1XMOI

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmoI00
2Q2EB 1N34E 1B63A 4DV3E 5FLXC 1HNZI 2CZ9A 3J7AM 3PYEA 4LFCE 3QT5A 1Z5BA 3WU5A 3ZKDA 2HFSA 4X66E 1PIEA 1PVGA 1NHHA 2UUCI 1KKHA 4DV0I 1K47A 4DV5E 4XTJA 4NXNI 4UTGA 4DV1E 2VQFE 4DV7I 3JAMQ 5A2QQ 4DU7A 4JI5I 4X62I 2V2QA 4DV2E 4DUZI 4DR5E 3V5RA 4JYAE 4LFBE 1HNWI 1ELOA 4FW9A 4LF6E 4USMA 3J81Q 1ZM4A 3ZZ0A 1N0VC 3H4LA 3CWVA 4JV5E 3OTOI 4ED4A 3J80C 4JI0E 4DU8A 4EMDA 2ZM6I 1QZRA 4LF9E 2R3VA 2ZM6E 1IBKI 3T1HI 3LNUA 2UUBI 1HR0I 4B3ME 3JAMC 4KHPI 4HY1A 4DR1I 1H7SA 4DR7I 1ZM2A 4DR5I 5IWAI 4HACB 2LJPA 4B3RI 4DV7E 4DUYE 1N36E 4YHHI 4YY3E 1Z0EA 3ZM7A 4LF7I 1OJ4A 3T1YE 1Z59A 4JI7E 1Z0VA 3HULA 3T1YI 4WUDA 4GKJE 1VISA 4RPFA 1J5EE 4JI3I 1WUUA 2E5LE 3LPSA 1NHIA 1N32I 4JI6I 3QT8A 4DPWA 1N0UA 3J7AG 3PYDA 2UUAE 4DR6I 1FKAE 1EI1A 4JI5E 2X36A 3Q1QA 2HFUA 4GKKE 3B8HA 5LMNI 1HNXE 1RREA 2E5LI 1HNXI 5BR8I 4FWGA 4GKKI 4AQYE 4DUYI 4DXLA 1XNQE 4HXZA 4YHHE 4MYTA 4JI8I 4DPUA 4NXMI 2E1RA 4DV2I 2DEIA 1MU5A 4UT4A 3LTOA 5IT9Q 1S4EA 1XMOI 4B3MI 1J5EI 4JI3E 4DR1E 1B62A 2HKJA 1XNQI 5GMEA 4DV5I 4FN5A 2HK2A 3WU6A 3T1HE 4KQVA 2J7KA 4Z7YA 1I94E 4M1KA 3GONA 4LF7E 2WW4A 1PKPA 1Z0GA 2XEXA 3B82A 4AQYI 1N33I 3D4JA 4PU9A 5LMUE 4USKA 3PYGA 2VF3A 4JI0I 5LMNE 2UUAI 4WUBA 4HYMA 3V2UC 4DR6E 4X66I 4DR7E 4LFBI 1HNWE 4B3RE 1FJGE 2DEJA 4DV6I 1H7UA 5L3JA 2NPFA 2VQEE 1HNZE 2UUBE 5LMUI 1I94I 1IBKE 1Z0WA 1Z5CA 3ZZTA 1FNMA 4LF8I 2UUCE 4P7AA 1H73A 4JI1I 4JYAI 4LFCI 1XMOE 1ZXNA 1N32E 2V2VA 2R42A 1H74A 2VQFI 3F0NA 1H72C 4KHPE 4K0KE 2F4VE 1HR0E 4B3TI 5BR8E 1UEKA 4JV5I 4DR4E 4Z7CA 1ZXMA 1FWLA 1DARA 4NXME 3B78A 4FWHA 2V8PA 1XHKA 4LF5E 4P52A 4DV4E 1ZM9A 4I3HA 4X62E 2EFGA 4URLA 4JI4E 3PYFA 4PRVA 1NHJA 4GKJI 2GS8A 5LL6R 4X65E 1Z0TA 1A6FA 4X64I 4B3SE 2A2CA 3OTOE 5A2QC 4JI2E 4DPXA 2UU9E 4PRXA 4DPYA 2HHHI 2BM0A 4LF5I 1BKNA 1ZM3A 5IWAE 1EA6A 4OX9E 4B3SI 4DR2I 5IT9C 2ZBKB 4DR3E 1XMQE 4DR2E 4YY3I 1NZ0A 1N36I 4LFAE 4LF9I 4NXNE 1Z0BA 2UXCI 1MX0A 3J80Q 4DV4I 4LF4I 2ZITA 1U2RA 2AJ4A 2BM1A 1KVKA 2V34A 1KTVA 4JI6E 1IBLI 1MG7A 4FWDA 2X7IA 4R1FA 4X64E 2UU9I 3WU3A 3QT7A 1N34I 2UXCE 3QT6A 4DPTA 4DV1I 2UXDI 1IBME 1IBMI 4JI7I 1KIJA 3ZKBA 1RR9A 4DV0E 2OI2A 4OX9I 3ZZUA 4JI4I 2VQEI 1IBLE 4WUCA 1S16A 2BV3A 4DV6E 4MYUA 1XNRE 3WU4A 4DR4I 5GMDA 3K17A 4LFAI 4JG4A 2UXDE 4HACA 2HK3A 3M6AA 4ZVIA 2HKEA 1Z5AA 2F4VI 2UXBI 1FWKA 1N33E 1FJGI 4LF6I 2A2DA 2V2ZA 4JI8E 4DV3I 1XNRI 1FI4A 4JI2I 1Z0CA 5FLXQ 4DUZE 2HHHE 4JI1E 4LF4E 3J81C 3K1JA 4LF8E 2UXBE 4B3TE 1D6TA 4K0KI 4DR3I 4X65I 1XMQI
chains in the Genus database with same CATH superfamily
2Q2EB 3Q6MA 1N34E 5C0XC 1B63A 2O1WA 4DV3E 1XXEA 2PO2A 5JEAC 5FLXC 1HNZI 2Z5CA 3Q6NA 2C38B 1HK7A 5DRQA 2CZ9A 2NN6B 3J7AM 3PYEA 4LFCE 3QT5A 1Z5BA 3WU5A 3ZKDA 2WNRB 2HFSA 2WNRA 4IFDF 4X66E 1PIEA 1PVGA 1NHHA 2UUCI 1KKHA 4BA2A 4DV0I 2JT2A 1K47A 5DROA 4DV5E 2GO3A 4XTJA 4NXNI 4UTGA 4DV1E 2VQFE 4BA1B 2IOQA 4DV7I 3P76A 5ELWA 3JAMQ 5A2QQ 4DU7A 5C0XD 4JI5I 4X62I 2V2QA 4DV2E 4DUZI 4OO1A 4NBQA 5K36F 4DR5E 3GLLA 3V5RA 5EKWA 4JYAE 4LFBE 2PO0A 1HNWI 1ELOA 4FW9A 4LF6E 4USMA 3J81Q 1ZM4A 3ZZ0A 1N0VC 3H4LA 3CWVA 3PRYA 4JV5E 3OTOI 4ED4A 3J80C 4JI0E 4DU8A 4EMDA 2ZM6I 1QZRA 4LF9E 2R3VA 2ZM6E 1IBKI 3T1HI 2VESA 3LNUA 2UUBI 2C38A 1HR0I 3PS2A 4B3ME 3JAMC 4IZJD 4KHPI 2NN6D 4HY1A 3U1YA 1H7SA 4BA1A 4DR1I 4DR7I 1ZM2A 4IZJA 4DR5I 5IWAI 4HACB 2LJPA 4LCFA 4B3RI 1Y4UA 4DV7E 4DUYE 3P06A 1N36E 4YHHI 4YY3E 1Z0EA 3ZM7A 4AIMA 4LF7I 1OJ4A 3T1YE 1Z59A 4JI7E 1Z0VA 5K36B 2BA0G 3HULA 3T1YI 3CDIA 4WUDA 4GKJE 1VISA 4RPFA 1J5EE 4JI3I 1WUUA 4MU3A 2E5LE 4IZJB 5DRPA 2JEBA 3LPSA 1NHIA 1N32I 4JI6I 1UDSA 4FW3A 3QT8A 1R6LA 4DPWA 1N0UA 3J7AG 3PYDA 2UUAE 4DR6I 1FKAE 1EI1A 3K85A 4IFDB 4JI5E 2X36A 3Q1QA 2HFUA 4GKKE 4MU4A 5K36C 3B8HA 5LMNI 1HNXE 1RREA 2E5LI 3HJCA 4OKGA 1HNXI 5BR8I 4FWGA 4GKKI 2F1DA 3NZKA 4MQYA 5DNXA 4AQYE 4DUYI 4DXLA 3M7ND 4FW5A 1XNQE 4HXZA 4YHHE 4MYTA 4JI8I 4DPUA 4NXMI 2E1RA 3M7NG 4DV2I 2DEIA 1MU5A 4UT4A 1OYPA 3LTOA 5IT9Q 1S4EA 1XMOI 4B3MI 1J5EI 4JI3E 2GO4A 3UHMA 4FW7A 4DR1E 1B62A 2HKJA 1XNQI 4FW6A 1P42A 5GMEA 4DV5I 4FN5A 4MDTA 4LCHA 2HK2A 4LPFA 4IS9A 3WU6A 3T1HE 3KRNA 4KQVA 2J7KA 4Z7YA 1I94E 4M1KA 2BR2A 3GONA 4LF7E 2WW4A 1PKPA 1Z0GA 2WP8B 5C0XE 4OO1F 4N3OA 2JEAA 5K36D 2BA1G 2XEXA 3B82A 2PO0B 4LOMA 1OYRA 4AQYI 1N33I 3D4JA 2PNMA 2C39B 4PU9A 4QNJA 5LMUE 5JEAF 4USKA 3PYGA 2CG9A 1Y6ZA 2VF3A 4JI0I 5LMNE 2UUAI 4WUBA 4HYMA 3V2UC 5K36E 4DR6E 4IFDC 4X66I 1Y5YA 4DR7E 4LFBI 1HNWE 4B3RE 1FJGE 2DEJA 1H7UA 5L3JA 4DV6I 2NPFA 5C0XB 2VQEE 1HNZE 2UUBE 5LMUI 1I94I 1IBKE 1Z0WA 1Z5CA 4U3DA 2NN6A 3ZZTA 1FNMA 4LF8I 4P7AA 2GQ0A 2UUCE 1H73A 4JI1I 2PO2B 3M85D 4LFCI 4IFDE 4JYAI 3P3GA 1XMOE 1ZXNA 4J3DA 4FW4A 4QNKA 2IOPA 2PNLA 5JEAB 1N32E 1Y4SA 2V2VA 1USVA 2R42A 1H74A 2VQFI 1E3PA 2O1TA 3F0NA 1H72C 4KHPE 4OO1B 4K0KE 4AM3A 2F4VE 1HR0E 1RHYA 4OO1C 4B3TI 2JE6B 3U1KA 5BR8E 3DD6A 1Y60A 1UEKA 4JV5I 4DR4E 4Z7CA 1ZXMA 3P3EA 4AIDA 1FWLA 3CDJA 1DARA 2C39A 3B78A 4NXME 1YH8A 4FWHA 2V8PA 1XHKA 4LF5E 4P52A 4DV4E 1ZM9A 4I3HA 4X62E 2EFGA 4URLA 4JI4E 3PYFA 4PRVA 2NN6E 1NHJA 2Z5CB 3P3CA 4GKJI 2GS8A 5LL6R 1UDOA 4X65E 1Z0TA 1A6FA 4X64I 4B3SE 2A2CA 1UDQA 3OTOE 5A2QC 1VI7A 4JI2E 4DPXA 3M85G 2UU9E 4PRXA 1UDNA 4DPYA 2HHHI 2BM0A 2C37A 4MU1A 4LF5I 5C0XA 1BKNA 1ZM3A 4U3BA 3PS3A 5IWAE 1EA6A 2AE8A 4OX9E 4B3SI 4GQUA 5DNLA 3L7ZA 3B4TA 4DR2I 4IFDA 5IT9C 5JEAA 2ZBKB 2C37B 4DR3E 1XMQE 4DR2E 4YY3I 1NZ0A 1N36I 4LFAE 4LF9I 4NXNE 1Z0BA 2O3ZA 2UXCI 5DRRA 1MX0A 3J80Q 3GMEA 4DV4I 2PO1B 4LF4I 2ZITA 1U2RA 2AJ4A 2BM1A 1KVKA 2V34A 2NN6C 1KTVA 4ISAA 1E3HA 4JI6E 4MU0A 1IBLI 1MG7A 4FWDA 5EL9A 2BA1D 2X7IA 4R1FA 4X64E 5C0XF 4OO1E 2UU9I 3WU3A 3QT7A 1N34I 2UXCE 3QT6A 4DPTA 4DV1I 1R6MA 3GCMA 2UXDI 1IBME 1IBMI 4JI7I 1KIJA 3ZKBA 1RR9A 4DV0E 1OYSA 2OI2A 4OZEA 2BR2B 4OX9I 1YHCA 3ZZUA 4JI4I 2PNZB 2JEBB 2VQEI 1IBLE 2Z5BA 4WUCA 1S16A 2BV3A 4DV6E 4MYUA 1XNRE 3WU4A 5JEAD 4LCGA 4DR4I 3PS1A 2JE6A 5GMDA 3K17A 2JEAB 2O1UA 4LFAI 4JG4A 3L7ZB 2IESA 4HACA 2UXDE 2HK3A 3M6AA 2WP8A 4ZVIA 2BA0D 4IZKB 4IZKA 2CVEA 2HKEA 1Z5AA 2F4VI 2UXBI 2J65A 1FWKA 1N33E 2PO1A 1FJGI 5K36A 4LF6I 5JEAE 2A2DA 2V2ZA 4JI8E 4DV3I 1XNRI 1FI4A 1USUA 4JI2I 1Z0CA 4BA2B 2CGEA 2Z5EA 5FLXQ 4DUZE 4IFDD 2HHHE 4JI1E 2O1VA 4LF4E 3J81C 3K1JA 5FWKA 4LF8E 2UXBE 3H1CA 4B3TE 1D6TA 2IERA 3HKMA 2NN6F 4K0KI 2PNZA 4DR3I 4X65I 1XMQI 2Z5BB 4OO1D
chains in the Genus database with same CATH topology
2Q2EB 3Q6MA 1N34E 1B63A 2O1WA 4DV3E 5FLXC 1HNZI 2Z5CA 3Q6NA 1HK7A 2CZ9A 3J7AM 3PYEA 4LFCE 3QT5A 1Z5BA 3WU5A 3ZKDA 2HFSA 4X66E 1PIEA 1PVGA 1NHHA 2UUCI 1KKHA 4DV0I 1K47A 4DV5E 4XTJA 4NXNI 4UTGA 4DV1E 2VQFE 2IOQA 4DV7I 3JAMQ 5A2QQ 4DU7A 4JI5I 4X62I 2V2QA 4DV2E 4DUZI 4DR5E 3V5RA 4JYAE 4LFBE 1HNWI 1ELOA 4FW9A 4LF6E 4USMA 3J81Q 1ZM4A 3ZZ0A 1N0VC 3H4LA 3CWVA 3PRYA 4JV5E 3OTOI 4ED4A 3J80C 4JI0E 4DU8A 4EMDA 2ZM6I 1QZRA 4LF9E 2R3VA 2ZM6E 1IBKI 3T1HI 3LNUA 2UUBI 1HR0I 4B3ME 3JAMC 4IZJD 4KHPI 4HY1A 4DR1I 1H7SA 4DR7I 1ZM2A 4IZJA 4DR5I 5IWAI 4HACB 2LJPA 4B3RI 1Y4UA 4DV7E 4DUYE 3P06A 1N36E 4YHHI 4YY3E 1Z0EA 3ZM7A 4LF7I 1OJ4A 3T1YE 1Z59A 4JI7E 1Z0VA 3HULA 3T1YI 4WUDA 4GKJE 1VISA 4RPFA 1J5EE 4JI3I 1WUUA 2E5LE 4IZJB 3LPSA 1NHIA 1N32I 4JI6I 3QT8A 4DPWA 1N0UA 3J7AG 3PYDA 2UUAE 4DR6I 1FKAE 1EI1A 3K85A 4JI5E 2X36A 3Q1QA 2HFUA 4GKKE 3B8HA 5LMNI 1HNXE 1RREA 2E5LI 3HJCA 1HNXI 5BR8I 4FWGA 4GKKI 4AQYE 4DUYI 4DXLA 1XNQE 4HXZA 4YHHE 4MYTA 4JI8I 4DPUA 4NXMI 2E1RA 4DV2I 2DEIA 1MU5A 4UT4A 3LTOA 5IT9Q 1S4EA 1XMOI 4B3MI 1J5EI 4JI3E 4DR1E 1B62A 2HKJA 1XNQI 5GMEA 4DV5I 4FN5A 2HK2A 3WU6A 3T1HE 4KQVA 2J7KA 4Z7YA 1I94E 4M1KA 3GONA 4LF7E 2WW4A 1PKPA 1Z0GA 4N3OA 2XEXA 3B82A 4AQYI 1N33I 3D4JA 2PNMA 4PU9A 5LMUE 4USKA 3PYGA 2CG9A 1Y6ZA 2VF3A 4JI0I 5LMNE 2UUAI 4WUBA 4HYMA 3V2UC 4DR6E 4X66I 4DR7E 4LFBI 1HNWE 4B3RE 1FJGE 2DEJA 4DV6I 1H7UA 5L3JA 2NPFA 2VQEE 1HNZE 2UUBE 5LMUI 1I94I 1IBKE 1Z0WA 1Z5CA 3ZZTA 1FNMA 4LF8I 2UUCE 2GQ0A 4P7AA 1H73A 4JI1I 4JYAI 4LFCI 1XMOE 1ZXNA 2IOPA 2PNLA 1N32E 1Y4SA 2V2VA 1USVA 2R42A 1H74A 2VQFI 2O1TA 3F0NA 1H72C 4KHPE 4K0KE 2F4VE 1HR0E 4B3TI 5BR8E 1UEKA 4JV5I 4DR4E 4Z7CA 1ZXMA 1FWLA 1DARA 3B78A 4NXME 4FWHA 2V8PA 1XHKA 4LF5E 4P52A 4DV4E 1ZM9A 4I3HA 4X62E 2EFGA 4URLA 4JI4E 3PYFA 4PRVA 1NHJA 2Z5CB 4GKJI 2GS8A 5LL6R 4X65E 1Z0TA 1A6FA 4X64I 4B3SE 2A2CA 3OTOE 5A2QC 4JI2E 4DPXA 2UU9E 4PRXA 4DPYA 2HHHI 2BM0A 4LF5I 1BKNA 1ZM3A 5IWAE 1EA6A 4OX9E 4B3SI 4DR2I 5IT9C 2ZBKB 4DR3E 1XMQE 4DR2E 4YY3I 1NZ0A 1N36I 4LFAE 4LF9I 4NXNE 1Z0BA 2UXCI 1MX0A 3J80Q 4DV4I 4LF4I 2ZITA 1U2RA 2AJ4A 2BM1A 1KVKA 2V34A 1KTVA 4JI6E 1IBLI 1MG7A 4FWDA 2X7IA 4R1FA 4X64E 2UU9I 3WU3A 3QT7A 1N34I 2UXCE 3QT6A 4DPTA 4DV1I 2UXDI 1IBME 1IBMI 4JI7I 1KIJA 3ZKBA 1RR9A 4DV0E 2OI2A 4OX9I 3ZZUA 4JI4I 2VQEI 1IBLE 2Z5BA 4WUCA 1S16A 2BV3A 4DV6E 4MYUA 1XNRE 3WU4A 4DR4I 5GMDA 3K17A 2O1UA 4LFAI 4JG4A 2UXDE 4HACA 2HK3A 3M6AA 4ZVIA 4IZKB 4IZKA 2HKEA 1Z5AA 2F4VI 2UXBI 1FWKA 1N33E 1FJGI 4LF6I 2A2DA 2V2ZA 4JI8E 4DV3I 1XNRI 1FI4A 1USUA 4JI2I 1Z0CA 2CGEA 2Z5EA 4DUZE 5FLXQ 2HHHE 4JI1E 2O1VA 4LF4E 3J81C 3K1JA 5FWKA 4LF8E 2UXBE 4B3TE 1D6TA 4K0KI 4DR3I 4X65I 1XMQI 2Z5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E B;  1N34 E;  1B63 A;  4DV3 E;  5FLX C;  1HNZ I;  2CZ9 A;  3J7A M;  3PYE A;  4LFC E;  3QT5 A;  1Z5B A;  3WU5 A;  3ZKD A;  2HFS A;  4X66 E;  1PIE A;  1PVG A;  1NHH A;  2UUC I;  1KKH A;  4DV0 I;  1K47 A;  4DV5 E;  4XTJ A;  4NXN I;  4UTG A;  4DV1 E;  2VQF E;  4DV7 I;  3JAM Q;  5A2Q Q;  4DU7 A;  4JI5 I;  4X62 I;  2V2Q A;  4DV2 E;  4DUZ I;  4DR5 E;  3V5R A;  4JYA E;  4LFB E;  1HNW I;  1ELO A;  4FW9 A;  4LF6 E;  4USM A;  3J81 Q;  1ZM4 A;  3ZZ0 A;  1N0V C;  3H4L A;  3CWV A;  4JV5 E;  3OTO I;  4ED4 A;  3J80 C;  4JI0 E;  4DU8 A;  4EMD A;  2ZM6 I;  1QZR A;  4LF9 E;  2R3V A;  2ZM6 E;  1IBK I;  3T1H I;  3LNU A;  2UUB I;  1HR0 I;  4B3M E;  3JAM C;  4KHP I;  4HY1 A;  4DR1 I;  1H7S A;  4DR7 I;  1ZM2 A;  4DR5 I;  5IWA I;  4HAC B;  2LJP A;  4B3R I;  4DV7 E;  4DUY E;  1N36 E;  4YHH I;  4YY3 E;  1Z0E A;  3ZM7 A;  4LF7 I;  1OJ4 A;  3T1Y E;  1Z59 A;  4JI7 E;  1Z0V A;  3HUL A;  3T1Y I;  4WUD A;  4GKJ E;  1VIS A;  4RPF A;  1J5E E;  4JI3 I;  1WUU A;  2E5L E;  3LPS A;  1NHI A;  1N32 I;  4JI6 I;  3QT8 A;  4DPW A;  1N0U A;  3J7A G;  3PYD A;  2UUA E;  4DR6 I;  1FKA E;  1EI1 A;  4JI5 E;  2X36 A;  3Q1Q A;  2HFU A;  4GKK E;  3B8H A;  5LMN I;  1HNX E;  1RRE A;  2E5L I;  1HNX I;  5BR8 I;  4FWG A;  4GKK I;  4AQY E;  4DUY I;  4DXL A;  1XNQ E;  4HXZ A;  4YHH E;  4MYT A;  4JI8 I;  4DPU A;  4NXM I;  2E1R A;  4DV2 I;  2DEI A;  1MU5 A;  4UT4 A;  3LTO A;  5IT9 Q;  1S4E A;  1XMO I;  4B3M I;  1J5E I;  4JI3 E;  4DR1 E;  1B62 A;  2HKJ A;  1XNQ I;  5GME A;  4DV5 I;  4FN5 A;  2HK2 A;  3WU6 A;  3T1H E;  4KQV A;  2J7K A;  4Z7Y A;  1I94 E;  4M1K A;  3GON A;  4LF7 E;  2WW4 A;  1PKP A;  1Z0G A;  2XEX A;  3B82 A;  4AQY I;  1N33 I;  3D4J A;  4PU9 A;  5LMU E;  4USK A;  3PYG A;  2VF3 A;  4JI0 I;  5LMN E;  2UUA I;  4WUB A;  4HYM A;  3V2U C;  4DR6 E;  4X66 I;  4DR7 E;  4LFB I;  1HNW E;  4B3R E;  1FJG E;  2DEJ A;  4DV6 I;  1H7U A;  5L3J A;  2NPF A;  2VQE E;  1HNZ E;  2UUB E;  5LMU I;  1I94 I;  1IBK E;  1Z0W A;  1Z5C A;  3ZZT A;  1FNM A;  4LF8 I;  2UUC E;  4P7A A;  1H73 A;  4JI1 I;  4JYA I;  4LFC I;  1XMO E;  1ZXN A;  1N32 E;  2V2V A;  2R42 A;  1H74 A;  2VQF I;  3F0N A;  1H72 C;  4KHP E;  4K0K E;  2F4V E;  1HR0 E;  4B3T I;  5BR8 E;  1UEK A;  4JV5 I;  4DR4 E;  4Z7C A;  1ZXM A;  1FWL A;  1DAR A;  4NXM E;  3B78 A;  4FWH A;  2V8P A;  1XHK A;  4LF5 E;  4P52 A;  4DV4 E;  1ZM9 A;  4I3H A;  4X62 E;  2EFG A;  4URL A;  4JI4 E;  3PYF A;  4PRV A;  1NHJ A;  4GKJ I;  2GS8 A;  5LL6 R;  4X65 E;  1Z0T A;  1A6F A;  4X64 I;  4B3S E;  2A2C A;  3OTO E;  5A2Q C;  4JI2 E;  4DPX A;  2UU9 E;  4PRX A;  4DPY A;  2HHH I;  2BM0 A;  4LF5 I;  1BKN A;  1ZM3 A;  5IWA E;  1EA6 A;  4OX9 E;  4B3S I;  4DR2 I;  5IT9 C;  2ZBK B;  4DR3 E;  1XMQ E;  4DR2 E;  4YY3 I;  1NZ0 A;  1N36 I;  4LFA E;  4LF9 I;  4NXN E;  1Z0B A;  2UXC I;  1MX0 A;  3J80 Q;  4DV4 I;  4LF4 I;  2ZIT A;  1U2R A;  2AJ4 A;  2BM1 A;  1KVK A;  2V34 A;  1KTV A;  4JI6 E;  1IBL I;  1MG7 A;  4FWD A;  2X7I A;  4R1F A;  4X64 E;  2UU9 I;  3WU3 A;  3QT7 A;  1N34 I;  2UXC E;  3QT6 A;  4DPT A;  4DV1 I;  2UXD I;  1IBM E;  1IBM I;  4JI7 I;  1KIJ A;  3ZKB A;  1RR9 A;  4DV0 E;  2OI2 A;  4OX9 I;  3ZZU A;  4JI4 I;  2VQE I;  1IBL E;  4WUC A;  1S16 A;  2BV3 A;  4DV6 E;  4MYU A;  1XNR E;  3WU4 A;  4DR4 I;  5GMD A;  3K17 A;  4LFA I;  4JG4 A;  2UXD E;  4HAC A;  2HK3 A;  3M6A A;  4ZVI A;  2HKE A;  1Z5A A;  2F4V I;  2UXB I;  1FWK A;  1N33 E;  1FJG I;  4LF6 I;  2A2D A;  2V2Z A;  4JI8 E;  4DV3 I;  1XNR I;  1FI4 A;  4JI2 I;  1Z0C A;  5FLX Q;  4DUZ E;  2HHH E;  4JI1 E;  4LF4 E;  3J81 C;  3K1J A;  4LF8 E;  2UXB E;  4B3T E;  1D6T A;  4K0K I;  4DR3 I;  4X65 I;  1XMQ I; 
#chains in the Genus database with same CATH topology
 2Q2E B;  3Q6M A;  1N34 E;  5C0X C;  1B63 A;  2O1W A;  4DV3 E;  1XXE A;  2PO2 A;  5JEA C;  5FLX C;  1HNZ I;  2Z5C A;  3Q6N A;  2C38 B;  1HK7 A;  5DRQ A;  2CZ9 A;  2NN6 B;  3J7A M;  3PYE A;  4LFC E;  3QT5 A;  1Z5B A;  3WU5 A;  3ZKD A;  2WNR B;  2HFS A;  2WNR A;  4IFD F;  4X66 E;  1PIE A;  1PVG A;  1NHH A;  2UUC I;  1KKH A;  4BA2 A;  4DV0 I;  2JT2 A;  1K47 A;  5DRO A;  4DV5 E;  2GO3 A;  4XTJ A;  4NXN I;  4UTG A;  4DV1 E;  2VQF E;  4BA1 B;  2IOQ A;  4DV7 I;  3P76 A;  5ELW A;  3JAM Q;  5A2Q Q;  4DU7 A;  5C0X D;  4JI5 I;  4X62 I;  2V2Q A;  4DV2 E;  4DUZ I;  4OO1 A;  4NBQ A;  5K36 F;  4DR5 E;  3GLL A;  3V5R A;  5EKW A;  4JYA E;  4LFB E;  2PO0 A;  1HNW I;  1ELO A;  4FW9 A;  4LF6 E;  4USM A;  3J81 Q;  1ZM4 A;  3ZZ0 A;  1N0V C;  3H4L A;  3CWV A;  3PRY A;  4JV5 E;  3OTO I;  4ED4 A;  3J80 C;  4JI0 E;  4DU8 A;  4EMD A;  2ZM6 I;  1QZR A;  4LF9 E;  2R3V A;  2ZM6 E;  1IBK I;  3T1H I;  2VES A;  3LNU A;  2UUB I;  2C38 A;  1HR0 I;  3PS2 A;  4B3M E;  3JAM C;  4IZJ D;  4KHP I;  2NN6 D;  4HY1 A;  3U1Y A;  1H7S A;  4BA1 A;  4DR1 I;  4DR7 I;  1ZM2 A;  4IZJ A;  4DR5 I;  5IWA I;  4HAC B;  2LJP A;  4LCF A;  4B3R I;  1Y4U A;  4DV7 E;  4DUY E;  3P06 A;  1N36 E;  4YHH I;  4YY3 E;  1Z0E A;  3ZM7 A;  4AIM A;  4LF7 I;  1OJ4 A;  3T1Y E;  1Z59 A;  4JI7 E;  1Z0V A;  5K36 B;  2BA0 G;  3HUL A;  3T1Y I;  3CDI A;  4WUD A;  4GKJ E;  1VIS A;  4RPF A;  1J5E E;  4JI3 I;  1WUU A;  4MU3 A;  2E5L E;  4IZJ B;  5DRP A;  2JEB A;  3LPS A;  1NHI A;  1N32 I;  4JI6 I;  1UDS A;  4FW3 A;  3QT8 A;  1R6L A;  4DPW A;  1N0U A;  3J7A G;  3PYD A;  2UUA E;  4DR6 I;  1FKA E;  1EI1 A;  3K85 A;  4IFD B;  4JI5 E;  2X36 A;  3Q1Q A;  2HFU A;  4GKK E;  4MU4 A;  5K36 C;  3B8H A;  5LMN I;  1HNX E;  1RRE A;  2E5L I;  3HJC A;  4OKG A;  1HNX I;  5BR8 I;  4FWG A;  4GKK I;  2F1D A;  3NZK A;  4MQY A;  5DNX A;  4AQY E;  4DUY I;  4DXL A;  3M7N D;  4FW5 A;  1XNQ E;  4HXZ A;  4YHH E;  4MYT A;  4JI8 I;  4DPU A;  4NXM I;  2E1R A;  3M7N G;  4DV2 I;  2DEI A;  1MU5 A;  4UT4 A;  1OYP A;  3LTO A;  5IT9 Q;  1S4E A;  1XMO I;  4B3M I;  1J5E I;  4JI3 E;  2GO4 A;  3UHM A;  4FW7 A;  4DR1 E;  1B62 A;  2HKJ A;  1XNQ I;  4FW6 A;  1P42 A;  5GME A;  4DV5 I;  4FN5 A;  4MDT A;  4LCH A;  2HK2 A;  4LPF A;  4IS9 A;  3WU6 A;  3T1H E;  3KRN A;  4KQV A;  2J7K A;  4Z7Y A;  1I94 E;  4M1K A;  2BR2 A;  3GON A;  4LF7 E;  2WW4 A;  1PKP A;  1Z0G A;  2WP8 B;  5C0X E;  4OO1 F;  4N3O A;  2JEA A;  5K36 D;  2BA1 G;  2XEX A;  3B82 A;  2PO0 B;  4LOM A;  1OYR A;  4AQY I;  1N33 I;  3D4J A;  2PNM A;  2C39 B;  4PU9 A;  4QNJ A;  5LMU E;  5JEA F;  4USK A;  3PYG A;  2CG9 A;  1Y6Z A;  2VF3 A;  4JI0 I;  5LMN E;  2UUA I;  4WUB A;  4HYM A;  3V2U C;  5K36 E;  4DR6 E;  4IFD C;  4X66 I;  1Y5Y A;  4DR7 E;  4LFB I;  1HNW E;  4B3R E;  1FJG E;  2DEJ A;  1H7U A;  5L3J A;  4DV6 I;  2NPF A;  5C0X B;  2VQE E;  1HNZ E;  2UUB E;  5LMU I;  1I94 I;  1IBK E;  1Z0W A;  1Z5C A;  4U3D A;  2NN6 A;  3ZZT A;  1FNM A;  4LF8 I;  4P7A A;  2GQ0 A;  2UUC E;  1H73 A;  4JI1 I;  2PO2 B;  3M85 D;  4LFC I;  4IFD E;  4JYA I;  3P3G A;  1XMO E;  1ZXN A;  4J3D A;  4FW4 A;  4QNK A;  2IOP A;  2PNL A;  5JEA B;  1N32 E;  1Y4S A;  2V2V A;  1USV A;  2R42 A;  1H74 A;  2VQF I;  1E3P A;  2O1T A;  3F0N A;  1H72 C;  4KHP E;  4OO1 B;  4K0K E;  4AM3 A;  2F4V E;  1HR0 E;  1RHY A;  4OO1 C;  4B3T I;  2JE6 B;  3U1K A;  5BR8 E;  3DD6 A;  1Y60 A;  1UEK A;  4JV5 I;  4DR4 E;  4Z7C A;  1ZXM A;  3P3E A;  4AID A;  1FWL A;  3CDJ A;  1DAR A;  2C39 A;  3B78 A;  4NXM E;  1YH8 A;  4FWH A;  2V8P A;  1XHK A;  4LF5 E;  4P52 A;  4DV4 E;  1ZM9 A;  4I3H A;  4X62 E;  2EFG A;  4URL A;  4JI4 E;  3PYF A;  4PRV A;  2NN6 E;  1NHJ A;  2Z5C B;  3P3C A;  4GKJ I;  2GS8 A;  5LL6 R;  1UDO A;  4X65 E;  1Z0T A;  1A6F A;  4X64 I;  4B3S E;  2A2C A;  1UDQ A;  3OTO E;  5A2Q C;  1VI7 A;  4JI2 E;  4DPX A;  3M85 G;  2UU9 E;  4PRX A;  1UDN A;  4DPY A;  2HHH I;  2BM0 A;  2C37 A;  4MU1 A;  4LF5 I;  5C0X A;  1BKN A;  1ZM3 A;  4U3B A;  3PS3 A;  5IWA E;  1EA6 A;  2AE8 A;  4OX9 E;  4B3S I;  4GQU A;  5DNL A;  3L7Z A;  3B4T A;  4DR2 I;  4IFD A;  5IT9 C;  5JEA A;  2ZBK B;  2C37 B;  4DR3 E;  1XMQ E;  4DR2 E;  4YY3 I;  1NZ0 A;  1N36 I;  4LFA E;  4LF9 I;  4NXN E;  1Z0B A;  2O3Z A;  2UXC I;  5DRR A;  1MX0 A;  3J80 Q;  3GME A;  4DV4 I;  2PO1 B;  4LF4 I;  2ZIT A;  1U2R A;  2AJ4 A;  2BM1 A;  1KVK A;  2V34 A;  2NN6 C;  1KTV A;  4ISA A;  1E3H A;  4JI6 E;  4MU0 A;  1IBL I;  1MG7 A;  4FWD A;  5EL9 A;  2BA1 D;  2X7I A;  4R1F A;  4X64 E;  5C0X F;  4OO1 E;  2UU9 I;  3WU3 A;  3QT7 A;  1N34 I;  2UXC E;  3QT6 A;  4DPT A;  4DV1 I;  1R6M A;  3GCM A;  2UXD I;  1IBM E;  1IBM I;  4JI7 I;  1KIJ A;  3ZKB A;  1RR9 A;  4DV0 E;  1OYS A;  2OI2 A;  4OZE A;  2BR2 B;  4OX9 I;  1YHC A;  3ZZU A;  4JI4 I;  2PNZ B;  2JEB B;  2VQE I;  1IBL E;  2Z5B A;  4WUC A;  1S16 A;  2BV3 A;  4DV6 E;  4MYU A;  1XNR E;  3WU4 A;  5JEA D;  4LCG A;  4DR4 I;  3PS1 A;  2JE6 A;  5GMD A;  3K17 A;  2JEA B;  2O1U A;  4LFA I;  4JG4 A;  3L7Z B;  2IES A;  4HAC A;  2UXD E;  2HK3 A;  3M6A A;  2WP8 A;  4ZVI A;  2BA0 D;  4IZK B;  4IZK A;  2CVE A;  2HKE A;  1Z5A A;  2F4V I;  2UXB I;  2J65 A;  1FWK A;  1N33 E;  2PO1 A;  1FJG I;  5K36 A;  4LF6 I;  5JEA E;  2A2D A;  2V2Z A;  4JI8 E;  4DV3 I;  1XNR I;  1FI4 A;  1USU A;  4JI2 I;  1Z0C A;  4BA2 B;  2CGE A;  2Z5E A;  5FLX Q;  4DUZ E;  4IFD D;  2HHH E;  4JI1 E;  2O1V A;  4LF4 E;  3J81 C;  3K1J A;  5FWK A;  4LF8 E;  2UXB E;  3H1C A;  4B3T E;  1D6T A;  2IER A;  3HKM A;  2NN6 F;  4K0K I;  2PNZ A;  4DR3 I;  4X65 I;  1XMQ I;  2Z5B B;  4OO1 D; 
#chains in the Genus database with same CATH homology
 2Q2E B;  3Q6M A;  1N34 E;  1B63 A;  2O1W A;  4DV3 E;  5FLX C;  1HNZ I;  2Z5C A;  3Q6N A;  1HK7 A;  2CZ9 A;  3J7A M;  3PYE A;  4LFC E;  3QT5 A;  1Z5B A;  3WU5 A;  3ZKD A;  2HFS A;  4X66 E;  1PIE A;  1PVG A;  1NHH A;  2UUC I;  1KKH A;  4DV0 I;  1K47 A;  4DV5 E;  4XTJ A;  4NXN I;  4UTG A;  4DV1 E;  2VQF E;  2IOQ A;  4DV7 I;  3JAM Q;  5A2Q Q;  4DU7 A;  4JI5 I;  4X62 I;  2V2Q A;  4DV2 E;  4DUZ I;  4DR5 E;  3V5R A;  4JYA E;  4LFB E;  1HNW I;  1ELO A;  4FW9 A;  4LF6 E;  4USM A;  3J81 Q;  1ZM4 A;  3ZZ0 A;  1N0V C;  3H4L A;  3CWV A;  3PRY A;  4JV5 E;  3OTO I;  4ED4 A;  3J80 C;  4JI0 E;  4DU8 A;  4EMD A;  2ZM6 I;  1QZR A;  4LF9 E;  2R3V A;  2ZM6 E;  1IBK I;  3T1H I;  3LNU A;  2UUB I;  1HR0 I;  4B3M E;  3JAM C;  4IZJ D;  4KHP I;  4HY1 A;  4DR1 I;  1H7S A;  4DR7 I;  1ZM2 A;  4IZJ A;  4DR5 I;  5IWA I;  4HAC B;  2LJP A;  4B3R I;  1Y4U A;  4DV7 E;  4DUY E;  3P06 A;  1N36 E;  4YHH I;  4YY3 E;  1Z0E A;  3ZM7 A;  4LF7 I;  1OJ4 A;  3T1Y E;  1Z59 A;  4JI7 E;  1Z0V A;  3HUL A;  3T1Y I;  4WUD A;  4GKJ E;  1VIS A;  4RPF A;  1J5E E;  4JI3 I;  1WUU A;  2E5L E;  4IZJ B;  3LPS A;  1NHI A;  1N32 I;  4JI6 I;  3QT8 A;  4DPW A;  1N0U A;  3J7A G;  3PYD A;  2UUA E;  4DR6 I;  1FKA E;  1EI1 A;  3K85 A;  4JI5 E;  2X36 A;  3Q1Q A;  2HFU A;  4GKK E;  3B8H A;  5LMN I;  1HNX E;  1RRE A;  2E5L I;  3HJC A;  1HNX I;  5BR8 I;  4FWG A;  4GKK I;  4AQY E;  4DUY I;  4DXL A;  1XNQ E;  4HXZ A;  4YHH E;  4MYT A;  4JI8 I;  4DPU A;  4NXM I;  2E1R A;  4DV2 I;  2DEI A;  1MU5 A;  4UT4 A;  3LTO A;  5IT9 Q;  1S4E A;  1XMO I;  4B3M I;  1J5E I;  4JI3 E;  4DR1 E;  1B62 A;  2HKJ A;  1XNQ I;  5GME A;  4DV5 I;  4FN5 A;  2HK2 A;  3WU6 A;  3T1H E;  4KQV A;  2J7K A;  4Z7Y A;  1I94 E;  4M1K A;  3GON A;  4LF7 E;  2WW4 A;  1PKP A;  1Z0G A;  4N3O A;  2XEX A;  3B82 A;  4AQY I;  1N33 I;  3D4J A;  2PNM A;  4PU9 A;  5LMU E;  4USK A;  3PYG A;  2CG9 A;  1Y6Z A;  2VF3 A;  4JI0 I;  5LMN E;  2UUA I;  4WUB A;  4HYM A;  3V2U C;  4DR6 E;  4X66 I;  4DR7 E;  4LFB I;  1HNW E;  4B3R E;  1FJG E;  2DEJ A;  4DV6 I;  1H7U A;  5L3J A;  2NPF A;  2VQE E;  1HNZ E;  2UUB E;  5LMU I;  1I94 I;  1IBK E;  1Z0W A;  1Z5C A;  3ZZT A;  1FNM A;  4LF8 I;  2UUC E;  2GQ0 A;  4P7A A;  1H73 A;  4JI1 I;  4JYA I;  4LFC I;  1XMO E;  1ZXN A;  2IOP A;  2PNL A;  1N32 E;  1Y4S A;  2V2V A;  1USV A;  2R42 A;  1H74 A;  2VQF I;  2O1T A;  3F0N A;  1H72 C;  4KHP E;  4K0K E;  2F4V E;  1HR0 E;  4B3T I;  5BR8 E;  1UEK A;  4JV5 I;  4DR4 E;  4Z7C A;  1ZXM A;  1FWL A;  1DAR A;  3B78 A;  4NXM E;  4FWH A;  2V8P A;  1XHK A;  4LF5 E;  4P52 A;  4DV4 E;  1ZM9 A;  4I3H A;  4X62 E;  2EFG A;  4URL A;  4JI4 E;  3PYF A;  4PRV A;  1NHJ A;  2Z5C B;  4GKJ I;  2GS8 A;  5LL6 R;  4X65 E;  1Z0T A;  1A6F A;  4X64 I;  4B3S E;  2A2C A;  3OTO E;  5A2Q C;  4JI2 E;  4DPX A;  2UU9 E;  4PRX A;  4DPY A;  2HHH I;  2BM0 A;  4LF5 I;  1BKN A;  1ZM3 A;  5IWA E;  1EA6 A;  4OX9 E;  4B3S I;  4DR2 I;  5IT9 C;  2ZBK B;  4DR3 E;  1XMQ E;  4DR2 E;  4YY3 I;  1NZ0 A;  1N36 I;  4LFA E;  4LF9 I;  4NXN E;  1Z0B A;  2UXC I;  1MX0 A;  3J80 Q;  4DV4 I;  4LF4 I;  2ZIT A;  1U2R A;  2AJ4 A;  2BM1 A;  1KVK A;  2V34 A;  1KTV A;  4JI6 E;  1IBL I;  1MG7 A;  4FWD A;  2X7I A;  4R1F A;  4X64 E;  2UU9 I;  3WU3 A;  3QT7 A;  1N34 I;  2UXC E;  3QT6 A;  4DPT A;  4DV1 I;  2UXD I;  1IBM E;  1IBM I;  4JI7 I;  1KIJ A;  3ZKB A;  1RR9 A;  4DV0 E;  2OI2 A;  4OX9 I;  3ZZU A;  4JI4 I;  2VQE I;  1IBL E;  2Z5B A;  4WUC A;  1S16 A;  2BV3 A;  4DV6 E;  4MYU A;  1XNR E;  3WU4 A;  4DR4 I;  5GMD A;  3K17 A;  2O1U A;  4LFA I;  4JG4 A;  2UXD E;  4HAC A;  2HK3 A;  3M6A A;  4ZVI A;  4IZK B;  4IZK A;  2HKE A;  1Z5A A;  2F4V I;  2UXB I;  1FWK A;  1N33 E;  1FJG I;  4LF6 I;  2A2D A;  2V2Z A;  4JI8 E;  4DV3 I;  1XNR I;  1FI4 A;  1USU A;  4JI2 I;  1Z0C A;  2CGE A;  2Z5E A;  4DUZ E;  5FLX Q;  2HHH E;  4JI1 E;  2O1V A;  4LF4 E;  3J81 C;  3K1J A;  5FWK A;  4LF8 E;  2UXB E;  4B3T E;  1D6T A;  4K0K I;  4DR3 I;  4X65 I;  1XMQ I;  2Z5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...