1XMHE

Structure of co(ii) reconstituted methane monooxygenase hydroxylase from m. capsulatus (bath)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
167
structure length
167
Chain Sequence
AKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Preparation and X-ray Structures of Metal-Free, Dicobalt and Dimanganese Forms of Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath)
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmhE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmhE02
1MMOG 1XMHE 1FZ2E 1XVBE 1XVDE 1XVCE 1FZ9E 1FZ7E 1FZHE 1FZ3E 1XMGE 1MHZG 4GAMC 1FZ6E 1FZ4E 1FZ0E 1XVGE 1XVEE 1FZ1E 1FZ8E 1FZ5E 1XMFE 1FZIE 1FYZE 1XVFE 1MHYG 1XU3E 1XU5E 1MTYG
chains in the Genus database with same CATH superfamily
2JHAA 4X5MA 3UO3A 1FZ2E 3LZJA 4FJGA 2VJ5A 1XVDE 2E32A 2P1PB 2PFVA 2P1QB 4DTXA 2DY4A 3NE6A 3NCIA 4KHSA 1WAJA 3SUOA 4RL5A 4FK2A 4EPHA 3CFPA 2JHPA 2ATQA 4FJJA 3QNNA 3OGKB 4DTPA 4ADOA 4FJMA 4DU4A 3CFOA 2RKHA 2P5GA 4KHYA 2PFTA 4KHWA 4JS4A 1Q9YA 3SUNA 1P22A 3SUPA 3SVIA 4FJIA 3NDKA 4M3UA 1FZ0E 1WAFA 3K2OA 4DTRA 1FZ1E 2B1EA 1XMFE 2P1OB 2JQTA 4FJLA 4FJKA 4JS5A 1MHYG 4M3WA 1CLQA 3C94A 3QESA 3WSOA 3UO2A 4KHNA 1XVBE 4E3SA 3SJJA 3SQ4A 3L0MA 4DTOA 2LF3A 3TAGA 3RMAA 2P1NB 4M3ZA 1XL3C 4M3RA 2OVQB 2QXFA 1FS1A 2JHCA 4J2EA 3TAEA 4ICGC 3SPZA 2FYOA 2OZSA 3N1BA 2JPNA 3E4YA 3HL8A 3SCXA 4J2AA 3LDSA 1FZ6E 2RCUA 3QEWA 1Q9XA 3TJYA 3CFRA 4M3YA 4AKHA 1FZ4E 2B8IA 2VJ4A 4IT5A 4RNGA 1N1CA 1XVGE 5IBKB 3QEXA 1FZ8E 2OVRB 2MMBA 4X5NA 3HP9A 3RMDA 2P5OA 4FJNA 3NAEA 3TAFA 4EP9A 5IZ7A 2LF6A 3LDBA 3HGKE 3QEVA 2VIXA 3NGIA 3RMBA 1LDKE 4DU3A 4FJ5A 4J2BA 4M42A 2MW2A 1XMHE 2FW3A 2K5SA 4FVMA 4KI6A 4QNCA 3SI6A 4KI4A 4AKGA 1FZ9E 4DTNA 3SNNA 3RWUA 1FZ7E 3C6NB 3E4WA 4EYWA 3SPYA 3SQ1A 3NHGA 3LZIA 1FZ3E 3OGMB 3QEPA 4HCBA 4GAMC 4FK0A 4KHUA 4M41A 1IG9A 4DU1A 2DEBA 4M3XA 3SQ0A 2E31A 3N1EA 4J2DA 1FZ5E 2H4TA 3C6PB 3TABA 1FYZE 1NEXB 4I9LA 4AI6A 4FK4A 3OGLB 4KHQA 4I9QA 1XU5E 2MZWB 4DTUA 2P1MB 3V7DB 3RMCA 4AKIA 3TL8B 1MTYG 1JW2A 3J2PA 4I6JB 3MKSB 1MMOG 3BVOA 2HD0A 4HCCA 1IH7A 1XVCE 3KD1E 2B7MA 3HGLA 4M45A 4JRQA 4JRPA 5H37A 3C95A 3QETA 2OZMA 3KD5E 3QEIA 2JH9A 1FZHE 4E4BA 4DTJA 1XMGE 2YB5A 4FJ8A 3QNOA 1MHZG 4FJXA 3LD8A 2DTUA 4FJHA 3C6OB 4DTMA 4FJ9A 4FJ7A 2OYQA 1XVEE 2JH8A 3J27A 3SUQA 5IREA 3UIQA 4B08A 1FZIE 1XVFE 2OVPB 4QNDA 4ADNA 3S9HA 3CQ8A 3L1NA 1FXXA 3SQ2A 4M3TA 1XU3E 3L8BA 1FPOA 4RG8A 4DTSA 3L2OB 3QERA
chains in the Genus database with same CATH topology
2JHAA 4X5MA 3LZJA 1FZ2E 4FJGA 2VJ5A 1XVDE 2E32A 2P1PB 2PFVA 2P1QB 4DTXA 2DY4A 3NE6A 3NCIA 4KHSA 1WAJA 3SUOA 4RL5A 4FK2A 4EPHA 3CFPA 2JHPA 2ATQA 4FJJA 3QNNA 3OGKB 4DTPA 4ADOA 4FJMA 4DU4A 3CFOA 2P5GA 4KHYA 2PFTA 4KHWA 4JS4A 1Q9YA 3SUNA 1P22A 3SUPA 3SVIA 4FJIA 3NDKA 4M3UA 1FZ0E 1WAFA 3K2OA 4DTRA 1FZ1E 2B1EA 1XMFE 2P1OB 4FJLA 4FJKA 4JS5A 1MHYG 4M3WA 1CLQA 3C94A 3QESA 3WSOA 4KHNA 1XVBE 4E3SA 3SJJA 3SQ4A 3L0MA 4DTOA 2LF3A 3TAGA 3RMAA 2P1NB 4M3ZA 1XL3C 4M3RA 2OVQB 2QXFA 1FS1A 2JHCA 4J2EA 3TAEA 3SPZA 2FYOA 2OZSA 3N1BA 2JPNA 3E4YA 3HL8A 3SCXA 4J2AA 3LDSA 1FZ6E 2RCUA 3QEWA 1Q9XA 4M3YA 3CFRA 4AKHA 1FZ4E 2B8IA 2VJ4A 4RNGA 3QEXA 1XVGE 5IBKB 1FZ8E 2OVRB 2MMBA 4X5NA 3HP9A 3RMDA 2P5OA 4FJNA 3NAEA 3TAFA 4EP9A 5IZ7A 2LF6A 3LDBA 3HGKE 3QEVA 2VIXA 3NGIA 3RMBA 1LDKE 4DU3A 4FJ5A 4J2BA 4M42A 1XMHE 2FW3A 4FVMA 4KI6A 4QNCA 3SI6A 4KI4A 4AKGA 1FZ9E 4DTNA 3SNNA 3RWUA 1FZ7E 3C6NB 3E4WA 4EYWA 3SPYA 3SQ1A 3NHGA 3LZIA 1FZ3E 3OGMB 3QEPA 4HCBA 4GAMC 4FK0A 4KHUA 4M41A 1IG9A 4DU1A 2DEBA 4M3XA 3SQ0A 2E31A 3N1EA 4J2DA 1FZ5E 2H4TA 3C6PB 3TABA 1FYZE 1NEXB 4I9LA 4AI6A 4FK4A 3OGLB 4KHQA 4I9QA 1XU5E 2MZWB 4DTUA 2P1MB 3V7DB 3RMCA 4AKIA 3TL8B 1MTYG 3J2PA 4I6JB 3MKSB 1MMOG 2HD0A 4HCCA 1IH7A 1XVCE 3KD1E 2B7MA 3HGLA 4M45A 4JRQA 4JRPA 5H37A 3C95A 3QETA 2OZMA 3KD5E 3QEIA 2JH9A 1FZHE 4E4BA 4DTJA 1XMGE 2YB5A 4FJ8A 3QNOA 1MHZG 4FJXA 3LD8A 2DTUA 4FJHA 3C6OB 4DTMA 4FJ9A 4FJ7A 2OYQA 1XVEE 2JH8A 3J27A 3SUQA 5IREA 3UIQA 4B08A 1FZIE 1XVFE 2OVPB 4QNDA 4ADNA 3S9HA 3CQ8A 3L1NA 1FXXA 3SQ2A 4M3TA 1XU3E 3L8BA 3TJYA 4RG8A 4DTSA 3L2OB 3QERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMO G;  1XMH E;  1FZ2 E;  1XVB E;  1XVD E;  1XVC E;  1FZ9 E;  1FZ7 E;  1FZH E;  1FZ3 E;  1XMG E;  1MHZ G;  4GAM C;  1FZ6 E;  1FZ4 E;  1FZ0 E;  1XVG E;  1XVE E;  1FZ1 E;  1FZ8 E;  1FZ5 E;  1XMF E;  1FZI E;  1FYZ E;  1XVF E;  1MHY G;  1XU3 E;  1XU5 E;  1MTY G; 
#chains in the Genus database with same CATH topology
 2JHA A;  4X5M A;  3UO3 A;  1FZ2 E;  3LZJ A;  4FJG A;  2VJ5 A;  1XVD E;  2E32 A;  2P1P B;  2PFV A;  2P1Q B;  4DTX A;  2DY4 A;  3NE6 A;  3NCI A;  4KHS A;  1WAJ A;  3SUO A;  4RL5 A;  4FK2 A;  4EPH A;  3CFP A;  2JHP A;  2ATQ A;  4FJJ A;  3QNN A;  3OGK B;  4DTP A;  4ADO A;  4FJM A;  4DU4 A;  3CFO A;  2RKH A;  2P5G A;  4KHY A;  2PFT A;  4KHW A;  4JS4 A;  1Q9Y A;  3SUN A;  1P22 A;  3SUP A;  3SVI A;  4FJI A;  3NDK A;  4M3U A;  1FZ0 E;  1WAF A;  3K2O A;  4DTR A;  1FZ1 E;  2B1E A;  1XMF E;  2P1O B;  2JQT A;  4FJL A;  4FJK A;  4JS5 A;  1MHY G;  4M3W A;  1CLQ A;  3C94 A;  3QES A;  3WSO A;  3UO2 A;  4KHN A;  1XVB E;  4E3S A;  3SJJ A;  3SQ4 A;  3L0M A;  4DTO A;  2LF3 A;  3TAG A;  3RMA A;  2P1N B;  4M3Z A;  1XL3 C;  4M3R A;  2OVQ B;  2QXF A;  1FS1 A;  2JHC A;  4J2E A;  3TAE A;  4ICG C;  3SPZ A;  2FYO A;  2OZS A;  3N1B A;  2JPN A;  3E4Y A;  3HL8 A;  3SCX A;  4J2A A;  3LDS A;  1FZ6 E;  2RCU A;  3QEW A;  1Q9X A;  3TJY A;  3CFR A;  4M3Y A;  4AKH A;  1FZ4 E;  2B8I A;  2VJ4 A;  4IT5 A;  4RNG A;  1N1C A;  1XVG E;  5IBK B;  3QEX A;  1FZ8 E;  2OVR B;  2MMB A;  4X5N A;  3HP9 A;  3RMD A;  2P5O A;  4FJN A;  3NAE A;  3TAF A;  4EP9 A;  5IZ7 A;  2LF6 A;  3LDB A;  3HGK E;  3QEV A;  2VIX A;  3NGI A;  3RMB A;  1LDK E;  4DU3 A;  4FJ5 A;  4J2B A;  4M42 A;  2MW2 A;  1XMH E;  2FW3 A;  2K5S A;  4FVM A;  4KI6 A;  4QNC A;  3SI6 A;  4KI4 A;  4AKG A;  1FZ9 E;  4DTN A;  3SNN A;  3RWU A;  1FZ7 E;  3C6N B;  3E4W A;  4EYW A;  3SPY A;  3SQ1 A;  3NHG A;  3LZI A;  1FZ3 E;  3OGM B;  3QEP A;  4HCB A;  4GAM C;  4FK0 A;  4KHU A;  4M41 A;  1IG9 A;  4DU1 A;  2DEB A;  4M3X A;  3SQ0 A;  2E31 A;  3N1E A;  4J2D A;  1FZ5 E;  2H4T A;  3C6P B;  3TAB A;  1FYZ E;  1NEX B;  4I9L A;  4AI6 A;  4FK4 A;  3OGL B;  4KHQ A;  4I9Q A;  1XU5 E;  2MZW B;  4DTU A;  2P1M B;  3V7D B;  3RMC A;  4AKI A;  3TL8 B;  1MTY G;  1JW2 A;  3J2P A;  4I6J B;  3MKS B;  1MMO G;  3BVO A;  2HD0 A;  4HCC A;  1IH7 A;  1XVC E;  3KD1 E;  2B7M A;  3HGL A;  4M45 A;  4JRQ A;  4JRP A;  5H37 A;  3C95 A;  3QET A;  2OZM A;  3KD5 E;  3QEI A;  2JH9 A;  1FZH E;  4E4B A;  4DTJ A;  1XMG E;  2YB5 A;  4FJ8 A;  3QNO A;  1MHZ G;  4FJX A;  3LD8 A;  2DTU A;  4FJH A;  3C6O B;  4DTM A;  4FJ9 A;  4FJ7 A;  2OYQ A;  1XVE E;  2JH8 A;  3J27 A;  3SUQ A;  5IRE A;  3UIQ A;  4B08 A;  1FZI E;  1XVF E;  2OVP B;  4QND A;  4ADN A;  3S9H A;  3CQ8 A;  3L1N A;  1FXX A;  3SQ2 A;  4M3T A;  1XU3 E;  3L8B A;  1FPO A;  4RG8 A;  4DTS A;  3L2O B;  3QER A; 
#chains in the Genus database with same CATH homology
 2JHA A;  4X5M A;  3LZJ A;  1FZ2 E;  4FJG A;  2VJ5 A;  1XVD E;  2E32 A;  2P1P B;  2PFV A;  2P1Q B;  4DTX A;  2DY4 A;  3NE6 A;  3NCI A;  4KHS A;  1WAJ A;  3SUO A;  4RL5 A;  4FK2 A;  4EPH A;  3CFP A;  2JHP A;  2ATQ A;  4FJJ A;  3QNN A;  3OGK B;  4DTP A;  4ADO A;  4FJM A;  4DU4 A;  3CFO A;  2P5G A;  4KHY A;  2PFT A;  4KHW A;  4JS4 A;  1Q9Y A;  3SUN A;  1P22 A;  3SUP A;  3SVI A;  4FJI A;  3NDK A;  4M3U A;  1FZ0 E;  1WAF A;  3K2O A;  4DTR A;  1FZ1 E;  2B1E A;  1XMF E;  2P1O B;  4FJL A;  4FJK A;  4JS5 A;  1MHY G;  4M3W A;  1CLQ A;  3C94 A;  3QES A;  3WSO A;  4KHN A;  1XVB E;  4E3S A;  3SJJ A;  3SQ4 A;  3L0M A;  4DTO A;  2LF3 A;  3TAG A;  3RMA A;  2P1N B;  4M3Z A;  1XL3 C;  4M3R A;  2OVQ B;  2QXF A;  1FS1 A;  2JHC A;  4J2E A;  3TAE A;  3SPZ A;  2FYO A;  2OZS A;  3N1B A;  2JPN A;  3E4Y A;  3HL8 A;  3SCX A;  4J2A A;  3LDS A;  1FZ6 E;  2RCU A;  3QEW A;  1Q9X A;  4M3Y A;  3CFR A;  4AKH A;  1FZ4 E;  2B8I A;  2VJ4 A;  4RNG A;  3QEX A;  1XVG E;  5IBK B;  1FZ8 E;  2OVR B;  2MMB A;  4X5N A;  3HP9 A;  3RMD A;  2P5O A;  4FJN A;  3NAE A;  3TAF A;  4EP9 A;  5IZ7 A;  2LF6 A;  3LDB A;  3HGK E;  3QEV A;  2VIX A;  3NGI A;  3RMB A;  1LDK E;  4DU3 A;  4FJ5 A;  4J2B A;  4M42 A;  1XMH E;  2FW3 A;  4FVM A;  4KI6 A;  4QNC A;  3SI6 A;  4KI4 A;  4AKG A;  1FZ9 E;  4DTN A;  3SNN A;  3RWU A;  1FZ7 E;  3C6N B;  3E4W A;  4EYW A;  3SPY A;  3SQ1 A;  3NHG A;  3LZI A;  1FZ3 E;  3OGM B;  3QEP A;  4HCB A;  4GAM C;  4FK0 A;  4KHU A;  4M41 A;  1IG9 A;  4DU1 A;  2DEB A;  4M3X A;  3SQ0 A;  2E31 A;  3N1E A;  4J2D A;  1FZ5 E;  2H4T A;  3C6P B;  3TAB A;  1FYZ E;  1NEX B;  4I9L A;  4AI6 A;  4FK4 A;  3OGL B;  4KHQ A;  4I9Q A;  1XU5 E;  2MZW B;  4DTU A;  2P1M B;  3V7D B;  3RMC A;  4AKI A;  3TL8 B;  1MTY G;  3J2P A;  4I6J B;  3MKS B;  1MMO G;  2HD0 A;  4HCC A;  1IH7 A;  1XVC E;  3KD1 E;  2B7M A;  3HGL A;  4M45 A;  4JRQ A;  4JRP A;  5H37 A;  3C95 A;  3QET A;  2OZM A;  3KD5 E;  3QEI A;  2JH9 A;  1FZH E;  4E4B A;  4DTJ A;  1XMG E;  2YB5 A;  4FJ8 A;  3QNO A;  1MHZ G;  4FJX A;  3LD8 A;  2DTU A;  4FJH A;  3C6O B;  4DTM A;  4FJ9 A;  4FJ7 A;  2OYQ A;  1XVE E;  2JH8 A;  3J27 A;  3SUQ A;  5IRE A;  3UIQ A;  4B08 A;  1FZI E;  1XVF E;  2OVP B;  4QND A;  4ADN A;  3S9H A;  3CQ8 A;  3L1N A;  1FXX A;  3SQ2 A;  4M3T A;  1XU3 E;  3L8B A;  3TJY A;  4RG8 A;  4DTS A;  3L2O B;  3QER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...