1XMOL

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmoL00
3U58A 5M3FH 2F3IA 2UUCQ 4OWWB 4KHPQ 3HOZG 2CKZB 2VQFL 4A3DG 3K0XA 3W1BA 4OX9Q 1YJ9A 3S1QH 2RHSB 2JA7H 4X62L 3BZCA 3L2PA 4A3LG 1CKNA 1S40A 5IYCH 5IE8A 1VQNA 1XMOQ 4DV4Q 1N32L 2PNHA 5FJ8G 4RMFA 1KHIA 3T1HL 4JI5Q 4JI4Q 4JYAQ 1L1OB 4HJ8A 2I5HA 4B3TL 4L5RC 3H3VH 4KI0A 4DR1L 3FP9A 2OWOA 2I0QA 2Y0SE 3PIOA 1N33L 2N49A 1JB7A 1Y1VG 3S1NH 4NXMQ 1QUQB 2R92G 5IYBH 2VW9A 1CKOA 2ZM6L 2JA6H 3HOVG 2Z6KC 3PCOB 2JK8A 4YCVA 4A3JG 1I5FA 1Q7YC 1JE5A 1UE6A 3CPFA 3KLWA 1NJIC 2NZOA 3MXNB 2V1CC 3D31A 4KHZA 3AYHB 3CF5A 4Y52H 1VQDA 2K50A 4A3FG 1L0WA 1PYBA 3S24A 4R4CA 5C3EG 4DR3L 1Q1EA 4DUZQ 4JOIC 1PH3A 2K75A 1YJNA 1OXTA 5M5YH 4GN5A 5LMUL 1OTCA 4P74A 4DV3L 4X64L 4YCUA 3J7A5 1UE1A 4JI1Q 1A0IA 4A3IH 4B3RQ 5IY0A 3UDIA 5GAGC 4LF4Q 3M4QA 1SLJA 1HR0Q 4X66Q 1TWCH 2ZTCA 3UDFA 1OXUA 5FLMG 4PG3A 4BXXG 1TWGH 1VQ8A 1N36L 2JQOA 1PH8A 1S72A 1WFQA 4TQUS 3CCSA 1ASYA 3UDGA 2K5NA 1VQ9A 4YWKA 1PV4A 1K73C 4MZ9A 1XPOA 1JMCA 4LFAL 1NBWA 3CW2C 1VQ6A 4XIGS 5IT9c 1SR3A 1V9PA 2OQ0A 2VS1A 3AFPA 4A3EH 4GKKQ 4KHPL 3PUVA 1BBWA 2QGQA 2B3GA 3GTPH 3HOXG 4HIOA 3UE1A 5IP7H 1K83H 4OO1I 1LTLA 2VQFQ 3GD7A 1U0LA 1GO3E 3ULLA 1P8LA 5M3MH 3F1ZA 1K0RA 4DV2Q 4A93H 4UY8C 1JJGA 1CSPA 1XMOL 1PH5A 1OXSC 3U4VA 4YY3Q 4AIMA 4JI5L 3UDXA 2ZJQA 4JYAL 4A3GG 1Y14B 3U4ZA 4C3HH 1YHQA 1VQ5A 4MNOA 1XPUA 2CCZA 1L1OA 3CCMA 3M4PA 4NXML 3GDEA 1VQCA 3HKZG 4OWXB 1VCIA 3W1GA 1TWHH 1PH1A 4AYBG 1N33Q 1A63A 1VQLA 3CC4A 1KRSA 4HJ7A 2A8VA 1QUQA 4GNXC 3G71A 4WJ3M 3S2DH 2ZM6Q 4LF5Q 3E0EA 1VQ4A 5JJLA 3M4OH 2KHJA 2F4VL 2MO1A 1N8RC 1I3QH 2BH2A 4P72A 1G51A 1WCMH 4DNIA 1UEBA 3CXCA 3H0GH 5GQOA 1FGUA 4JCVE 4DR5Q 3A5ZB 3HOWG 3GTGH 2GN5A 3F8TA 3FKIG 1GKHA 5J3BA 3CC7A 4DUZL 3ULJA 2NZHA 3S16H 3H15A 3OYYA 4JI1L 3HOZH 4HIMA 4LF9L 1SN8A 2QA4A 3S1MH 4A3DH 4B3RL 4DAMA 4GKJL 2CWAA 2LSSA 2NVYH 1HR0L 5JEAG 4X66L 1JT8A 3CAMA 4A3LH 3PUZA 3RLFA 4R4QA 4BY1G 3F2DA 4LF6Q 2MO0A 4UP8A 1C9OA 2F52A 3KF6B 3RLOA 2JA5G 3MEFA 2JA8G 5JJKA 4JBWA 1VQKA 4HIDA 4A3MG 5FJ8H 2ZJRA 4YWMA 4BBRG 3CMEA 1CUKA 2ES2A 1FL0A 3I2ZA 1SMXA 1Y1VH 1EWIA 4YHHQ 3DM3A 2R92H 1EQQA 3CQZH 4YCWA 2Z0SA 4GKKL 1VS0A 3K80C 4IPHA 3HOVH 2R7ZG 3BZKA 3E9HA 3ZJYC 3DLLA 4A3JH 4DR6Q 5C44H 4WJ4A 2OCEA 1GM5A 1VQGA 3FHWA 1MJCA 4BBSG 3I4MH 4Y7NH 4DV2L 1IYJB 3UE0A 1HH2P 4P73A 1K8GA 2WFWA 4BA2I 2PI2A 2MQHA 1PH7A 4KLKA 3GTKH 4YY3L 4A3FH 3W5OA 1NE3A 2UU9Q 3T1YQ 5C3EH 3RZOH 4QGUA 1P16A 1QVCA 4A3CH 3KJOA 1EYGA 1G6PA 2RF4A 1PH2A 2D0OA 1XNQL 2WB1G 3IRBA 1FJGQ 2IT1A 1ASZA 4PMWA 5C4JH 2QEXA 2E8GA 3PUYA 1M90C 1O7IA 3VDYA 4GOPC 4IJHA 4LF5L 5EAYA 4YWLA 5FLMH 4BXXH 2IX1A 5M5XH 3KF8B 3PSIA 3PO3G 2IX0A 3BJUA 2F4VQ 2VY3A 1RL2A 1PHJA 4DR5L 3HKSA 4JI2Q 4GN3B 1I50H 1JJ2A 2CQOA 1EUJA 2R93G 2YTXA 2C35B 1B70B 3CCQA 5IYDH 3M7NA 1EFWA 4APVA 1Z9FA 1U5KA 3HOXH 1EQRA 2HT1A 3KDFB 2YYZA 4LUVA 2R6GA 4DV7L 3I7FA 4LF9Q 2KCTA 4GKJQ 4P75A 3JAMi 4LF6L 2AHOB 4DAYB 5LMNQ 2N8NA 4DPGA 2UXDQ 1YHBA 1IBLQ 4DUYQ 4O0AA 1MKHA 1VQPA 2UUBL 1C0AA 3S2HH 4X65Q 1Q81C 2IHEA 3KF6A 2ASBA 1A8VA 4A3GH 2Q2TA 1X3GA 4L5QA 1SROA 2KHIA 1UE7A 1SE8A 2K14A 4RG1A 4YHHL 5JEAJ 4LF7L 2HQLA 1KC8C 2JEAI 2R7DA 1OXXK 1IBMQ 4PZ8A 4J15A 4TVAB 3F2CA 5H1SE 2UXBL 1QZHA 1VQ7A 1Q82C 1M1KC 1HR0W 3CMAA 4DR6L 4HJ5A 2UXCQ 2GVAA 3I4OA 1Q46A 3HKZE 4JBKA 2JA6G 1AH9A 1X56A 4AYBE 2WAQG 1V1QA 1Q8KA 2OQKA 3S14H 1D7QA 1X6OA 1VQHA 2UU9L 3T1YL 2K4KA 3KJPA 4OWTB 2E5LL 3FKIH 3J80i 1IBKQ 1EIFA 2H5XA 3S15H 3K7UC 3TEHB 2IY5B 1QVGA 2YTVA 2PI2E 4UP9A 3GTJH 3GO5A 1FJGL 4JC0A 4OXPA 3GTOH 3AEVA 4JI3Q 4IFDI 5BR8Q 1XNQQ 2ZTDA 1VQIA 4GLVB 5AJ3Q 1PH6A 1IZ6A 3PF5A 1Q86C 1EOVA 1W3SA 2WP8J 3L0OA 1VQOA 2JA5H 2VNUD 2JA8H 4IPDA 4DR2L 4JBMA 4QY7A 3STBD 3PUXA 5C0XI 4A3MH 4JI2L 4AQYQ 4BBRH 3E9IA 1KD1C 1YJWA 4JV5L 1CSQA 3BU2A 1KIXA 4R4OA 5DLQE 2ZJPA 2R7ZH 2EIFA 1C7YA 4OO1G 4A3KG 3GTMH 1PH9A 4C3IH 2CFMA 2AMCB 2VUMG 5JJIA 1V43A 2EXDA 2N78A 3K8AA 5LMNL 4C3JH 3A5UA 3KDFA 4DV7Q 3CCUA 4BBSH 2UXDL 3JC66 1IBLL 4DUYL 1E24A 1HJPA 1YVCA 1YIJA 4IJLA 2CWPA 4GNXB 4X65L 3ULPA 4LUOA 3S17H 3CCLA 4EX5A 3OTOQ 1Q12A 2Z6KA 5M3MG 2UUBQ 3J81j 3G48A 1K3RA 1W2BA 2JJQA 5ELOA 5GAHC 4JG2A 1I94L 1IBML 3JAMc 1BKBA 3M9BA 4DV0Q 1IXRA 2DGYA 2LXKA 4LF7Q 1PVOA 3I55A 1TXYA 1MIUA 4GS3A 1YEZA 1VQEA 1HNZL 2VQEQ 3S1RH 1KQSA 2UXCL 1KRTA 3ICEA 3Q8DA 1HNXQ 3PF4A 2UXBQ 2ZTEA 4JOIA 3A0JA 2RHQB 4GLAC 4ME3A 4QJFA 1VQMA 2WB1E 4DV6Q 1E7ZA 1HZCA 3PO3H 4JI0Q 1G291 4GN4B 1J5EL 4JI6Q 4POGA 5IWAL 2NVQH 4IO9A 4NPSA 1UWVA 2AWNA 3AQQA 5IP9G 1K8AC 3K7AH 1IBKL 5C4XG 1L1OC 4PZ6A 1SRUA 2R93H 3NELA 4DV1L 1XPRA 3M85A 2E5LQ 4DR7L 1OXVA 1E3PA 3PO2G 3G4SA 2E2IH 1LYLA 1K9MC 3NBHB 4JI3L 3PGZA 4IPCA 5BR8L 4PZ7A 3RLNA 4O2DA 5AJ3L 1QVFA 3I4NG 3HOUG 1X3EA 3HOYG 4DR4L 2EQSA 1Y1WG 1N34Q 4EQ5A 1VQJA 3SGIA 4NXNL 1S3OA 2B63G 3H3VI 3J80c 4P71A 1VQFA 4BY7G 3CCVA 1A62A 1KAWA 3J81i 4AQYL 2I5LX 1EIYB 4DR2Q 4BA1I 3ER0A 2YV5A 4JI8Q 2Q2UA 1PA6A 3G6EA 4DV5L 1KL9A 2K52A 1YITA 1YI2A 3TRZA 1TWFH 2PQAB 4JV5Q 1AE3A 3NENA 3D0FA 1WI5A 1WYDA 4LF8Q 3TS2A 1SFOH 3B6YA 4JI7Q 4A3BG 5E7NA 1YHAA 1X9NA 4UPAA 1LM0A 3CCRA 3GTLH 3TREA 3TQYA 5M3FG 4XTCS 1XNRQ 3WWVA 2HHHL 1XJVA 4LWCA 2D0PA 2K5VA 4LFBQ 2UUAQ 4IOCA 2ATWA 3AFQA 4GOPB 1GD7A 2XTIA 3STBC 5C44G 2JA7G 1XMQQ 3OTOL 3I4MG 1Q1BA 4JBJA 4GNXA 5IYCG 2Y0SG 1N9WA 2WAQE 1GVPA 1BBUA 1HZAA 2AKWB 2NN6I 4L5TA 4B3SL 3M3YH 4DV0L 3A74A 1I94Q 1YNXA 2VL6A 4A3CG 1HNWQ 3J7ZC 4POFA 3CPWA 2VQEL 2B29A 2MFIA 2JE6I 1YBYA 4UP7A 5LMNW 1HNXL 4L5SA 5GAEC 1HNZQ 4NB3A 3EBEA 1PH4A 4DV6L 1XTDA 2KENA 5IYBG 2DUDA 5FLXc 4JI0L 4JI6L 3NEMA 4DKAC 1R9TH 4IFDJ 3KFUA 4IPGA 4B3MQ 1J5EQ 1J6QA 4A76A 5IWAQ 4R1JA 4K0KQ 2ALYB 2KCMA 1NMGA 2I5MX 4OONA 3HOWH 4LFCQ 1I6HH 1CKMA 2VUMH 4DV1Q 3GTQH 1WOCA 4DR7Q 5C0XJ 1E1TA 1NMFA 4A3KH 2JA9A 1B8AA 2UUCL 1NTGA 1WJJA 2K5HA 3RNUA 3OW2A 5IYDG 1E22A 4H02A 1N34L 4GLXA 2IHFA 3PIPA 4OX9L 4QIWE 3KYHC 4ALPA 4BY1H 4DR4Q 1VQBA 4HJ9A 1PYSB 3K81C 4A3IG 1CKNB 4NXNQ 2Q2IA 4LW1A 3RZDH 1HZ9A 2AWOA 3LGJA 4R4TA 3U50C 2KBNA 4X62Q 5ELNA 2NVXH 3CD6A 4JI8L 2NN6G 2L15A 1X3FA 1B7YB 3F2BA 4DV4L 4QQBX 2OTJA 2A19A 2BA1A 1KXLA 4JI4L 4DV5Q 1N32Q 4C2MH 4LF8L 4JI7L 2PMZE 3T1HQ 2PQAA 4B3TQ 1UE5A 4DR1Q 2LXJA 4AH6A 3RR5A 3J81c 1XNRL 2RCNA 4A3EG 1FVIA 1PFSA 4LFBL 2UUAL 1X54A 3CC2A 1VQAA 2ID0A 3CP0A 2HHHQ 4A4IA 1XMQL 4QL5A 2VZAA 5IP7G 3CCEA 2YTYA 4FDBA 4X6AH 5IP9H 1HZBA 2BH8A 2XGTA 5C4XH 4HIKA 4GOPA 3TS0A 2NVTH 2HIXA 3ERSX 4A93G 1JJCB 1E1OA 3RN2A 3RN5A 5M5WH 3PO2H 4IFDG 1HNWL 1L2FA 4IOAA 1H95A 4B3SQ 3KOJA 5GADC 3I4NH 3HOUH 3EN2A 1BVSA 1D8LA 1T9HA 4DR3Q 3HOYH 1AE2A 2D62A 1Z47A 2BA0A 1Y1WH 3L7ZC 3HFZB 5LMUQ 2N3SA 2B63H 1DGSA 2FXQA 2Q2HA 3EIVA 4LUZA 4DV3Q 4X64Q 4LF4L 2HIVA 4BY7H 5C0XG 3I56A 1LUZA 1NY4A 1RIPA 1X55A 2R7FA 2MNAA 1MJEA 4HJAA 4B3ML 2A1AA 4K0KL 2GVBA 3CCJA 2YU9H 5GROA 4MTNA 1TWAH 5HGQA 1N36Q 1X65A 4LFCL 4R4IA 4DK6C 1WCMG 2OTLA 5HY6A 3PUWA 2E2JH 1QZGA 5K36G 4DK3C 2JEBI 3H0GG 4A75A 1YZ6A 2E2HH 4A3BH 1IL2A 4LNQA 4LFAQ 3PV0A
chains in the Genus database with same CATH superfamily
4F87A 5ISRA 4KHPQ 3HOZG 4A3DG 2VQFL 1B53A 1XX8A 1TS4A 1S40A 5IYCH 2B2VC 1N32L 5C3EB 2PNHA 5FJ8G 1KHIA 3T1HL 4JI4Q 1FNUA 4KI0A 2EPBA 3X3MA 2I0QA 4HCSA 3PIOA 1JOKA 5ELEA 3HRZC 1QUQB 1CKOA 4EQOA 5HGTA 1SE2A 2JK8A 5KIXA 1DYQA 2QF7A 4RA8A 4B08A 2EY5A 3D31A 3AYHB 2OEOA 4A3FG 3K57A 1L0WA 3MFGA 1BDOA 4DUZQ 2EY6A 5EPKA 1UNSA 5LMUL 1OTCA 3R3OA 1PDQA 2F03A 2NTSA 2MGSA 1B2TA 2K32A 2RBMA 5GAGC 2A68C 1SLJA 4G4KA 4RGNA 1SE4A 2NN6H 2JQOA 3S2HB 1FNWA 4QUCA 1F9QA 1PTOF 1WFQA 4NKLA 4TQUS 4U673 3CCSA 1VQ9A 1HUNA 3V96A 1K73C 1JMCA 5CV6A 2IWHA 5IGCA 1V9PA 2VS1A 3AFPA 3PUVA 3GTPH 3HOXG 1B50A 3J7AF 5FKAC 3GD7A 2BE5C 3ULLA 1NAPA 2F3VA 3F1ZA 4A93H 1GUNA 4DV2Q 3QJYA 1SNCA 1XMOL 1SYDA 1OXSC 3BVZA 4NP5A 3HOWB 1Q8IA 2B2UA 3SXHA 4YY3Q 4IFDH 1SYBA 4IZ8A 3UDXA 2ZJQA 3U4ZA 3GTJB 3BDOA 4MNOA 3L9AX 1XPUA 3GTOB 3C46A 2ICIA 4NXML 4OWXB 1PH1A 1N33Q 4AYBG 1VQLA 1ZKOA 4GNXC 3S2DH 3D6CA 2KUMA 4H7BA 4P72A 1G51A 4DNIA 1S5CD 4JCVE 2SNSA 3A5ZB 3FKIG 3CC7A 2Z9HA 3OHXC 3AMUA 3GTMB 1H9KA 3HOZH 1STYA 4A3DH 1SN8A 1JWSD 4DAMA 2CWAA 1HR0L 2FMMA 4BBSB 3CAMA 4LF6Q 2MHVA 2MO0A 4UP8A 3KF6B 2L5TA 2JA5G 4IURA 3MEFA 1LV9A 3D6WA 4A3MG 5FJ8H 4BBRG 3CMEA 5FOBB 3I2ZA 2WB1B 1SNMA 2C5CA 3DM3A 5TSSA 2KCCA 1XWEA 4IPHA 2R7ZG 3K6OA 3BZKA 3A55A 3DEPA 2FINB 4WJ4A 1STHA 5C44H 2OCEA 1GM5A 2F0NA 1A2UA 3BVMA 5COYA 1CHQD 1L0XB 1IYJB 4JVZA 4KKSA 2HUGA 3I3CA 4A3FH 2R93B 4HR7B 1SEBD 2MJ8A 4CKBA 3A54A 1IW7D 1AZPA 3KJOA 3GP7A 1EYGA 3NE5B 4PMWA 5C4JH 3VDYA 2WKCA 2HD3A 4RH6A 5M5XH 2PCFB 4V0BA 3BJUA 4FNFA 5M9OA 1PRTC 2F0LA 2VY3A 4DR5L 3HKSA 2FFKB 1B3QA 1PXUA 3I72A 1I50H 1O7LA 1TWFB 4TRDA 2PO4A 1B70B 1H9MA 1VDZA 1SFOB 1EWHA 1M8AA 5BN3A 3HOXH 1ZEQX 4LF9Q 5IOCA 2JN4A 2AHOB 4DAYB 3A8JE 2N8NA 3NHHA 3F2UA 1C0AA 1ILPA 1LT4D 1MSGA 2WINB 1SROA 2EYLA 1SMYD 2ICEC 1V8QA 2XWJB 4RG1A 4YHHL 5JEAJ 2HQLA 1OXXK 1NR2A 4J15A 1D5MC 5DNFA 1K3BC 2M9VA 1T5XD 3CMAA 5EQ0A 2UXCQ 1Y8OB 2F0JA 2JA6G 1XXGA 1BO0A 3S14H 2K4KA 4KY6A 4ODGA 3FKIH 5KRUA 3J80i 2IY5B 1PTOH 3OIQA 2I07B 3GO5A 4JC0A 3Q0AA 2F0UA 4LAAA 3MEHA 4IFDI 3EQLC 4KD4A 5EKKA 4C56C 1IZ6A 1Q86C 2QDLA 4XYQA 1F2MA 1SNQA 3RZDB 2JA5H 4JBMA 4DR2L 4QY7A 3URYA 1EYAA 3PUXA 4A3MH 3OOCA 4X3SA 4BBRH 1GOZA 1SNDA 3IAYA 5CBAE 1CSQA 2F0SA 4C3HB 1HXYD 2QW7A 2LKVA 4CJ1B 2R7ZH 2D5DA 4OO1G 4A3KG 2F0EA 4DK1A 1PH9A 1K8OA 2CFMA 4TKOB 2N78A 4FF3A 5KEEA 5LMNL 3SVMA 1IBLL 2N88A 4DUYL 1HJPA 1BCPF 1YVCA 3NWSA 1TS2A 3NXWA 3PIP3 1E2WA 2B2WA 2NVTB 1DXMA 1VMPA 2XNAC 5M5WB 3PO2B 5ELOA 2Z4IA 4JG2A 1IBML 1A3UA 3FPUB 3JAMc 1BKBA 3VR3A 4DV0Q 4O42A 3I55A 1TXYA 1MIUA 4GS3A 1HNZL 2ZTEA 4JOIA 2KCNA 1STNA 3RMHA 2B2UC 4JI6Q 5IWAL 2CW0D 4NPSA 2AWNA 3KLSA 1K8AC 2R3ZA 4PZ6A 1SRUA 5CV9A 4H44C 4A3BB 3PGZA 4IPCA 5AJ3L 3S9WA 3HOUG 3HOYG 2EY1A 4DR4L 2EQSA 1N34Q 4KMUC 1S3OA 2B63G 4G57A 4P71A 2L9HA 3I4MB 3CCVA 1NSNS 1KAWA 2WKDA 1BOSA 2P5ZX 2Q2UA 2YV5A 4JI8Q 2X6LA 2ENBA 2QEJC 2Z6BA 5C4ZA 1JC7A 4JV5Q 1C8CA 3NENA 2PQEA 3DMUA 3S1NB 1YHAA 1X9NA 1I4QA 3CCRA 3GTLH 5M3FG 3DXJC 3Q6SA 2K33A 4LWCA 2ATWA 1KNEA 5C6AA 3HGBA 2JA7G 1MBYA 3OTOL 3SK5A 5EGTA 2Y0SG 2PNRC 1N9WA 1SDFA 1STBA 5JOBA 3M3YH 4L5TA 4CKCA 1YNXA 2VL6A 5G3LD 1UAPA 5M5YB 2VQEL 2A69C 1HNXL 4L5SA 3QO2A 4NB3A 4A3IB 1PH4A 4DV6L 1XTDA 2KENA 2DUDA 3KFUA 4B3MQ 2TSSA 2ALYB 2KCMA 1PTOC 3ND8A 1NMGA 4JK1C 3QG1A 3GTQH 1AFPA 1LTGD 1WOCA 4KY7A 4DR7Q 4OO1H 4XQQA 4A3KH 2JA9A 3T13A 2EY2A 4A3EB 4PV1C 4H02A 1IHZA 4GLXA 4ALPA 3KYHC 2G5DA 1O78A 5HURA 2MUYA 1C4QA 1CKNB 2Q2IA 3NQIA 1VMCA 4R4TA 2PW5A 3CD6A 1TR5A 3LNNA 4XYOA 1X3FA 4UDUC 3L3OC 4JI4L 4FP5D 3VR6A 4C2MH 4LF8L 3HZXA 2F0OA 2CQAA 1CI3M 2LXJA 4AH6A 3RR5A 2UUAL 1X54A 4TSSA 3CP0A 2HHHQ 1V1OA 4QL5A 2A68D 2YTYA 3CCEA 2K28A 2XSCA 2XGTA 4HIKA 3BDCA 5CORA 1JJCB 1QOHA 2QCPX 2CVRA 3MXNA 5A2QE 3RN2A 1YNJC 4RKLA 1HNWL 5KNDA 4B3SQ 3KOJA 5GADC 3HOUH 4DR3Q 5A2QL 3S16B 3HOYH 4FXGC 1AE2A 2D62A 3HFZB 2B63H 4DV3Q 2Q2HA 5J39A 4X64Q 4CJ2C 2HIVA 1VF7A 3AB9A 4OIJA 2A1AA 4FF4A 1GHJA 2BE5D 3S17B 1TWAH 4I7AA 3ONAB 1WCMG 5K36G 2EVBA 4G7HC 2JEBI 3H0GG 5IGGA 2E2HH 1SXTA 3X3NA 5M3FH 4KJNA 1CA5A 2UUCQ 3HOVB 3EJIA 1STGA 4C3IG 3K0XA 5CR3A 1TY0A 3IFTA 3IFDA 3S1QH 2RHSB 2JA7H 3PMFA 4X62L 2B8GA 3L2PA 2NVQB 2K5DA 4Y7NB 3NPPA 1ET6A 5IE8A 1VQNA 3K7AB 5D3IB 4DV4Q 2AQ2B 5KYLA 1GUTA 3RZOB 4JI5Q 4JYAQ 1L1OB 3H3VH 2I5HA 1RDPD 2OWOA 1N33L 3MHBA 2IJ0A 1AN8A 1JB7A 1CQFA 3T16A 4K8IA 3VYUA 2EYHA 4FXKC 2B2WC 4K14A 2M2LA 2JXMB 1JE5A 3QOJA 1NJIC 3MXNB 2FMCA 2DY7A 3P20A 4Y52H 2K50A 3OWFA 1W6KA 5C3EG 2B2TA 1Q1EA 4JOIC 3ND9A 1YJNA 1OXTA 4GN5A 4KJOA 3J7A5 3MVVA 4IN3A 4B3RQ 5IY0A 1EEFD 3NTIA 3SDZA 3LWEA 4CBVA 1TWCH 1TWGH 5ELBA 1XYIA 1PZID 1S72A 4A3GB 1ASYA 2K5NA 1HPCA 4YWKA 1PV4A 1SNPA 3Q24A 4I7ZC 3CW2C 4XDXA 4XIGS 5IT9c 3T4AC 1BBWA 2B3GA 5EPJA 3UE1A 1K83H 4OO1I 1LTLA 3QIAA 1CHPD 2WIIB 4IUVA 1U0LA 5M3MH 2VB2X 4UY8C 2F0GA 1PRTD 1ESRA 3U4VA 5NUCA 4AIMA 2F4IA 4WFN3 1U9RA 4RCNA 1B4OA 2CCZA 3CCMA 2EOTA 1GXDC 5IODA 1VCIA 5C3WA 4K2KA 2KJXA 1KRSA 1KTKA 1QUQA 4BY1B 2DY8A 2ZM6Q 2AQ3B 4LF5Q 1VQ4A 1YNNC 2KHJA 2JA8B 2BH2A 1WCMH 3FEWX 1ENFA 5K36H 4HN7A 3H0GH 5GQOA 2VB3X 3BDLA 3GTGH 3HOWG 5J3BA 1GKHA 1FNVA 3SK4A 4JI1L 2RDHA 4LF9L 3S1MH 2QA4A 1K28A 3KBXA 2EDGA 3GV6A 4X66L 1BCPC 1EY5A 2RDFA 2XVSA 2K5WA 2J7ZA 1GHKA 5CV5A 4JBWA 4HIDA 3D3RA 1T5EA 4YWMA 5C5MA 1C48A 1LABA 4ID6A 4GKKL 3CQZH 3G6JB 3VR5A 1HA6A 3S1RB 3J80E 3DEOA 3DLLA 3PO3B 4DR6Q 3BS1A 1QWYA 1MJCA 4P2CB 3J80L 4BBSG 4BA2I 3UE0A 1AP0A 4OIKA 2MQHA 4HMIA 2F0DA 1SJHD 2JYOA 2MP1A 3H3VC 2UU9Q 1JWMD 5C3EH 3BYYB 5FO7B 1P16A 4QGUA 4A3CH 2RF4A 1EYCA 1S5ED 1TS3A 2WB1G 2IT1A 1WTQA 2QEXA 4RGMA 4C1NK 4YWLA 1CQVA 4CJ0B 3I90A 1DM0B 1EY9A 2F4VQ 4U68A 1RL2A 4JI2Q 3BZDB 2G9HD 4GN3B 4KTAA 1JJ2A 2O5IC 2CQOA 3H91A 2R93G 2YTXA 1PFMA 1FR3A 1F2YA 3E6ZX 1EFWA 1U5KA 2K5QA 2HT1A 3KDFB 2R6GA 3K5LA 4P75A 1S5DD 3D4WA 1KAAA 3CHBD 3I8ZA 1GUGA 1DOMA 1VQPA 3S2HH 3SE0A 3KF6A 1A8VA 1H9RA 1X3GA 2A6EC 3OPOA 3CRLC 1UE7A 1SE8A 1KC8C 2JEAI 1HQRD 4TVAB 3MAQA 1QZHA 1IYVA 1ONLA 3TDQA 2KVMA 1Q46A 3HKZE 1QNKA 2F0HA 3TP8A 4JBKA 1AH9A 1RCVD 1R9TB 1V1QA 1Q8KA 4ZK9B 1X6OA 3T1YL 3KJPA 4OWTB 3Q23A 1IBKQ 2H5XA 1I6HB 3S15H 3NP8A 3K7UC 4NDXA 5J1ZA 1SYGA 2PI2E 3GTJH 1HFNA 1S4ZA 3GV3A 1FJGL 4OXPA 3GTOH 4JI3Q 5DM73 4HSVA 1XNQQ 3DWQA 4FXDA 3L0OA 2F0FA 1VQOA 3E0JA 4IPDA 4I65A 1B3AA 2B2TC 1YJWA 3JAME 2E74C 4JV5L 3BU2A 1KIXA 3NQTA 3VYRA 5DLQE 3JAML 3GTMH 2ZXPA 2EXDA 2A69D 4BBSH 2KEEA 3CCUA 2UXDL 3JC66 4DAYA 3ULPA 4X65L 2EYFA 3A8KE 4EX5A 2UUBQ 3TZDA 3KUPA 1PTOD 1W2BA 3NBIA 5I2XA 5GAHC 2F0WA 5C3XA 2DGYA 2LXKA 4C3HG 4LF7Q 1PVOA 1STEA 1PLFA 3MTSA 3Q8DA 2EZVA 3PF4A 2RHQB 1VQMA 4GN4B 4R9WA 1EL0A 2R93H 3NELA 5DEHA 3H09A 3TBIB 4DR7L 2DJGC 1RJTA 2F0IA 3PO2G 3P75A 1LYLA 4PNYA 5BR8L 1QVFA 4O2DA 4RKBA 4ZKBB 2HDMA 3VYTA 1KDCA 4N9TA 5C44B 4M1UB 3J80c 1A62A 3J81i 4AQYL 2I5LX 1LTID 2OF1A 1HCZA 2QILA 5EKLA 1YITA 2JSOA 3TRZA 1TWFH 2RKSA 1ML0D 1WI5A 1WYDA 1R4QB 1YNJD 2WV6D 1SFOH 3B6YA 4A3BG 2F0MA 1LM0A 4IUPA 3O13A 3TP6A 2HHHL 1XJVA 1LT6D 2D0PA 5T1GA 5IGFA 4IOCA 3I70A 4GOPB 4ZUIA 2XTIA 5E3FA 3STBC 1XMQQ 3I4MG 2PPBC 5CC4A 4MN3A 3A8IE 5BN5A 2WAQE 3NTHA 1GVPA 4B3SL 2NN6I 1DOKA 1TS5A 3K59A 1I94Q 1ZYRD 3J7ZC 4POFA 1B44D 2M00A 3TN2A 2JE6I 1YBYA 4UP7A 1CT1D 5GAEC 1RTOA 4JI0L 2SOBA 1EQTA 1EQVA 3PIO3 3QOLA 4DKAC 4IALA 4IPGA 1J6QA 4A76A 4K0KQ 4R1JA 4GZYC 4OONA 2I5MX 3TSSA 3DWAA 2Z4HA 3TP7A 1CKMA 1GUOA 4DV1Q 2BOSA 1Z6HA 1E1TA 1NMFA 2F0PA 5C0XJ 1IL8A 2UUCL 1WJJA 3OW2A 5IYDG 1DD2A 1TQOA 1MGSA 4QIWE 1S5FD 4A3IG 4UHVA 1I4GA 2L0CA 4NXNQ 1E2VA 4LW1A 3RZDH 4FO2A 4CDFC 2NTTA 2QDBA 2L15A 2HCIA 4DV4L 1LTSD 1D5XC 3VR2A 5EJWA 4KN7C 1BXTA 3I73A 2J4XA 3J7AV 4DV5Q 2GA4B 1N32Q 2DNCA 1RTNA 4JI7L 2PMZE 3T1HQ 1WTPA 3M4YA 1TT2A 4KKUA 1TWHB 1XNRL 3HS0C 2RCNA 4A3EG 4LFBL 2E2DC 1VQAA 2RA4A 2ID0A 4J6HA 3M4OB 4FDBA 1I6VC 1I3QB 4DK0A 2Q8IB 3TS0A 3BVGA 1ENCA 1DJRD 2NVTH 2B2YA 3M7GA 1E1OA 4HCEA 5M5WH 3FMCA 3PO2H 4IOAA 3MA2B 3PQIA 1PZJD 2BA0A 3L7ZC 5LMUQ 1DGSA 3EIVA 3ZYYX 2NVYB 2K1BA 5C0XG 3I56A 1NY4A 2MNAA 1O80A 1H9SB 4DAPA 3CCJA 3LX0A 2EJFC 5GROA 1F77A 3TZUA 4QB4A 1X65A 4LFCL 5HY6A 3PUWA 2E2JH 4QCLA 1HTPA 4DK3C 1PFNA 4IUQA 4A3BH 1Y1VB 3PV0A 2R92B 3SK8A 3U58A 2Z8LA 1SSOA 1EY4A 4DA2A 5C5LA 2CKZB 3BYTB 1JR0D 3NTKA 4A3JB 4K8JA 1MI2A 3T53B 1ILQA 4A3LG 1RD9D 1CKNA 1YNND 4K5WA 4KY5A 3GTKB 1XMOQ 4RMFA 2D9UA 3W3AA 4HJ8A 4B3TL 4L5RC 3WDNA 4DR1L 3KLRA 3S1NH 4NXMQ 2VW9A 2ZM6L 2JA6H 3HOVG 1F9PA 1BCPD 4YCVA 1Q7YC 3CPFA 2A6HC 2L4NA 2LMCB 1VQDA 4Q5VA 4R4CA 1Y8PB 5IT9E 1WTWA 4DN4M 4YIJA 1PH3A 5M5YH 3GQBA 5IT9L 4YCUA 1UE1A 5FO8B 4A3IH 3UDIA 5J22A 4WRDA 2K04A 2RSOA 3M4QA 4OEMB 2PYKA 4XXEA 1HR0Q 5FLMG 1QG7A 5L37A 1N36L 1PH8A 5CMDA 1SBBB 2X6GA 3UDGA 1HA5A 3M3YB 2RSNA 5D14A 1XPOA 4LFAL 3HKZB 2SNMA 3P7JA 1SR3A 2K7VA 4A3EH 4KHPL 3EROA 3MFYA 2D2CC 1F9SA 1FGBD 2BDOA 5EPLA 1GO3E 1P8LA 1K0RA 1PH5A 3P1HA 1Y8NB 2R61A 3A56A 4A3GG 1Y14B 3ITPA 1U4MA 1L1OA 3M4PA 1VQCA 1A63A 5C0XH 3CC4A 4HJ7A 1DONA 2A8VA 2F3WA 3SHLA 3G71A 5JJLA 5FK9C 5DAUA 4ZKCB 2F4VL 2MO1A 4RHSA 1MSHA 4B9XA 1UEBA 5E4XA 4DR5Q 1IW7C 2J0TD 5CBEE 4DUZL 1SYCA 3K5MA 1ET9A 2RQXA 3S16H 4HIMA 3VA7A 4C3JB 1JT8A 4A3LH 3PUZA 3RLFA 3F2DA 4BY1G 2QKIC 2F52A 1HQMC 2JA8G 1VQKA 1KDBA 2EXZA 2ZJRA 1FL0A 3NUCA 3K0YA 1EY8A 1SMXA 3DHQA 1D1IA 4YHHQ 4CDDC 1EQQA 4YCWA 1A6XA 1EWCA 3HOVH 3ZJYC 1QJOA 4JW0A 1TVXA 1VQGA 3FHWA 4PMCA 4Y7NH 4DV2L 1HH2P 1K8GA 2WFWA 1PH7A 4KLKA 4YY3L 1IKLA 1U4LA 1NE3A 2KHSA 1LT3D 3RZOH 2E2IB 1G6PA 4K6LA 2BDNA 1XNQL 3IRBA 2PZTA 3MWYW 1M90C 2E8GA 3PUYA 4V190 2Z1CA 4IJHA 5EAYA 1X32A 5FLMH 2B2YC 2IX1A 1R4PB 3KF8B 3PO3G 2IX0A 4ZLTF 1PHJA 1PRTF 3SK6A 1A3VA 2NB0A 1EUJA 2C35B 2K05A 2Q8TA 1B1ZA 3CCQA 2CH4A 3MC0B 3M7NA 4APVA 2LS01 1Z9FA 2WACA 5FLXE 4LUVA 3R8BA 4GKJQ 3I7FA 3D4DA 4LF6L 2WAQB 5LMNQ 4DPGA 2KEDA 1IBLQ 4DUYQ 2UUBL 3E3XA 2XRSD 4RAUC 4OGQC 5ELDA 3MZ5A 2ASBA 4A3GH 2Q2TA 4L5QA 3KK7A 2K14A 4LF7L 1IBMQ 3I4LA 1TIID 5I4DA 4PZ8A 1E0BA 4RHRA 1Q82C 1M1KC 2HQEA 4HJ5A 1D2BA 2GVAA 1TWCB 4AYBE 5KNCA 1TWGB 2EE1A 1D7QA 1VQHA 1EIFA 4QIWB 3MXPA 5C4HA 5JVG3 1QVGA 2YTVA 1KDAA 3J81E 2VUMB 4Q0FA 2A73B 1PZKD 5AJ3Q 4GLVB 1PH6A 4CDEC 3PF5A 3J81L 1LO5D 2NBFA 3I91A 1W3SA 2VNUD 2JA8H 2NVXB 1EEID 2PMZB 5M3MB 3STBD 5C0XI 2O4XA 2V4DA 4IUTA 3TP5A 4FF2A 4FF1A 1ESFA 1G8ZD 2B39A 3UI2A 4R4OA 2ZJPA 3QWNA 4C3IH 2F1MA 2AMCB 1V43A 3KDFA 4DV7Q 5IGBA 3OMCA 4IJLA 4GNXB 2AUKA 4LUOA 5C4XB 3CCLA 4X3TA 3OTOQ 2Z6KA 1W6JA 3EVQA 3G48A 4KN4C 1J9OA 4DFAA 2JJQA 1I94L 1CA6A 3I4NB 3M9BA 1IXRA 2K03A 2A5HA 2F0VA 1Y1WB 4XT3B 1JOQA 2VQEQ 4OHJA 2I46A 3S1RH 2XWBB 1KQSA 1L0YB 2UXCL 1HNXQ 2UXBQ 4GLAC 4BY7B 3PO3H 4DV6Q 1HZCA 1ICWA 4M8AA 2YU9B 1S5BD 3H6MA 3AQQA 4EQNA 5IP9G 3VA5A 1L1OC 4DV1L 1XPRA 3M85A 2EJGC 2E5LQ 3G4SA 4XQNA 3NBHB 2H1EA 1K0SA 3NWTA 1VQJA 1EZ6A 4NXNL 2RCFA 2IPKD 3SGIA 3H3VI 4K5VA 1F2ZA 3D4RA 1EIYB 5E4WC 4EGVA 3ER0A 1PA6A 3G6EA 4DV5L 4ILWA 2PQAB 2OT2A 1AE3A 3D0FA 4LF8Q 3A7AB 4OELB 2DJFC 1SJED 5E7NA 3VYSA 4UPAA 4RCOA 2LFNA 3TQYA 1V1PB 3FPPA 1QCBD 3ERQA 5KNBA 2DNEA 2UUAQ 4IUNA 3AFQA 5I6YA 5C44G 3CU7A 5D65A 2PZWA 4KV6A 1PRTB 1BBUA 5AFWA 2AKWB 4DV0L 1HNWQ 5D3DA 3CPWA 2B29A 2XRQD 4ZCKA 4O1NA 3KLSX 2SEBD 4HAEA 5CYUA 5FLXc 5IYBG 4JI6L 3NEMA 4FYDA 1R9TH 1J5EQ 3D8GA 1ZXTA 3H94A 5CV7A 3HOWH 2F0TA 1I6HH 3K5OA 2F0KA 1JORA 1TY2A 2NWGA 1NTGA 1O7YA 3RNUA 1E22A 1N34L 1M4VA 1WVLA 1GJXA 2IHFA 3PIPA 3C1FA 3GTPB 4EVOA 1VQBA 1PYSB 5I2YA 1I4XA 1LTRD 1HZ9A 2AWOA 3LGJA 3U50C 4X62Q 5ELNA 1ICFB 4A93B 4JI8L 4KK7A 4DXFA 1B7YB 3F2BA 4QQBX 2OTJA 4MTKA 2A19A 2BA1A 2A6HD 2F0QA 3S15B 1KXLA 1SYEA 1RKNA 1IYUA 4X3KA 3J81c 1FVIA 3CC2A 3S2DB 4A4IA 2VZAA 5IP7G 5F2DA 2FHTA 5IP9H 1HZBA 2BH8A 2L12A 4GOPA 1MHWC 4J8QA 5FO9B 1WTXA 4G7OC 2HIXA 3ERSX 5JJZA 3RN5A 1HRJA 1L2FA 4C1NI 3EN2A 1BVSA 2L11A 1WTVA 2L55A 4F8MA 3HOZB 4A3DB 1BQQT 2N3SA 3A7LA 4LUZA 2FXQA 1D5ZC 1LUZA 1X55A 4B3ML 2R7FA 1MJEA 1DZ1A 3QR8A 4CHTB 4MTNA 2Q8RE 4DK6C 2RVLA 2IL8A 4Z9CB 1YZ6A 3G7LA 4LNQA 1CZWA 3MXUA 1VF5C 5IIFA 2F3IA 2N55A 4OWWB 1EY0A 3HP3A 2OXPA 3W1BA 4OX9Q 4CDCC 1YJ9A 4X3UA 3HG9A 3BZCA 3U9OA 1K8MA 4S3SA 2HCCA 4A3FB 4HSPA 1A15A 1EY7A 4DAVA 4PQXA 1EIHA 5LL6S 1CK1A 1RF2D 2AUJD 3FP9A 2Y0SE 3E5SA 1KABA 2N49A 4ZUJA 1Y1VG 5C4JB 2R92G 5IYBH 1X3QA 2Z6KC 3PCOB 1FYCA 5M5XB 4A3JG 1I5FA 1EFID 1UE6A 3KLWA 2NZOA 1LACA 2V1CC 4KHZA 1KNAA 5EKIA 2JP1A 1I50B 3CF5A 2FJ2A 1PYBA 3S24A 3OWEB 1LTTD 4ABNA 4DR3L 3Q22A 4LK1C 4WORA 1B9NA 2K75A 2EYMA 4P74A 2KA7A 4DV3L 4MIUA 3HOXB 4X64L 4XQJA 4DF7A 4JI1Q 1A0IA 4ZYSA 4JPBW 4LF4Q 1PYWD 1TU2B 4X66Q 2ZTCA 3UDFA 1OXUA 4BXXG 4PG3A 1VQ8A 3BG3A 1H9SA 4FVMA 1I4RA 2IX3A 3N6RA 4K2LA 1EIGA 4MZ9A 1CFMA 1NBWA 4AYBB 4QUFA 2OQ0A 4GKKQ 1IKMA 2QGQA 3SR1A 4HIOA 2TMPA 5IP7H 2VQFQ 1PFBA 5CV8A 3RD4A 2NYZD 3S14B 1JJGA 1CSPA 4EQPA 4BWGB 3FKIB 2RDGA 5ELFA 4JI5L 4JYAL 1PTOB 3QB3A 1F2LA 4C3HH 1YHQA 1VQ5A 2LY7A 3GDEA 3HKZG 4CKEA 4F88A 3W1GA 1VQ6A 1TWHH 2PW7A 3DM1A 4WJ3M 4G7ZC 2O5JC 3E0EA 1BR9A 2K6AA 3M4OH 2JA5B 5JPMC 4DU9A 1N8RC 1I3QH 3R2IA 4A3MB 5JVH3 4BBRB 1Q3LA 4ZRZA 3CXCA 4K5XA 1FGUA 2GN5A 3F8TA 3ULJA 2NZHA 2R7ZB 3H15A 3OYYA 4GKJL 4B3RL 3CRKC 1A2TA 2LSSA 2NVYH 1JWUD 5CV4A 5JEAG 4R4QA 4RWSC 3K5NA 1C9OA 3RLOA 1LLRD 5JJKA 1AEXA 5IGEA 2BCOA 1CUKA 2ES2A 1Y1VH 1EWIA 5G3LF 2R92H 2Z0SA 1VS0A 3K80C 2XIWA 4XT1B 2EJMA 3E9HA 4A3JH 1QE6A 1KLUD 4C3JG 1UUPA 3I4MH 4P73A 3K58A 1H9JA 1DCZA 2PI2A 1BUVT 2X69A 5IGDA 3GTKH 2EYPA 3W5OA 3T1YQ 2E2JB 4PMBA 4B9WA 1QVCA 2ZT9C 4L63B 1HFGA 4L6TB 2D0OA 1PH2A 3VR4A 1FJGQ 1ASZA 4IUUA 1O7IA 4GOPC 4LF5L 4DNTB 1LTAD 2E75C 4BXXH 5KGUA 3PSIA 1EU4A 1HHVA 4IQZA 5IYDH 2DN8A 2AQ1B 1I4PA 3CKIB 2G9DA 1EQRA 1EOTA 4N9PA 4ZQ3A 3GTLB 2YYZA 4DV7L 2KCTA 5KYIA 2JA6B 3JAMi 3EFXD 3C3LA 3OMGA 3C1EA 1EZ8A 3N52A 2UXDQ 1G2SA 1YHBA 4ME5A 4O0AA 1LTBD 1MKHA 4E6IA 4X65Q 1Q81C 2IHEA 3J7YW 2A74C 2KHIA 1AW7A 1SE3A 3WOFA 1H95A 1CTMA 1EU3A 2KECA 2R7DA 1G6ZA 3F2CA 2UXBL 1JQYD 5H1SE 1VQ7A 2E76C 3SEBA 1HR0W 4DR6L 1SAPA 3I4OA 1I4HA 3OSOA 3AU7A 1X56A 2WAQG 1LT5D 2XN9C 5ELCA 2OQKA 1RHPA 1NR4A 2UU9L 1JCKB 2E5LL 3TEHB 3GTQB 1UEAB 4UP9A 1PMRA 4A3KB 3U9SA 4DNRB 3AEVA 5BR8Q 1QILA 1VQIA 2ZTDA 5JEAH 1SNOA 4L8JA 3T51B 1F9RA 3FRPB 5BN4A 1EOVA 2WP8J 1G91A 5DM63 3KF8A 4JI2L 4AQYQ 5CGKA 4KKTA 3E9IA 4ULLA 2VXWA 1KD1C 5T1IA 2ZXRA 2A6ED 4C2MB 1RODA 1BBXC 2B2VA 3FVQA 1JE4A 2EIFA 1C7YA 3V05A 2B8FA 1Z7TA 2VUMG 5JJIA 3K8AA 4C3JH 3A5UA 1E24A 3IL8A 1WTRA 1YIJA 2CWPA 3S17H 4MHEA 1Q12A 5M3MG 1QNUA 1JICA 3J81j 1K3RA 4RGOS 1XTCD 3HOUB 3HOYB 4NW2A 5LHY1 4R8IA 1YEZA 1VQEA 2ZXOA 4KD3A 2B63B 1KRTA 3ICEA 3A0JA 4ME3A 4QJFA 2WB1E 1E7ZA 1CZGA 4JI0Q 1BNZA 1G291 1J5EL 4POGA 2NVQH 4ZAIA 1BCPB 5E1FA 4IO9A 1UWVA 3EA6A 1TWAB 4H13C 4QMGA 3K7AH 1IBKL 5C4XG 1HUMA 1SMYC 1KLGD 1OXVA 1E3PA 1ZYRC 2E2HB 1QB5D 2E2IH 1WTOA 1K9MC 4JI3L 4WJWA 4PZ7A 3RLNA 1WD1A 3I4NG 5M3FB 4QF4A 1X3EA 4N8FA 1JOOA 3MXGA 1Y1WG 5EBDA 4EQ5A 2HDLA 3S1QB 2JA7B 1U4RA 1VQFA 3DWPA 4BY7G 2Y0SB 1II3A 4DR2Q 3C2PA 4BA1I 5I9OA 3R93A 4OL7A 1KL9A 2K52A 2NZ1D 4J1MA 1YI2A 4HTHA 3TS2A 3DUZA 4JI7Q 4HMJA 1D1KA 3TREA 4XTCS 1XNRQ 3R2TA 3WWVA 2K5VA 4LFBQ 4NMZA 3W2DA 3OIPA 1CM9A 5FLXL 1GD7A 2KOLA 1AZQA 4DXGA 1Q1BA 1B9MA 1D6EC 4JBJA 4GNXA 3HEJA 5IYCG 1Q90A 1HZAA 1OO9B 4R8NA 3T56B 1O7ZA 3A74A 1DOLA 4A3CG 1MD2D 2MFIA 4N8X1 5LMNW 3LWUA 1HNZQ 2PZUA 3EBEA 3TMEA 2CH4W 3V2TA 4IFDJ 1WTHA 5IWAQ 1U4PA 1NCVA 2IW3A 4LFCQ 5JPNC 5I9PA 1EYDA 1NNXA 1B8AA 2CHBD 1GUSA 5I6WA 2VUMH 2K5HA 2O2LD 3NBHA 3OW7A 4LJZC 1ENAA 4OX9L 1G2TA 4CGYB 4BY1H 4DR4Q 1K83B 4HJ9A 3K81C 2CW0C 5K5PA 4LMQD 2L1BA 2KBNA 1Y69U 2NVXH 5LL6X 1WD0A 2NN6G 4H0LC 3NK9A 4HEDA 2EYOA 1HTLD 1STAA 2PQAA 2SDFA 1UE5A 4B3TQ 4RGTA 1E2ZA 1NUCA 4DR1Q 1PFSA 2H4OA 3IKJA 1V1PA 1X3PA 1JB3A 1XMQL 1J8IA 1A3TA 2MPMA 4X6AH 3RUZA 5C4XH 1WCMB 4KHVA 4A93G 3H0GB 4UAIA 1SYFA 2K01A 4BS9A 3GTGB 4IFDG 2C9OA 3I4NH 4K6DA 1D8LA 1T9HA 1Z47A 1Y1WH 4C3IB 3S1MB 3KBGA 4LF4L 2EYJA 4DGZA 1FD7D 3NSWA 4BY7H 4F7XA 1BF4A 1RIPA 4HJAA 4K0KL 2GVBA 4RFBA 2YU9H 1TKWB 5A35A 5EBCA 1GUWA 1N36Q 5HGQA 4R4IA 2NUCA 2OTLA 3FDTA 1QZGA 5JAVA 4A75A 1EY6A 1IL2A 4LFAQ 3WOEA 2KQ3A 3CQZB
chains in the Genus database with same CATH topology
3U58A 5M3FH 2F3IA 2UUCQ 4OWWB 4KHPQ 3HOZG 2CKZB 2VQFL 4A3DG 3K0XA 3W1BA 4OX9Q 1YJ9A 3S1QH 2RHSB 2JA7H 4X62L 3BZCA 3L2PA 4A3LG 1CKNA 1S40A 5IYCH 5IE8A 1VQNA 1XMOQ 4DV4Q 1N32L 2PNHA 5FJ8G 4RMFA 1KHIA 3T1HL 4JI5Q 4JI4Q 4JYAQ 1L1OB 4HJ8A 2I5HA 4B3TL 4L5RC 3H3VH 4KI0A 4DR1L 3FP9A 2OWOA 2I0QA 2Y0SE 3PIOA 1N33L 2N49A 1JB7A 1Y1VG 3S1NH 4NXMQ 1QUQB 2R92G 5IYBH 2VW9A 1CKOA 2ZM6L 2JA6H 3HOVG 2Z6KC 3PCOB 2JK8A 4YCVA 4A3JG 1I5FA 1Q7YC 1JE5A 1UE6A 3CPFA 3KLWA 1NJIC 2NZOA 3MXNB 2V1CC 3D31A 4KHZA 3AYHB 3CF5A 4Y52H 1VQDA 2K50A 4A3FG 1L0WA 1PYBA 3S24A 4R4CA 5C3EG 4DR3L 1Q1EA 4DUZQ 4JOIC 1PH3A 2K75A 1YJNA 1OXTA 5M5YH 4GN5A 5LMUL 1OTCA 4P74A 4DV3L 4X64L 4YCUA 3J7A5 1UE1A 4JI1Q 1A0IA 4A3IH 4B3RQ 5IY0A 3UDIA 5GAGC 4LF4Q 3M4QA 1SLJA 1HR0Q 4X66Q 1TWCH 2ZTCA 3UDFA 1OXUA 5FLMG 4PG3A 4BXXG 1TWGH 1VQ8A 1N36L 2JQOA 1PH8A 1S72A 1WFQA 4TQUS 3CCSA 1ASYA 3UDGA 2K5NA 1VQ9A 4YWKA 1PV4A 1K73C 4MZ9A 1XPOA 1JMCA 4LFAL 1NBWA 3CW2C 1VQ6A 4XIGS 5IT9c 1SR3A 1V9PA 2OQ0A 2VS1A 3AFPA 4A3EH 4GKKQ 4KHPL 3PUVA 1BBWA 2QGQA 2B3GA 3GTPH 3HOXG 4HIOA 3UE1A 5IP7H 1K83H 4OO1I 1LTLA 2VQFQ 3GD7A 1U0LA 1GO3E 3ULLA 1P8LA 5M3MH 3F1ZA 1K0RA 4DV2Q 4A93H 4UY8C 1JJGA 1CSPA 1XMOL 1PH5A 1OXSC 3U4VA 4YY3Q 4AIMA 4JI5L 3UDXA 2ZJQA 4JYAL 4A3GG 1Y14B 3U4ZA 4C3HH 1YHQA 1VQ5A 4MNOA 1XPUA 2CCZA 1L1OA 3CCMA 3M4PA 4NXML 3GDEA 1VQCA 3HKZG 4OWXB 1VCIA 3W1GA 1TWHH 1PH1A 4AYBG 1N33Q 1A63A 1VQLA 3CC4A 1KRSA 4HJ7A 2A8VA 1QUQA 4GNXC 3G71A 4WJ3M 3S2DH 2ZM6Q 4LF5Q 3E0EA 1VQ4A 5JJLA 3M4OH 2KHJA 2F4VL 2MO1A 1N8RC 1I3QH 2BH2A 4P72A 1G51A 1WCMH 4DNIA 1UEBA 3CXCA 3H0GH 5GQOA 1FGUA 4JCVE 4DR5Q 3A5ZB 3HOWG 3GTGH 2GN5A 3F8TA 3FKIG 1GKHA 5J3BA 3CC7A 4DUZL 3ULJA 2NZHA 3S16H 3H15A 3OYYA 4JI1L 3HOZH 4HIMA 4LF9L 1SN8A 2QA4A 3S1MH 4A3DH 4B3RL 4DAMA 4GKJL 2CWAA 2LSSA 2NVYH 1HR0L 5JEAG 4X66L 1JT8A 3CAMA 4A3LH 3PUZA 3RLFA 4R4QA 4BY1G 3F2DA 4LF6Q 2MO0A 4UP8A 1C9OA 2F52A 3KF6B 3RLOA 2JA5G 3MEFA 2JA8G 5JJKA 4JBWA 1VQKA 4HIDA 4A3MG 5FJ8H 2ZJRA 4YWMA 4BBRG 3CMEA 1CUKA 2ES2A 1FL0A 3I2ZA 1SMXA 1Y1VH 1EWIA 4YHHQ 3DM3A 2R92H 1EQQA 3CQZH 4YCWA 2Z0SA 4GKKL 1VS0A 3K80C 4IPHA 3HOVH 2R7ZG 3BZKA 3E9HA 3ZJYC 3DLLA 4A3JH 4DR6Q 5C44H 4WJ4A 2OCEA 1GM5A 1VQGA 3FHWA 1MJCA 4BBSG 3I4MH 4Y7NH 4DV2L 1IYJB 3UE0A 1HH2P 4P73A 1K8GA 2WFWA 4BA2I 2PI2A 2MQHA 1PH7A 4KLKA 3GTKH 4YY3L 4A3FH 3W5OA 1NE3A 2UU9Q 3T1YQ 5C3EH 3RZOH 4QGUA 1P16A 1QVCA 4A3CH 3KJOA 1EYGA 1G6PA 2RF4A 1PH2A 2D0OA 1XNQL 2WB1G 3IRBA 1FJGQ 2IT1A 1ASZA 4PMWA 5C4JH 2QEXA 2E8GA 3PUYA 1M90C 1O7IA 3VDYA 4GOPC 4IJHA 4LF5L 5EAYA 4YWLA 5FLMH 4BXXH 2IX1A 5M5XH 3KF8B 3PSIA 3PO3G 2IX0A 3BJUA 2F4VQ 2VY3A 1RL2A 1PHJA 4DR5L 3HKSA 4JI2Q 4GN3B 1I50H 1JJ2A 2CQOA 1EUJA 2R93G 2YTXA 2C35B 1B70B 3CCQA 5IYDH 3M7NA 1EFWA 4APVA 1Z9FA 1U5KA 3HOXH 1EQRA 2HT1A 3KDFB 2YYZA 4LUVA 2R6GA 4DV7L 3I7FA 4LF9Q 2KCTA 4GKJQ 4P75A 3JAMi 4LF6L 2AHOB 4DAYB 5LMNQ 2N8NA 4DPGA 2UXDQ 1YHBA 1IBLQ 4DUYQ 4O0AA 1MKHA 1VQPA 2UUBL 1C0AA 3S2HH 4X65Q 1Q81C 2IHEA 3KF6A 2ASBA 1A8VA 4A3GH 2Q2TA 1X3GA 4L5QA 1SROA 2KHIA 1UE7A 1SE8A 2K14A 4RG1A 4YHHL 5JEAJ 4LF7L 2HQLA 1KC8C 2JEAI 2R7DA 1OXXK 1IBMQ 4PZ8A 4J15A 4TVAB 3F2CA 5H1SE 2UXBL 1QZHA 1VQ7A 1Q82C 1M1KC 1HR0W 3CMAA 4DR6L 4HJ5A 2UXCQ 2GVAA 3I4OA 1Q46A 3HKZE 4JBKA 2JA6G 1AH9A 1X56A 4AYBE 2WAQG 1V1QA 1Q8KA 2OQKA 3S14H 1D7QA 1X6OA 1VQHA 2UU9L 3T1YL 2K4KA 3KJPA 4OWTB 2E5LL 3FKIH 3J80i 1IBKQ 1EIFA 2H5XA 3S15H 3K7UC 3TEHB 2IY5B 1QVGA 2YTVA 2PI2E 4UP9A 3GTJH 3GO5A 1FJGL 4JC0A 4OXPA 3GTOH 3AEVA 4JI3Q 4IFDI 5BR8Q 1XNQQ 2ZTDA 1VQIA 4GLVB 5AJ3Q 1PH6A 1IZ6A 3PF5A 1Q86C 1EOVA 1W3SA 2WP8J 3L0OA 1VQOA 2JA5H 2VNUD 2JA8H 4IPDA 4DR2L 4JBMA 4QY7A 3STBD 3PUXA 5C0XI 4A3MH 4JI2L 4AQYQ 4BBRH 3E9IA 1KD1C 1YJWA 4JV5L 1CSQA 3BU2A 1KIXA 4R4OA 5DLQE 2ZJPA 2R7ZH 2EIFA 1C7YA 4OO1G 4A3KG 3GTMH 1PH9A 4C3IH 2CFMA 2AMCB 2VUMG 5JJIA 1V43A 2EXDA 2N78A 3K8AA 5LMNL 4C3JH 3A5UA 3KDFA 4DV7Q 3CCUA 4BBSH 2UXDL 3JC66 1IBLL 4DUYL 1E24A 1HJPA 1YVCA 1YIJA 4IJLA 2CWPA 4GNXB 4X65L 3ULPA 4LUOA 3S17H 3CCLA 4EX5A 3OTOQ 1Q12A 2Z6KA 5M3MG 2UUBQ 3J81j 3G48A 1K3RA 1W2BA 2JJQA 5ELOA 5GAHC 4JG2A 1I94L 1IBML 3JAMc 1BKBA 3M9BA 4DV0Q 1IXRA 2DGYA 2LXKA 4LF7Q 1PVOA 3I55A 1TXYA 1MIUA 4GS3A 1YEZA 1VQEA 1HNZL 2VQEQ 3S1RH 1KQSA 2UXCL 1KRTA 3ICEA 3Q8DA 1HNXQ 3PF4A 2UXBQ 2ZTEA 4JOIA 3A0JA 2RHQB 4GLAC 4ME3A 4QJFA 1VQMA 2WB1E 4DV6Q 1E7ZA 1HZCA 3PO3H 4JI0Q 1G291 4GN4B 1J5EL 4JI6Q 4POGA 5IWAL 2NVQH 4IO9A 4NPSA 1UWVA 2AWNA 3AQQA 5IP9G 1K8AC 3K7AH 1IBKL 5C4XG 1L1OC 4PZ6A 1SRUA 2R93H 3NELA 4DV1L 1XPRA 3M85A 2E5LQ 4DR7L 1OXVA 1E3PA 3PO2G 3G4SA 2E2IH 1LYLA 1K9MC 3NBHB 4JI3L 3PGZA 4IPCA 5BR8L 4PZ7A 3RLNA 4O2DA 5AJ3L 1QVFA 3I4NG 3HOUG 1X3EA 3HOYG 4DR4L 2EQSA 1Y1WG 1N34Q 4EQ5A 1VQJA 3SGIA 4NXNL 1S3OA 2B63G 3H3VI 3J80c 4P71A 1VQFA 4BY7G 3CCVA 1A62A 1KAWA 3J81i 4AQYL 2I5LX 1EIYB 4DR2Q 4BA1I 3ER0A 2YV5A 4JI8Q 2Q2UA 1PA6A 3G6EA 4DV5L 1KL9A 2K52A 1YITA 1YI2A 3TRZA 1TWFH 2PQAB 4JV5Q 1AE3A 3NENA 3D0FA 1WI5A 1WYDA 4LF8Q 3TS2A 1SFOH 3B6YA 4JI7Q 4A3BG 5E7NA 1YHAA 1X9NA 4UPAA 1LM0A 3CCRA 3GTLH 3TREA 3TQYA 5M3FG 4XTCS 1XNRQ 3WWVA 2HHHL 1XJVA 4LWCA 2D0PA 2K5VA 4LFBQ 2UUAQ 4IOCA 2ATWA 3AFQA 4GOPB 1GD7A 2XTIA 3STBC 5C44G 2JA7G 1XMQQ 3OTOL 3I4MG 1Q1BA 4JBJA 4GNXA 5IYCG 2Y0SG 1N9WA 2WAQE 1GVPA 1BBUA 1HZAA 2AKWB 2NN6I 4L5TA 4B3SL 3M3YH 4DV0L 3A74A 1I94Q 1YNXA 2VL6A 4A3CG 1HNWQ 3J7ZC 4POFA 3CPWA 2VQEL 2B29A 2MFIA 2JE6I 1YBYA 4UP7A 5LMNW 1HNXL 4L5SA 5GAEC 1HNZQ 4NB3A 3EBEA 1PH4A 4DV6L 1XTDA 2KENA 5IYBG 2DUDA 5FLXc 4JI0L 4JI6L 3NEMA 4DKAC 1R9TH 4IFDJ 3KFUA 4IPGA 4B3MQ 1J5EQ 1J6QA 4A76A 5IWAQ 4R1JA 4K0KQ 2ALYB 2KCMA 1NMGA 2I5MX 4OONA 3HOWH 4LFCQ 1I6HH 1CKMA 2VUMH 4DV1Q 3GTQH 1WOCA 4DR7Q 5C0XJ 1E1TA 1NMFA 4A3KH 2JA9A 1B8AA 2UUCL 1NTGA 1WJJA 2K5HA 3RNUA 3OW2A 5IYDG 1E22A 4H02A 1N34L 4GLXA 2IHFA 3PIPA 4OX9L 4QIWE 3KYHC 4ALPA 4BY1H 4DR4Q 1VQBA 4HJ9A 1PYSB 3K81C 4A3IG 1CKNB 4NXNQ 2Q2IA 4LW1A 3RZDH 1HZ9A 2AWOA 3LGJA 4R4TA 3U50C 2KBNA 4X62Q 5ELNA 2NVXH 3CD6A 4JI8L 2NN6G 2L15A 1X3FA 1B7YB 3F2BA 4DV4L 4QQBX 2OTJA 2A19A 2BA1A 1KXLA 4JI4L 4DV5Q 1N32Q 4C2MH 4LF8L 4JI7L 2PMZE 3T1HQ 2PQAA 4B3TQ 1UE5A 4DR1Q 2LXJA 4AH6A 3RR5A 3J81c 1XNRL 2RCNA 4A3EG 1FVIA 1PFSA 4LFBL 2UUAL 1X54A 3CC2A 1VQAA 2ID0A 3CP0A 2HHHQ 4A4IA 1XMQL 4QL5A 2VZAA 5IP7G 3CCEA 2YTYA 4FDBA 4X6AH 5IP9H 1HZBA 2BH8A 2XGTA 5C4XH 4HIKA 4GOPA 3TS0A 2NVTH 2HIXA 3ERSX 4A93G 1JJCB 1E1OA 3RN2A 3RN5A 5M5WH 3PO2H 4IFDG 1HNWL 1L2FA 4IOAA 1H95A 4B3SQ 3KOJA 5GADC 3I4NH 3HOUH 3EN2A 1BVSA 1D8LA 1T9HA 4DR3Q 3HOYH 1AE2A 2D62A 1Z47A 2BA0A 1Y1WH 3L7ZC 3HFZB 5LMUQ 2N3SA 2B63H 1DGSA 2FXQA 2Q2HA 3EIVA 4LUZA 4DV3Q 4X64Q 4LF4L 2HIVA 4BY7H 5C0XG 3I56A 1LUZA 1NY4A 1RIPA 1X55A 2R7FA 2MNAA 1MJEA 4HJAA 4B3ML 2A1AA 4K0KL 2GVBA 3CCJA 2YU9H 5GROA 4MTNA 1TWAH 5HGQA 1N36Q 1X65A 4LFCL 4R4IA 4DK6C 1WCMG 2OTLA 5HY6A 3PUWA 2E2JH 1QZGA 5K36G 4DK3C 2JEBI 3H0GG 4A75A 1YZ6A 2E2HH 4A3BH 1IL2A 4LNQA 4LFAQ 3PV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U58 A;  5M3F H;  2F3I A;  2UUC Q;  4OWW B;  4KHP Q;  3HOZ G;  2CKZ B;  2VQF L;  4A3D G;  3K0X A;  3W1B A;  4OX9 Q;  1YJ9 A;  3S1Q H;  2RHS B;  2JA7 H;  4X62 L;  3BZC A;  3L2P A;  4A3L G;  1CKN A;  1S40 A;  5IYC H;  5IE8 A;  1VQN A;  1XMO Q;  4DV4 Q;  1N32 L;  2PNH A;  5FJ8 G;  4RMF A;  1KHI A;  3T1H L;  4JI5 Q;  4JI4 Q;  4JYA Q;  1L1O B;  4HJ8 A;  2I5H A;  4B3T L;  4L5R C;  3H3V H;  4KI0 A;  4DR1 L;  3FP9 A;  2OWO A;  2I0Q A;  2Y0S E;  3PIO A;  1N33 L;  2N49 A;  1JB7 A;  1Y1V G;  3S1N H;  4NXM Q;  1QUQ B;  2R92 G;  5IYB H;  2VW9 A;  1CKO A;  2ZM6 L;  2JA6 H;  3HOV G;  2Z6K C;  3PCO B;  2JK8 A;  4YCV A;  4A3J G;  1I5F A;  1Q7Y C;  1JE5 A;  1UE6 A;  3CPF A;  3KLW A;  1NJI C;  2NZO A;  3MXN B;  2V1C C;  3D31 A;  4KHZ A;  3AYH B;  3CF5 A;  4Y52 H;  1VQD A;  2K50 A;  4A3F G;  1L0W A;  1PYB A;  3S24 A;  4R4C A;  5C3E G;  4DR3 L;  1Q1E A;  4DUZ Q;  4JOI C;  1PH3 A;  2K75 A;  1YJN A;  1OXT A;  5M5Y H;  4GN5 A;  5LMU L;  1OTC A;  4P74 A;  4DV3 L;  4X64 L;  4YCU A;  3J7A 5;  1UE1 A;  4JI1 Q;  1A0I A;  4A3I H;  4B3R Q;  5IY0 A;  3UDI A;  5GAG C;  4LF4 Q;  3M4Q A;  1SLJ A;  1HR0 Q;  4X66 Q;  1TWC H;  2ZTC A;  3UDF A;  1OXU A;  5FLM G;  4PG3 A;  4BXX G;  1TWG H;  1VQ8 A;  1N36 L;  2JQO A;  1PH8 A;  1S72 A;  1WFQ A;  4TQU S;  3CCS A;  1ASY A;  3UDG A;  2K5N A;  1VQ9 A;  4YWK A;  1PV4 A;  1K73 C;  4MZ9 A;  1XPO A;  1JMC A;  4LFA L;  1NBW A;  3CW2 C;  1VQ6 A;  4XIG S;  5IT9 c;  1SR3 A;  1V9P A;  2OQ0 A;  2VS1 A;  3AFP A;  4A3E H;  4GKK Q;  4KHP L;  3PUV A;  1BBW A;  2QGQ A;  2B3G A;  3GTP H;  3HOX G;  4HIO A;  3UE1 A;  5IP7 H;  1K83 H;  4OO1 I;  1LTL A;  2VQF Q;  3GD7 A;  1U0L A;  1GO3 E;  3ULL A;  1P8L A;  5M3M H;  3F1Z A;  1K0R A;  4DV2 Q;  4A93 H;  4UY8 C;  1JJG A;  1CSP A;  1XMO L;  1PH5 A;  1OXS C;  3U4V A;  4YY3 Q;  4AIM A;  4JI5 L;  3UDX A;  2ZJQ A;  4JYA L;  4A3G G;  1Y14 B;  3U4Z A;  4C3H H;  1YHQ A;  1VQ5 A;  4MNO A;  1XPU A;  2CCZ A;  1L1O A;  3CCM A;  3M4P A;  4NXM L;  3GDE A;  1VQC A;  3HKZ G;  4OWX B;  1VCI A;  3W1G A;  1TWH H;  1PH1 A;  4AYB G;  1N33 Q;  1A63 A;  1VQL A;  3CC4 A;  1KRS A;  4HJ7 A;  2A8V A;  1QUQ A;  4GNX C;  3G71 A;  4WJ3 M;  3S2D H;  2ZM6 Q;  4LF5 Q;  3E0E A;  1VQ4 A;  5JJL A;  3M4O H;  2KHJ A;  2F4V L;  2MO1 A;  1N8R C;  1I3Q H;  2BH2 A;  4P72 A;  1G51 A;  1WCM H;  4DNI A;  1UEB A;  3CXC A;  3H0G H;  5GQO A;  1FGU A;  4JCV E;  4DR5 Q;  3A5Z B;  3HOW G;  3GTG H;  2GN5 A;  3F8T A;  3FKI G;  1GKH A;  5J3B A;  3CC7 A;  4DUZ L;  3ULJ A;  2NZH A;  3S16 H;  3H15 A;  3OYY A;  4JI1 L;  3HOZ H;  4HIM A;  4LF9 L;  1SN8 A;  2QA4 A;  3S1M H;  4A3D H;  4B3R L;  4DAM A;  4GKJ L;  2CWA A;  2LSS A;  2NVY H;  1HR0 L;  5JEA G;  4X66 L;  1JT8 A;  3CAM A;  4A3L H;  3PUZ A;  3RLF A;  4R4Q A;  4BY1 G;  3F2D A;  4LF6 Q;  2MO0 A;  4UP8 A;  1C9O A;  2F52 A;  3KF6 B;  3RLO A;  2JA5 G;  3MEF A;  2JA8 G;  5JJK A;  4JBW A;  1VQK A;  4HID A;  4A3M G;  5FJ8 H;  2ZJR A;  4YWM A;  4BBR G;  3CME A;  1CUK A;  2ES2 A;  1FL0 A;  3I2Z A;  1SMX A;  1Y1V H;  1EWI A;  4YHH Q;  3DM3 A;  2R92 H;  1EQQ A;  3CQZ H;  4YCW A;  2Z0S A;  4GKK L;  1VS0 A;  3K80 C;  4IPH A;  3HOV H;  2R7Z G;  3BZK A;  3E9H A;  3ZJY C;  3DLL A;  4A3J H;  4DR6 Q;  5C44 H;  4WJ4 A;  2OCE A;  1GM5 A;  1VQG A;  3FHW A;  1MJC A;  4BBS G;  3I4M H;  4Y7N H;  4DV2 L;  1IYJ B;  3UE0 A;  1HH2 P;  4P73 A;  1K8G A;  2WFW A;  4BA2 I;  2PI2 A;  2MQH A;  1PH7 A;  4KLK A;  3GTK H;  4YY3 L;  4A3F H;  3W5O A;  1NE3 A;  2UU9 Q;  3T1Y Q;  5C3E H;  3RZO H;  4QGU A;  1P16 A;  1QVC A;  4A3C H;  3KJO A;  1EYG A;  1G6P A;  2RF4 A;  1PH2 A;  2D0O A;  1XNQ L;  2WB1 G;  3IRB A;  1FJG Q;  2IT1 A;  1ASZ A;  4PMW A;  5C4J H;  2QEX A;  2E8G A;  3PUY A;  1M90 C;  1O7I A;  3VDY A;  4GOP C;  4IJH A;  4LF5 L;  5EAY A;  4YWL A;  5FLM H;  4BXX H;  2IX1 A;  5M5X H;  3KF8 B;  3PSI A;  3PO3 G;  2IX0 A;  3BJU A;  2F4V Q;  2VY3 A;  1RL2 A;  1PHJ A;  4DR5 L;  3HKS A;  4JI2 Q;  4GN3 B;  1I50 H;  1JJ2 A;  2CQO A;  1EUJ A;  2R93 G;  2YTX A;  2C35 B;  1B70 B;  3CCQ A;  5IYD H;  3M7N A;  1EFW A;  4APV A;  1Z9F A;  1U5K A;  3HOX H;  1EQR A;  2HT1 A;  3KDF B;  2YYZ A;  4LUV A;  2R6G A;  4DV7 L;  3I7F A;  4LF9 Q;  2KCT A;  4GKJ Q;  4P75 A;  3JAM i;  4LF6 L;  2AHO B;  4DAY B;  5LMN Q;  2N8N A;  4DPG A;  2UXD Q;  1YHB A;  1IBL Q;  4DUY Q;  4O0A A;  1MKH A;  1VQP A;  2UUB L;  1C0A A;  3S2H H;  4X65 Q;  1Q81 C;  2IHE A;  3KF6 A;  2ASB A;  1A8V A;  4A3G H;  2Q2T A;  1X3G A;  4L5Q A;  1SRO A;  2KHI A;  1UE7 A;  1SE8 A;  2K14 A;  4RG1 A;  4YHH L;  5JEA J;  4LF7 L;  2HQL A;  1KC8 C;  2JEA I;  2R7D A;  1OXX K;  1IBM Q;  4PZ8 A;  4J15 A;  4TVA B;  3F2C A;  5H1S E;  2UXB L;  1QZH A;  1VQ7 A;  1Q82 C;  1M1K C;  1HR0 W;  3CMA A;  4DR6 L;  4HJ5 A;  2UXC Q;  2GVA A;  3I4O A;  1Q46 A;  3HKZ E;  4JBK A;  2JA6 G;  1AH9 A;  1X56 A;  4AYB E;  2WAQ G;  1V1Q A;  1Q8K A;  2OQK A;  3S14 H;  1D7Q A;  1X6O A;  1VQH A;  2UU9 L;  3T1Y L;  2K4K A;  3KJP A;  4OWT B;  2E5L L;  3FKI H;  3J80 i;  1IBK Q;  1EIF A;  2H5X A;  3S15 H;  3K7U C;  3TEH B;  2IY5 B;  1QVG A;  2YTV A;  2PI2 E;  4UP9 A;  3GTJ H;  3GO5 A;  1FJG L;  4JC0 A;  4OXP A;  3GTO H;  3AEV A;  4JI3 Q;  4IFD I;  5BR8 Q;  1XNQ Q;  2ZTD A;  1VQI A;  4GLV B;  5AJ3 Q;  1PH6 A;  1IZ6 A;  3PF5 A;  1Q86 C;  1EOV A;  1W3S A;  2WP8 J;  3L0O A;  1VQO A;  2JA5 H;  2VNU D;  2JA8 H;  4IPD A;  4DR2 L;  4JBM A;  4QY7 A;  3STB D;  3PUX A;  5C0X I;  4A3M H;  4JI2 L;  4AQY Q;  4BBR H;  3E9I A;  1KD1 C;  1YJW A;  4JV5 L;  1CSQ A;  3BU2 A;  1KIX A;  4R4O A;  5DLQ E;  2ZJP A;  2R7Z H;  2EIF A;  1C7Y A;  4OO1 G;  4A3K G;  3GTM H;  1PH9 A;  4C3I H;  2CFM A;  2AMC B;  2VUM G;  5JJI A;  1V43 A;  2EXD A;  2N78 A;  3K8A A;  5LMN L;  4C3J H;  3A5U A;  3KDF A;  4DV7 Q;  3CCU A;  4BBS H;  2UXD L;  3JC6 6;  1IBL L;  4DUY L;  1E24 A;  1HJP A;  1YVC A;  1YIJ A;  4IJL A;  2CWP A;  4GNX B;  4X65 L;  3ULP A;  4LUO A;  3S17 H;  3CCL A;  4EX5 A;  3OTO Q;  1Q12 A;  2Z6K A;  5M3M G;  2UUB Q;  3J81 j;  3G48 A;  1K3R A;  1W2B A;  2JJQ A;  5ELO A;  5GAH C;  4JG2 A;  1I94 L;  1IBM L;  3JAM c;  1BKB A;  3M9B A;  4DV0 Q;  1IXR A;  2DGY A;  2LXK A;  4LF7 Q;  1PVO A;  3I55 A;  1TXY A;  1MIU A;  4GS3 A;  1YEZ A;  1VQE A;  1HNZ L;  2VQE Q;  3S1R H;  1KQS A;  2UXC L;  1KRT A;  3ICE A;  3Q8D A;  1HNX Q;  3PF4 A;  2UXB Q;  2ZTE A;  4JOI A;  3A0J A;  2RHQ B;  4GLA C;  4ME3 A;  4QJF A;  1VQM A;  2WB1 E;  4DV6 Q;  1E7Z A;  1HZC A;  3PO3 H;  4JI0 Q;  1G29 1;  4GN4 B;  1J5E L;  4JI6 Q;  4POG A;  5IWA L;  2NVQ H;  4IO9 A;  4NPS A;  1UWV A;  2AWN A;  3AQQ A;  5IP9 G;  1K8A C;  3K7A H;  1IBK L;  5C4X G;  1L1O C;  4PZ6 A;  1SRU A;  2R93 H;  3NEL A;  4DV1 L;  1XPR A;  3M85 A;  2E5L Q;  4DR7 L;  1OXV A;  1E3P A;  3PO2 G;  3G4S A;  2E2I H;  1LYL A;  1K9M C;  3NBH B;  4JI3 L;  3PGZ A;  4IPC A;  5BR8 L;  4PZ7 A;  3RLN A;  4O2D A;  5AJ3 L;  1QVF A;  3I4N G;  3HOU G;  1X3E A;  3HOY G;  4DR4 L;  2EQS A;  1Y1W G;  1N34 Q;  4EQ5 A;  1VQJ A;  3SGI A;  4NXN L;  1S3O A;  2B63 G;  3H3V I;  3J80 c;  4P71 A;  1VQF A;  4BY7 G;  3CCV A;  1A62 A;  1KAW A;  3J81 i;  4AQY L;  2I5L X;  1EIY B;  4DR2 Q;  4BA1 I;  3ER0 A;  2YV5 A;  4JI8 Q;  2Q2U A;  1PA6 A;  3G6E A;  4DV5 L;  1KL9 A;  2K52 A;  1YIT A;  1YI2 A;  3TRZ A;  1TWF H;  2PQA B;  4JV5 Q;  1AE3 A;  3NEN A;  3D0F A;  1WI5 A;  1WYD A;  4LF8 Q;  3TS2 A;  1SFO H;  3B6Y A;  4JI7 Q;  4A3B G;  5E7N A;  1YHA A;  1X9N A;  4UPA A;  1LM0 A;  3CCR A;  3GTL H;  3TRE A;  3TQY A;  5M3F G;  4XTC S;  1XNR Q;  3WWV A;  2HHH L;  1XJV A;  4LWC A;  2D0P A;  2K5V A;  4LFB Q;  2UUA Q;  4IOC A;  2ATW A;  3AFQ A;  4GOP B;  1GD7 A;  2XTI A;  3STB C;  5C44 G;  2JA7 G;  1XMQ Q;  3OTO L;  3I4M G;  1Q1B A;  4JBJ A;  4GNX A;  5IYC G;  2Y0S G;  1N9W A;  2WAQ E;  1GVP A;  1BBU A;  1HZA A;  2AKW B;  2NN6 I;  4L5T A;  4B3S L;  3M3Y H;  4DV0 L;  3A74 A;  1I94 Q;  1YNX A;  2VL6 A;  4A3C G;  1HNW Q;  3J7Z C;  4POF A;  3CPW A;  2VQE L;  2B29 A;  2MFI A;  2JE6 I;  1YBY A;  4UP7 A;  5LMN W;  1HNX L;  4L5S A;  5GAE C;  1HNZ Q;  4NB3 A;  3EBE A;  1PH4 A;  4DV6 L;  1XTD A;  2KEN A;  5IYB G;  2DUD A;  5FLX c;  4JI0 L;  4JI6 L;  3NEM A;  4DKA C;  1R9T H;  4IFD J;  3KFU A;  4IPG A;  4B3M Q;  1J5E Q;  1J6Q A;  4A76 A;  5IWA Q;  4R1J A;  4K0K Q;  2ALY B;  2KCM A;  1NMG A;  2I5M X;  4OON A;  3HOW H;  4LFC Q;  1I6H H;  1CKM A;  2VUM H;  4DV1 Q;  3GTQ H;  1WOC A;  4DR7 Q;  5C0X J;  1E1T A;  1NMF A;  4A3K H;  2JA9 A;  1B8A A;  2UUC L;  1NTG A;  1WJJ A;  2K5H A;  3RNU A;  3OW2 A;  5IYD G;  1E22 A;  4H02 A;  1N34 L;  4GLX A;  2IHF A;  3PIP A;  4OX9 L;  4QIW E;  3KYH C;  4ALP A;  4BY1 H;  4DR4 Q;  1VQB A;  4HJ9 A;  1PYS B;  3K81 C;  4A3I G;  1CKN B;  4NXN Q;  2Q2I A;  4LW1 A;  3RZD H;  1HZ9 A;  2AWO A;  3LGJ A;  4R4T A;  3U50 C;  2KBN A;  4X62 Q;  5ELN A;  2NVX H;  3CD6 A;  4JI8 L;  2NN6 G;  2L15 A;  1X3F A;  1B7Y B;  3F2B A;  4DV4 L;  4QQB X;  2OTJ A;  2A19 A;  2BA1 A;  1KXL A;  4JI4 L;  4DV5 Q;  1N32 Q;  4C2M H;  4LF8 L;  4JI7 L;  2PMZ E;  3T1H Q;  2PQA A;  4B3T Q;  1UE5 A;  4DR1 Q;  2LXJ A;  4AH6 A;  3RR5 A;  3J81 c;  1XNR L;  2RCN A;  4A3E G;  1FVI A;  1PFS A;  4LFB L;  2UUA L;  1X54 A;  3CC2 A;  1VQA A;  2ID0 A;  3CP0 A;  2HHH Q;  4A4I A;  1XMQ L;  4QL5 A;  2VZA A;  5IP7 G;  3CCE A;  2YTY A;  4FDB A;  4X6A H;  5IP9 H;  1HZB A;  2BH8 A;  2XGT A;  5C4X H;  4HIK A;  4GOP A;  3TS0 A;  2NVT H;  2HIX A;  3ERS X;  4A93 G;  1JJC B;  1E1O A;  3RN2 A;  3RN5 A;  5M5W H;  3PO2 H;  4IFD G;  1HNW L;  1L2F A;  4IOA A;  1H95 A;  4B3S Q;  3KOJ A;  5GAD C;  3I4N H;  3HOU H;  3EN2 A;  1BVS A;  1D8L A;  1T9H A;  4DR3 Q;  3HOY H;  1AE2 A;  2D62 A;  1Z47 A;  2BA0 A;  1Y1W H;  3L7Z C;  3HFZ B;  5LMU Q;  2N3S A;  2B63 H;  1DGS A;  2FXQ A;  2Q2H A;  3EIV A;  4LUZ A;  4DV3 Q;  4X64 Q;  4LF4 L;  2HIV A;  4BY7 H;  5C0X G;  3I56 A;  1LUZ A;  1NY4 A;  1RIP A;  1X55 A;  2R7F A;  2MNA A;  1MJE A;  4HJA A;  4B3M L;  2A1A A;  4K0K L;  2GVB A;  3CCJ A;  2YU9 H;  5GRO A;  4MTN A;  1TWA H;  5HGQ A;  1N36 Q;  1X65 A;  4LFC L;  4R4I A;  4DK6 C;  1WCM G;  2OTL A;  5HY6 A;  3PUW A;  2E2J H;  1QZG A;  5K36 G;  4DK3 C;  2JEB I;  3H0G G;  4A75 A;  1YZ6 A;  2E2H H;  4A3B H;  1IL2 A;  4LNQ A;  4LFA Q;  3PV0 A; 
#chains in the Genus database with same CATH topology
 4F87 A;  5ISR A;  4KHP Q;  3HOZ G;  4A3D G;  2VQF L;  1B53 A;  1XX8 A;  1TS4 A;  1S40 A;  5IYC H;  2B2V C;  1N32 L;  5C3E B;  2PNH A;  5FJ8 G;  1KHI A;  3T1H L;  4JI4 Q;  1FNU A;  4KI0 A;  2EPB A;  3X3M A;  2I0Q A;  4HCS A;  3PIO A;  1JOK A;  5ELE A;  3HRZ C;  1QUQ B;  1CKO A;  4EQO A;  5HGT A;  1SE2 A;  2JK8 A;  5KIX A;  1DYQ A;  2QF7 A;  4RA8 A;  4B08 A;  2EY5 A;  3D31 A;  3AYH B;  2OEO A;  4A3F G;  3K57 A;  1L0W A;  3MFG A;  1BDO A;  4DUZ Q;  2EY6 A;  5EPK A;  1UNS A;  5LMU L;  1OTC A;  3R3O A;  1PDQ A;  2F03 A;  2NTS A;  2MGS A;  1B2T A;  2K32 A;  2RBM A;  5GAG C;  2A68 C;  1SLJ A;  4G4K A;  4RGN A;  1SE4 A;  2NN6 H;  2JQO A;  3S2H B;  1FNW A;  4QUC A;  1F9Q A;  1PTO F;  1WFQ A;  4NKL A;  4TQU S;  4U67 3;  3CCS A;  1VQ9 A;  1HUN A;  3V96 A;  1K73 C;  1JMC A;  5CV6 A;  2IWH A;  5IGC A;  1V9P A;  2VS1 A;  3AFP A;  3PUV A;  3GTP H;  3HOX G;  1B50 A;  3J7A F;  5FKA C;  3GD7 A;  2BE5 C;  3ULL A;  1NAP A;  2F3V A;  3F1Z A;  4A93 H;  1GUN A;  4DV2 Q;  3QJY A;  1SNC A;  1XMO L;  1SYD A;  1OXS C;  3BVZ A;  4NP5 A;  3HOW B;  1Q8I A;  2B2U A;  3SXH A;  4YY3 Q;  4IFD H;  1SYB A;  4IZ8 A;  3UDX A;  2ZJQ A;  3U4Z A;  3GTJ B;  3BDO A;  4MNO A;  3L9A X;  1XPU A;  3GTO B;  3C46 A;  2ICI A;  4NXM L;  4OWX B;  1PH1 A;  1N33 Q;  4AYB G;  1VQL A;  1ZKO A;  4GNX C;  3S2D H;  3D6C A;  2KUM A;  4H7B A;  4P72 A;  1G51 A;  4DNI A;  1S5C D;  4JCV E;  2SNS A;  3A5Z B;  3FKI G;  3CC7 A;  2Z9H A;  3OHX C;  3AMU A;  3GTM B;  1H9K A;  3HOZ H;  1STY A;  4A3D H;  1SN8 A;  1JWS D;  4DAM A;  2CWA A;  1HR0 L;  2FMM A;  4BBS B;  3CAM A;  4LF6 Q;  2MHV A;  2MO0 A;  4UP8 A;  3KF6 B;  2L5T A;  2JA5 G;  4IUR A;  3MEF A;  1LV9 A;  3D6W A;  4A3M G;  5FJ8 H;  4BBR G;  3CME A;  5FOB B;  3I2Z A;  2WB1 B;  1SNM A;  2C5C A;  3DM3 A;  5TSS A;  2KCC A;  1XWE A;  4IPH A;  2R7Z G;  3K6O A;  3BZK A;  3A55 A;  3DEP A;  2FIN B;  4WJ4 A;  1STH A;  5C44 H;  2OCE A;  1GM5 A;  2F0N A;  1A2U A;  3BVM A;  5COY A;  1CHQ D;  1L0X B;  1IYJ B;  4JVZ A;  4KKS A;  2HUG A;  3I3C A;  4A3F H;  2R93 B;  4HR7 B;  1SEB D;  2MJ8 A;  4CKB A;  3A54 A;  1IW7 D;  1AZP A;  3KJO A;  3GP7 A;  1EYG A;  3NE5 B;  4PMW A;  5C4J H;  3VDY A;  2WKC A;  2HD3 A;  4RH6 A;  5M5X H;  2PCF B;  4V0B A;  3BJU A;  4FNF A;  5M9O A;  1PRT C;  2F0L A;  2VY3 A;  4DR5 L;  3HKS A;  2FFK B;  1B3Q A;  1PXU A;  3I72 A;  1I50 H;  1O7L A;  1TWF B;  4TRD A;  2PO4 A;  1B70 B;  1H9M A;  1VDZ A;  1SFO B;  1EWH A;  1M8A A;  5BN3 A;  3HOX H;  1ZEQ X;  4LF9 Q;  5IOC A;  2JN4 A;  2AHO B;  4DAY B;  3A8J E;  2N8N A;  3NHH A;  3F2U A;  1C0A A;  1ILP A;  1LT4 D;  1MSG A;  2WIN B;  1SRO A;  2EYL A;  1SMY D;  2ICE C;  1V8Q A;  2XWJ B;  4RG1 A;  4YHH L;  5JEA J;  2HQL A;  1OXX K;  1NR2 A;  4J15 A;  1D5M C;  5DNF A;  1K3B C;  2M9V A;  1T5X D;  3CMA A;  5EQ0 A;  2UXC Q;  1Y8O B;  2F0J A;  2JA6 G;  1XXG A;  1BO0 A;  3S14 H;  2K4K A;  4KY6 A;  4ODG A;  3FKI H;  5KRU A;  3J80 i;  2IY5 B;  1PTO H;  3OIQ A;  2I07 B;  3GO5 A;  4JC0 A;  3Q0A A;  2F0U A;  4LAA A;  3MEH A;  4IFD I;  3EQL C;  4KD4 A;  5EKK A;  4C56 C;  1IZ6 A;  1Q86 C;  2QDL A;  4XYQ A;  1F2M A;  1SNQ A;  3RZD B;  2JA5 H;  4JBM A;  4DR2 L;  4QY7 A;  3URY A;  1EYA A;  3PUX A;  4A3M H;  3OOC A;  4X3S A;  4BBR H;  1GOZ A;  1SND A;  3IAY A;  5CBA E;  1CSQ A;  2F0S A;  4C3H B;  1HXY D;  2QW7 A;  2LKV A;  4CJ1 B;  2R7Z H;  2D5D A;  4OO1 G;  4A3K G;  2F0E A;  4DK1 A;  1PH9 A;  1K8O A;  2CFM A;  4TKO B;  2N78 A;  4FF3 A;  5KEE A;  5LMN L;  3SVM A;  1IBL L;  2N88 A;  4DUY L;  1HJP A;  1BCP F;  1YVC A;  3NWS A;  1TS2 A;  3NXW A;  3PIP 3;  1E2W A;  2B2W A;  2NVT B;  1DXM A;  1VMP A;  2XNA C;  5M5W B;  3PO2 B;  5ELO A;  2Z4I A;  4JG2 A;  1IBM L;  1A3U A;  3FPU B;  3JAM c;  1BKB A;  3VR3 A;  4DV0 Q;  4O42 A;  3I55 A;  1TXY A;  1MIU A;  4GS3 A;  1HNZ L;  2ZTE A;  4JOI A;  2KCN A;  1STN A;  3RMH A;  2B2U C;  4JI6 Q;  5IWA L;  2CW0 D;  4NPS A;  2AWN A;  3KLS A;  1K8A C;  2R3Z A;  4PZ6 A;  1SRU A;  5CV9 A;  4H44 C;  4A3B B;  3PGZ A;  4IPC A;  5AJ3 L;  3S9W A;  3HOU G;  3HOY G;  2EY1 A;  4DR4 L;  2EQS A;  1N34 Q;  4KMU C;  1S3O A;  2B63 G;  4G57 A;  4P71 A;  2L9H A;  3I4M B;  3CCV A;  1NSN S;  1KAW A;  2WKD A;  1BOS A;  2P5Z X;  2Q2U A;  2YV5 A;  4JI8 Q;  2X6L A;  2ENB A;  2QEJ C;  2Z6B A;  5C4Z A;  1JC7 A;  4JV5 Q;  1C8C A;  3NEN A;  2PQE A;  3DMU A;  3S1N B;  1YHA A;  1X9N A;  1I4Q A;  3CCR A;  3GTL H;  5M3F G;  3DXJ C;  3Q6S A;  2K33 A;  4LWC A;  2ATW A;  1KNE A;  5C6A A;  3HGB A;  2JA7 G;  1MBY A;  3OTO L;  3SK5 A;  5EGT A;  2Y0S G;  2PNR C;  1N9W A;  1SDF A;  1STB A;  5JOB A;  3M3Y H;  4L5T A;  4CKC A;  1YNX A;  2VL6 A;  5G3L D;  1UAP A;  5M5Y B;  2VQE L;  2A69 C;  1HNX L;  4L5S A;  3QO2 A;  4NB3 A;  4A3I B;  1PH4 A;  4DV6 L;  1XTD A;  2KEN A;  2DUD A;  3KFU A;  4B3M Q;  2TSS A;  2ALY B;  2KCM A;  1PTO C;  3ND8 A;  1NMG A;  4JK1 C;  3QG1 A;  3GTQ H;  1AFP A;  1LTG D;  1WOC A;  4KY7 A;  4DR7 Q;  4OO1 H;  4XQQ A;  4A3K H;  2JA9 A;  3T13 A;  2EY2 A;  4A3E B;  4PV1 C;  4H02 A;  1IHZ A;  4GLX A;  4ALP A;  3KYH C;  2G5D A;  1O78 A;  5HUR A;  2MUY A;  1C4Q A;  1CKN B;  2Q2I A;  3NQI A;  1VMC A;  4R4T A;  2PW5 A;  3CD6 A;  1TR5 A;  3LNN A;  4XYO A;  1X3F A;  4UDU C;  3L3O C;  4JI4 L;  4FP5 D;  3VR6 A;  4C2M H;  4LF8 L;  3HZX A;  2F0O A;  2CQA A;  1CI3 M;  2LXJ A;  4AH6 A;  3RR5 A;  2UUA L;  1X54 A;  4TSS A;  3CP0 A;  2HHH Q;  1V1O A;  4QL5 A;  2A68 D;  2YTY A;  3CCE A;  2K28 A;  2XSC A;  2XGT A;  4HIK A;  3BDC A;  5COR A;  1JJC B;  1QOH A;  2QCP X;  2CVR A;  3MXN A;  5A2Q E;  3RN2 A;  1YNJ C;  4RKL A;  1HNW L;  5KND A;  4B3S Q;  3KOJ A;  5GAD C;  3HOU H;  4DR3 Q;  5A2Q L;  3S16 B;  3HOY H;  4FXG C;  1AE2 A;  2D62 A;  3HFZ B;  2B63 H;  4DV3 Q;  2Q2H A;  5J39 A;  4X64 Q;  4CJ2 C;  2HIV A;  1VF7 A;  3AB9 A;  4OIJ A;  2A1A A;  4FF4 A;  1GHJ A;  2BE5 D;  3S17 B;  1TWA H;  4I7A A;  3ONA B;  1WCM G;  5K36 G;  2EVB A;  4G7H C;  2JEB I;  3H0G G;  5IGG A;  2E2H H;  1SXT A;  3X3N A;  5M3F H;  4KJN A;  1CA5 A;  2UUC Q;  3HOV B;  3EJI A;  1STG A;  4C3I G;  3K0X A;  5CR3 A;  1TY0 A;  3IFT A;  3IFD A;  3S1Q H;  2RHS B;  2JA7 H;  3PMF A;  4X62 L;  2B8G A;  3L2P A;  2NVQ B;  2K5D A;  4Y7N B;  3NPP A;  1ET6 A;  5IE8 A;  1VQN A;  3K7A B;  5D3I B;  4DV4 Q;  2AQ2 B;  5KYL A;  1GUT A;  3RZO B;  4JI5 Q;  4JYA Q;  1L1O B;  3H3V H;  2I5H A;  1RDP D;  2OWO A;  1N33 L;  3MHB A;  2IJ0 A;  1AN8 A;  1JB7 A;  1CQF A;  3T16 A;  4K8I A;  3VYU A;  2EYH A;  4FXK C;  2B2W C;  4K14 A;  2M2L A;  2JXM B;  1JE5 A;  3QOJ A;  1NJI C;  3MXN B;  2FMC A;  2DY7 A;  3P20 A;  4Y52 H;  2K50 A;  3OWF A;  1W6K A;  5C3E G;  2B2T A;  1Q1E A;  4JOI C;  3ND9 A;  1YJN A;  1OXT A;  4GN5 A;  4KJO A;  3J7A 5;  3MVV A;  4IN3 A;  4B3R Q;  5IY0 A;  1EEF D;  3NTI A;  3SDZ A;  3LWE A;  4CBV A;  1TWC H;  1TWG H;  5ELB A;  1XYI A;  1PZI D;  1S72 A;  4A3G B;  1ASY A;  2K5N A;  1HPC A;  4YWK A;  1PV4 A;  1SNP A;  3Q24 A;  4I7Z C;  3CW2 C;  4XDX A;  4XIG S;  5IT9 c;  3T4A C;  1BBW A;  2B3G A;  5EPJ A;  3UE1 A;  1K83 H;  4OO1 I;  1LTL A;  3QIA A;  1CHP D;  2WII B;  4IUV A;  1U0L A;  5M3M H;  2VB2 X;  4UY8 C;  2F0G A;  1PRT D;  1ESR A;  3U4V A;  5NUC A;  4AIM A;  2F4I A;  4WFN 3;  1U9R A;  4RCN A;  1B4O A;  2CCZ A;  3CCM A;  2EOT A;  1GXD C;  5IOD A;  1VCI A;  5C3W A;  4K2K A;  2KJX A;  1KRS A;  1KTK A;  1QUQ A;  4BY1 B;  2DY8 A;  2ZM6 Q;  2AQ3 B;  4LF5 Q;  1VQ4 A;  1YNN C;  2KHJ A;  2JA8 B;  2BH2 A;  1WCM H;  3FEW X;  1ENF A;  5K36 H;  4HN7 A;  3H0G H;  5GQO A;  2VB3 X;  3BDL A;  3GTG H;  3HOW G;  5J3B A;  1GKH A;  1FNV A;  3SK4 A;  4JI1 L;  2RDH A;  4LF9 L;  3S1M H;  2QA4 A;  1K28 A;  3KBX A;  2EDG A;  3GV6 A;  4X66 L;  1BCP C;  1EY5 A;  2RDF A;  2XVS A;  2K5W A;  2J7Z A;  1GHK A;  5CV5 A;  4JBW A;  4HID A;  3D3R A;  1T5E A;  4YWM A;  5C5M A;  1C48 A;  1LAB A;  4ID6 A;  4GKK L;  3CQZ H;  3G6J B;  3VR5 A;  1HA6 A;  3S1R B;  3J80 E;  3DEO A;  3DLL A;  3PO3 B;  4DR6 Q;  3BS1 A;  1QWY A;  1MJC A;  4P2C B;  3J80 L;  4BBS G;  4BA2 I;  3UE0 A;  1AP0 A;  4OIK A;  2MQH A;  4HMI A;  2F0D A;  1SJH D;  2JYO A;  2MP1 A;  3H3V C;  2UU9 Q;  1JWM D;  5C3E H;  3BYY B;  5FO7 B;  1P16 A;  4QGU A;  4A3C H;  2RF4 A;  1EYC A;  1S5E D;  1TS3 A;  2WB1 G;  2IT1 A;  1WTQ A;  2QEX A;  4RGM A;  4C1N K;  4YWL A;  1CQV A;  4CJ0 B;  3I90 A;  1DM0 B;  1EY9 A;  2F4V Q;  4U68 A;  1RL2 A;  4JI2 Q;  3BZD B;  2G9H D;  4GN3 B;  4KTA A;  1JJ2 A;  2O5I C;  2CQO A;  3H91 A;  2R93 G;  2YTX A;  1PFM A;  1FR3 A;  1F2Y A;  3E6Z X;  1EFW A;  1U5K A;  2K5Q A;  2HT1 A;  3KDF B;  2R6G A;  3K5L A;  4P75 A;  1S5D D;  3D4W A;  1KAA A;  3CHB D;  3I8Z A;  1GUG A;  1DOM A;  1VQP A;  3S2H H;  3SE0 A;  3KF6 A;  1A8V A;  1H9R A;  1X3G A;  2A6E C;  3OPO A;  3CRL C;  1UE7 A;  1SE8 A;  1KC8 C;  2JEA I;  1HQR D;  4TVA B;  3MAQ A;  1QZH A;  1IYV A;  1ONL A;  3TDQ A;  2KVM A;  1Q46 A;  3HKZ E;  1QNK A;  2F0H A;  3TP8 A;  4JBK A;  1AH9 A;  1RCV D;  1R9T B;  1V1Q A;  1Q8K A;  4ZK9 B;  1X6O A;  3T1Y L;  3KJP A;  4OWT B;  3Q23 A;  1IBK Q;  2H5X A;  1I6H B;  3S15 H;  3NP8 A;  3K7U C;  4NDX A;  5J1Z A;  1SYG A;  2PI2 E;  3GTJ H;  1HFN A;  1S4Z A;  3GV3 A;  1FJG L;  4OXP A;  3GTO H;  4JI3 Q;  5DM7 3;  4HSV A;  1XNQ Q;  3DWQ A;  4FXD A;  3L0O A;  2F0F A;  1VQO A;  3E0J A;  4IPD A;  4I65 A;  1B3A A;  2B2T C;  1YJW A;  3JAM E;  2E74 C;  4JV5 L;  3BU2 A;  1KIX A;  3NQT A;  3VYR A;  5DLQ E;  3JAM L;  3GTM H;  2ZXP A;  2EXD A;  2A69 D;  4BBS H;  2KEE A;  3CCU A;  2UXD L;  3JC6 6;  4DAY A;  3ULP A;  4X65 L;  2EYF A;  3A8K E;  4EX5 A;  2UUB Q;  3TZD A;  3KUP A;  1PTO D;  1W2B A;  3NBI A;  5I2X A;  5GAH C;  2F0W A;  5C3X A;  2DGY A;  2LXK A;  4C3H G;  4LF7 Q;  1PVO A;  1STE A;  1PLF A;  3MTS A;  3Q8D A;  2EZV A;  3PF4 A;  2RHQ B;  1VQM A;  4GN4 B;  4R9W A;  1EL0 A;  2R93 H;  3NEL A;  5DEH A;  3H09 A;  3TBI B;  4DR7 L;  2DJG C;  1RJT A;  2F0I A;  3PO2 G;  3P75 A;  1LYL A;  4PNY A;  5BR8 L;  1QVF A;  4O2D A;  4RKB A;  4ZKB B;  2HDM A;  3VYT A;  1KDC A;  4N9T A;  5C44 B;  4M1U B;  3J80 c;  1A62 A;  3J81 i;  4AQY L;  2I5L X;  1LTI D;  2OF1 A;  1HCZ A;  2QIL A;  5EKL A;  1YIT A;  2JSO A;  3TRZ A;  1TWF H;  2RKS A;  1ML0 D;  1WI5 A;  1WYD A;  1R4Q B;  1YNJ D;  2WV6 D;  1SFO H;  3B6Y A;  4A3B G;  2F0M A;  1LM0 A;  4IUP A;  3O13 A;  3TP6 A;  2HHH L;  1XJV A;  1LT6 D;  2D0P A;  5T1G A;  5IGF A;  4IOC A;  3I70 A;  4GOP B;  4ZUI A;  2XTI A;  5E3F A;  3STB C;  1XMQ Q;  3I4M G;  2PPB C;  5CC4 A;  4MN3 A;  3A8I E;  5BN5 A;  2WAQ E;  3NTH A;  1GVP A;  4B3S L;  2NN6 I;  1DOK A;  1TS5 A;  3K59 A;  1I94 Q;  1ZYR D;  3J7Z C;  4POF A;  1B44 D;  2M00 A;  3TN2 A;  2JE6 I;  1YBY A;  4UP7 A;  1CT1 D;  5GAE C;  1RTO A;  4JI0 L;  2SOB A;  1EQT A;  1EQV A;  3PIO 3;  3QOL A;  4DKA C;  4IAL A;  4IPG A;  1J6Q A;  4A76 A;  4K0K Q;  4R1J A;  4GZY C;  4OON A;  2I5M X;  3TSS A;  3DWA A;  2Z4H A;  3TP7 A;  1CKM A;  1GUO A;  4DV1 Q;  2BOS A;  1Z6H A;  1E1T A;  1NMF A;  2F0P A;  5C0X J;  1IL8 A;  2UUC L;  1WJJ A;  3OW2 A;  5IYD G;  1DD2 A;  1TQO A;  1MGS A;  4QIW E;  1S5F D;  4A3I G;  4UHV A;  1I4G A;  2L0C A;  4NXN Q;  1E2V A;  4LW1 A;  3RZD H;  4FO2 A;  4CDF C;  2NTT A;  2QDB A;  2L15 A;  2HCI A;  4DV4 L;  1LTS D;  1D5X C;  3VR2 A;  5EJW A;  4KN7 C;  1BXT A;  3I73 A;  2J4X A;  3J7A V;  4DV5 Q;  2GA4 B;  1N32 Q;  2DNC A;  1RTN A;  4JI7 L;  2PMZ E;  3T1H Q;  1WTP A;  3M4Y A;  1TT2 A;  4KKU A;  1TWH B;  1XNR L;  3HS0 C;  2RCN A;  4A3E G;  4LFB L;  2E2D C;  1VQA A;  2RA4 A;  2ID0 A;  4J6H A;  3M4O B;  4FDB A;  1I6V C;  1I3Q B;  4DK0 A;  2Q8I B;  3TS0 A;  3BVG A;  1ENC A;  1DJR D;  2NVT H;  2B2Y A;  3M7G A;  1E1O A;  4HCE A;  5M5W H;  3FMC A;  3PO2 H;  4IOA A;  3MA2 B;  3PQI A;  1PZJ D;  2BA0 A;  3L7Z C;  5LMU Q;  1DGS A;  3EIV A;  3ZYY X;  2NVY B;  2K1B A;  5C0X G;  3I56 A;  1NY4 A;  2MNA A;  1O80 A;  1H9S B;  4DAP A;  3CCJ A;  3LX0 A;  2EJF C;  5GRO A;  1F77 A;  3TZU A;  4QB4 A;  1X65 A;  4LFC L;  5HY6 A;  3PUW A;  2E2J H;  4QCL A;  1HTP A;  4DK3 C;  1PFN A;  4IUQ A;  4A3B H;  1Y1V B;  3PV0 A;  2R92 B;  3SK8 A;  3U58 A;  2Z8L A;  1SSO A;  1EY4 A;  4DA2 A;  5C5L A;  2CKZ B;  3BYT B;  1JR0 D;  3NTK A;  4A3J B;  4K8J A;  1MI2 A;  3T53 B;  1ILQ A;  4A3L G;  1RD9 D;  1CKN A;  1YNN D;  4K5W A;  4KY5 A;  3GTK B;  1XMO Q;  4RMF A;  2D9U A;  3W3A A;  4HJ8 A;  4B3T L;  4L5R C;  3WDN A;  4DR1 L;  3KLR A;  3S1N H;  4NXM Q;  2VW9 A;  2ZM6 L;  2JA6 H;  3HOV G;  1F9P A;  1BCP D;  4YCV A;  1Q7Y C;  3CPF A;  2A6H C;  2L4N A;  2LMC B;  1VQD A;  4Q5V A;  4R4C A;  1Y8P B;  5IT9 E;  1WTW A;  4DN4 M;  4YIJ A;  1PH3 A;  5M5Y H;  3GQB A;  5IT9 L;  4YCU A;  1UE1 A;  5FO8 B;  4A3I H;  3UDI A;  5J22 A;  4WRD A;  2K04 A;  2RSO A;  3M4Q A;  4OEM B;  2PYK A;  4XXE A;  1HR0 Q;  5FLM G;  1QG7 A;  5L37 A;  1N36 L;  1PH8 A;  5CMD A;  1SBB B;  2X6G A;  3UDG A;  1HA5 A;  3M3Y B;  2RSN A;  5D14 A;  1XPO A;  4LFA L;  3HKZ B;  2SNM A;  3P7J A;  1SR3 A;  2K7V A;  4A3E H;  4KHP L;  3ERO A;  3MFY A;  2D2C C;  1F9S A;  1FGB D;  2BDO A;  5EPL A;  1GO3 E;  1P8L A;  1K0R A;  1PH5 A;  3P1H A;  1Y8N B;  2R61 A;  3A56 A;  4A3G G;  1Y14 B;  3ITP A;  1U4M A;  1L1O A;  3M4P A;  1VQC A;  1A63 A;  5C0X H;  3CC4 A;  4HJ7 A;  1DON A;  2A8V A;  2F3W A;  3SHL A;  3G71 A;  5JJL A;  5FK9 C;  5DAU A;  4ZKC B;  2F4V L;  2MO1 A;  4RHS A;  1MSH A;  4B9X A;  1UEB A;  5E4X A;  4DR5 Q;  1IW7 C;  2J0T D;  5CBE E;  4DUZ L;  1SYC A;  3K5M A;  1ET9 A;  2RQX A;  3S16 H;  4HIM A;  3VA7 A;  4C3J B;  1JT8 A;  4A3L H;  3PUZ A;  3RLF A;  3F2D A;  4BY1 G;  2QKI C;  2F52 A;  1HQM C;  2JA8 G;  1VQK A;  1KDB A;  2EXZ A;  2ZJR A;  1FL0 A;  3NUC A;  3K0Y A;  1EY8 A;  1SMX A;  3DHQ A;  1D1I A;  4YHH Q;  4CDD C;  1EQQ A;  4YCW A;  1A6X A;  1EWC A;  3HOV H;  3ZJY C;  1QJO A;  4JW0 A;  1TVX A;  1VQG A;  3FHW A;  4PMC A;  4Y7N H;  4DV2 L;  1HH2 P;  1K8G A;  2WFW A;  1PH7 A;  4KLK A;  4YY3 L;  1IKL A;  1U4L A;  1NE3 A;  2KHS A;  1LT3 D;  3RZO H;  2E2I B;  1G6P A;  4K6L A;  2BDN A;  1XNQ L;  3IRB A;  2PZT A;  3MWY W;  1M90 C;  2E8G A;  3PUY A;  4V19 0;  2Z1C A;  4IJH A;  5EAY A;  1X32 A;  5FLM H;  2B2Y C;  2IX1 A;  1R4P B;  3KF8 B;  3PO3 G;  2IX0 A;  4ZLT F;  1PHJ A;  1PRT F;  3SK6 A;  1A3V A;  2NB0 A;  1EUJ A;  2C35 B;  2K05 A;  2Q8T A;  1B1Z A;  3CCQ A;  2CH4 A;  3MC0 B;  3M7N A;  4APV A;  2LS0 1;  1Z9F A;  2WAC A;  5FLX E;  4LUV A;  3R8B A;  4GKJ Q;  3I7F A;  3D4D A;  4LF6 L;  2WAQ B;  5LMN Q;  4DPG A;  2KED A;  1IBL Q;  4DUY Q;  2UUB L;  3E3X A;  2XRS D;  4RAU C;  4OGQ C;  5ELD A;  3MZ5 A;  2ASB A;  4A3G H;  2Q2T A;  4L5Q A;  3KK7 A;  2K14 A;  4LF7 L;  1IBM Q;  3I4L A;  1TII D;  5I4D A;  4PZ8 A;  1E0B A;  4RHR A;  1Q82 C;  1M1K C;  2HQE A;  4HJ5 A;  1D2B A;  2GVA A;  1TWC B;  4AYB E;  5KNC A;  1TWG B;  2EE1 A;  1D7Q A;  1VQH A;  1EIF A;  4QIW B;  3MXP A;  5C4H A;  5JVG 3;  1QVG A;  2YTV A;  1KDA A;  3J81 E;  2VUM B;  4Q0F A;  2A73 B;  1PZK D;  5AJ3 Q;  4GLV B;  1PH6 A;  4CDE C;  3PF5 A;  3J81 L;  1LO5 D;  2NBF A;  3I91 A;  1W3S A;  2VNU D;  2JA8 H;  2NVX B;  1EEI D;  2PMZ B;  5M3M B;  3STB D;  5C0X I;  2O4X A;  2V4D A;  4IUT A;  3TP5 A;  4FF2 A;  4FF1 A;  1ESF A;  1G8Z D;  2B39 A;  3UI2 A;  4R4O A;  2ZJP A;  3QWN A;  4C3I H;  2F1M A;  2AMC B;  1V43 A;  3KDF A;  4DV7 Q;  5IGB A;  3OMC A;  4IJL A;  4GNX B;  2AUK A;  4LUO A;  5C4X B;  3CCL A;  4X3T A;  3OTO Q;  2Z6K A;  1W6J A;  3EVQ A;  3G48 A;  4KN4 C;  1J9O A;  4DFA A;  2JJQ A;  1I94 L;  1CA6 A;  3I4N B;  3M9B A;  1IXR A;  2K03 A;  2A5H A;  2F0V A;  1Y1W B;  4XT3 B;  1JOQ A;  2VQE Q;  4OHJ A;  2I46 A;  3S1R H;  2XWB B;  1KQS A;  1L0Y B;  2UXC L;  1HNX Q;  2UXB Q;  4GLA C;  4BY7 B;  3PO3 H;  4DV6 Q;  1HZC A;  1ICW A;  4M8A A;  2YU9 B;  1S5B D;  3H6M A;  3AQQ A;  4EQN A;  5IP9 G;  3VA5 A;  1L1O C;  4DV1 L;  1XPR A;  3M85 A;  2EJG C;  2E5L Q;  3G4S A;  4XQN A;  3NBH B;  2H1E A;  1K0S A;  3NWT A;  1VQJ A;  1EZ6 A;  4NXN L;  2RCF A;  2IPK D;  3SGI A;  3H3V I;  4K5V A;  1F2Z A;  3D4R A;  1EIY B;  5E4W C;  4EGV A;  3ER0 A;  1PA6 A;  3G6E A;  4DV5 L;  4ILW A;  2PQA B;  2OT2 A;  1AE3 A;  3D0F A;  4LF8 Q;  3A7A B;  4OEL B;  2DJF C;  1SJE D;  5E7N A;  3VYS A;  4UPA A;  4RCO A;  2LFN A;  3TQY A;  1V1P B;  3FPP A;  1QCB D;  3ERQ A;  5KNB A;  2DNE A;  2UUA Q;  4IUN A;  3AFQ A;  5I6Y A;  5C44 G;  3CU7 A;  5D65 A;  2PZW A;  4KV6 A;  1PRT B;  1BBU A;  5AFW A;  2AKW B;  4DV0 L;  1HNW Q;  5D3D A;  3CPW A;  2B29 A;  2XRQ D;  4ZCK A;  4O1N A;  3KLS X;  2SEB D;  4HAE A;  5CYU A;  5FLX c;  5IYB G;  4JI6 L;  3NEM A;  4FYD A;  1R9T H;  1J5E Q;  3D8G A;  1ZXT A;  3H94 A;  5CV7 A;  3HOW H;  2F0T A;  1I6H H;  3K5O A;  2F0K A;  1JOR A;  1TY2 A;  2NWG A;  1NTG A;  1O7Y A;  3RNU A;  1E22 A;  1N34 L;  1M4V A;  1WVL A;  1GJX A;  2IHF A;  3PIP A;  3C1F A;  3GTP B;  4EVO A;  1VQB A;  1PYS B;  5I2Y A;  1I4X A;  1LTR D;  1HZ9 A;  2AWO A;  3LGJ A;  3U50 C;  4X62 Q;  5ELN A;  1ICF B;  4A93 B;  4JI8 L;  4KK7 A;  4DXF A;  1B7Y B;  3F2B A;  4QQB X;  2OTJ A;  4MTK A;  2A19 A;  2BA1 A;  2A6H D;  2F0Q A;  3S15 B;  1KXL A;  1SYE A;  1RKN A;  1IYU A;  4X3K A;  3J81 c;  1FVI A;  3CC2 A;  3S2D B;  4A4I A;  2VZA A;  5IP7 G;  5F2D A;  2FHT A;  5IP9 H;  1HZB A;  2BH8 A;  2L12 A;  4GOP A;  1MHW C;  4J8Q A;  5FO9 B;  1WTX A;  4G7O C;  2HIX A;  3ERS X;  5JJZ A;  3RN5 A;  1HRJ A;  1L2F A;  4C1N I;  3EN2 A;  1BVS A;  2L11 A;  1WTV A;  2L55 A;  4F8M A;  3HOZ B;  4A3D B;  1BQQ T;  2N3S A;  3A7L A;  4LUZ A;  2FXQ A;  1D5Z C;  1LUZ A;  1X55 A;  4B3M L;  2R7F A;  1MJE A;  1DZ1 A;  3QR8 A;  4CHT B;  4MTN A;  2Q8R E;  4DK6 C;  2RVL A;  2IL8 A;  4Z9C B;  1YZ6 A;  3G7L A;  4LNQ A;  1CZW A;  3MXU A;  1VF5 C;  5IIF A;  2F3I A;  2N55 A;  4OWW B;  1EY0 A;  3HP3 A;  2OXP A;  3W1B A;  4OX9 Q;  4CDC C;  1YJ9 A;  4X3U A;  3HG9 A;  3BZC A;  3U9O A;  1K8M A;  4S3S A;  2HCC A;  4A3F B;  4HSP A;  1A15 A;  1EY7 A;  4DAV A;  4PQX A;  1EIH A;  5LL6 S;  1CK1 A;  1RF2 D;  2AUJ D;  3FP9 A;  2Y0S E;  3E5S A;  1KAB A;  2N49 A;  4ZUJ A;  1Y1V G;  5C4J B;  2R92 G;  5IYB H;  1X3Q A;  2Z6K C;  3PCO B;  1FYC A;  5M5X B;  4A3J G;  1I5F A;  1EFI D;  1UE6 A;  3KLW A;  2NZO A;  1LAC A;  2V1C C;  4KHZ A;  1KNA A;  5EKI A;  2JP1 A;  1I50 B;  3CF5 A;  2FJ2 A;  1PYB A;  3S24 A;  3OWE B;  1LTT D;  4ABN A;  4DR3 L;  3Q22 A;  4LK1 C;  4WOR A;  1B9N A;  2K75 A;  2EYM A;  4P74 A;  2KA7 A;  4DV3 L;  4MIU A;  3HOX B;  4X64 L;  4XQJ A;  4DF7 A;  4JI1 Q;  1A0I A;  4ZYS A;  4JPB W;  4LF4 Q;  1PYW D;  1TU2 B;  4X66 Q;  2ZTC A;  3UDF A;  1OXU A;  4BXX G;  4PG3 A;  1VQ8 A;  3BG3 A;  1H9S A;  4FVM A;  1I4R A;  2IX3 A;  3N6R A;  4K2L A;  1EIG A;  4MZ9 A;  1CFM A;  1NBW A;  4AYB B;  4QUF A;  2OQ0 A;  4GKK Q;  1IKM A;  2QGQ A;  3SR1 A;  4HIO A;  2TMP A;  5IP7 H;  2VQF Q;  1PFB A;  5CV8 A;  3RD4 A;  2NYZ D;  3S14 B;  1JJG A;  1CSP A;  4EQP A;  4BWG B;  3FKI B;  2RDG A;  5ELF A;  4JI5 L;  4JYA L;  1PTO B;  3QB3 A;  1F2L A;  4C3H H;  1YHQ A;  1VQ5 A;  2LY7 A;  3GDE A;  3HKZ G;  4CKE A;  4F88 A;  3W1G A;  1VQ6 A;  1TWH H;  2PW7 A;  3DM1 A;  4WJ3 M;  4G7Z C;  2O5J C;  3E0E A;  1BR9 A;  2K6A A;  3M4O H;  2JA5 B;  5JPM C;  4DU9 A;  1N8R C;  1I3Q H;  3R2I A;  4A3M B;  5JVH 3;  4BBR B;  1Q3L A;  4ZRZ A;  3CXC A;  4K5X A;  1FGU A;  2GN5 A;  3F8T A;  3ULJ A;  2NZH A;  2R7Z B;  3H15 A;  3OYY A;  4GKJ L;  4B3R L;  3CRK C;  1A2T A;  2LSS A;  2NVY H;  1JWU D;  5CV4 A;  5JEA G;  4R4Q A;  4RWS C;  3K5N A;  1C9O A;  3RLO A;  1LLR D;  5JJK A;  1AEX A;  5IGE A;  2BCO A;  1CUK A;  2ES2 A;  1Y1V H;  1EWI A;  5G3L F;  2R92 H;  2Z0S A;  1VS0 A;  3K80 C;  2XIW A;  4XT1 B;  2EJM A;  3E9H A;  4A3J H;  1QE6 A;  1KLU D;  4C3J G;  1UUP A;  3I4M H;  4P73 A;  3K58 A;  1H9J A;  1DCZ A;  2PI2 A;  1BUV T;  2X69 A;  5IGD A;  3GTK H;  2EYP A;  3W5O A;  3T1Y Q;  2E2J B;  4PMB A;  4B9W A;  1QVC A;  2ZT9 C;  4L63 B;  1HFG A;  4L6T B;  2D0O A;  1PH2 A;  3VR4 A;  1FJG Q;  1ASZ A;  4IUU A;  1O7I A;  4GOP C;  4LF5 L;  4DNT B;  1LTA D;  2E75 C;  4BXX H;  5KGU A;  3PSI A;  1EU4 A;  1HHV A;  4IQZ A;  5IYD H;  2DN8 A;  2AQ1 B;  1I4P A;  3CKI B;  2G9D A;  1EQR A;  1EOT A;  4N9P A;  4ZQ3 A;  3GTL B;  2YYZ A;  4DV7 L;  2KCT A;  5KYI A;  2JA6 B;  3JAM i;  3EFX D;  3C3L A;  3OMG A;  3C1E A;  1EZ8 A;  3N52 A;  2UXD Q;  1G2S A;  1YHB A;  4ME5 A;  4O0A A;  1LTB D;  1MKH A;  4E6I A;  4X65 Q;  1Q81 C;  2IHE A;  3J7Y W;  2A74 C;  2KHI A;  1AW7 A;  1SE3 A;  3WOF A;  1H95 A;  1CTM A;  1EU3 A;  2KEC A;  2R7D A;  1G6Z A;  3F2C A;  2UXB L;  1JQY D;  5H1S E;  1VQ7 A;  2E76 C;  3SEB A;  1HR0 W;  4DR6 L;  1SAP A;  3I4O A;  1I4H A;  3OSO A;  3AU7 A;  1X56 A;  2WAQ G;  1LT5 D;  2XN9 C;  5ELC A;  2OQK A;  1RHP A;  1NR4 A;  2UU9 L;  1JCK B;  2E5L L;  3TEH B;  3GTQ B;  1UEA B;  4UP9 A;  1PMR A;  4A3K B;  3U9S A;  4DNR B;  3AEV A;  5BR8 Q;  1QIL A;  1VQI A;  2ZTD A;  5JEA H;  1SNO A;  4L8J A;  3T51 B;  1F9R A;  3FRP B;  5BN4 A;  1EOV A;  2WP8 J;  1G91 A;  5DM6 3;  3KF8 A;  4JI2 L;  4AQY Q;  5CGK A;  4KKT A;  3E9I A;  4ULL A;  2VXW A;  1KD1 C;  5T1I A;  2ZXR A;  2A6E D;  4C2M B;  1ROD A;  1BBX C;  2B2V A;  3FVQ A;  1JE4 A;  2EIF A;  1C7Y A;  3V05 A;  2B8F A;  1Z7T A;  2VUM G;  5JJI A;  3K8A A;  4C3J H;  3A5U A;  1E24 A;  3IL8 A;  1WTR A;  1YIJ A;  2CWP A;  3S17 H;  4MHE A;  1Q12 A;  5M3M G;  1QNU A;  1JIC A;  3J81 j;  1K3R A;  4RGO S;  1XTC D;  3HOU B;  3HOY B;  4NW2 A;  5LHY 1;  4R8I A;  1YEZ A;  1VQE A;  2ZXO A;  4KD3 A;  2B63 B;  1KRT A;  3ICE A;  3A0J A;  4ME3 A;  4QJF A;  2WB1 E;  1E7Z A;  1CZG A;  4JI0 Q;  1BNZ A;  1G29 1;  1J5E L;  4POG A;  2NVQ H;  4ZAI A;  1BCP B;  5E1F A;  4IO9 A;  1UWV A;  3EA6 A;  1TWA B;  4H13 C;  4QMG A;  3K7A H;  1IBK L;  5C4X G;  1HUM A;  1SMY C;  1KLG D;  1OXV A;  1E3P A;  1ZYR C;  2E2H B;  1QB5 D;  2E2I H;  1WTO A;  1K9M C;  4JI3 L;  4WJW A;  4PZ7 A;  3RLN A;  1WD1 A;  3I4N G;  5M3F B;  4QF4 A;  1X3E A;  4N8F A;  1JOO A;  3MXG A;  1Y1W G;  5EBD A;  4EQ5 A;  2HDL A;  3S1Q B;  2JA7 B;  1U4R A;  1VQF A;  3DWP A;  4BY7 G;  2Y0S B;  1II3 A;  4DR2 Q;  3C2P A;  4BA1 I;  5I9O A;  3R93 A;  4OL7 A;  1KL9 A;  2K52 A;  2NZ1 D;  4J1M A;  1YI2 A;  4HTH A;  3TS2 A;  3DUZ A;  4JI7 Q;  4HMJ A;  1D1K A;  3TRE A;  4XTC S;  1XNR Q;  3R2T A;  3WWV A;  2K5V A;  4LFB Q;  4NMZ A;  3W2D A;  3OIP A;  1CM9 A;  5FLX L;  1GD7 A;  2KOL A;  1AZQ A;  4DXG A;  1Q1B A;  1B9M A;  1D6E C;  4JBJ A;  4GNX A;  3HEJ A;  5IYC G;  1Q90 A;  1HZA A;  1OO9 B;  4R8N A;  3T56 B;  1O7Z A;  3A74 A;  1DOL A;  4A3C G;  1MD2 D;  2MFI A;  4N8X 1;  5LMN W;  3LWU A;  1HNZ Q;  2PZU A;  3EBE A;  3TME A;  2CH4 W;  3V2T A;  4IFD J;  1WTH A;  5IWA Q;  1U4P A;  1NCV A;  2IW3 A;  4LFC Q;  5JPN C;  5I9P A;  1EYD A;  1NNX A;  1B8A A;  2CHB D;  1GUS A;  5I6W A;  2VUM H;  2K5H A;  2O2L D;  3NBH A;  3OW7 A;  4LJZ C;  1ENA A;  4OX9 L;  1G2T A;  4CGY B;  4BY1 H;  4DR4 Q;  1K83 B;  4HJ9 A;  3K81 C;  2CW0 C;  5K5P A;  4LMQ D;  2L1B A;  2KBN A;  1Y69 U;  2NVX H;  5LL6 X;  1WD0 A;  2NN6 G;  4H0L C;  3NK9 A;  4HED A;  2EYO A;  1HTL D;  1STA A;  2PQA A;  2SDF A;  1UE5 A;  4B3T Q;  4RGT A;  1E2Z A;  1NUC A;  4DR1 Q;  1PFS A;  2H4O A;  3IKJ A;  1V1P A;  1X3P A;  1JB3 A;  1XMQ L;  1J8I A;  1A3T A;  2MPM A;  4X6A H;  3RUZ A;  5C4X H;  1WCM B;  4KHV A;  4A93 G;  3H0G B;  4UAI A;  1SYF A;  2K01 A;  4BS9 A;  3GTG B;  4IFD G;  2C9O A;  3I4N H;  4K6D A;  1D8L A;  1T9H A;  1Z47 A;  1Y1W H;  4C3I B;  3S1M B;  3KBG A;  4LF4 L;  2EYJ A;  4DGZ A;  1FD7 D;  3NSW A;  4BY7 H;  4F7X A;  1BF4 A;  1RIP A;  4HJA A;  4K0K L;  2GVB A;  4RFB A;  2YU9 H;  1TKW B;  5A35 A;  5EBC A;  1GUW A;  1N36 Q;  5HGQ A;  4R4I A;  2NUC A;  2OTL A;  3FDT A;  1QZG A;  5JAV A;  4A75 A;  1EY6 A;  1IL2 A;  4LFA Q;  3WOE A;  2KQ3 A;  3CQZ B; 
#chains in the Genus database with same CATH homology
 3U58 A;  5M3F H;  2F3I A;  2UUC Q;  4OWW B;  4KHP Q;  3HOZ G;  2CKZ B;  2VQF L;  4A3D G;  3K0X A;  3W1B A;  4OX9 Q;  1YJ9 A;  3S1Q H;  2RHS B;  2JA7 H;  4X62 L;  3BZC A;  3L2P A;  4A3L G;  1CKN A;  1S40 A;  5IYC H;  5IE8 A;  1VQN A;  1XMO Q;  4DV4 Q;  1N32 L;  2PNH A;  5FJ8 G;  4RMF A;  1KHI A;  3T1H L;  4JI5 Q;  4JI4 Q;  4JYA Q;  1L1O B;  4HJ8 A;  2I5H A;  4B3T L;  4L5R C;  3H3V H;  4KI0 A;  4DR1 L;  3FP9 A;  2OWO A;  2I0Q A;  2Y0S E;  3PIO A;  1N33 L;  2N49 A;  1JB7 A;  1Y1V G;  3S1N H;  4NXM Q;  1QUQ B;  2R92 G;  5IYB H;  2VW9 A;  1CKO A;  2ZM6 L;  2JA6 H;  3HOV G;  2Z6K C;  3PCO B;  2JK8 A;  4YCV A;  4A3J G;  1I5F A;  1Q7Y C;  1JE5 A;  1UE6 A;  3CPF A;  3KLW A;  1NJI C;  2NZO A;  3MXN B;  2V1C C;  3D31 A;  4KHZ A;  3AYH B;  3CF5 A;  4Y52 H;  1VQD A;  2K50 A;  4A3F G;  1L0W A;  1PYB A;  3S24 A;  4R4C A;  5C3E G;  4DR3 L;  1Q1E A;  4DUZ Q;  4JOI C;  1PH3 A;  2K75 A;  1YJN A;  1OXT A;  5M5Y H;  4GN5 A;  5LMU L;  1OTC A;  4P74 A;  4DV3 L;  4X64 L;  4YCU A;  3J7A 5;  1UE1 A;  4JI1 Q;  1A0I A;  4A3I H;  4B3R Q;  5IY0 A;  3UDI A;  5GAG C;  4LF4 Q;  3M4Q A;  1SLJ A;  1HR0 Q;  4X66 Q;  1TWC H;  2ZTC A;  3UDF A;  1OXU A;  5FLM G;  4PG3 A;  4BXX G;  1TWG H;  1VQ8 A;  1N36 L;  2JQO A;  1PH8 A;  1S72 A;  1WFQ A;  4TQU S;  3CCS A;  1ASY A;  3UDG A;  2K5N A;  1VQ9 A;  4YWK A;  1PV4 A;  1K73 C;  4MZ9 A;  1XPO A;  1JMC A;  4LFA L;  1NBW A;  3CW2 C;  1VQ6 A;  4XIG S;  5IT9 c;  1SR3 A;  1V9P A;  2OQ0 A;  2VS1 A;  3AFP A;  4A3E H;  4GKK Q;  4KHP L;  3PUV A;  1BBW A;  2QGQ A;  2B3G A;  3GTP H;  3HOX G;  4HIO A;  3UE1 A;  5IP7 H;  1K83 H;  4OO1 I;  1LTL A;  2VQF Q;  3GD7 A;  1U0L A;  1GO3 E;  3ULL A;  1P8L A;  5M3M H;  3F1Z A;  1K0R A;  4DV2 Q;  4A93 H;  4UY8 C;  1JJG A;  1CSP A;  1XMO L;  1PH5 A;  1OXS C;  3U4V A;  4YY3 Q;  4AIM A;  4JI5 L;  3UDX A;  2ZJQ A;  4JYA L;  4A3G G;  1Y14 B;  3U4Z A;  4C3H H;  1YHQ A;  1VQ5 A;  4MNO A;  1XPU A;  2CCZ A;  1L1O A;  3CCM A;  3M4P A;  4NXM L;  3GDE A;  1VQC A;  3HKZ G;  4OWX B;  1VCI A;  3W1G A;  1TWH H;  1PH1 A;  4AYB G;  1N33 Q;  1A63 A;  1VQL A;  3CC4 A;  1KRS A;  4HJ7 A;  2A8V A;  1QUQ A;  4GNX C;  3G71 A;  4WJ3 M;  3S2D H;  2ZM6 Q;  4LF5 Q;  3E0E A;  1VQ4 A;  5JJL A;  3M4O H;  2KHJ A;  2F4V L;  2MO1 A;  1N8R C;  1I3Q H;  2BH2 A;  4P72 A;  1G51 A;  1WCM H;  4DNI A;  1UEB A;  3CXC A;  3H0G H;  5GQO A;  1FGU A;  4JCV E;  4DR5 Q;  3A5Z B;  3HOW G;  3GTG H;  2GN5 A;  3F8T A;  3FKI G;  1GKH A;  5J3B A;  3CC7 A;  4DUZ L;  3ULJ A;  2NZH A;  3S16 H;  3H15 A;  3OYY A;  4JI1 L;  3HOZ H;  4HIM A;  4LF9 L;  1SN8 A;  2QA4 A;  3S1M H;  4A3D H;  4B3R L;  4DAM A;  4GKJ L;  2CWA A;  2LSS A;  2NVY H;  1HR0 L;  5JEA G;  4X66 L;  1JT8 A;  3CAM A;  4A3L H;  3PUZ A;  3RLF A;  4R4Q A;  4BY1 G;  3F2D A;  4LF6 Q;  2MO0 A;  4UP8 A;  1C9O A;  2F52 A;  3KF6 B;  3RLO A;  2JA5 G;  3MEF A;  2JA8 G;  5JJK A;  4JBW A;  1VQK A;  4HID A;  4A3M G;  5FJ8 H;  2ZJR A;  4YWM A;  4BBR G;  3CME A;  1CUK A;  2ES2 A;  1FL0 A;  3I2Z A;  1SMX A;  1Y1V H;  1EWI A;  4YHH Q;  3DM3 A;  2R92 H;  1EQQ A;  3CQZ H;  4YCW A;  2Z0S A;  4GKK L;  1VS0 A;  3K80 C;  4IPH A;  3HOV H;  2R7Z G;  3BZK A;  3E9H A;  3ZJY C;  3DLL A;  4A3J H;  4DR6 Q;  5C44 H;  4WJ4 A;  2OCE A;  1GM5 A;  1VQG A;  3FHW A;  1MJC A;  4BBS G;  3I4M H;  4Y7N H;  4DV2 L;  1IYJ B;  3UE0 A;  1HH2 P;  4P73 A;  1K8G A;  2WFW A;  4BA2 I;  2PI2 A;  2MQH A;  1PH7 A;  4KLK A;  3GTK H;  4YY3 L;  4A3F H;  3W5O A;  1NE3 A;  2UU9 Q;  3T1Y Q;  5C3E H;  3RZO H;  4QGU A;  1P16 A;  1QVC A;  4A3C H;  3KJO A;  1EYG A;  1G6P A;  2RF4 A;  1PH2 A;  2D0O A;  1XNQ L;  2WB1 G;  3IRB A;  1FJG Q;  2IT1 A;  1ASZ A;  4PMW A;  5C4J H;  2QEX A;  2E8G A;  3PUY A;  1M90 C;  1O7I A;  3VDY A;  4GOP C;  4IJH A;  4LF5 L;  5EAY A;  4YWL A;  5FLM H;  4BXX H;  2IX1 A;  5M5X H;  3KF8 B;  3PSI A;  3PO3 G;  2IX0 A;  3BJU A;  2F4V Q;  2VY3 A;  1RL2 A;  1PHJ A;  4DR5 L;  3HKS A;  4JI2 Q;  4GN3 B;  1I50 H;  1JJ2 A;  2CQO A;  1EUJ A;  2R93 G;  2YTX A;  2C35 B;  1B70 B;  3CCQ A;  5IYD H;  3M7N A;  1EFW A;  4APV A;  1Z9F A;  1U5K A;  3HOX H;  1EQR A;  2HT1 A;  3KDF B;  2YYZ A;  4LUV A;  2R6G A;  4DV7 L;  3I7F A;  4LF9 Q;  2KCT A;  4GKJ Q;  4P75 A;  3JAM i;  4LF6 L;  2AHO B;  4DAY B;  5LMN Q;  2N8N A;  4DPG A;  2UXD Q;  1YHB A;  1IBL Q;  4DUY Q;  4O0A A;  1MKH A;  1VQP A;  2UUB L;  1C0A A;  3S2H H;  4X65 Q;  1Q81 C;  2IHE A;  3KF6 A;  2ASB A;  1A8V A;  4A3G H;  2Q2T A;  1X3G A;  4L5Q A;  1SRO A;  2KHI A;  1UE7 A;  1SE8 A;  2K14 A;  4RG1 A;  4YHH L;  5JEA J;  4LF7 L;  2HQL A;  1KC8 C;  2JEA I;  2R7D A;  1OXX K;  1IBM Q;  4PZ8 A;  4J15 A;  4TVA B;  3F2C A;  5H1S E;  2UXB L;  1QZH A;  1VQ7 A;  1Q82 C;  1M1K C;  1HR0 W;  3CMA A;  4DR6 L;  4HJ5 A;  2UXC Q;  2GVA A;  3I4O A;  1Q46 A;  3HKZ E;  4JBK A;  2JA6 G;  1AH9 A;  1X56 A;  4AYB E;  2WAQ G;  1V1Q A;  1Q8K A;  2OQK A;  3S14 H;  1D7Q A;  1X6O A;  1VQH A;  2UU9 L;  3T1Y L;  2K4K A;  3KJP A;  4OWT B;  2E5L L;  3FKI H;  3J80 i;  1IBK Q;  1EIF A;  2H5X A;  3S15 H;  3K7U C;  3TEH B;  2IY5 B;  1QVG A;  2YTV A;  2PI2 E;  4UP9 A;  3GTJ H;  3GO5 A;  1FJG L;  4JC0 A;  4OXP A;  3GTO H;  3AEV A;  4JI3 Q;  4IFD I;  5BR8 Q;  1XNQ Q;  2ZTD A;  1VQI A;  4GLV B;  5AJ3 Q;  1PH6 A;  1IZ6 A;  3PF5 A;  1Q86 C;  1EOV A;  1W3S A;  2WP8 J;  3L0O A;  1VQO A;  2JA5 H;  2VNU D;  2JA8 H;  4IPD A;  4DR2 L;  4JBM A;  4QY7 A;  3STB D;  3PUX A;  5C0X I;  4A3M H;  4JI2 L;  4AQY Q;  4BBR H;  3E9I A;  1KD1 C;  1YJW A;  4JV5 L;  1CSQ A;  3BU2 A;  1KIX A;  4R4O A;  5DLQ E;  2ZJP A;  2R7Z H;  2EIF A;  1C7Y A;  4OO1 G;  4A3K G;  3GTM H;  1PH9 A;  4C3I H;  2CFM A;  2AMC B;  2VUM G;  5JJI A;  1V43 A;  2EXD A;  2N78 A;  3K8A A;  5LMN L;  4C3J H;  3A5U A;  3KDF A;  4DV7 Q;  3CCU A;  4BBS H;  2UXD L;  3JC6 6;  1IBL L;  4DUY L;  1E24 A;  1HJP A;  1YVC A;  1YIJ A;  4IJL A;  2CWP A;  4GNX B;  4X65 L;  3ULP A;  4LUO A;  3S17 H;  3CCL A;  4EX5 A;  3OTO Q;  1Q12 A;  2Z6K A;  5M3M G;  2UUB Q;  3J81 j;  3G48 A;  1K3R A;  1W2B A;  2JJQ A;  5ELO A;  5GAH C;  4JG2 A;  1I94 L;  1IBM L;  3JAM c;  1BKB A;  3M9B A;  4DV0 Q;  1IXR A;  2DGY A;  2LXK A;  4LF7 Q;  1PVO A;  3I55 A;  1TXY A;  1MIU A;  4GS3 A;  1YEZ A;  1VQE A;  1HNZ L;  2VQE Q;  3S1R H;  1KQS A;  2UXC L;  1KRT A;  3ICE A;  3Q8D A;  1HNX Q;  3PF4 A;  2UXB Q;  2ZTE A;  4JOI A;  3A0J A;  2RHQ B;  4GLA C;  4ME3 A;  4QJF A;  1VQM A;  2WB1 E;  4DV6 Q;  1E7Z A;  1HZC A;  3PO3 H;  4JI0 Q;  1G29 1;  4GN4 B;  1J5E L;  4JI6 Q;  4POG A;  5IWA L;  2NVQ H;  4IO9 A;  4NPS A;  1UWV A;  2AWN A;  3AQQ A;  5IP9 G;  1K8A C;  3K7A H;  1IBK L;  5C4X G;  1L1O C;  4PZ6 A;  1SRU A;  2R93 H;  3NEL A;  4DV1 L;  1XPR A;  3M85 A;  2E5L Q;  4DR7 L;  1OXV A;  1E3P A;  3PO2 G;  3G4S A;  2E2I H;  1LYL A;  1K9M C;  3NBH B;  4JI3 L;  3PGZ A;  4IPC A;  5BR8 L;  4PZ7 A;  3RLN A;  4O2D A;  5AJ3 L;  1QVF A;  3I4N G;  3HOU G;  1X3E A;  3HOY G;  4DR4 L;  2EQS A;  1Y1W G;  1N34 Q;  4EQ5 A;  1VQJ A;  3SGI A;  4NXN L;  1S3O A;  2B63 G;  3H3V I;  3J80 c;  4P71 A;  1VQF A;  4BY7 G;  3CCV A;  1A62 A;  1KAW A;  3J81 i;  4AQY L;  2I5L X;  1EIY B;  4DR2 Q;  4BA1 I;  3ER0 A;  2YV5 A;  4JI8 Q;  2Q2U A;  1PA6 A;  3G6E A;  4DV5 L;  1KL9 A;  2K52 A;  1YIT A;  1YI2 A;  3TRZ A;  1TWF H;  2PQA B;  4JV5 Q;  1AE3 A;  3NEN A;  3D0F A;  1WI5 A;  1WYD A;  4LF8 Q;  3TS2 A;  1SFO H;  3B6Y A;  4JI7 Q;  4A3B G;  5E7N A;  1YHA A;  1X9N A;  4UPA A;  1LM0 A;  3CCR A;  3GTL H;  3TRE A;  3TQY A;  5M3F G;  4XTC S;  1XNR Q;  3WWV A;  2HHH L;  1XJV A;  4LWC A;  2D0P A;  2K5V A;  4LFB Q;  2UUA Q;  4IOC A;  2ATW A;  3AFQ A;  4GOP B;  1GD7 A;  2XTI A;  3STB C;  5C44 G;  2JA7 G;  1XMQ Q;  3OTO L;  3I4M G;  1Q1B A;  4JBJ A;  4GNX A;  5IYC G;  2Y0S G;  1N9W A;  2WAQ E;  1GVP A;  1BBU A;  1HZA A;  2AKW B;  2NN6 I;  4L5T A;  4B3S L;  3M3Y H;  4DV0 L;  3A74 A;  1I94 Q;  1YNX A;  2VL6 A;  4A3C G;  1HNW Q;  3J7Z C;  4POF A;  3CPW A;  2VQE L;  2B29 A;  2MFI A;  2JE6 I;  1YBY A;  4UP7 A;  5LMN W;  1HNX L;  4L5S A;  5GAE C;  1HNZ Q;  4NB3 A;  3EBE A;  1PH4 A;  4DV6 L;  1XTD A;  2KEN A;  5IYB G;  2DUD A;  5FLX c;  4JI0 L;  4JI6 L;  3NEM A;  4DKA C;  1R9T H;  4IFD J;  3KFU A;  4IPG A;  4B3M Q;  1J5E Q;  1J6Q A;  4A76 A;  5IWA Q;  4R1J A;  4K0K Q;  2ALY B;  2KCM A;  1NMG A;  2I5M X;  4OON A;  3HOW H;  4LFC Q;  1I6H H;  1CKM A;  2VUM H;  4DV1 Q;  3GTQ H;  1WOC A;  4DR7 Q;  5C0X J;  1E1T A;  1NMF A;  4A3K H;  2JA9 A;  1B8A A;  2UUC L;  1NTG A;  1WJJ A;  2K5H A;  3RNU A;  3OW2 A;  5IYD G;  1E22 A;  4H02 A;  1N34 L;  4GLX A;  2IHF A;  3PIP A;  4OX9 L;  4QIW E;  3KYH C;  4ALP A;  4BY1 H;  4DR4 Q;  1VQB A;  4HJ9 A;  1PYS B;  3K81 C;  4A3I G;  1CKN B;  4NXN Q;  2Q2I A;  4LW1 A;  3RZD H;  1HZ9 A;  2AWO A;  3LGJ A;  4R4T A;  3U50 C;  2KBN A;  4X62 Q;  5ELN A;  2NVX H;  3CD6 A;  4JI8 L;  2NN6 G;  2L15 A;  1X3F A;  1B7Y B;  3F2B A;  4DV4 L;  4QQB X;  2OTJ A;  2A19 A;  2BA1 A;  1KXL A;  4JI4 L;  4DV5 Q;  1N32 Q;  4C2M H;  4LF8 L;  4JI7 L;  2PMZ E;  3T1H Q;  2PQA A;  4B3T Q;  1UE5 A;  4DR1 Q;  2LXJ A;  4AH6 A;  3RR5 A;  3J81 c;  1XNR L;  2RCN A;  4A3E G;  1FVI A;  1PFS A;  4LFB L;  2UUA L;  1X54 A;  3CC2 A;  1VQA A;  2ID0 A;  3CP0 A;  2HHH Q;  4A4I A;  1XMQ L;  4QL5 A;  2VZA A;  5IP7 G;  3CCE A;  2YTY A;  4FDB A;  4X6A H;  5IP9 H;  1HZB A;  2BH8 A;  2XGT A;  5C4X H;  4HIK A;  4GOP A;  3TS0 A;  2NVT H;  2HIX A;  3ERS X;  4A93 G;  1JJC B;  1E1O A;  3RN2 A;  3RN5 A;  5M5W H;  3PO2 H;  4IFD G;  1HNW L;  1L2F A;  4IOA A;  1H95 A;  4B3S Q;  3KOJ A;  5GAD C;  3I4N H;  3HOU H;  3EN2 A;  1BVS A;  1D8L A;  1T9H A;  4DR3 Q;  3HOY H;  1AE2 A;  2D62 A;  1Z47 A;  2BA0 A;  1Y1W H;  3L7Z C;  3HFZ B;  5LMU Q;  2N3S A;  2B63 H;  1DGS A;  2FXQ A;  2Q2H A;  3EIV A;  4LUZ A;  4DV3 Q;  4X64 Q;  4LF4 L;  2HIV A;  4BY7 H;  5C0X G;  3I56 A;  1LUZ A;  1NY4 A;  1RIP A;  1X55 A;  2R7F A;  2MNA A;  1MJE A;  4HJA A;  4B3M L;  2A1A A;  4K0K L;  2GVB A;  3CCJ A;  2YU9 H;  5GRO A;  4MTN A;  1TWA H;  5HGQ A;  1N36 Q;  1X65 A;  4LFC L;  4R4I A;  4DK6 C;  1WCM G;  2OTL A;  5HY6 A;  3PUW A;  2E2J H;  1QZG A;  5K36 G;  4DK3 C;  2JEB I;  3H0G G;  4A75 A;  1YZ6 A;  2E2H H;  4A3B H;  1IL2 A;  4LNQ A;  4LFA Q;  3PV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...