1XMOI

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmoI00
4DV0I 4DV5I 4HYMA 2UXBI 4USMA 1ZM4A 2E5LI 4YHHE 1FJGI 4B3TI 4GKKE 1MU5A 4X66E 1PIEA 4DV7E 1XNQI 3M6AA 2AJ4A 1MX0A 3HULA 4X65I 4LFCE 2HKJA 2HK2A 4RPFA 1D6TA 1XNRI 4JI5I 1Z0EA 5GMEA 4JI2I 2LJPA 3J81Q 3OTOI 1N36E 1I94E 1A6FA 2ZM6I 4X64I 4LFAI 1ZXMA 1NHJA 1HNZI 4DV1E 1VISA 4JI3I 4ZVIA 4DV3I 5LMNI 2DEIA 2X36A 3T1YI 4HXZA 4GKJI 2V8PA 1Z0TA 4OX9I 1IBLE 4DPYA 4DR3I 1H7UA 1FI4A 4B3RE 2OI2A 3LNUA 4YY3I 4LF4E 4P7AA 3CWVA 2UXBE 1N33E 1ZM3A 2F4VE 4DU8A 4X62I 4DV6E 4EMDA 1Z0CA 4P52A 4URLA 4R1FA 4LF8E 1N32E 4HACA 4WUDA 4B3TE 1XMQI 4LFBI 3GONA 4NXNE 2VQFI 1ELOA 3ZZ0A 2UXCE 1XNQE 4B3SI 1XMOI 1MG7A 4DV2E 2A2DA 1ZXNA 1H72C 3ZKBA 3PYEA 3ZM7A 4DR5E 4LF9E 2UUCI 1Z0VA 4MYTA 4I3HA 1H73A 3K1JA 4KHPE 1KVKA 4X65E 2ZITA 3B82A 4DR6E 4DR4E 4JI7E 4JI1I 1N0UA 4B3MI 2UUAE 2Q2EB 1S4EA 4FWHA 2VQEE 3WU5A 3J7AM 1Z5BA 4NXME 3PYGA 4FN5A 4WUBA 3ZKDA 5LMNE 2HHHE 1H7SA 1J5EI 1IBME 4LF5E 1Z0WA 4DPWA 4LF6I 3QT8A 4DR3E 4DPUA 2GS8A 3T1HI 1B63A 2A2CA 4JI6E 1NHIA 3QT7A 1WUUA 4PRXA 1UEKA 3Q1QA 2UU9I 4JI4E 1N0VC 5BR8E 2J7KA 4JYAI 4DUZI 4FWDA 3K17A 1NHHA 4DR1E 4JI0E 3LTOA 1HNXI 4DR7I 1ZM9A 4FWGA 3J81C 2VF3A 1DARA 1Z0GA 1RREA 4LF7E 4AQYE 4PU9A 5IWAE 5LMUE 4XTJA 4FW9A 1N34I 5IT9Q 4DUYI 2X7IA 3D4JA 2UUBI 4DR2I 4ED4A 1FWLA 1HNWI 3H4LA 4JG4A 4DV0E 1Z59A 4DV5E 3ZZTA 5IT9C 1XHKA 2V2ZA 2E5LE 4YHHI 1FJGE 2R3VA 4GKKI 4X66I 2NPFA 3F0NA 3PYFA 2V2VA 1QZRA 1Z0BA 2UXDI 1EI1A 4DV4I 2UU9E 4LFCI 2HKEA 4JYAE 2XEXA 4DPTA 1XNRE 1B62A 2WW4A 4JI5E 4JI2E 1HR0I 4JV5I 3OTOE 3J80Q 1I94I 2ZM6E 1Z5CA 4X64E 4LFAE 4K0KI 1H74A 5A2QQ 1HNZE 2HFUA 4JI3E 4DV1I 1BKNA 2EFGA 4DV3E 3J7AG 3T1YE 3J80C 2V2QA 3ZZUA 4GKJE 2CZ9A 2R42A 3V2UC 2DEJA 4DUYE 4OX9E 3LPSA 1IBLI 4B3RI 4YY3E 4LF4I 1N33I 4X62E 2F4VI 1FNMA 4DV6I 4DPXA 3B8HA 2BM1A 4KQVA 4LF8I 4USKA 1RR9A 1N32I 1XMQE 4LFBE 2E1RA 4HY1A 4NXNI 2VQFE 2UXCI 4B3SE 1XMOE 2UXDE 4JI8I 4DV2I 3QT6A 5LL6R 5L3JA 4UTGA 4Z7CA 4DXLA 4DR5I 4LF9I 2UUCE 1IBKI 4WUCA 4DV4E 4KHPI 4HACB 2HFSA 5GMDA 1ZM2A 4DR6I 4DR4I 4JI7I 4B3ME 4JI1E 2V34A 2UUAI 4UT4A 1HR0E 3WU3A 4JV5E 3B78A 3WU4A 2VQEI 4K0KE 1FKAE 4MYUA 2BV3A 4NXMI 1EA6A 2HHHI 1J5EE 1IBMI 4LF5I 4DU7A 2ZBKB 4LF6E 1K47A 3T1HE 4DV7I 1PKPA 3JAMQ 4JI6I 1PVGA 5FLXQ 4M1KA 1KKHA 1KTVA 3JAMC 1Z5AA 4JI4I 5FLXC 1S16A 5BR8I 3PYDA 1FWKA 4DUZE 1NZ0A 4DR1I 4JI0I 2HK3A 4JI8E 1HNXE 4DR7E 4Z7YA 1N36I 1U2RA 1IBKE 3WU6A 3V5RA 1KIJA 4LF7I 4AQYI 2BM0A 3QT5A 5A2QC 5IWAI 5LMUI 1N34E 1OJ4A 2UUBE 4DR2E 4PRVA 1HNWE
chains in the Genus database with same CATH superfamily
4OO1A 3P76A 2WNRB 4DV0I 4HYMA 4DV5I 4USMA 2UXBI 1ZM4A 4FW3A 1P42A 4YHHE 2E5LI 1FJGI 4B3TI 4GKKE 1MU5A 4QNJA 1OYPA 4X66E 2PNLA 5C0XE 1PIEA 4DV7E 1XNQI 4FW4A 3M6AA 5FWKA 3DD6A 2AJ4A 1MX0A 2J65A 3HULA 1R6LA 4X65I 4LFCE 2HKJA 2HK2A 1UDSA 4RPFA 1D6TA 1XNRI 4JI5I 1Z0EA 5GMEA 4JI2I 2LJPA 5K36B 3J81Q 3OTOI 1N36E 1I94E 1A6FA 2ZM6I 4IZJA 4X64I 1ZXMA 4LFAI 2WNRA 1NHJA 2GQ0A 4OO1E 1HNZI 4LOMA 4DV1E 1VISA 4JI3I 5JEAC 4ZVIA 2JE6A 4DV3I 5LMNI 2DEIA 3PS1A 2X36A 2PNMA 4HXZA 3T1YI 4GKJI 3L7ZB 2V8PA 1Z0TA 1E3HA 2IESA 4OX9I 1IBLE 4DPYA 4DR3I 1H7UA 1FI4A 4B3RE 2JEAA 2OI2A 2Z5CB 3LNUA 4IZKB 4J3DA 4YY3I 4LF4E 5K36C 3NZKA 4P7AA 3CWVA 2UXBE 1N33E 1ZM3A 2NN6C 4DU8A 4X62I 2F4VE 4DV6E 2PO1A 1YH8A 1UDQA 4MU0A 4EMDA 1Z0CA 4P52A 4URLA 4R1FA 4LF8E 1N32E 4HACA 4WUDA 4B3TE 1XMQI 4LFBI 3GONA 4NXNE 2VQFI 4BA2A 1ELOA 3ZZ0A 2UXCE 1XNQE 4B3SI 1XMOI 1MG7A 2A2DA 4DV2E 2Z5BB 1ZXNA 1H72C 1USUA 3ZKBA 4MQYA 3GLLA 3PYEA 3ZM7A 4DR5E 4LF9E 2UUCI 4IS9A 2GO3A 2O1UA 1Z0VA 4MYTA 4I3HA 1H73A 4QNKA 3K1JA 3Q6NA 4KHPE 2GO4A 1KVKA 4X65E 2ZITA 3B82A 4DR6E 4DR4E 4JI7E 4NBQA 2PO2A 4JI1I 1N0UA 4B3MI 2UUAE 3P3GA 4FW7A 3M85G 2VESA 5JEAF 2Q2EB 1S4EA 4FWHA 5DRRA 2C38B 3GMEA 5DRPA 2VQEE 5JEAD 3WU5A 3J7AM 1R6MA 4AM3A 4ISAA 1Z5BA 4NXME 3PYGA 4FN5A 5K36F 4WUBA 3ZKDA 5LMNE 2HHHE 1H7SA 3P3EA 1J5EI 5K36D 1IBME 4LF5E 1Z0WA 4DPWA 4LF6I 2CG9A 3QT8A 4DR3E 4DPUA 2GS8A 3T1HI 1B63A 2NN6D 2A2CA 4AIMA 2F1DA 2CGEA 2JEBA 3HKMA 2C37A 4JI6E 1HK7A 1NHIA 2Z5BA 3QT7A 1WUUA 4N3OA 4PRXA 5C0XD 1UEKA 4IFDB 2BR2A 5DROA 4OKGA 3Q1QA 5JEAB 2UU9I 4JI4E 1N0VC 5BR8E 2J7KA 4JYAI 2PNZB 4DUZI 4FWDA 3K17A 1NHHA 4DR1E 4MU3A 4JI0E 2C39A 2IOPA 4MU4A 3LTOA 1HNXI 4LCGA 4DR7I 4IFDC 3PRYA 1ZM9A 2NN6B 2IOQA 4FWGA 3M7ND 3U1YA 2BA1D 3J81C 2VF3A 1DARA 1Z0GA 3CDJA 1RREA 5C0XB 4LF7E 4AQYE 3PS3A 4FW5A 4PU9A 4LPFA 5IWAE 4XTJA 4FW9A 5LMUE 1N34I 5IT9Q 4DUYI 2X7IA 3D4JA 1XXEA 4FW6A 2UUBI 4DR2I 4ED4A 1FWLA 1HNWI 3H4LA 4JG4A 4DV0E 1Z59A 4DV5E 3ZZTA 5IT9C 1XHKA 2V2ZA 2E5LE 4YHHI 5JEAA 1FJGE 2R3VA 5C0XC 4GKKI 2IERA 4X66I 2PNZA 2NPFA 3F0NA 3K85A 3PYFA 2V2VA 1QZRA 4OO1B 1Z0BA 2UXDI 5K36A 1EI1A 2NN6A 3H1CA 4DV4I 2BA0D 2UU9E 4LFCI 5ELWA 2HKEA 4JYAE 4IZJD 4IFDF 2XEXA 3L7ZA 4DPTA 1XNRE 1B62A 2WW4A 4JI5E 4IFDD 4LCFA 4JI2E 1HR0I 4JV5I 1Y5YA 4OO1C 3OTOE 2Z5CA 4IZKA 5DNLA 3J80Q 1I94I 2ZM6E 1Z5CA 4X64E 4LFAE 4K0KI 1H74A 5A2QQ 1HNZE 2HFUA 4JI3E 4DV1I 1BKNA 2EFGA 4DV3E 3J7AG 3T1YE 2WP8B 3J80C 2V2QA 3ZZUA 4GKJE 5EKWA 2CZ9A 2CVEA 2R42A 3V2UC 1Y4UA 5JEAE 2NN6F 2DEJA 4DUYE 4OX9E 4MU1A 3LPSA 1IBLI 4B3RI 4YY3E 4LF4I 4GQUA 5C0XF 4IZJB 2PO0B 1N33I 4X62E 2F4VI 5K36E 1FNMA 2AE8A 4DV6I 4DPXA 3B8HA 2BM1A 4KQVA 3B4TA 2JE6B 4LF8I 4USKA 1RR9A 2NN6E 1N32I 1Y6ZA 1XMQE 4LFBE 2E1RA 4LCHA 4HY1A 4NXNI 2VQFE 2UXCI 2JEAB 4B3SE 1XMOE 2UXDE 4JI8I 2C38A 4DV2I 3QT6A 5LL6R 5L3JA 4UTGA 4Z7CA 2PO1B 4DXLA 2O1TA 4U3BA 4AIDA 4DR5I 2UUCE 4LF9I 1IBKI 4WUCA 4DV4E 4KHPI 5DRQA 4OO1F 4HACB 2HFSA 5GMDA 4OZEA 1Y4SA 2WP8A 1ZM2A 4DR6I 1UDOA 3UHMA 4JI7I 4DR4I 4OO1D 4BA2B 4B3ME 4JI1E 2V34A 2UUAI 3HJCA 4UT4A 1HR0E 3WU3A 3M7NG 3KRNA 4JV5E 1Y60A 2BA1G 2Z5EA 3B78A 3WU4A 2VQEI 5EL9A 4K0KE 1FKAE 4MYUA 2BV3A 2PO0A 1OYRA 4NXMI 4IFDA 2O3ZA 1EA6A 4BA1B 2HHHI 1J5EE 2O1WA 2PO2B 1IBMI 4LF5I 4DU7A 2ZBKB 4LF6E 1K47A 5DNXA 3P3CA 3T1HE 4DV7I 1PKPA 3JAMQ 4JI6I 1PVGA 5FLXQ 4M1KA 1USVA 1KKHA 3Q6MA 1KTVA 3JAMC 1Z5AA 2JT2A 1VI7A 3P06A 4JI4I 4U3DA 5FLXC 1S16A 5BR8I 3PYDA 1FWKA 1UDNA 5C0XA 4DUZE 3U1KA 1NZ0A 4DR1I 2BA0G 2JEBB 4JI0I 2HK3A 2C37B 4JI8E 1HNXE 4DR7E 4Z7YA 1E3PA 1N36I 2BR2B 1U2RA 1IBKE 2O1VA 3M85D 4BA1A 3WU6A 3V5RA 4IFDE 1KIJA 4LF7I 4AQYI 2BM0A 3CDIA 1YHCA 3QT5A 5A2QC 1OYSA 5IWAI 5LMUI 2C39B 1N34E 1OJ4A 3PS2A 3GCMA 2UUBE 4MDTA 4DR2E 4PRVA 1RHYA 1HNWE
chains in the Genus database with same CATH topology
4DV0I 4DV5I 4HYMA 2UXBI 4USMA 1ZM4A 2E5LI 4YHHE 1FJGI 4B3TI 4GKKE 1MU5A 4X66E 2PNLA 1PIEA 4DV7E 1XNQI 3M6AA 5FWKA 2AJ4A 1MX0A 3HULA 4X65I 4LFCE 2HKJA 2HK2A 4RPFA 1D6TA 1XNRI 4JI5I 1Z0EA 5GMEA 4JI2I 2LJPA 3J81Q 3OTOI 1N36E 1I94E 1A6FA 2ZM6I 4IZJA 4X64I 1ZXMA 4LFAI 1NHJA 2GQ0A 1HNZI 4DV1E 1VISA 4JI3I 4ZVIA 4DV3I 5LMNI 2DEIA 2X36A 2PNMA 4HXZA 3T1YI 4GKJI 2V8PA 1Z0TA 4OX9I 1IBLE 4DPYA 4DR3I 1H7UA 1FI4A 4B3RE 2OI2A 2Z5CB 3LNUA 4IZKB 4YY3I 4LF4E 4P7AA 3CWVA 2UXBE 1N33E 1ZM3A 2F4VE 4DU8A 4X62I 4DV6E 4EMDA 1Z0CA 4P52A 4URLA 4R1FA 4LF8E 1N32E 4HACA 4WUDA 4B3TE 1XMQI 4LFBI 3GONA 4NXNE 2VQFI 1ELOA 3ZZ0A 2UXCE 1XNQE 4B3SI 1XMOI 1MG7A 4DV2E 2A2DA 2Z5BB 1ZXNA 1USUA 1H72C 3ZKBA 3PYEA 3ZM7A 4DR5E 4LF9E 2UUCI 2O1UA 1Z0VA 4MYTA 4I3HA 1H73A 3K1JA 3Q6NA 4KHPE 1KVKA 4X65E 2ZITA 3B82A 4DR6E 4DR4E 4JI7E 4JI1I 1N0UA 4B3MI 2UUAE 2Q2EB 1S4EA 4FWHA 2VQEE 3WU5A 3J7AM 1Z5BA 4NXME 3PYGA 4FN5A 4WUBA 3ZKDA 5LMNE 2HHHE 1H7SA 1J5EI 1IBME 4LF5E 1Z0WA 4DPWA 4LF6I 2CG9A 3QT8A 4DR3E 4DPUA 2GS8A 3T1HI 1B63A 2A2CA 2CGEA 4JI6E 1HK7A 1NHIA 2Z5BA 3QT7A 1WUUA 4N3OA 4PRXA 1UEKA 3Q1QA 2UU9I 4JI4E 1N0VC 5BR8E 2J7KA 4JYAI 4DUZI 4FWDA 3K17A 1NHHA 4DR1E 4JI0E 2IOPA 3LTOA 1HNXI 4DR7I 3PRYA 1ZM9A 2IOQA 4FWGA 3J81C 2VF3A 1DARA 1Z0GA 1RREA 4LF7E 4AQYE 4PU9A 5IWAE 5LMUE 4XTJA 4FW9A 1N34I 5IT9Q 4DUYI 2X7IA 3D4JA 2UUBI 4DR2I 4ED4A 1FWLA 1HNWI 3H4LA 4JG4A 4DV0E 1Z59A 4DV5E 3ZZTA 5IT9C 1XHKA 2V2ZA 2E5LE 4YHHI 1FJGE 2R3VA 4GKKI 4X66I 2NPFA 3F0NA 3K85A 3PYFA 2V2VA 1QZRA 1Z0BA 2UXDI 1EI1A 4DV4I 2UU9E 4LFCI 2HKEA 4JYAE 4IZJD 2XEXA 4DPTA 1XNRE 1B62A 2WW4A 4JI5E 4JI2E 1HR0I 4JV5I 3OTOE 2Z5CA 4IZKA 3J80Q 1I94I 2ZM6E 1Z5CA 4X64E 4LFAE 4K0KI 1H74A 5A2QQ 1HNZE 2HFUA 4JI3E 4DV1I 1BKNA 2EFGA 4DV3E 3J7AG 3T1YE 3J80C 2V2QA 3ZZUA 4GKJE 2CZ9A 2R42A 3V2UC 1Y4UA 2DEJA 4DUYE 4OX9E 3LPSA 1IBLI 4B3RI 4YY3E 4LF4I 4IZJB 1N33I 4X62E 2F4VI 1FNMA 4DV6I 4DPXA 3B8HA 2BM1A 4KQVA 4LF8I 4USKA 1RR9A 1N32I 1Y6ZA 1XMQE 4LFBE 2E1RA 4HY1A 4NXNI 2VQFE 2UXCI 4B3SE 1XMOE 2UXDE 4JI8I 4DV2I 3QT6A 5LL6R 5L3JA 4UTGA 4Z7CA 4DXLA 2O1TA 4DR5I 4LF9I 2UUCE 1IBKI 4WUCA 4DV4E 4KHPI 4HACB 2HFSA 5GMDA 1Y4SA 1ZM2A 4DR6I 4DR4I 4JI7I 4B3ME 4JI1E 2V34A 2UUAI 3HJCA 4UT4A 1HR0E 3WU3A 4JV5E 2Z5EA 3B78A 3WU4A 2VQEI 4K0KE 1FKAE 4MYUA 2BV3A 4NXMI 1EA6A 2HHHI 1J5EE 2O1WA 1IBMI 4LF5I 4DU7A 2ZBKB 4LF6E 1K47A 3T1HE 4DV7I 1PKPA 3JAMQ 4JI6I 1PVGA 5FLXQ 4M1KA 1USVA 1KKHA 3Q6MA 1KTVA 3JAMC 1Z5AA 3P06A 4JI4I 5FLXC 1S16A 5BR8I 3PYDA 1FWKA 4DUZE 1NZ0A 4DR1I 4JI0I 2HK3A 4JI8E 1HNXE 4DR7E 4Z7YA 1N36I 1U2RA 1IBKE 2O1VA 3WU6A 3V5RA 1KIJA 4LF7I 4AQYI 2BM0A 3QT5A 5A2QC 5IWAI 5LMUI 1N34E 1OJ4A 2UUBE 4DR2E 4PRVA 1HNWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 I;  4DV5 I;  4HYM A;  2UXB I;  4USM A;  1ZM4 A;  2E5L I;  4YHH E;  1FJG I;  4B3T I;  4GKK E;  1MU5 A;  4X66 E;  1PIE A;  4DV7 E;  1XNQ I;  3M6A A;  2AJ4 A;  1MX0 A;  3HUL A;  4X65 I;  4LFC E;  2HKJ A;  2HK2 A;  4RPF A;  1D6T A;  1XNR I;  4JI5 I;  1Z0E A;  5GME A;  4JI2 I;  2LJP A;  3J81 Q;  3OTO I;  1N36 E;  1I94 E;  1A6F A;  2ZM6 I;  4X64 I;  4LFA I;  1ZXM A;  1NHJ A;  1HNZ I;  4DV1 E;  1VIS A;  4JI3 I;  4ZVI A;  4DV3 I;  5LMN I;  2DEI A;  2X36 A;  3T1Y I;  4HXZ A;  4GKJ I;  2V8P A;  1Z0T A;  4OX9 I;  1IBL E;  4DPY A;  4DR3 I;  1H7U A;  1FI4 A;  4B3R E;  2OI2 A;  3LNU A;  4YY3 I;  4LF4 E;  4P7A A;  3CWV A;  2UXB E;  1N33 E;  1ZM3 A;  2F4V E;  4DU8 A;  4X62 I;  4DV6 E;  4EMD A;  1Z0C A;  4P52 A;  4URL A;  4R1F A;  4LF8 E;  1N32 E;  4HAC A;  4WUD A;  4B3T E;  1XMQ I;  4LFB I;  3GON A;  4NXN E;  2VQF I;  1ELO A;  3ZZ0 A;  2UXC E;  1XNQ E;  4B3S I;  1XMO I;  1MG7 A;  4DV2 E;  2A2D A;  1ZXN A;  1H72 C;  3ZKB A;  3PYE A;  3ZM7 A;  4DR5 E;  4LF9 E;  2UUC I;  1Z0V A;  4MYT A;  4I3H A;  1H73 A;  3K1J A;  4KHP E;  1KVK A;  4X65 E;  2ZIT A;  3B82 A;  4DR6 E;  4DR4 E;  4JI7 E;  4JI1 I;  1N0U A;  4B3M I;  2UUA E;  2Q2E B;  1S4E A;  4FWH A;  2VQE E;  3WU5 A;  3J7A M;  1Z5B A;  4NXM E;  3PYG A;  4FN5 A;  4WUB A;  3ZKD A;  5LMN E;  2HHH E;  1H7S A;  1J5E I;  1IBM E;  4LF5 E;  1Z0W A;  4DPW A;  4LF6 I;  3QT8 A;  4DR3 E;  4DPU A;  2GS8 A;  3T1H I;  1B63 A;  2A2C A;  4JI6 E;  1NHI A;  3QT7 A;  1WUU A;  4PRX A;  1UEK A;  3Q1Q A;  2UU9 I;  4JI4 E;  1N0V C;  5BR8 E;  2J7K A;  4JYA I;  4DUZ I;  4FWD A;  3K17 A;  1NHH A;  4DR1 E;  4JI0 E;  3LTO A;  1HNX I;  4DR7 I;  1ZM9 A;  4FWG A;  3J81 C;  2VF3 A;  1DAR A;  1Z0G A;  1RRE A;  4LF7 E;  4AQY E;  4PU9 A;  5IWA E;  5LMU E;  4XTJ A;  4FW9 A;  1N34 I;  5IT9 Q;  4DUY I;  2X7I A;  3D4J A;  2UUB I;  4DR2 I;  4ED4 A;  1FWL A;  1HNW I;  3H4L A;  4JG4 A;  4DV0 E;  1Z59 A;  4DV5 E;  3ZZT A;  5IT9 C;  1XHK A;  2V2Z A;  2E5L E;  4YHH I;  1FJG E;  2R3V A;  4GKK I;  4X66 I;  2NPF A;  3F0N A;  3PYF A;  2V2V A;  1QZR A;  1Z0B A;  2UXD I;  1EI1 A;  4DV4 I;  2UU9 E;  4LFC I;  2HKE A;  4JYA E;  2XEX A;  4DPT A;  1XNR E;  1B62 A;  2WW4 A;  4JI5 E;  4JI2 E;  1HR0 I;  4JV5 I;  3OTO E;  3J80 Q;  1I94 I;  2ZM6 E;  1Z5C A;  4X64 E;  4LFA E;  4K0K I;  1H74 A;  5A2Q Q;  1HNZ E;  2HFU A;  4JI3 E;  4DV1 I;  1BKN A;  2EFG A;  4DV3 E;  3J7A G;  3T1Y E;  3J80 C;  2V2Q A;  3ZZU A;  4GKJ E;  2CZ9 A;  2R42 A;  3V2U C;  2DEJ A;  4DUY E;  4OX9 E;  3LPS A;  1IBL I;  4B3R I;  4YY3 E;  4LF4 I;  1N33 I;  4X62 E;  2F4V I;  1FNM A;  4DV6 I;  4DPX A;  3B8H A;  2BM1 A;  4KQV A;  4LF8 I;  4USK A;  1RR9 A;  1N32 I;  1XMQ E;  4LFB E;  2E1R A;  4HY1 A;  4NXN I;  2VQF E;  2UXC I;  4B3S E;  1XMO E;  2UXD E;  4JI8 I;  4DV2 I;  3QT6 A;  5LL6 R;  5L3J A;  4UTG A;  4Z7C A;  4DXL A;  4DR5 I;  4LF9 I;  2UUC E;  1IBK I;  4WUC A;  4DV4 E;  4KHP I;  4HAC B;  2HFS A;  5GMD A;  1ZM2 A;  4DR6 I;  4DR4 I;  4JI7 I;  4B3M E;  4JI1 E;  2V34 A;  2UUA I;  4UT4 A;  1HR0 E;  3WU3 A;  4JV5 E;  3B78 A;  3WU4 A;  2VQE I;  4K0K E;  1FKA E;  4MYU A;  2BV3 A;  4NXM I;  1EA6 A;  2HHH I;  1J5E E;  1IBM I;  4LF5 I;  4DU7 A;  2ZBK B;  4LF6 E;  1K47 A;  3T1H E;  4DV7 I;  1PKP A;  3JAM Q;  4JI6 I;  1PVG A;  5FLX Q;  4M1K A;  1KKH A;  1KTV A;  3JAM C;  1Z5A A;  4JI4 I;  5FLX C;  1S16 A;  5BR8 I;  3PYD A;  1FWK A;  4DUZ E;  1NZ0 A;  4DR1 I;  4JI0 I;  2HK3 A;  4JI8 E;  1HNX E;  4DR7 E;  4Z7Y A;  1N36 I;  1U2R A;  1IBK E;  3WU6 A;  3V5R A;  1KIJ A;  4LF7 I;  4AQY I;  2BM0 A;  3QT5 A;  5A2Q C;  5IWA I;  5LMU I;  1N34 E;  1OJ4 A;  2UUB E;  4DR2 E;  4PRV A;  1HNW E; 
#chains in the Genus database with same CATH topology
 4OO1 A;  3P76 A;  2WNR B;  4DV0 I;  4HYM A;  4DV5 I;  4USM A;  2UXB I;  1ZM4 A;  4FW3 A;  1P42 A;  4YHH E;  2E5L I;  1FJG I;  4B3T I;  4GKK E;  1MU5 A;  4QNJ A;  1OYP A;  4X66 E;  2PNL A;  5C0X E;  1PIE A;  4DV7 E;  1XNQ I;  4FW4 A;  3M6A A;  5FWK A;  3DD6 A;  2AJ4 A;  1MX0 A;  2J65 A;  3HUL A;  1R6L A;  4X65 I;  4LFC E;  2HKJ A;  2HK2 A;  1UDS A;  4RPF A;  1D6T A;  1XNR I;  4JI5 I;  1Z0E A;  5GME A;  4JI2 I;  2LJP A;  5K36 B;  3J81 Q;  3OTO I;  1N36 E;  1I94 E;  1A6F A;  2ZM6 I;  4IZJ A;  4X64 I;  1ZXM A;  4LFA I;  2WNR A;  1NHJ A;  2GQ0 A;  4OO1 E;  1HNZ I;  4LOM A;  4DV1 E;  1VIS A;  4JI3 I;  5JEA C;  4ZVI A;  2JE6 A;  4DV3 I;  5LMN I;  2DEI A;  3PS1 A;  2X36 A;  2PNM A;  4HXZ A;  3T1Y I;  4GKJ I;  3L7Z B;  2V8P A;  1Z0T A;  1E3H A;  2IES A;  4OX9 I;  1IBL E;  4DPY A;  4DR3 I;  1H7U A;  1FI4 A;  4B3R E;  2JEA A;  2OI2 A;  2Z5C B;  3LNU A;  4IZK B;  4J3D A;  4YY3 I;  4LF4 E;  5K36 C;  3NZK A;  4P7A A;  3CWV A;  2UXB E;  1N33 E;  1ZM3 A;  2NN6 C;  4DU8 A;  4X62 I;  2F4V E;  4DV6 E;  2PO1 A;  1YH8 A;  1UDQ A;  4MU0 A;  4EMD A;  1Z0C A;  4P52 A;  4URL A;  4R1F A;  4LF8 E;  1N32 E;  4HAC A;  4WUD A;  4B3T E;  1XMQ I;  4LFB I;  3GON A;  4NXN E;  2VQF I;  4BA2 A;  1ELO A;  3ZZ0 A;  2UXC E;  1XNQ E;  4B3S I;  1XMO I;  1MG7 A;  2A2D A;  4DV2 E;  2Z5B B;  1ZXN A;  1H72 C;  1USU A;  3ZKB A;  4MQY A;  3GLL A;  3PYE A;  3ZM7 A;  4DR5 E;  4LF9 E;  2UUC I;  4IS9 A;  2GO3 A;  2O1U A;  1Z0V A;  4MYT A;  4I3H A;  1H73 A;  4QNK A;  3K1J A;  3Q6N A;  4KHP E;  2GO4 A;  1KVK A;  4X65 E;  2ZIT A;  3B82 A;  4DR6 E;  4DR4 E;  4JI7 E;  4NBQ A;  2PO2 A;  4JI1 I;  1N0U A;  4B3M I;  2UUA E;  3P3G A;  4FW7 A;  3M85 G;  2VES A;  5JEA F;  2Q2E B;  1S4E A;  4FWH A;  5DRR A;  2C38 B;  3GME A;  5DRP A;  2VQE E;  5JEA D;  3WU5 A;  3J7A M;  1R6M A;  4AM3 A;  4ISA A;  1Z5B A;  4NXM E;  3PYG A;  4FN5 A;  5K36 F;  4WUB A;  3ZKD A;  5LMN E;  2HHH E;  1H7S A;  3P3E A;  1J5E I;  5K36 D;  1IBM E;  4LF5 E;  1Z0W A;  4DPW A;  4LF6 I;  2CG9 A;  3QT8 A;  4DR3 E;  4DPU A;  2GS8 A;  3T1H I;  1B63 A;  2NN6 D;  2A2C A;  4AIM A;  2F1D A;  2CGE A;  2JEB A;  3HKM A;  2C37 A;  4JI6 E;  1HK7 A;  1NHI A;  2Z5B A;  3QT7 A;  1WUU A;  4N3O A;  4PRX A;  5C0X D;  1UEK A;  4IFD B;  2BR2 A;  5DRO A;  4OKG A;  3Q1Q A;  5JEA B;  2UU9 I;  4JI4 E;  1N0V C;  5BR8 E;  2J7K A;  4JYA I;  2PNZ B;  4DUZ I;  4FWD A;  3K17 A;  1NHH A;  4DR1 E;  4MU3 A;  4JI0 E;  2C39 A;  2IOP A;  4MU4 A;  3LTO A;  1HNX I;  4LCG A;  4DR7 I;  4IFD C;  3PRY A;  1ZM9 A;  2NN6 B;  2IOQ A;  4FWG A;  3M7N D;  3U1Y A;  2BA1 D;  3J81 C;  2VF3 A;  1DAR A;  1Z0G A;  3CDJ A;  1RRE A;  5C0X B;  4LF7 E;  4AQY E;  3PS3 A;  4FW5 A;  4PU9 A;  4LPF A;  5IWA E;  4XTJ A;  4FW9 A;  5LMU E;  1N34 I;  5IT9 Q;  4DUY I;  2X7I A;  3D4J A;  1XXE A;  4FW6 A;  2UUB I;  4DR2 I;  4ED4 A;  1FWL A;  1HNW I;  3H4L A;  4JG4 A;  4DV0 E;  1Z59 A;  4DV5 E;  3ZZT A;  5IT9 C;  1XHK A;  2V2Z A;  2E5L E;  4YHH I;  5JEA A;  1FJG E;  2R3V A;  5C0X C;  4GKK I;  2IER A;  4X66 I;  2PNZ A;  2NPF A;  3F0N A;  3K85 A;  3PYF A;  2V2V A;  1QZR A;  4OO1 B;  1Z0B A;  2UXD I;  5K36 A;  1EI1 A;  2NN6 A;  3H1C A;  4DV4 I;  2BA0 D;  2UU9 E;  4LFC I;  5ELW A;  2HKE A;  4JYA E;  4IZJ D;  4IFD F;  2XEX A;  3L7Z A;  4DPT A;  1XNR E;  1B62 A;  2WW4 A;  4JI5 E;  4IFD D;  4LCF A;  4JI2 E;  1HR0 I;  4JV5 I;  1Y5Y A;  4OO1 C;  3OTO E;  2Z5C A;  4IZK A;  5DNL A;  3J80 Q;  1I94 I;  2ZM6 E;  1Z5C A;  4X64 E;  4LFA E;  4K0K I;  1H74 A;  5A2Q Q;  1HNZ E;  2HFU A;  4JI3 E;  4DV1 I;  1BKN A;  2EFG A;  4DV3 E;  3J7A G;  3T1Y E;  2WP8 B;  3J80 C;  2V2Q A;  3ZZU A;  4GKJ E;  5EKW A;  2CZ9 A;  2CVE A;  2R42 A;  3V2U C;  1Y4U A;  5JEA E;  2NN6 F;  2DEJ A;  4DUY E;  4OX9 E;  4MU1 A;  3LPS A;  1IBL I;  4B3R I;  4YY3 E;  4LF4 I;  4GQU A;  5C0X F;  4IZJ B;  2PO0 B;  1N33 I;  4X62 E;  2F4V I;  5K36 E;  1FNM A;  2AE8 A;  4DV6 I;  4DPX A;  3B8H A;  2BM1 A;  4KQV A;  3B4T A;  2JE6 B;  4LF8 I;  4USK A;  1RR9 A;  2NN6 E;  1N32 I;  1Y6Z A;  1XMQ E;  4LFB E;  2E1R A;  4LCH A;  4HY1 A;  4NXN I;  2VQF E;  2UXC I;  2JEA B;  4B3S E;  1XMO E;  2UXD E;  4JI8 I;  2C38 A;  4DV2 I;  3QT6 A;  5LL6 R;  5L3J A;  4UTG A;  4Z7C A;  2PO1 B;  4DXL A;  2O1T A;  4U3B A;  4AID A;  4DR5 I;  2UUC E;  4LF9 I;  1IBK I;  4WUC A;  4DV4 E;  4KHP I;  5DRQ A;  4OO1 F;  4HAC B;  2HFS A;  5GMD A;  4OZE A;  1Y4S A;  2WP8 A;  1ZM2 A;  4DR6 I;  1UDO A;  3UHM A;  4JI7 I;  4DR4 I;  4OO1 D;  4BA2 B;  4B3M E;  4JI1 E;  2V34 A;  2UUA I;  3HJC A;  4UT4 A;  1HR0 E;  3WU3 A;  3M7N G;  3KRN A;  4JV5 E;  1Y60 A;  2BA1 G;  2Z5E A;  3B78 A;  3WU4 A;  2VQE I;  5EL9 A;  4K0K E;  1FKA E;  4MYU A;  2BV3 A;  2PO0 A;  1OYR A;  4NXM I;  4IFD A;  2O3Z A;  1EA6 A;  4BA1 B;  2HHH I;  1J5E E;  2O1W A;  2PO2 B;  1IBM I;  4LF5 I;  4DU7 A;  2ZBK B;  4LF6 E;  1K47 A;  5DNX A;  3P3C A;  3T1H E;  4DV7 I;  1PKP A;  3JAM Q;  4JI6 I;  1PVG A;  5FLX Q;  4M1K A;  1USV A;  1KKH A;  3Q6M A;  1KTV A;  3JAM C;  1Z5A A;  2JT2 A;  1VI7 A;  3P06 A;  4JI4 I;  4U3D A;  5FLX C;  1S16 A;  5BR8 I;  3PYD A;  1FWK A;  1UDN A;  5C0X A;  4DUZ E;  3U1K A;  1NZ0 A;  4DR1 I;  2BA0 G;  2JEB B;  4JI0 I;  2HK3 A;  2C37 B;  4JI8 E;  1HNX E;  4DR7 E;  4Z7Y A;  1E3P A;  1N36 I;  2BR2 B;  1U2R A;  1IBK E;  2O1V A;  3M85 D;  4BA1 A;  3WU6 A;  3V5R A;  4IFD E;  1KIJ A;  4LF7 I;  4AQY I;  2BM0 A;  3CDI A;  1YHC A;  3QT5 A;  5A2Q C;  1OYS A;  5IWA I;  5LMU I;  2C39 B;  1N34 E;  1OJ4 A;  3PS2 A;  3GCM A;  2UUB E;  4MDT A;  4DR2 E;  4PRV A;  1RHY A;  1HNW E; 
#chains in the Genus database with same CATH homology
 4DV0 I;  4DV5 I;  4HYM A;  2UXB I;  4USM A;  1ZM4 A;  2E5L I;  4YHH E;  1FJG I;  4B3T I;  4GKK E;  1MU5 A;  4X66 E;  2PNL A;  1PIE A;  4DV7 E;  1XNQ I;  3M6A A;  5FWK A;  2AJ4 A;  1MX0 A;  3HUL A;  4X65 I;  4LFC E;  2HKJ A;  2HK2 A;  4RPF A;  1D6T A;  1XNR I;  4JI5 I;  1Z0E A;  5GME A;  4JI2 I;  2LJP A;  3J81 Q;  3OTO I;  1N36 E;  1I94 E;  1A6F A;  2ZM6 I;  4IZJ A;  4X64 I;  1ZXM A;  4LFA I;  1NHJ A;  2GQ0 A;  1HNZ I;  4DV1 E;  1VIS A;  4JI3 I;  4ZVI A;  4DV3 I;  5LMN I;  2DEI A;  2X36 A;  2PNM A;  4HXZ A;  3T1Y I;  4GKJ I;  2V8P A;  1Z0T A;  4OX9 I;  1IBL E;  4DPY A;  4DR3 I;  1H7U A;  1FI4 A;  4B3R E;  2OI2 A;  2Z5C B;  3LNU A;  4IZK B;  4YY3 I;  4LF4 E;  4P7A A;  3CWV A;  2UXB E;  1N33 E;  1ZM3 A;  2F4V E;  4DU8 A;  4X62 I;  4DV6 E;  4EMD A;  1Z0C A;  4P52 A;  4URL A;  4R1F A;  4LF8 E;  1N32 E;  4HAC A;  4WUD A;  4B3T E;  1XMQ I;  4LFB I;  3GON A;  4NXN E;  2VQF I;  1ELO A;  3ZZ0 A;  2UXC E;  1XNQ E;  4B3S I;  1XMO I;  1MG7 A;  4DV2 E;  2A2D A;  2Z5B B;  1ZXN A;  1USU A;  1H72 C;  3ZKB A;  3PYE A;  3ZM7 A;  4DR5 E;  4LF9 E;  2UUC I;  2O1U A;  1Z0V A;  4MYT A;  4I3H A;  1H73 A;  3K1J A;  3Q6N A;  4KHP E;  1KVK A;  4X65 E;  2ZIT A;  3B82 A;  4DR6 E;  4DR4 E;  4JI7 E;  4JI1 I;  1N0U A;  4B3M I;  2UUA E;  2Q2E B;  1S4E A;  4FWH A;  2VQE E;  3WU5 A;  3J7A M;  1Z5B A;  4NXM E;  3PYG A;  4FN5 A;  4WUB A;  3ZKD A;  5LMN E;  2HHH E;  1H7S A;  1J5E I;  1IBM E;  4LF5 E;  1Z0W A;  4DPW A;  4LF6 I;  2CG9 A;  3QT8 A;  4DR3 E;  4DPU A;  2GS8 A;  3T1H I;  1B63 A;  2A2C A;  2CGE A;  4JI6 E;  1HK7 A;  1NHI A;  2Z5B A;  3QT7 A;  1WUU A;  4N3O A;  4PRX A;  1UEK A;  3Q1Q A;  2UU9 I;  4JI4 E;  1N0V C;  5BR8 E;  2J7K A;  4JYA I;  4DUZ I;  4FWD A;  3K17 A;  1NHH A;  4DR1 E;  4JI0 E;  2IOP A;  3LTO A;  1HNX I;  4DR7 I;  3PRY A;  1ZM9 A;  2IOQ A;  4FWG A;  3J81 C;  2VF3 A;  1DAR A;  1Z0G A;  1RRE A;  4LF7 E;  4AQY E;  4PU9 A;  5IWA E;  5LMU E;  4XTJ A;  4FW9 A;  1N34 I;  5IT9 Q;  4DUY I;  2X7I A;  3D4J A;  2UUB I;  4DR2 I;  4ED4 A;  1FWL A;  1HNW I;  3H4L A;  4JG4 A;  4DV0 E;  1Z59 A;  4DV5 E;  3ZZT A;  5IT9 C;  1XHK A;  2V2Z A;  2E5L E;  4YHH I;  1FJG E;  2R3V A;  4GKK I;  4X66 I;  2NPF A;  3F0N A;  3K85 A;  3PYF A;  2V2V A;  1QZR A;  1Z0B A;  2UXD I;  1EI1 A;  4DV4 I;  2UU9 E;  4LFC I;  2HKE A;  4JYA E;  4IZJ D;  2XEX A;  4DPT A;  1XNR E;  1B62 A;  2WW4 A;  4JI5 E;  4JI2 E;  1HR0 I;  4JV5 I;  3OTO E;  2Z5C A;  4IZK A;  3J80 Q;  1I94 I;  2ZM6 E;  1Z5C A;  4X64 E;  4LFA E;  4K0K I;  1H74 A;  5A2Q Q;  1HNZ E;  2HFU A;  4JI3 E;  4DV1 I;  1BKN A;  2EFG A;  4DV3 E;  3J7A G;  3T1Y E;  3J80 C;  2V2Q A;  3ZZU A;  4GKJ E;  2CZ9 A;  2R42 A;  3V2U C;  1Y4U A;  2DEJ A;  4DUY E;  4OX9 E;  3LPS A;  1IBL I;  4B3R I;  4YY3 E;  4LF4 I;  4IZJ B;  1N33 I;  4X62 E;  2F4V I;  1FNM A;  4DV6 I;  4DPX A;  3B8H A;  2BM1 A;  4KQV A;  4LF8 I;  4USK A;  1RR9 A;  1N32 I;  1Y6Z A;  1XMQ E;  4LFB E;  2E1R A;  4HY1 A;  4NXN I;  2VQF E;  2UXC I;  4B3S E;  1XMO E;  2UXD E;  4JI8 I;  4DV2 I;  3QT6 A;  5LL6 R;  5L3J A;  4UTG A;  4Z7C A;  4DXL A;  2O1T A;  4DR5 I;  4LF9 I;  2UUC E;  1IBK I;  4WUC A;  4DV4 E;  4KHP I;  4HAC B;  2HFS A;  5GMD A;  1Y4S A;  1ZM2 A;  4DR6 I;  4DR4 I;  4JI7 I;  4B3M E;  4JI1 E;  2V34 A;  2UUA I;  3HJC A;  4UT4 A;  1HR0 E;  3WU3 A;  4JV5 E;  2Z5E A;  3B78 A;  3WU4 A;  2VQE I;  4K0K E;  1FKA E;  4MYU A;  2BV3 A;  4NXM I;  1EA6 A;  2HHH I;  1J5E E;  2O1W A;  1IBM I;  4LF5 I;  4DU7 A;  2ZBK B;  4LF6 E;  1K47 A;  3T1H E;  4DV7 I;  1PKP A;  3JAM Q;  4JI6 I;  1PVG A;  5FLX Q;  4M1K A;  1USV A;  1KKH A;  3Q6M A;  1KTV A;  3JAM C;  1Z5A A;  3P06 A;  4JI4 I;  5FLX C;  1S16 A;  5BR8 I;  3PYD A;  1FWK A;  4DUZ E;  1NZ0 A;  4DR1 I;  4JI0 I;  2HK3 A;  4JI8 E;  1HNX E;  4DR7 E;  4Z7Y A;  1N36 I;  1U2R A;  1IBK E;  2O1V A;  3WU6 A;  3V5R A;  1KIJ A;  4LF7 I;  4AQY I;  2BM0 A;  3QT5 A;  5A2Q C;  5IWA I;  5LMU I;  1N34 E;  1OJ4 A;  2UUB E;  4DR2 E;  4PRV A;  1HNW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...