1XMOI

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmoI00
2HK3A 2OI2A 2AJ4A 3LTOA 4PRVA 5FLXC 4X66I 1WUUA 4HYMA 4AQYI 1HR0I 3WU6A 4DR5I 4M1KA 4DU7A 2UU9E 2UUAI 4K0KE 4DR7E 4LF5I 4UT4A 4LF7E 4NXMI 3PYEA 3ZZ0A 1IBLE 4JI2I 2UXDE 4HACA 1KKHA 4B3TI 1I94E 3J80C 4JI8E 3T1HE 1U2RA 1Z0VA 2UUBI 1KTVA 3CWVA 2EFGA 1MU5A 1ZXMA 1Z0GA 4DR1I 2HHHI 2BV3A 4X66E 4AQYE 1HR0E 1ZM2A 1N36I 1Z0CA 1MG7A 1PIEA 1N34I 4JI5I 4DPTA 4DR3I 4WUCA 2UUAE 1HNZI 4LF5E 4XTJA 3ZKBA 4JI4I 4NXME 2DEIA 2HFSA 4LF8I 4B3TE 3JAMC 2UXCI 2R42A 4LF6I 3QT5A 2UUBE 4LF9I 4USKA 2HKEA 2V8PA 2UXBI 3ZZTA 4LFAI 3J81C 4DR1E 2HHHE 1N32I 2E5LI 4OX9E 1N36E 4LFBI 3J81Q 1N34E 4JI5E 1HNXI 2VQFI 1Z5CA 1Z5BA 4PU9A 4DR3E 4R1FA 1IBKI 5LL6R 3F0NA 1XMQI 4JI4E 4RPFA 1KVKA 4EMDA 4LF8E 4DV6E 2UXCE 4X64I 2A2CA 3WU3A 3PYDA 4LF6E 4KQVA 1H72C 4LF9E 2UXBE 4HY1A 4LFAE 2ZBKB 4JI0I 4X65I 3WU4A 1N32E 3J7AM 2E5LE 1N0VC 5IWAI 1HNXE 2VQFE 4KHPI 1OJ4A 1ZM3A 2UUCI 1IBKE 1Z0TA 1XMQE 4B3SI 1J5EI 1VISA 1H74A 3HULA 4ZVIA 1H7SA 4X64E 4DR2I 3GONA 1IBMI 4JI7I 2ZITA 4WUDA 4PRXA 4B3RI 4DV3I 1XNRI 4DR5E 4DXLA 3H4LA 4YHHI 4X65E 1XNQI 5LMUI 1EA6A 4DPYA 3ZM7A 4DV2I 2ZM6I 3LNUA 1UEKA 5IWAE 4DV7I 5LMNI 1Z0WA 4KHPE 3QT6A 4JI2E 4P52A 3QT7A 2F4VI 2UUCE 3ZKDA 4B3SE 1Z0BA 1FI4A 4UTGA 1J5EE 2VF3A 1XHKA 1NZ0A 3J7AG 4DR2E 2A2DA 1IBME 4JI7E 1H7UA 1Z0EA 2X36A 4B3RE 4DV3E 1XNRE 3B78A 1NHJA 4YHHE 4JYAI 1S4EA 1H73A 1XNQE 5LMUE 4JI1I 4I3HA 2BM0A 4DV4I 3V5RA 4DV2E 1HNZE 4DUZI 2ZM6E 4HXZA 5LMNE 4DV7E 2DEJA 1EI1A 4JI3I 2F4VE 1QZRA 2X7IA 1BKNA 1N33I 2GS8A 1PVGA 1ZM9A 5A2QQ 1DARA 3LPSA 4FW9A 1S16A 2HKJA 4P7AA 4NXNI 1ELOA 4URLA 5IT9Q 1B62A 1RR9A 2V2VA 4JYAE 4FN5A 4LFBE 4JI1E 4DU8A 4DV4E 1ZXNA 4DPWA 4DUZE 4LFCI 3V2UC 4JI3E 2J7KA 1K47A 4GKJI 5FLXQ 1KIJA 3D4JA 4HACB 5BR8I 1B63A 2V2QA 2CZ9A 1Z59A 1N33E 4DR6I 1MX0A 1FJGI 2VQEI 5L3JA 4MYUA 4JI0E 4DV5I 4NXNE 1NHHA 4GKKI 3OTOI 1PKPA 3B82A 1Z5AA 4DV1I 3PYGA 3J80Q 2V2ZA 2NPFA 3M6AA 4FWDA 1RREA 3PYFA 4OX9I 4X62I 1XMOI 4LF4I 4LFCE 4DPXA 4GKJE 1ZM4A 4Z7YA 5GMDA 3T1YI 3B8HA 5BR8E 4DPUA 1A6FA 4B3MI 4DR6E 5GMEA 4YY3I 4DUYI 4DV0I 1FJGE 2VQEE 2LJPA 1HNWI 4JI6I 4JV5I 3ZZUA 4DR4I 4DV6I 3Q1QA 1NHIA 3K17A 4FWHA 2HFUA 4DV5E 4Z7CA 4GKKE 1N0UA 3OTOE 1FNMA 4DV1E 1D6TA 1FWKA 2V34A 3JAMQ 4ED4A 2R3VA 2Q2EB 1FWLA 2UU9I 2E1RA 4FWGA 5A2QC 2HK2A 4K0KI 4X62E 4DR7I 3K1JA 3WU5A 1XMOE 4LF4E 4LF7I 4USMA 2XEXA 1IBLI 4MYTA 3T1YE 2UXDI 5IT9C 2WW4A 4JG4A 4WUBA 4B3ME 1FKAE 1I94I 4YY3E 4JI8I 4DUYE 4DV0E 2BM1A 1HNWE 3QT8A 3T1HI 4JI6E 4JV5E 4DR4E
chains in the Genus database with same CATH superfamily
2HK3A 2OI2A 2AJ4A 2PO2A 3LTOA 4ISAA 4PRVA 5FLXC 4X66I 1WUUA 4HYMA 4AQYI 1HR0I 3WU6A 4DR5I 4NBQA 4OO1E 5K36C 4M1KA 4DU7A 2UU9E 3L7ZB 3HKMA 4OZEA 5JEAE 2UUAI 4K0KE 4DR7E 4LF5I 4UT4A 3GMEA 4LF7E 2PO1A 4NXMI 3PYEA 4LCHA 3ZZ0A 1IBLE 4JI2I 2BA1D 2JEAB 2UXDE 4HACA 1KKHA 4B3TI 1I94E 3J80C 4JI8E 1Y6ZA 3T1HE 1U2RA 1Z0VA 2UUBI 2PNZA 3KRNA 2JE6B 5C0XB 2J65A 1KTVA 3CWVA 1MU5A 2EFGA 1ZXMA 1Z0GA 2IERA 4DR1I 2HHHI 2BV3A 4BA2B 4X66E 4AQYE 1HR0E 1ZM2A 2GQ0A 1N36I 1Z0CA 1MG7A 1PIEA 1N34I 4JI5I 3K85A 4DPTA 2O1TA 4DR3I 1UDSA 4WUCA 2WP8B 2UUAE 1HNZI 4LF5E 4XTJA 3ZKBA 4JI4I 4NXME 1VI7A 3M7ND 2DEIA 2HFSA 5DNXA 4LF8I 4B3TE 1UDNA 2JEBB 3JAMC 2UXCI 2R42A 2VESA 2BR2B 4QNJA 4LF6I 3QT5A 5C0XC 2UUBE 4LF9I 4USKA 2HKEA 2V8PA 2UXBI 3ZZTA 4LFAI 3U1KA 2NN6D 4LPFA 1E3HA 1Y4SA 3J81C 4DR1E 2HHHE 1N32I 3U1YA 4N3OA 5DNLA 2CVEA 2NN6F 2E5LI 4AIMA 4U3BA 4OX9E 1N36E 2PO0A 4FW5A 4LFBI 3J81Q 2C39B 1N34E 1HNXI 4JI5E 2VQFI 1Z5CA 1Z5BA 4PU9A 4DR3E 5K36A 4R1FA 1IBKI 4FW3A 4IS9A 5LL6R 2Z5CA 3F0NA 1XMQI 2NN6B 4JI4E 5JEAB 4RPFA 1KVKA 2AE8A 4EMDA 4LF8E 1OYPA 4IZJD 4DV6E 2UXCE 4X64I 2A2CA 3WU3A 3PYDA 4LF6E 4KQVA 4FW6A 1HK7A 1H72C 4IZKA 4LF9E 2UXBE 3P06A 4HY1A 1P42A 4LFAE 2ZBKB 4JI0I 3UHMA 2PO2B 4X65I 3WU4A 1N32E 3J7AM 3H1CA 2E5LE 4IZJB 2C38B 5C0XD 5K36E 2WNRB 1N0VC 3NZKA 5IWAI 2GO3A 2CG9A 1HNXE 2VQFE 4KHPI 2O3ZA 3L7ZA 1OJ4A 3PS1A 1ZM3A 5DRRA 1IBKE 5C0XF 2UUCI 1Z0TA 2NN6C 3M7NG 5JEAC 1XMQE 4AM3A 4B3SI 3Q6MA 5ELWA 1J5EI 1VISA 1E3PA 1H74A 3HULA 4ZVIA 1Y5YA 2JEAA 1H7SA 4X64E 4DR2I 3GONA 1IBMI 4JI7I 2ZITA 4WUDA 4PRXA 4B3RI 4DV3I 1XNRI 3HJCA 4DR5E 4DXLA 3H4LA 4YHHI 2JE6A 5C0XA 4X65E 1XNQI 5LMUI 1EA6A 4BA2A 4DPYA 3ZM7A 1Y4UA 4DV2I 2ZM6I 3LNUA 1UEKA 5IWAE 4IFDD 5LMNI 1Z0WA 4DV7I 4KHPE 3PRYA 3P3GA 1USVA 3QT6A 4MU0A 4JI2E 4P52A 3QT7A 2F4VI 2UUCE 4MDTA 4IFDF 2PNMA 3ZKDA 2WP8A 4B3SE 1Z0BA 1FI4A 4UTGA 1J5EE 1R6MA 2O1UA 2VF3A 1XHKA 4OO1D 1NZ0A 3J7AG 4OO1F 4DR2E 4IFDB 2JEBA 5JEAD 2A2DA 2BR2A 4JI7E 1H7UA 1IBME 1Z0EA 2X36A 4U3DA 5C0XE 4B3RE 4MU1A 4DV3E 1XNRE 3B78A 1NHJA 4YHHE 5JEAF 4JYAI 5FWKA 1S4EA 1H73A 1XNQE 4OO1B 5LMUE 4JI1I 4I3HA 2BM0A 4DV4I 3V5RA 4DV2E 2BA1G 1HNZE 4DUZI 2ZM6E 4HXZA 5LMNE 4DV7E 2DEJA 1EI1A 4BA1B 4JI3I 3P76A 2C39A 2F4VE 1QZRA 1OYSA 4MQYA 2O1WA 2X7IA 1OYRA 1BKNA 1USUA 2NN6A 1N33I 2GS8A 2Z5BA 4MU3A 1PVGA 1ZM9A 2GO4A 5A2QQ 2C37A 4J3DA 5DROA 4IFDC 1DARA 1R6LA 3B4TA 3P3EA 2IOQA 3LPSA 4FW9A 1S16A 2HKJA 4P7AA 4NXNI 1ELOA 4URLA 2PNLA 5IT9Q 1B62A 1UDQA 3P3CA 1RR9A 2V2VA 4JYAE 4OO1C 4FN5A 4LFBE 3GLLA 4JI1E 4DU8A 4DV4E 1ZXNA 4DPWA 3PS2A 4IZJA 4DUZE 2PO1B 4OKGA 2C38A 4FW7A 2WNRA 4LFCI 2BA0D 3V2UC 1Y60A 4JI3E 2J7KA 1K47A 4GKJI 5FLXQ 1KIJA 3D4JA 4HACB 2NN6E 5BR8I 1B63A 2V2QA 2CZ9A 1Z59A 1N33E 3M85D 4DR6I 1MX0A 1FJGI 2IESA 2VQEI 2PNZB 5L3JA 4MYUA 4JI0E 4DV5I 4NXNE 1NHHA 4GKKI 3OTOI 1PKPA 3B82A 1Z5AA 4MU4A 4QNKA 4DV1I 3Q6NA 3PYGA 3J80Q 2V2ZA 4LCFA 2NPFA 3M6AA 5DRPA 4FWDA 4LOMA 2JT2A 1RREA 2O1VA 3PYFA 4OX9I 4X62I 1RHYA 1XMOI 4LF4I 4LFCE 4DPXA 2IOPA 3PS3A 4GKJE 1ZM4A 4Z7YA 5GMDA 3T1YI 3B8HA 4GQUA 5EL9A 5BR8E 3CDJA 4AIDA 4DPUA 1A6FA 4B3MI 4DR6E 5GMEA 4YY3I 4DUYI 4DV0I 1FJGE 5K36D 2VQEE 2LJPA 1HNWI 4JI6I 4JV5I 3ZZUA 4DR4I 4DV6I 3Q1QA 1NHIA 3K17A 4FWHA 2HFUA 4DV5E 5K36F 3GCMA 4Z7CA 4GKKE 4IFDA 1N0UA 3OTOE 1FNMA 4DV1E 1D6TA 1FWKA 2V34A 1YH8A 3JAMQ 2PO0B 4ED4A 2R3VA 4LCGA 4FW4A 2Q2EB 1FWLA 2UU9I 2E1RA 5K36B 4OO1A 2BA0G 4FWGA 5A2QC 2HK2A 2Z5CB 2CGEA 4K0KI 4X62E 1UDOA 4DR7I 3K1JA 3WU5A 1XMOE 4LF4E 4LF7I 1YHCA 1XXEA 4USMA 2XEXA 5JEAA 1IBLI 4MYTA 3CDIA 3M85G 3DD6A 2F1DA 5DRQA 4BA1A 3T1YE 2UXDI 5IT9C 2WW4A 4JG4A 4WUBA 4B3ME 2Z5BB 1FKAE 1I94I 5EKWA 4YY3E 4JI8I 4DUYE 4DV0E 2Z5EA 2BM1A 2C37B 4IZKB 1HNWE 3QT8A 3T1HI 4JI6E 4JV5E 4DR4E 4IFDE
chains in the Genus database with same CATH topology
2HK3A 2OI2A 2AJ4A 3LTOA 4PRVA 5FLXC 4X66I 1WUUA 4HYMA 4AQYI 1HR0I 3WU6A 4DR5I 4M1KA 4DU7A 2UU9E 2UUAI 4K0KE 4DR7E 4LF5I 4UT4A 4LF7E 4NXMI 3PYEA 3ZZ0A 1IBLE 4JI2I 2UXDE 4HACA 1KKHA 4B3TI 1I94E 3J80C 4JI8E 1Y6ZA 3T1HE 1U2RA 1Z0VA 2UUBI 1KTVA 3CWVA 1MU5A 2EFGA 1ZXMA 1Z0GA 4DR1I 2HHHI 2BV3A 4X66E 4AQYE 1HR0E 1ZM2A 2GQ0A 1N36I 1Z0CA 1MG7A 1PIEA 1N34I 4JI5I 3K85A 4DPTA 2O1TA 4DR3I 4WUCA 2UUAE 1HNZI 4LF5E 4XTJA 3ZKBA 4JI4I 4NXME 2DEIA 2HFSA 4LF8I 4B3TE 3JAMC 2UXCI 2R42A 4LF6I 3QT5A 2UUBE 4LF9I 4USKA 2HKEA 2V8PA 2UXBI 3ZZTA 4LFAI 1Y4SA 3J81C 4DR1E 2HHHE 1N32I 4N3OA 2E5LI 4OX9E 1N36E 4LFBI 3J81Q 1N34E 4JI5E 1HNXI 2VQFI 1Z5CA 1Z5BA 4PU9A 4DR3E 4R1FA 1IBKI 5LL6R 2Z5CA 3F0NA 1XMQI 4JI4E 4RPFA 1KVKA 4EMDA 4LF8E 4IZJD 4DV6E 2UXCE 4X64I 2A2CA 3WU3A 3PYDA 4LF6E 4KQVA 1HK7A 1H72C 4IZKA 4LF9E 2UXBE 3P06A 4HY1A 4LFAE 2ZBKB 4JI0I 4X65I 3WU4A 1N32E 3J7AM 2E5LE 4IZJB 1N0VC 5IWAI 2CG9A 1HNXE 2VQFE 4KHPI 1OJ4A 1ZM3A 2UUCI 1IBKE 1Z0TA 1XMQE 4B3SI 3Q6MA 1J5EI 1VISA 1H74A 3HULA 4ZVIA 1H7SA 4X64E 4DR2I 3GONA 1IBMI 4JI7I 2ZITA 4WUDA 4PRXA 4B3RI 4DV3I 1XNRI 3HJCA 4DR5E 4DXLA 3H4LA 4YHHI 4X65E 1XNQI 5LMUI 1EA6A 4DPYA 3ZM7A 1Y4UA 4DV2I 2ZM6I 3LNUA 1UEKA 5IWAE 4DV7I 5LMNI 1Z0WA 4KHPE 3PRYA 3QT6A 1USVA 4JI2E 4P52A 3QT7A 2F4VI 2UUCE 2PNMA 3ZKDA 4B3SE 1Z0BA 1FI4A 4UTGA 1J5EE 2O1UA 2VF3A 1XHKA 1NZ0A 3J7AG 4DR2E 2A2DA 1IBME 4JI7E 1H7UA 1Z0EA 2X36A 4B3RE 4DV3E 1XNRE 3B78A 1NHJA 4YHHE 4JYAI 5FWKA 1S4EA 1H73A 1XNQE 5LMUE 4JI1I 4I3HA 2BM0A 4DV4I 3V5RA 4DV2E 1HNZE 4DUZI 2ZM6E 4HXZA 5LMNE 4DV7E 2DEJA 1EI1A 4JI3I 2F4VE 1QZRA 2O1WA 2X7IA 1BKNA 1USUA 1N33I 2GS8A 2Z5BA 1PVGA 1ZM9A 5A2QQ 1DARA 2IOQA 3LPSA 4FW9A 1S16A 2HKJA 4P7AA 4NXNI 1ELOA 4URLA 2PNLA 5IT9Q 1B62A 1RR9A 2V2VA 4JYAE 4FN5A 4LFBE 4JI1E 4DU8A 4DV4E 1ZXNA 4DPWA 4IZJA 4DUZE 4LFCI 3V2UC 4JI3E 2J7KA 1K47A 4GKJI 5FLXQ 1KIJA 3D4JA 4HACB 5BR8I 1B63A 2V2QA 2CZ9A 1Z59A 1N33E 4DR6I 1MX0A 1FJGI 2VQEI 5L3JA 4MYUA 4JI0E 4DV5I 4NXNE 1NHHA 4GKKI 3OTOI 1PKPA 3B82A 1Z5AA 4DV1I 3Q6NA 3PYGA 3J80Q 2V2ZA 2NPFA 3M6AA 4FWDA 1RREA 2O1VA 3PYFA 4OX9I 4X62I 1XMOI 4LF4I 4LFCE 4DPXA 2IOPA 4GKJE 1ZM4A 4Z7YA 5GMDA 3T1YI 3B8HA 5BR8E 4DPUA 1A6FA 4B3MI 4DR6E 5GMEA 4YY3I 4DV0I 4DUYI 1FJGE 2VQEE 2LJPA 1HNWI 4JI6I 4JV5I 3ZZUA 4DR4I 4DV6I 3Q1QA 1NHIA 3K17A 4FWHA 2HFUA 4DV5E 4Z7CA 4GKKE 1N0UA 3OTOE 1FNMA 4DV1E 1D6TA 1FWKA 2V34A 3JAMQ 4ED4A 2R3VA 2Q2EB 1FWLA 2UU9I 2E1RA 4FWGA 5A2QC 2HK2A 2Z5CB 2CGEA 4K0KI 4X62E 4DR7I 3K1JA 3WU5A 1XMOE 4LF4E 4LF7I 4USMA 2XEXA 1IBLI 4MYTA 3T1YE 2UXDI 5IT9C 2WW4A 4JG4A 4WUBA 4B3ME 2Z5BB 1FKAE 1I94I 4YY3E 4JI8I 4DUYE 4DV0E 2Z5EA 2BM1A 4IZKB 1HNWE 3QT8A 3T1HI 4JI6E 4JV5E 4DR4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  2OI2 A;  2AJ4 A;  3LTO A;  4PRV A;  5FLX C;  4X66 I;  1WUU A;  4HYM A;  4AQY I;  1HR0 I;  3WU6 A;  4DR5 I;  4M1K A;  4DU7 A;  2UU9 E;  2UUA I;  4K0K E;  4DR7 E;  4LF5 I;  4UT4 A;  4LF7 E;  4NXM I;  3PYE A;  3ZZ0 A;  1IBL E;  4JI2 I;  2UXD E;  4HAC A;  1KKH A;  4B3T I;  1I94 E;  3J80 C;  4JI8 E;  3T1H E;  1U2R A;  1Z0V A;  2UUB I;  1KTV A;  3CWV A;  2EFG A;  1MU5 A;  1ZXM A;  1Z0G A;  4DR1 I;  2HHH I;  2BV3 A;  4X66 E;  4AQY E;  1HR0 E;  1ZM2 A;  1N36 I;  1Z0C A;  1MG7 A;  1PIE A;  1N34 I;  4JI5 I;  4DPT A;  4DR3 I;  4WUC A;  2UUA E;  1HNZ I;  4LF5 E;  4XTJ A;  3ZKB A;  4JI4 I;  4NXM E;  2DEI A;  2HFS A;  4LF8 I;  4B3T E;  3JAM C;  2UXC I;  2R42 A;  4LF6 I;  3QT5 A;  2UUB E;  4LF9 I;  4USK A;  2HKE A;  2V8P A;  2UXB I;  3ZZT A;  4LFA I;  3J81 C;  4DR1 E;  2HHH E;  1N32 I;  2E5L I;  4OX9 E;  1N36 E;  4LFB I;  3J81 Q;  1N34 E;  4JI5 E;  1HNX I;  2VQF I;  1Z5C A;  1Z5B A;  4PU9 A;  4DR3 E;  4R1F A;  1IBK I;  5LL6 R;  3F0N A;  1XMQ I;  4JI4 E;  4RPF A;  1KVK A;  4EMD A;  4LF8 E;  4DV6 E;  2UXC E;  4X64 I;  2A2C A;  3WU3 A;  3PYD A;  4LF6 E;  4KQV A;  1H72 C;  4LF9 E;  2UXB E;  4HY1 A;  4LFA E;  2ZBK B;  4JI0 I;  4X65 I;  3WU4 A;  1N32 E;  3J7A M;  2E5L E;  1N0V C;  5IWA I;  1HNX E;  2VQF E;  4KHP I;  1OJ4 A;  1ZM3 A;  2UUC I;  1IBK E;  1Z0T A;  1XMQ E;  4B3S I;  1J5E I;  1VIS A;  1H74 A;  3HUL A;  4ZVI A;  1H7S A;  4X64 E;  4DR2 I;  3GON A;  1IBM I;  4JI7 I;  2ZIT A;  4WUD A;  4PRX A;  4B3R I;  4DV3 I;  1XNR I;  4DR5 E;  4DXL A;  3H4L A;  4YHH I;  4X65 E;  1XNQ I;  5LMU I;  1EA6 A;  4DPY A;  3ZM7 A;  4DV2 I;  2ZM6 I;  3LNU A;  1UEK A;  5IWA E;  4DV7 I;  5LMN I;  1Z0W A;  4KHP E;  3QT6 A;  4JI2 E;  4P52 A;  3QT7 A;  2F4V I;  2UUC E;  3ZKD A;  4B3S E;  1Z0B A;  1FI4 A;  4UTG A;  1J5E E;  2VF3 A;  1XHK A;  1NZ0 A;  3J7A G;  4DR2 E;  2A2D A;  1IBM E;  4JI7 E;  1H7U A;  1Z0E A;  2X36 A;  4B3R E;  4DV3 E;  1XNR E;  3B78 A;  1NHJ A;  4YHH E;  4JYA I;  1S4E A;  1H73 A;  1XNQ E;  5LMU E;  4JI1 I;  4I3H A;  2BM0 A;  4DV4 I;  3V5R A;  4DV2 E;  1HNZ E;  4DUZ I;  2ZM6 E;  4HXZ A;  5LMN E;  4DV7 E;  2DEJ A;  1EI1 A;  4JI3 I;  2F4V E;  1QZR A;  2X7I A;  1BKN A;  1N33 I;  2GS8 A;  1PVG A;  1ZM9 A;  5A2Q Q;  1DAR A;  3LPS A;  4FW9 A;  1S16 A;  2HKJ A;  4P7A A;  4NXN I;  1ELO A;  4URL A;  5IT9 Q;  1B62 A;  1RR9 A;  2V2V A;  4JYA E;  4FN5 A;  4LFB E;  4JI1 E;  4DU8 A;  4DV4 E;  1ZXN A;  4DPW A;  4DUZ E;  4LFC I;  3V2U C;  4JI3 E;  2J7K A;  1K47 A;  4GKJ I;  5FLX Q;  1KIJ A;  3D4J A;  4HAC B;  5BR8 I;  1B63 A;  2V2Q A;  2CZ9 A;  1Z59 A;  1N33 E;  4DR6 I;  1MX0 A;  1FJG I;  2VQE I;  5L3J A;  4MYU A;  4JI0 E;  4DV5 I;  4NXN E;  1NHH A;  4GKK I;  3OTO I;  1PKP A;  3B82 A;  1Z5A A;  4DV1 I;  3PYG A;  3J80 Q;  2V2Z A;  2NPF A;  3M6A A;  4FWD A;  1RRE A;  3PYF A;  4OX9 I;  4X62 I;  1XMO I;  4LF4 I;  4LFC E;  4DPX A;  4GKJ E;  1ZM4 A;  4Z7Y A;  5GMD A;  3T1Y I;  3B8H A;  5BR8 E;  4DPU A;  1A6F A;  4B3M I;  4DR6 E;  5GME A;  4YY3 I;  4DUY I;  4DV0 I;  1FJG E;  2VQE E;  2LJP A;  1HNW I;  4JI6 I;  4JV5 I;  3ZZU A;  4DR4 I;  4DV6 I;  3Q1Q A;  1NHI A;  3K17 A;  4FWH A;  2HFU A;  4DV5 E;  4Z7C A;  4GKK E;  1N0U A;  3OTO E;  1FNM A;  4DV1 E;  1D6T A;  1FWK A;  2V34 A;  3JAM Q;  4ED4 A;  2R3V A;  2Q2E B;  1FWL A;  2UU9 I;  2E1R A;  4FWG A;  5A2Q C;  2HK2 A;  4K0K I;  4X62 E;  4DR7 I;  3K1J A;  3WU5 A;  1XMO E;  4LF4 E;  4LF7 I;  4USM A;  2XEX A;  1IBL I;  4MYT A;  3T1Y E;  2UXD I;  5IT9 C;  2WW4 A;  4JG4 A;  4WUB A;  4B3M E;  1FKA E;  1I94 I;  4YY3 E;  4JI8 I;  4DUY E;  4DV0 E;  2BM1 A;  1HNW E;  3QT8 A;  3T1H I;  4JI6 E;  4JV5 E;  4DR4 E; 
#chains in the Genus database with same CATH topology
 2HK3 A;  2OI2 A;  2AJ4 A;  2PO2 A;  3LTO A;  4ISA A;  4PRV A;  5FLX C;  4X66 I;  1WUU A;  4HYM A;  4AQY I;  1HR0 I;  3WU6 A;  4DR5 I;  4NBQ A;  4OO1 E;  5K36 C;  4M1K A;  4DU7 A;  2UU9 E;  3L7Z B;  3HKM A;  4OZE A;  5JEA E;  2UUA I;  4K0K E;  4DR7 E;  4LF5 I;  4UT4 A;  3GME A;  4LF7 E;  2PO1 A;  4NXM I;  3PYE A;  4LCH A;  3ZZ0 A;  1IBL E;  4JI2 I;  2BA1 D;  2JEA B;  2UXD E;  4HAC A;  1KKH A;  4B3T I;  1I94 E;  3J80 C;  4JI8 E;  1Y6Z A;  3T1H E;  1U2R A;  1Z0V A;  2UUB I;  2PNZ A;  3KRN A;  2JE6 B;  5C0X B;  2J65 A;  1KTV A;  3CWV A;  1MU5 A;  2EFG A;  1ZXM A;  1Z0G A;  2IER A;  4DR1 I;  2HHH I;  2BV3 A;  4BA2 B;  4X66 E;  4AQY E;  1HR0 E;  1ZM2 A;  2GQ0 A;  1N36 I;  1Z0C A;  1MG7 A;  1PIE A;  1N34 I;  4JI5 I;  3K85 A;  4DPT A;  2O1T A;  4DR3 I;  1UDS A;  4WUC A;  2WP8 B;  2UUA E;  1HNZ I;  4LF5 E;  4XTJ A;  3ZKB A;  4JI4 I;  4NXM E;  1VI7 A;  3M7N D;  2DEI A;  2HFS A;  5DNX A;  4LF8 I;  4B3T E;  1UDN A;  2JEB B;  3JAM C;  2UXC I;  2R42 A;  2VES A;  2BR2 B;  4QNJ A;  4LF6 I;  3QT5 A;  5C0X C;  2UUB E;  4LF9 I;  4USK A;  2HKE A;  2V8P A;  2UXB I;  3ZZT A;  4LFA I;  3U1K A;  2NN6 D;  4LPF A;  1E3H A;  1Y4S A;  3J81 C;  4DR1 E;  2HHH E;  1N32 I;  3U1Y A;  4N3O A;  5DNL A;  2CVE A;  2NN6 F;  2E5L I;  4AIM A;  4U3B A;  4OX9 E;  1N36 E;  2PO0 A;  4FW5 A;  4LFB I;  3J81 Q;  2C39 B;  1N34 E;  1HNX I;  4JI5 E;  2VQF I;  1Z5C A;  1Z5B A;  4PU9 A;  4DR3 E;  5K36 A;  4R1F A;  1IBK I;  4FW3 A;  4IS9 A;  5LL6 R;  2Z5C A;  3F0N A;  1XMQ I;  2NN6 B;  4JI4 E;  5JEA B;  4RPF A;  1KVK A;  2AE8 A;  4EMD A;  4LF8 E;  1OYP A;  4IZJ D;  4DV6 E;  2UXC E;  4X64 I;  2A2C A;  3WU3 A;  3PYD A;  4LF6 E;  4KQV A;  4FW6 A;  1HK7 A;  1H72 C;  4IZK A;  4LF9 E;  2UXB E;  3P06 A;  4HY1 A;  1P42 A;  4LFA E;  2ZBK B;  4JI0 I;  3UHM A;  2PO2 B;  4X65 I;  3WU4 A;  1N32 E;  3J7A M;  3H1C A;  2E5L E;  4IZJ B;  2C38 B;  5C0X D;  5K36 E;  2WNR B;  1N0V C;  3NZK A;  5IWA I;  2GO3 A;  2CG9 A;  1HNX E;  2VQF E;  4KHP I;  2O3Z A;  3L7Z A;  1OJ4 A;  3PS1 A;  1ZM3 A;  5DRR A;  1IBK E;  5C0X F;  2UUC I;  1Z0T A;  2NN6 C;  3M7N G;  5JEA C;  1XMQ E;  4AM3 A;  4B3S I;  3Q6M A;  5ELW A;  1J5E I;  1VIS A;  1E3P A;  1H74 A;  3HUL A;  4ZVI A;  1Y5Y A;  2JEA A;  1H7S A;  4X64 E;  4DR2 I;  3GON A;  1IBM I;  4JI7 I;  2ZIT A;  4WUD A;  4PRX A;  4B3R I;  4DV3 I;  1XNR I;  3HJC A;  4DR5 E;  4DXL A;  3H4L A;  4YHH I;  2JE6 A;  5C0X A;  4X65 E;  1XNQ I;  5LMU I;  1EA6 A;  4BA2 A;  4DPY A;  3ZM7 A;  1Y4U A;  4DV2 I;  2ZM6 I;  3LNU A;  1UEK A;  5IWA E;  4IFD D;  5LMN I;  1Z0W A;  4DV7 I;  4KHP E;  3PRY A;  3P3G A;  1USV A;  3QT6 A;  4MU0 A;  4JI2 E;  4P52 A;  3QT7 A;  2F4V I;  2UUC E;  4MDT A;  4IFD F;  2PNM A;  3ZKD A;  2WP8 A;  4B3S E;  1Z0B A;  1FI4 A;  4UTG A;  1J5E E;  1R6M A;  2O1U A;  2VF3 A;  1XHK A;  4OO1 D;  1NZ0 A;  3J7A G;  4OO1 F;  4DR2 E;  4IFD B;  2JEB A;  5JEA D;  2A2D A;  2BR2 A;  4JI7 E;  1H7U A;  1IBM E;  1Z0E A;  2X36 A;  4U3D A;  5C0X E;  4B3R E;  4MU1 A;  4DV3 E;  1XNR E;  3B78 A;  1NHJ A;  4YHH E;  5JEA F;  4JYA I;  5FWK A;  1S4E A;  1H73 A;  1XNQ E;  4OO1 B;  5LMU E;  4JI1 I;  4I3H A;  2BM0 A;  4DV4 I;  3V5R A;  4DV2 E;  2BA1 G;  1HNZ E;  4DUZ I;  2ZM6 E;  4HXZ A;  5LMN E;  4DV7 E;  2DEJ A;  1EI1 A;  4BA1 B;  4JI3 I;  3P76 A;  2C39 A;  2F4V E;  1QZR A;  1OYS A;  4MQY A;  2O1W A;  2X7I A;  1OYR A;  1BKN A;  1USU A;  2NN6 A;  1N33 I;  2GS8 A;  2Z5B A;  4MU3 A;  1PVG A;  1ZM9 A;  2GO4 A;  5A2Q Q;  2C37 A;  4J3D A;  5DRO A;  4IFD C;  1DAR A;  1R6L A;  3B4T A;  3P3E A;  2IOQ A;  3LPS A;  4FW9 A;  1S16 A;  2HKJ A;  4P7A A;  4NXN I;  1ELO A;  4URL A;  2PNL A;  5IT9 Q;  1B62 A;  1UDQ A;  3P3C A;  1RR9 A;  2V2V A;  4JYA E;  4OO1 C;  4FN5 A;  4LFB E;  3GLL A;  4JI1 E;  4DU8 A;  4DV4 E;  1ZXN A;  4DPW A;  3PS2 A;  4IZJ A;  4DUZ E;  2PO1 B;  4OKG A;  2C38 A;  4FW7 A;  2WNR A;  4LFC I;  2BA0 D;  3V2U C;  1Y60 A;  4JI3 E;  2J7K A;  1K47 A;  4GKJ I;  5FLX Q;  1KIJ A;  3D4J A;  4HAC B;  2NN6 E;  5BR8 I;  1B63 A;  2V2Q A;  2CZ9 A;  1Z59 A;  1N33 E;  3M85 D;  4DR6 I;  1MX0 A;  1FJG I;  2IES A;  2VQE I;  2PNZ B;  5L3J A;  4MYU A;  4JI0 E;  4DV5 I;  4NXN E;  1NHH A;  4GKK I;  3OTO I;  1PKP A;  3B82 A;  1Z5A A;  4MU4 A;  4QNK A;  4DV1 I;  3Q6N A;  3PYG A;  3J80 Q;  2V2Z A;  4LCF A;  2NPF A;  3M6A A;  5DRP A;  4FWD A;  4LOM A;  2JT2 A;  1RRE A;  2O1V A;  3PYF A;  4OX9 I;  4X62 I;  1RHY A;  1XMO I;  4LF4 I;  4LFC E;  4DPX A;  2IOP A;  3PS3 A;  4GKJ E;  1ZM4 A;  4Z7Y A;  5GMD A;  3T1Y I;  3B8H A;  4GQU A;  5EL9 A;  5BR8 E;  3CDJ A;  4AID A;  4DPU A;  1A6F A;  4B3M I;  4DR6 E;  5GME A;  4YY3 I;  4DUY I;  4DV0 I;  1FJG E;  5K36 D;  2VQE E;  2LJP A;  1HNW I;  4JI6 I;  4JV5 I;  3ZZU A;  4DR4 I;  4DV6 I;  3Q1Q A;  1NHI A;  3K17 A;  4FWH A;  2HFU A;  4DV5 E;  5K36 F;  3GCM A;  4Z7C A;  4GKK E;  4IFD A;  1N0U A;  3OTO E;  1FNM A;  4DV1 E;  1D6T A;  1FWK A;  2V34 A;  1YH8 A;  3JAM Q;  2PO0 B;  4ED4 A;  2R3V A;  4LCG A;  4FW4 A;  2Q2E B;  1FWL A;  2UU9 I;  2E1R A;  5K36 B;  4OO1 A;  2BA0 G;  4FWG A;  5A2Q C;  2HK2 A;  2Z5C B;  2CGE A;  4K0K I;  4X62 E;  1UDO A;  4DR7 I;  3K1J A;  3WU5 A;  1XMO E;  4LF4 E;  4LF7 I;  1YHC A;  1XXE A;  4USM A;  2XEX A;  5JEA A;  1IBL I;  4MYT A;  3CDI A;  3M85 G;  3DD6 A;  2F1D A;  5DRQ A;  4BA1 A;  3T1Y E;  2UXD I;  5IT9 C;  2WW4 A;  4JG4 A;  4WUB A;  4B3M E;  2Z5B B;  1FKA E;  1I94 I;  5EKW A;  4YY3 E;  4JI8 I;  4DUY E;  4DV0 E;  2Z5E A;  2BM1 A;  2C37 B;  4IZK B;  1HNW E;  3QT8 A;  3T1H I;  4JI6 E;  4JV5 E;  4DR4 E;  4IFD E; 
#chains in the Genus database with same CATH homology
 2HK3 A;  2OI2 A;  2AJ4 A;  3LTO A;  4PRV A;  5FLX C;  4X66 I;  1WUU A;  4HYM A;  4AQY I;  1HR0 I;  3WU6 A;  4DR5 I;  4M1K A;  4DU7 A;  2UU9 E;  2UUA I;  4K0K E;  4DR7 E;  4LF5 I;  4UT4 A;  4LF7 E;  4NXM I;  3PYE A;  3ZZ0 A;  1IBL E;  4JI2 I;  2UXD E;  4HAC A;  1KKH A;  4B3T I;  1I94 E;  3J80 C;  4JI8 E;  1Y6Z A;  3T1H E;  1U2R A;  1Z0V A;  2UUB I;  1KTV A;  3CWV A;  1MU5 A;  2EFG A;  1ZXM A;  1Z0G A;  4DR1 I;  2HHH I;  2BV3 A;  4X66 E;  4AQY E;  1HR0 E;  1ZM2 A;  2GQ0 A;  1N36 I;  1Z0C A;  1MG7 A;  1PIE A;  1N34 I;  4JI5 I;  3K85 A;  4DPT A;  2O1T A;  4DR3 I;  4WUC A;  2UUA E;  1HNZ I;  4LF5 E;  4XTJ A;  3ZKB A;  4JI4 I;  4NXM E;  2DEI A;  2HFS A;  4LF8 I;  4B3T E;  3JAM C;  2UXC I;  2R42 A;  4LF6 I;  3QT5 A;  2UUB E;  4LF9 I;  4USK A;  2HKE A;  2V8P A;  2UXB I;  3ZZT A;  4LFA I;  1Y4S A;  3J81 C;  4DR1 E;  2HHH E;  1N32 I;  4N3O A;  2E5L I;  4OX9 E;  1N36 E;  4LFB I;  3J81 Q;  1N34 E;  4JI5 E;  1HNX I;  2VQF I;  1Z5C A;  1Z5B A;  4PU9 A;  4DR3 E;  4R1F A;  1IBK I;  5LL6 R;  2Z5C A;  3F0N A;  1XMQ I;  4JI4 E;  4RPF A;  1KVK A;  4EMD A;  4LF8 E;  4IZJ D;  4DV6 E;  2UXC E;  4X64 I;  2A2C A;  3WU3 A;  3PYD A;  4LF6 E;  4KQV A;  1HK7 A;  1H72 C;  4IZK A;  4LF9 E;  2UXB E;  3P06 A;  4HY1 A;  4LFA E;  2ZBK B;  4JI0 I;  4X65 I;  3WU4 A;  1N32 E;  3J7A M;  2E5L E;  4IZJ B;  1N0V C;  5IWA I;  2CG9 A;  1HNX E;  2VQF E;  4KHP I;  1OJ4 A;  1ZM3 A;  2UUC I;  1IBK E;  1Z0T A;  1XMQ E;  4B3S I;  3Q6M A;  1J5E I;  1VIS A;  1H74 A;  3HUL A;  4ZVI A;  1H7S A;  4X64 E;  4DR2 I;  3GON A;  1IBM I;  4JI7 I;  2ZIT A;  4WUD A;  4PRX A;  4B3R I;  4DV3 I;  1XNR I;  3HJC A;  4DR5 E;  4DXL A;  3H4L A;  4YHH I;  4X65 E;  1XNQ I;  5LMU I;  1EA6 A;  4DPY A;  3ZM7 A;  1Y4U A;  4DV2 I;  2ZM6 I;  3LNU A;  1UEK A;  5IWA E;  4DV7 I;  5LMN I;  1Z0W A;  4KHP E;  3PRY A;  3QT6 A;  1USV A;  4JI2 E;  4P52 A;  3QT7 A;  2F4V I;  2UUC E;  2PNM A;  3ZKD A;  4B3S E;  1Z0B A;  1FI4 A;  4UTG A;  1J5E E;  2O1U A;  2VF3 A;  1XHK A;  1NZ0 A;  3J7A G;  4DR2 E;  2A2D A;  1IBM E;  4JI7 E;  1H7U A;  1Z0E A;  2X36 A;  4B3R E;  4DV3 E;  1XNR E;  3B78 A;  1NHJ A;  4YHH E;  4JYA I;  5FWK A;  1S4E A;  1H73 A;  1XNQ E;  5LMU E;  4JI1 I;  4I3H A;  2BM0 A;  4DV4 I;  3V5R A;  4DV2 E;  1HNZ E;  4DUZ I;  2ZM6 E;  4HXZ A;  5LMN E;  4DV7 E;  2DEJ A;  1EI1 A;  4JI3 I;  2F4V E;  1QZR A;  2O1W A;  2X7I A;  1BKN A;  1USU A;  1N33 I;  2GS8 A;  2Z5B A;  1PVG A;  1ZM9 A;  5A2Q Q;  1DAR A;  2IOQ A;  3LPS A;  4FW9 A;  1S16 A;  2HKJ A;  4P7A A;  4NXN I;  1ELO A;  4URL A;  2PNL A;  5IT9 Q;  1B62 A;  1RR9 A;  2V2V A;  4JYA E;  4FN5 A;  4LFB E;  4JI1 E;  4DU8 A;  4DV4 E;  1ZXN A;  4DPW A;  4IZJ A;  4DUZ E;  4LFC I;  3V2U C;  4JI3 E;  2J7K A;  1K47 A;  4GKJ I;  5FLX Q;  1KIJ A;  3D4J A;  4HAC B;  5BR8 I;  1B63 A;  2V2Q A;  2CZ9 A;  1Z59 A;  1N33 E;  4DR6 I;  1MX0 A;  1FJG I;  2VQE I;  5L3J A;  4MYU A;  4JI0 E;  4DV5 I;  4NXN E;  1NHH A;  4GKK I;  3OTO I;  1PKP A;  3B82 A;  1Z5A A;  4DV1 I;  3Q6N A;  3PYG A;  3J80 Q;  2V2Z A;  2NPF A;  3M6A A;  4FWD A;  1RRE A;  2O1V A;  3PYF A;  4OX9 I;  4X62 I;  1XMO I;  4LF4 I;  4LFC E;  4DPX A;  2IOP A;  4GKJ E;  1ZM4 A;  4Z7Y A;  5GMD A;  3T1Y I;  3B8H A;  5BR8 E;  4DPU A;  1A6F A;  4B3M I;  4DR6 E;  5GME A;  4YY3 I;  4DV0 I;  4DUY I;  1FJG E;  2VQE E;  2LJP A;  1HNW I;  4JI6 I;  4JV5 I;  3ZZU A;  4DR4 I;  4DV6 I;  3Q1Q A;  1NHI A;  3K17 A;  4FWH A;  2HFU A;  4DV5 E;  4Z7C A;  4GKK E;  1N0U A;  3OTO E;  1FNM A;  4DV1 E;  1D6T A;  1FWK A;  2V34 A;  3JAM Q;  4ED4 A;  2R3V A;  2Q2E B;  1FWL A;  2UU9 I;  2E1R A;  4FWG A;  5A2Q C;  2HK2 A;  2Z5C B;  2CGE A;  4K0K I;  4X62 E;  4DR7 I;  3K1J A;  3WU5 A;  1XMO E;  4LF4 E;  4LF7 I;  4USM A;  2XEX A;  1IBL I;  4MYT A;  3T1Y E;  2UXD I;  5IT9 C;  2WW4 A;  4JG4 A;  4WUB A;  4B3M E;  2Z5B B;  1FKA E;  1I94 I;  4YY3 E;  4JI8 I;  4DUY E;  4DV0 E;  2Z5E A;  2BM1 A;  4IZK B;  1HNW E;  3QT8 A;  3T1H I;  4JI6 E;  4JV5 E;  4DR4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...