4KHN A;  4M3T A;  3V7D B;  2JPN A;  3NE6 A;  2HD0 A;  2QXF A;  3C6N B;  3HGK E;  1FZ2 E;  4JS4 A;  3UIQ A;  4KHS A;  4ADO A;  2DTU A;  4DTO A;  3TAF A;  1WAF A;  4M3R A;  1FZ1 E;  1FZH E;  3SQ4 A;  2P1M B;  2PFV A;  1XU5 E;  4JRQ A;  1XVC E;  4QNC A;  3CFR A;  3QNO A;  4M3W A;  3OGL B;  3QEP A;  5IBK B;  4J2A A;  2LF3 A;  2PFT A;  4KHU A;  3QEV A;  1Q9X A;  2MZW B;  1XMG E;  3LZJ A;  4AI6 A;  4FJG A;  3C95 A;  1FZ3 E;  3L0M A;  3QNN A;  1FZ7 E;  3N1B A;  3TL8 B;  4DTJ A;  4FJI A;  1FXX A;  3QES A;  1IG9 A;  4FK0 A;  3TAE A;  4FJL A;  1CLQ A;  4E3S A;  3L1N A;  4FK4 A;  3SCX A;  1XVF E;  4GAM C;  4X5N A;  1WAJ A;  1MHY G;  3SUO A;  1MTY G;  4DTR A;  4KI6 A;  1XL3 C;  3QET A;  2B7M A;  5IZ7 A;  2MMB A;  3J2P A;  1FZI E;  4FJN A;  4AKG A;  2P1O B;  4FJM A;  4M3Y A;  1XVD E;  4M3Z A;  1MHZ G;  1XMH E;  4FJ7 A;  3HP9 A;  3OGM B;  1P22 A;  3RMD A;  4J2B A;  2FW3 A;  3KD5 E;  2VJ4 A;  5IRE A;  2P1P B;  3LDS A;  3SPZ A;  4M3U A;  2P5G A;  4QND A;  3C94 A;  4M42 A;  4AKI A;  3KD1 E;  2B1E A;  4RG8 A;  2P5O A;  4I9Q A;  1FYZ E;  3QEX A;  3SQ0 A;  4AKH A;  4FJ5 A;  4DU3 A;  3QEI A;  4FJH A;  3SUN A;  4DTP A;  3C6P B;  3OGK B;  3RMB A;  3SVI A;  3SI6 A;  2ATQ A;  3MKS B;  2OZS A;  2OZM A;  4DTM A;  2LF6 A;  4ADN A;  4FJ8 A;  1IH7 A;  4JS5 A;  3SUP A;  2VIX A;  2H4T A;  4HCB A;  3TJY A;  4E4B A;  2JHC A;  2JH9 A;  2RCU A;  3TAG A;  2DEB A;  4DU4 A;  4HCC A;  4M3X A;  4EYW A;  4X5M A;  3LZI A;  2DY4 A;  3K2O A;  2VJ5 A;  3SNN A;  3LDB A;  4DTU A;  2OYQ A;  1FZ8 E;  3J27 A;  3LD8 A;  3CQ8 A;  2P1Q B;  4DTN A;  3QER A;  3S9H A;  3RMC A;  3SPY A;  4KI4 A;  3CFO A;  4KHQ A;  3E4Y A;  4I6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...