1XMOL

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmoL00
4BY7G 1O7IA 2ZJRA 4R1JA 4A76A 4A3IH 1IXRA 3FP9A 1XNQL 5K36G 1CKNB 1FJGL 4HIOA 4A3EG 2E5LQ 2A8VA 2R7ZH 3S2DH 1N32Q 1BBWA 5C4JH 4GS3A 4X64L 3CCQA 1X55A 1PH9A 4HJ8A 1VQEA 1YHBA 1R9TH 4JI4L 1VQFA 4GKKQ 3PO2H 1QVFA 5H1SE 3PUXA 4IPCA 4YCUA 4OX9L 3CQZH 3W5OA 2EXDA 4LUOA 1VQOA 1YJNA 4GOPB 2WAQG 1IYJB 1FJGQ 4OO1G 3CCJA 3E9HA 4GLVB 3GTPH 1K3RA 4L5SA 4DV7Q 4BY1H 3ER0A 2JA7G 1SFOH 3UDIA 1VQBA 2ID0A 1HNWL 1QZHA 1PHJA 2E2HH 4JC0A 5IYBG 4A75A 1VQHA 1C9OA 4OX9Q 4R4OA 4DV1L 1PV4A 4WJ3M 4O2DA 1I94Q 3STBC 1JMCA 1A62A 1KRSA 4GKJQ 4HJ9A 2I5HA 2D0PA 4A3FG 1UE6A 4JI0Q 1JJCB 1VQ5A 3AYHB 4DNIA 2NVQH 4LWCA 3AQQA 4O0AA 5JEAJ 1P8LA 4OWWB 5IYDH 2F3IA 4AH6A 3HOUG 1CSQA 2CKZB 4JCVE 3CCLA 3HKZG 3H0GH 2YU9H 3A5UA 3J80i 1N34L 1U5KA 1AE3A 1VCIA 1Q1EA 4X65L 4POGA 5ELNA 2GN5A 4HJAA 4IJLA 1N33L 1GO3E 5GAGC 1VQNA 3JAMc 4PG3A 3RLFA 2JA8H 2RF4A 3K80C 1Q1BA 4B3TL 2UXCL 4HJ7A 4DV3L 3KYHC 4A3GH 4LFCL 1Q82C 1KXLA 1V1QA 5LMNW 4A3DH 2N8NA 2H5XA 3NENA 1PH1A 1PH7A 4BBSH 4X6AH 4JI6Q 3PCOB 3UE1A 3CC4A 1E7ZA 2ZM6Q 1TWCH 1E22A 4R4CA 1X54A 5JJIA 1TWHH 2B63G 3CD6A 4KHPL 4A3KG 4XIGS 3GD7A 3PIPA 2YV5A 1NMFA 2IX1A 1RL2A 5C44G 3BZKA 2UUCQ 3KJOA 2NZHA 1N36L 3M3YH 2KCMA 4A3LH 4K0KL 5FLMH 4GOPC 1E1TA 1V9PA 3TEHB 4DUYL 1LM0A 2Z0SA 1VQCA 2VQFL 1B8AA 3I4MH 3S1MH 5GAEC 3GTJH 4BBRH 3S15H 2AWNA 1HNXL 1BVSA 1TWAH 3M4PA 3CAMA 3HOWG 2IY5B 4DV0L 2WB1G 4LF9L 1FVIA 2UXBL 1SE8A 4P75A 1Q46A 4RG1A 5IP9H 2V1CC 4DV6Q 4AIMA 1XMQL 1Q86C 4JYAQ 4B3RQ 1A0IA 4BXXG 1YBYA 3T1YQ 2K52A 4A3JH 1N36Q 1AE2A 1J6QA 1VS0A 4K0KQ 4YHHL 4OO1I 1S72A 4IOAA 1P16A 5GAHC 5IP7H 2ATWA 5LMNL 5JJKA 2K50A 3ERSX 1HZAA 3F2CA 1VQDA 2K5HA 1HNXQ 2Q2UA 4HJ5A 3WWVA 4NXNQ 4LF9Q 4NXML 1I6HH 4A3CG 1E1OA 1HZBA 2IHFA 4JI1Q 4IFDG 2C35B 1YI2A 2CQOA 2XTIA 1HNZL 4DR7Q 3CP0A 3GDEA 2QEXA 3I4NH 1I50H 3OYYA 2RCNA 3AEVA 3S14H 1CKNA 3ZJYC 1YJ9A 4HIMA 1PH4A 2FXQA 1WI5A 1VQPA 2E5LL 1TWFH 3RZOH 2GVBA 3PUVA 1Y1WG 1XJVA 4QIWE 1N32L 4LF5Q 1UE1A 4DUZL 1AH9A 1I3QH 1NY4A 3NELA 1PH8A 4Y7NH 1HNZQ 2ZJQA 4GKKL 2Z6KA 4JI2Q 5C0XJ 3W1BA 2AWOA 4DV2L 4GOPA 4Y52H 4L5RC 2B29A 5JJLA 1W2BA 4GLAC 2K75A 2PQAA 3ULJA 2NVYH 1YJWA 1GM5A 5C4XG 5LMUQ 4A3BH 2R92H 4DR3Q 1SROA 1IBMQ 3HOZH 1E3PA 1OXTA 1U0LA 4BBRG 2PI2E 4LFAQ 1PA6A 4DV7L 4DUZQ 3GTLH 4LF4Q 1HR0Q 3CCSA 2OCEA 1IL2A 1MJCA 3PGZA 3GO5A 4DV2Q 1H95A 3GTOH 1YITA 3Q8DA 2F52A 1G291 3L7ZC 1QVCA 1BKBA 1FGUA 1NTGA 1YHAA 2QGQA 2JA6H 4XTCS 1I94L 3ICEA 1EIFA 4JOIC 4IOCA 5M5WH 2A19A 4DK3C 3UE0A 4GKJL 4JI0L 4UPAA 5FLXc 1XPUA 1KAWA 1E24A 2ASBA 3PUYA 1YVCA 2MQHA 2VZAA 4UP8A 2R7DA 1IZ6A 1WCMH 2IX0A 3I55A 2UU9Q 4LF6Q 1HH2P 2R93G 2VUMH 4UP9A 2VQEQ 2D62A 3I7FA 1Y14B 1EIYB 4B3MQ 1N8RC 2BH2A 2CFMA 1NMGA 2VW9A 3S1RH 3F2BA 3KF8B 4KLKA 3HKZE 3KDFB 4PZ7A 2MO0A 3NEMA 1VQLA 4DR6Q 2LSSA 3M85A 3PV0A 1VQ6A 2L15A 3RZDH 2RHSB 3CCMA 1Q81C 1Z9FA 2JA9A 3KLWA 1OXSC 5HGQA 1KIXA 4KI0A 4GLXA 3CC2A 2YTYA 4PZ6A 3T1HQ 4A3IG 4DAYB 4ME3A 3KFUA 1XTDA 2R7ZG 3U58A 4JI6L 4KHZA 5IWAL 3TREA 3F8TA 1I5FA 2D0OA 2ZM6L 2NZOA 2ES2A 4OXPA 4RMFA 2F4VQ 4IFDI 4IPHA 2NVXH 1JE5A 4YCVA 2GVAA 3J7A5 1YZ6A 2E2JH 4YWMA 1CKOA 1D8LA 1K83H 3PO2G 4B3SQ 5C3EH 3CF5A 1RIPA 2YYZA 3HFZB 3TS2A 2MO1A 2DGYA 2DUDA 1L1OC 2R6GA 2UUCL 1WOCA 1Y1VH 1L0WA 1MJEA 5FJ8H 5IWAQ 2I5LX 2AHOB 4IPGA 3ULLA 4BY1G 3G6EA 5BR8Q 2JA5H 2ZTEA 4R4QA 3CPWA 4OONA 4DR2Q 1XPOA 4YWKA 4MNOA 1X56A 5E7NA 1WCMG 1X3FA 1UWVA 4GNXB 3CMEA 3I2ZA 2NN6G 4JYAL 4DV6L 3EIVA 2VUMG 4B3RL 1V43A 4HIKA 1EFWA 1LYLA 4DR1Q 3T1YL 4LNQA 5IE8A 1UE7A 1BBUA 3FKIH 4JI7Q 1HR0W 2KHIA 1PFSA 4QGUA 2N49A 4AYBG 5M3FH 1KRTA 5C0XG 1VQAA 5M3MH 4LFBL 3BJUA 3L0OA 1JB7A 4NXNL 4A3MH 3LGJA 3HOXH 2RHQB 4JI1L 5IYDG 3S1QH 2Y0SE 4P72A 1QUQB 3VDYA 3H3VI 1MIUA 3HOYH 2YTVA 4DR7L 3OTOQ 4QQBX 2NVTH 3H0GG 1X3GA 1X6OA 5IYCH 3EN2A 3CCUA 3G48A 4JBWA 5HY6A 3CCVA 4BY7H 4J15A 2JK8A 1KHIA 2EQSA 3RNUA 4LFBQ 2A1AA 4AQYL 4LUZA 4LF5L 4C3HH 1Q8KA 2JA8G 3U4VA 4A3EH 1X9NA 4APVA 1CKMA 3CXCA 4A3GG 3A74A 1S3OA 4JI2L 4A3DG 4PMWA 2HT1A 5IY0A 3SGIA 2KENA 1X65A 1Q12A 2YTXA 3E0EA 3KF6B 1PH5A 2R7FA 2BA0A 3DM3A 1QVGA 4BBSG 1A8VA 2XGTA 3MEFA 5LMUL 4P71A 4DR3L 1IBML 4DV5Q 1Q7YC 2JA5G 4JI3Q 4AQYQ 4LFAL 2UUBQ 1VQGA 4LF4L 1SLJA 4LUVA 3H15A 1HR0L 1PYSB 1JJGA 3I56A 2VY3A 3BZCA 3EBEA 2OQKA 4NPSA 2JA7H 5AJ3Q 3KJPA 2VNUD 1MKHA 1L1OB 4JG2A 3U4ZA 1GKHA 1D7QA 4A3LG 1IBKQ 3PUZA 2JE6I 3K8AA 5IYBH 5FLMG 4LF7L 3CCRA 3OW2A 3I4MG 1SN8A 1WYDA 1SR3A 5GQOA 2JJQA 2WAQE 5JEAG 3TRZA 5GROA 4L5TA 1J5EQ 4UY8C 1WJJA 1EYGA 4TVAB 3JAMi 2B3GA 4JI8L 4X66Q 3M9BA 1KQSA 3HOXG 2K5VA 1PYBA 4GN4B 5IP9G 2OWOA 4DV4Q 2ZTDA 4A3FH 4LF6L 4MTNA 2UU9L 4GNXC 4DR5Q 4A3JG 2MNAA 1K9MC 1XMOL 3S16H 1IBLL 2I5MX 2Q2TA 2VQEL 1EOVA 2EIFA 4LF7Q 2N78A 1Z47A 3KDFA 3RLOA 4B3ML 1OXVA 2AKWB 5IP7G 3RN5A 1TWGH 1VQMA 3CC7A 3HOUH 2UXDL 3G71A 3D0FA 4YWLA 2HIVA 3L2PA 4DR6L 4JI8Q 4EX5A 4POFA 4P74A 5EAYA 4JI5Q 3B6YA 2NN6I 1YIJA 4BA1I 3I4NG 3PF4A 3KOJA 1LTLA 2JEBI 1XMOQ 1IBLQ 4JV5Q 4JBKA 1VQ4A 4OWTB 3J81c 3T1HL 1QZGA 3HOVH 3S17H 4LF8Q 2UXDQ 4WJ4A 3PSIA 5C0XI 1VQ8A 4IFDJ 1KC8C 3S24A 1VQKA 4PZ8A 3UDFA 4DK6C 1KL9A 5ELOA 1XNQQ 4BA2I 3S2HH 3M7NA 1JT8A 2F4VL 4C3JH 2PQAB 4A4IA 1PVOA 4X64Q 4C3IH 3G4SA 3RLNA 4B3SL 2OTJA 1OXXK 2B63H 4QJFA 4A3KH 1VQ7A 2HHHL 2PMZE 4JI4Q 2CWPA 1NBWA 2JQOA 4DR4L 1YEZA 1PH2A 4R4IA 5DLQE 4DKAC 2E2IH 1KD1C 4A3BG 2OQ0A 2CCZA 2R92G 2MFIA 4IJHA 1CSPA 2ZJPA 1TXYA 3HOZG 5C44H 1A63A 4JBMA 4H02A 2UUAL 1K8GA 5BR8L 4GNXA 4UP7A 5GADC 4DR2L 1HZ9A 3W1GA 1UE5A 2HHHQ 1HNWQ 3HOWH 4NB3A 4JOIA 4DR4Q 3A5ZB 1K0RA 4DR1L 3K7AH 3A0JA 4DV1Q 4LW1A 2JA6G 3CMAA 4ALPA 4BXXH 1T9HA 4JI7L 2QA4A 2K5NA 2UUAQ 1K73C 1SMXA 3BU2A 5IT9c 3PF5A 4A93H 3TQYA 1ASYA 1XPRA 1X3EA 2KHJA 1QUQA 3FHWA 1HJPA 4AYBE 1M90C 3JC66 3CCEA 3RR5A 1K8AC 1C7YA 1EWIA 2PI2A 2CWAA 2WB1E 1PH3A 3OTOL 1XNRL 4A3CH 3HOVG 3NBHB 1HZCA 2BA1A 1M1KC 2PNHA 2Q2IA 4X62L 3E9IA 4IPDA 1L2FA 1N34Q 3F1ZA 1W3SA 4X65Q 3AFPA 2IT1A 3U50C 4R4TA 1G6PA 2VS1A 3D31A 1S40A 1N33Q 1Y1WH 3PO3H 4IO9A 3F2DA 3ULPA 2K14A 1WFQA 2ZTCA 3KF6A 3DLLA 1XNRQ 2I0QA 4B3TQ 2UXCQ 4DV3Q 3K81C 1N9WA 4LFCQ 2HQLA 2E8GA 1C0AA 4X62Q 1DGSA 2JEAI 4JBJA 2WFWA 1ASZA 2HIXA 2Q2HA 3CPFA 1EQRA 2Z6KC 3M4QA 4DV5L 1CUKA 1UEBA 4JI3L 5C4XH 3I4OA 2UUBL 3PIOA 1FL0A 2OTLA 5C3EG 3RN2A 1L1OA 4KHPQ 3CW2C 3AFQA 3S1NH 2VL6A 3M4OH 3IRBA 5AJ3L 4MZ9A 3J81i 4TQUS 1Y1VG 1OTCA 1IBKL 4FDBA 3TS0A 3GTMH 2IHEA 5FJ8G 4HIDA 3GTQH 1B70B 4GN3B 3H3VH 2N3SA 4DPGA 4OWXB 1G51A 3J7ZC 4DUYQ 4A93G 1GD7A 2VQFQ 1J5EL 1LUZA 4QY7A 3J80c 3GTGH 3UDGA 4X66L 1NE3A 2KBNA 4YY3L 4DV4L 4DV0Q 2Y0SG 4DR5L 2LXKA 2LXJA 2UXBQ 2AMCB 1XMQQ 1EQQA 2R93H 2K4KA 5J3BA 3FKIG 3K7UC 2WP8J 1NJIC 4C2MH 4YHHQ 5M5YH 1SRUA 1OXUA 5M3FG 1VQJA 4DAMA 1VQ9A 5M3MG 4P73A 4EQ5A 4L5QA 1YNXA 5LMNQ 3HKSA 3GTKH 4A3MG 4JI5L 3UDXA 3J81j 1GVPA 4GN5A 5M5XH 3STBD 1YHQA 3K0XA 4YY3Q 3PO3G 4NXMQ 3HOYG 4QL5A 1JJ2A 4YCWA 1B7YB 2KCTA 2ALYB 1PH6A 4JV5L 3PUWA 2BH8A 5IYCG 3MXNB 1VQIA 4LF8L 1EUJA
chains in the Genus database with same CATH superfamily
4BY7G 1LO5D 3TMEA 2PQEA 2AUKA 3A56A 4ZK9B 4ODGA 4A3IH 2NTTA 4FF2A 2WACA 1FJGL 1BBWA 4CGYB 3R2IA 1PH9A 1VQEA 5L37A 4GKKQ 4RHSA 2F0EA 2B2VA 3OIPA 2XN9C 4OX9L 3W5OA 2G9DA 2B2WC 3HEJA 2WAQG 1ENCA 1IYJB 2NVQB 2ZXPA 2QCPX 5KNDA 1XX8A 1K3RA 3BYTB 3I3CA 1X32A 1SFOH 3IFDA 3V96A 3EA6A 1WTHA 1QCBD 2ID0A 4RAUC 1QZHA 3OWEB 3N6RA 4JC0A 1TS4A 2A68D 1PV4A 1I94Q 4UAIA 1AZQA 4K5WA 2IW3A 4A3FG 3EFXD 1JOKA 2JSOA 3NPPA 1S5CD 4O0AA 3K59A 3FEWX 5IYDH 4AH6A 1CSQA 3H0GH 2B2UC 3A8KE 1N34L 1E0BA 1KDBA 2L12A 3W3AA 4KY6A 1VQNA 2A69C 4PG3A 2JA8H 3K80C 4HJ7A 1S5ED 2RSNA 4X3KA 3S15B 2F0WA 1BCPC 1B3AA 4KY5A 4KHVA 4KY7A 4OIKA 4X6AH 1EEID 4JI6Q 4BWGB 3CHBD 4C3IG 1TWCH 5CV7A 3VR2A 2CH4A 1KXLA 3PIPA 3H94A 1Y69U 2PPBC 4DA2A 1NMFA 3BZKA 3KJOA 1JWSD 2F4IA 4K0KL 1E1TA 1HHVA 1LM0A 2Z0SA 3I4MH 2IX3A 2R93B 1HNXL 3I4NB 1F2YA 2G5DA 1TWAH 3HOWG 1FVIA 4P75A 1Q46A 1TQOA 5IP9H 1Q86C 3T1YQ 1STEA 1N36Q 3O13A 4XYQA 1P16A 5GAHC 5IP7H 5LMNL 2K50A 3BG3A 1HZAA 3D4RA 3F2CA 1MBYA 4HJ5A 3WWVA 2IHFA 1LTBD 2CQOA 2XTIA 4IUVA 4A3BB 3CP0A 4K2LA 1PTOB 3OYYA 4HIMA 3VYRA 1GUSA 3RZOH 2K5WA 1PH8A 2EY1A 4Y7NH 1HNZQ 3BVGA 5C0XJ 4JI2Q 3W1BA 2AWOA 1Q90A 1W2BA 2K75A 2PQAA 4HAEA 1WD1A 5M9OA 5C4XG 1SROA 1WCMB 1OXTA 1PA6A 4CDEC 1DZ1A 4KTAA 1IW7C 1HR0Q 3MFYA 1MJCA 1TU2B 4DV2Q 4ZUIA 2F52A 1NSNS 1LTRD 3L7ZC 2HCCA 3NTKA 4KN4C 4U68A 2B8GA 1YHAA 1VF5C 3K5LA 2QGQA 3ICEA 1DXMA 4JOIC 4IOCA 1K28A 1EY4A 4GKJL 3K0YA 2LS01 4JI0L 2F0TA 1XPUA 1KAWA 2ASBA 3PUYA 2VZAA 4FVMA 4LF6Q 2UU9Q 2K28A 5F2DA 3HG9A 4UP9A 2Z6BA 4DXGA 4H7BA 3NQIA 2D62A 1EIYB 4B3MQ 4ZRZA 5C4HA 2BH2A 1HRJA 2CFMA 5C6AA 3HKZE 3E0JA 3J7AF 2LSSA 2L15A 3CCMA 1SYCA 3KLWA 4BBSB 5HGQA 1KIXA 4GLXA 3A7LA 3BZDB 4KKSA 3J80L 2FJ2A 3BDCA 2NBFA 1PTOC 3JAME 4PNYA 4ME3A 3KFUA 3Q24A 5IWAL 3F8TA 1I5FA 4OXPA 2O5IC 3M3YB 1JE5A 5C5LA 1D8LA 3CF5A 1CHQD 1HUNA 2YYZA 4C1NK 4QUFA 2UUCL 3MFGA 1Z7TA 4BY1G 2JA5H 4R4QA 2NVTB 2PCFB 4MNOA 1F9RA 4PQXA 1UWVA 4LJZC 5KGUA 1BXTA 4BY7B 5IE8A 3W2DA 4QIWB 1C48A 2OT2A 4ME5A 2FINB 2N49A 4UDUC 2A5HA 1KRTA 5KYIA 2RKSA 4NXNL 4LK1C 3LGJA 2PZUA 4Q0FA 3MAQA 4P72A 1Z6HA 1TWFB 5HGTA 2QDLA 2SEBD 1RCVD 2X69A 3G48A 1TY0A 3CCVA 1UEAB 4J15A 2JK8A 4LFBQ 2EQSA 1L0YB 3QB3A 3CRLC 2GA4B 3MXNA 3U4VA 5G3LF 1K8MA 1LT5D 4A3DG 4IALA 3GTLB 4FXGC 4HCSA 1Y8NB 3DM3A 4KD3A 4JW0A 5J1ZA 5LMUL 4P71A 5EKIA 4A3FB 4DV5Q 3GTOB 2JA5G 1F9QA 3SK5A 4LF4L 5J39A 4DK0A 1IKLA 2VY3A 4NPSA 1HFNA 4FXKC 1IBKQ 1SNMA 5IYBH 2QKIC 4FF3A 1HPCA 1SN8A 3TRZA 1SR3A 4J1MA 5GROA 4L5TA 1J5EQ 2IJ0A 1EYGA 5DEHA 3M9BA 3VYUA 2OWOA 5JAVA 1G8ZD 1KNEA 1O7YA 2ZTDA 4DR5Q 1WTWA 2E2DC 1K9MC 3S2HB 2I5MX 2VQEL 1EOVA 1PRTB 4LF7Q 2N78A 1Z47A 3E3XA 4PMCA 1BO0A 3NQTA 3HOUH 3L3OC 1QILA 4YWLA 3T16A 4JI8Q 1JOQA 5EPLA 4JI5Q 3B6YA 2KJXA 4HN7A 2XVSA 3PF4A 2A74C 3KOJA 3MXGA 4CJ1B 1IBLQ 4JBKA 2PW5A 4B08A 3MXPA 4OWTB 3HOVH 4V190 4WJ4A 2DY7A 1OO9B 3M4YA 1KC8C 5CORA 2F3VA 3UDFA 5ELOA 2F0UA 5HURA 2RCFA 3SK8A 3K7AB 4MIUA 4B3SL 2OTJA 2O2LD 2QW7A 3OMCA 1J8IA 1NBWA 4DR4L 1YEZA 4A93B 5DLQE 2E2IH 4DKAC 1TS3A 1KD1C 2RQXA 2R92G 3MC0B 4IJHA 1TXYA 1H9RA 2Y0SB 5A35A 1SE3A 4NDXA 1B4OA 5EPKA 2J0TD 4JOIA 5KEEA 5M3MB 2B8FA 2JA6G 2QILA 4BXXH 1UUPA 4JI7L 3BU2A 3PF5A 5I2YA 4I65A 2EYFA 2TSSA 2PI2A 2CWAA 3ND8A 2PW7A 2EYMA 2L0CA 2XNAC 5ISRA 3HOVG 4N9TA 1M1KC 1D1KA 1PRTC 2PNHA 4A3EB 4RGOS 3S1NB 2A6HD 1N34Q 2AQ1B 5EQ0A 3F1ZA 2F3WA 1B1ZA 4CKEA 4F87A 4PMBA 3PO3H 2ZXOA 4IO9A 3KF6A 2F0GA 5G3LD 3P20A 3DMUA 3GV6A 1SSOA 3GTGB 5EKKA 4XXEA 2WFWA 1ASZA 3CPFA 2JA7B 1HUMA 3M4QA 1UEBA 4JI3L 2K32A 3R2TA 5C3EG 3RN2A 3CW2C 1BF4A 3M4OH 3IRBA 2XWBB 2EYJA 4MZ9A 3I70A 1Y1VG 4FDBA 4FF1A 4GN3B 2B2VC 2N3SA 3KUPA 3OWFA 4RGNA 3NWTA 2MUYA 4NMZA 3MXUA 2AMCB 2C5CA 3TDQA 2SOBA 4OGQC 2R93H 2K4KA 3K7UC 1YNJD 5C4JB 1ESRA 1SRUA 1VQ9A 1XTCD 4P73A 4L5QA 4DNRB 5LMNQ 1VF7A 5D3DA 1F9PA 3K0XA 4YY3Q 3PO3G 3HS0C 3HOYG 1B7YB 2KCTA 1PH6A 3KLSX 2BH8A 1O80A 2L9HA 1O7IA 4KKTA 2ZJRA 4A76A 2B63B 1IXRA 1CI3M 4A3KB 5I4DA 3S2DH 3CCQA 4DAVA 1MSGA 1YHBA 1R9TH 2PYKA 1F2MA 4DGZA 2DN8A 4LUOA 1VQOA 3DWQA 4M1UB 4OO1G 2CW0C 2WB1B 3GTPH 4L5SA 3I8ZA 3PIO3 1VQBA 2E2HH 4NP5A 4A75A 3T51B 3K6OA 1B9MA 4R4OA 2NN6H 3H09A 4DV1L 1ENAA 1G2SA 3K5NA 2BE5D 2EVBA 3OMGA 3NHHA 1KRSA 2RVLA 2BOSA 4GKJQ 2D0PA 2F0LA 1UE6A 4JI0Q 1VQ5A 4LWCA 3QIAA 1D5ZC 2CH4W 4NKLA 3CCLA 1TWHB 5D65A 3J80i 2IWHA 1U5KA 3FPUB 4POGA 1NNXA 4IJLA 1SE2A 4DFAA 2UXCL 4HTHA 4DV3L 3KYHC 5CR3A 1V1QA 3FPPA 2B2TC 1A3VA 4BBRB 1CQFA 3QG1A 4BBSH 1GHJA 1PH1A 1PH7A 4C3JG 3R93A 5JJIA 2H4OA 4RKBA 2HCIA 3GD7A 2A68C 1SYGA 1AEXA 5IGGA 1B53A 3M3YH 1B2TA 4CJ0B 2UUCQ 4L63B 4A3LH 4QF4A 5FLMH 4CBVA 4DUYL 2DY8A 1B8AA 5GAEC 4TRDA 1CFMA 2E74C 1I50B 1ICWA 4C2MB 1DOMA 3X3NA 4LF9L 4ILWA 2UXBL 4KJNA 2R61A 2K52A 4A3JH 1AE2A 1J6QA 4OO1I 4YHHL 2ICIA 2FFKB 4QMGA 1NUCA 5IGCA 3C46A 3BVZA 4H0LC 4NXNQ 1SNDA 4ABNA 1HZBA 4CDDC 1JQYD 2Z1CA 1YI2A 4ZQ3A 1EWHA 4F8MA 1KDCA 2DJGC 1MI2A 1WVLA 3ZJYC 1YJ9A 4IUNA 1PH4A 2QEJC 1VQPA 1TWFH 2GVBA 4QIWE 1UE1A 4DUZL 1AH9A 3CQZB 1NY4A 2ENBA 5C3WA 2K5DA 4Y52H 3D6CA 5JJLA 4GLAC 3ULJA 2NVYH 2OEOA 1YJWA 1GM5A 5LMUQ 1LTID 5KNCA 1E3PA 1BR9A 4DV7L 3GTLH 1SYEA 3VYTA 4LF4Q 3CCSA 1ZKOA 3GO5A 4HMIA 1SJHD 3PIP3 3DHQA 3GTOH 3NBIA 1BKBA 1NTGA 1EIFA 5A2QE 1KABA 1LABA 5JPMC 2Z4HA 2FMMA 2KEEA 4UPAA 3C1FA 1E24A 2RDGA 1F77A 3NE5B 1SE4A 5ELFA 2VUMH 2VQEQ 1CA5A 1F9SA 1TT2A 1NMGA 3IL8A 1S5DD 5C3EB 1G6ZA 3NEMA 3NK9A 1VQLA 4A3GB 3J7YW 2A73B 3RZDH 2RHSB 3A8JE 4S3SA 1Q81C 1EY7A 4RCOA 1D1IA 3CC2A 2YTYA 5BN5A 3FMCA 2SNMA 5FO7B 4A3IG 2EY6A 1XTDA 1BCPF 2D0OA 4RMFA 1EYAA 2ICEC 3M7GA 5K5PA 1CKOA 4B3SQ 2XIWA 2KECA 3TS2A 1HQMC 2DUDA 3IAYA 1O78A 1L1OC 2R6GA 5EBCA 5EJWA 2N55A 1MJEA 4RA8A 1QG7A 3HOXB 2I5LX 3ULLA 1XYIA 3LNNA 5JJZA 2XRQD 4OONA 1XPOA 1HQRD 3QR8A 1QWYA 3N52A 4DV6L 2VUMG 1IHZA 4B3RL 4LNQA 4QUCA 2K01A 4RWSC 1HA5A 4FYDA 1JORA 4XDXA 4JI7Q 1HR0W 2KEDA 1PFSA 5M3FH 1VQAA 5M3MH 3S14B 2L55A 3L0OA 1JB7A 3F2UA 3SR1A 4A3MH 2RHQB 5IYDG 2Y0SE 3H3VI 4DR7L 1JR0D 2YTVA 3ND9A 3H0GG 4OHJA 1V1OA 1I3QB 2EPBA 1DYQA 1B50A 3AU7A 5HY6A 3X3MA 1KLUD 2A1AA 3NTHA 4X3TA 3E5SA 4C3HH 1Q8KA 2JA8G 2B2TA 2SNSA 4A3EH 1X9NA 2VXWA 2B2YC 4DN4M 3H6MA 3OIQA 3A74A 4PV1C 3HOZB 4PMWA 3VR6A 5IY0A 1G91A 1Q12A 3KF6B 1ML0D 3DM1A 1A8VA 4C1NI 4DR3L 4JI3Q 4AQYQ 1VQGA 5IGBA 3KLRA 1PYSB 1JJGA 1TWGB 2JA7H 5M5WB 2VNUD 1GKHA 2JE6I 3K8AA 3CCRA 5JVG3 3I72A 3OW2A 3QWNA 3I4MG 1WYDA 2JJQA 5DNFA 3MWYW 1K8OA 5IP9G 4MTNA 2MNAA 1BUVT 2Q2TA 3CRKC 2EIFA 1ET6A 3KF8A 1KNAA 3KDFA 1OXVA 2AKWB 4C3JB 5IP7G 2UXDL 4DF7A 1LLRD 4DR6L 2EJFC 4G7OC 1EY8A 4EX5A 2Z8LA 3PQIA 4C3HG 5EAYA 4POFA 5EPJA 2OXPA 3KK7A 1SYBA 3BYYB 2G9HD 2R3ZA 1LTLA 1XMOQ 1AN8A 2F0FA 1VQ4A 4M8AA 4RH6A 1QZGA 3S17H 3S9WA 4N8FA 1K83B 2AQ2B 3IFTA 1S5FD 1FR3A 4PZ8A 4BA2I 1JT8A 1KL9A 5FO8B 3J7AV 3DWPA 4A4IA 1PVOA 4YIJA 5CV6A 3G4SA 3RLNA 3MVVA 1OXXK 2B63H 1PFNA 4A3KH 1VQ7A 2JQOA 1TS2A 1CSPA 2F0DA 5C44H 4JBMA 1DOLA 2D2CC 4H02A 1K8GA 3A8IE 5BR8L 4GNXA 4UP7A 2CVRA 1I4RA 1PLFA 1E2WA 4DR2L 3FKIB 1UE5A 2HHHQ 3D6WA 4FP5D 4DV1Q 1SNPA 3CMAA 1T9HA 3S1QB 3G6JB 2UUAQ 3EJIA 2KHJA 2KA7A 1QUQA 1HJPA 1PZID 3JC66 5E1FA 3RR5A 1K8AC 1K0SA 1EWIA 1XXGA 2WB1E 1SNCA 3RMHA 1PH3A 1XNRL 4A3CH 4IFDH 1HZCA 1RJTA 2Q2IA 1RDPD 3E9IA 1L2FA 1PXUA 2AUJD 3MTSA 2PZWA 3U50C 4R4TA 1EOTA 1Y1WH 1WTOA 3F2DA 3ULPA 2I0QA 5FO9B 2UXCQ 4DV3Q 2WAQB 3K81C 1N9WA 4H44C 2J7ZA 4X62Q 3SK6A 2JEAI 4JBJA 1YNND 1AW7A 5FKAC 2UUBL 3I4OA 4HEDA 1FL0A 1J9OA 2OTLA 1H9SB 1L1OA 4F7XA 3AFQA 5CV5A 1HFGA 1I4QA 5AJ3L 4K5XA 3GTKB 4FF4A 1O7ZA 2K05A 3OSOA 1HA6A 4HIDA 4DPGA 1G51A 4DUYQ 1I4XA 1GD7A 1ILQA 3J80c 4IUQA 3BVMA 2HDLA 3ERQA 3SVMA 2UXBQ 2LXJA 2IL8A 1M4VA 4A3IB 1EQQA 2LFNA 4TSSA 3EROA 1KLGD 2A6HC 3JAML 4C2MH 4YHHQ 4DAMA 1SJED 2JYOA 2ZT9C 3K5OA 4DK1A 1WTXA 3HKSA 1TR5A 1GVPA 3STBD 1YHQA 2KQ3A 4QL5A 1DD2A 3PUWA 5KNBA 1STHA 1GUGA 3MZ5A 2KVMA 2F0KA 4C3IB 4R1JA 5D3IB 1SFOB 2B2YA 1CHPD 1EZ8A 3FP9A 3SE0A 3WOEA 3J81E 1XNQL 5ELCA 2A8VA 2R7ZH 1G2TA 2FMCA 4CKCA 4GS3A 4X64L 5E3FA 1ZYRD 3PO2H 4IZ8A 3PUXA 4IPCA 2HUGA 4YCUA 3CQZH 4LAAA 3AMUA 1FJGQ 3HOWB 4B9XA 2MHVA 1FNVA 4K8IA 1L0XB 4DV7Q 5D14A 4Q5VA 4IN3A 1VMPA 3UDIA 4DNTB 1PHJA 3H0GB 5IYBG 1VQHA 1YNJC 3GV3A 1PZJD 4OX9Q 2PZTA 2MP1A 4WJ3M 3ZYYX 4O2DA 1ESFA 1JMCA 1A62A 5E4XA 4HJ9A 2I5HA 3GQBA 5EBDA 5C0XH 3NBHA 2NVQH 3AQQA 3NWSA 2EDGA 2F0IA 2NZ1D 2XRSD 2F3IA 3V05A 3OOCA 2EY5A 3HOUG 1ZXTA 2CKZB 5JVH3 1CZGA 1AE3A 1VCIA 3I4LA 1Q1EA 2RDFA 4X65L 4G7HC 4EQPA 1GO3E 1W6JA 5GAGC 3JAMc 3RLFA 1STAA 2RF4A 4WJWA 1SMYD 5IGFA 1JWUD 2F0PA 4LFCL 1Q82C 4A3GH 3I4MB 5C4XB 5LMNW 2H5XA 3OPOA 1BDOA 1TWAB 2EXZA 4OELB 3C2PA 1CQVA 1E22A 1X54A 3GTMB 4KHPL 4XIGS 2NWGA 3GTQB 1Q8IA 3LWEA 2A6ED 3TP6A 2HDMA 4ZLTF 1CZWA 2YV5A 5FLXL 2BE5C 2IX1A 1RL2A 3TN2A 1N36L 3DEPA 2KCMA 3P7JA 2VQFL 5DM63 2N88A 5JEAH 4XQNA 2AWNA 3NUCA 4F88A 3S15H 1BVSA 5CMDA 3CAMA 5M5YB 4DV0L 1QJOA 1SE8A 1W6KA 4DV6Q 4B3RQ 2EYOA 4BXXG 2KCCA 5JOBA 2XWJB 3RZOB 1VS0A 4K0KQ 4RFBA 1S72A 4IOAA 1DCZA 2ATWA 4Y7NB 5JJKA 1HNXQ 1VQDA 2K5HA 2L1BA 4NXML 1E1OA 1ENFA 1EIHA 4DR7Q 1HNZL 1KTKA 3MA2B 2K5QA 2QEXA 3I4NH 3Q22A 3AEVA 3S14H 1MSHA 1CKNA 1I4GA 3EQLC 5KYLA 4L8JA 2E5LL 1U9RA 4ID6A 1N32L 1BOSA 3K57A 2K03A 1I3QH 1LTTD 3NELA 1AZPA 4DV2L 4GOPA 1U4RA 2B29A 4BY1B 3D4DA 4A3BH 4DR3Q 3HOZH 1PTOH 3RUZA 2PI2E 2HD3A 2QF7A 3IKJA 4JK1C 2OCEA 2F0SA 1MD2D 1D2BA 4K6LA 1U4MA 1YITA 3Q8DA 4JVZA 3VR5A 3OW7A 1QE6A 1QVCA 2WKDA 1FGUA 2Q8RE 1O7LA 1BQQT 5CBAE 4K6DA 3DWAA 4U673 5M5WH 2A19A 3LWUA 4KN7C 4X3SA 3UE0A 5FLXc 2M2LA 1YVCA 2YU9B 2MQHA 1KDAA 3SXHA 2IX0A 1IZ6A 1WCMH 3I55A 2R93G 3WOFA 4RHRA 1N8RC 1WTRA 4K5VA 2VW9A 3KF8B 1DOKA 3KDFB 4PZ7A 4DR6Q 1LTAD 1EIGA 3V2TA 4A3DB 4CKBA 1CK1A 1Z9FA 4EQNA 1OXSC 1QNKA 3K5MA 4ZAIA 1EY5A 4PZ6A 3VR3A 1RTOA 2L4NA 2EOTA 3FVQA 2JA5B 1E2ZA 1A2UA 3DUZA 1ONLA 3TREA 2ZM6L 4IPHA 4YCVA 2GVAA 1KAAA 4YWMA 1K83H 3KLSA 2TMPA 1RIPA 4H13C 3S1MB 3HFZB 2MO1A 1NCVA 2DGYA 3GTJB 2KOLA 3K58A 4KJOA 1TKWB 1FGBD 1A6XA 1H9SA 5FJ8H 5IWAQ 1EYCA 1A3TA 3H91A 1VDZA 3TZDA 5BR8Q 3G6EA 3CPWA 4DR2Q 1X56A 1WCMG 2M9VA 4GNXB 2CQAA 3CMEA 3I2ZA 2NN6G 4JYAL 3EIVA 1C8CA 1LYLA 1BBUA 1I6HB 3FKIH 1BNZA 2ZXRA 4AYBG 5IGEA 4LFBL 3BJUA 4CJ2C 4JI1L 3S1QH 1QUQB 3VDYA 2NVTH 5FK9C 1X3GA 5IYCH 3CCUA 5KIXA 4CDFC 4BY7H 1RTNA 5J22A 1A15A 1EZ6A 3VA5A 3Q23A 4IUTA 4LUZA 4LF5L 4APVA 1CKMA 3CXCA 3ONAB 2R92B 2HT1A 3SGIA 2KENA 2YTXA 3E0EA 4BBSG 1PH5A 2R7FA 1QVGA 2JXMB 2F1MA 1IBML 1GUTA 1Q7YC 4LFAL 3L9AX 5I6YA 2UUBQ 1C4QA 3VR4A 4LUVA 1D6EC 3I56A 2JA6B 5IT9L 4G7ZC 2OQKA 3HOUB 5AJ3Q 3KJPA 4ULLA 2BCOA 1L1OB 1D7QA 3HGBA 4A3LG 3PUZA 5FLMG 2F03A 4LF7L 4EGVA 1CT1D 1GUWA 2WAQE 4UY8C 3BDOA 4TVAB 3JAMi 4JI8L 1RHPA 1KQSA 1LV9A 3HOVB 3FDTA 4A3FH 4GNXC 3S1RB 4A3JG 2Q8TA 1IBLL 3EVQA 1F2LA 1G6PA 3RN5A 5FOBB 2K1BA 3D0FA 2HIVA 1WTPA 1F2ZA 4J8QA 2MJ8A 2NN6I 2E2IB 4BA1I 4ZYSA 5T1GA 4CDCC 1B44D 2SDFA 4DAYA 2EY2A 2X6GA 3I90A 3T1HL 2NVXB 2WKCA 5EGTA 4N9PA 2E2JB 4IFDJ 2NUCA 4LMQD 3S2HH 1UNSA 4DK6C 1XNQQ 2F4VL 5IODA 1Y1VB 4X64Q 4C3IH 3C3LA 5COYA 1WD0A 3CU7A 4HSVA 1DONA 3QOLA 5IOCA 4R4IA 1PH2A 1SNQA 1HTPA 2CCZA 2D9UA 2MFIA 4K14A 2ZJPA 1A63A 2EZVA 4EQOA 1NAPA 4MN3A 4KK7A 1V8QA 3HOWH 4NB3A 4DR4Q 3I73A 3A5ZB 4DR1L 3K7AH 4LW1A 1MHWC 3NSWA 1Y8PB 2K5NA 2RBMA 3PO3B 4MHEA 2RSOA 1SMXA 4IURA 1SXTA 5IT9c 3HOYB 4A93H 4N8X1 1ASYA 1XPRA 3BS1A 2EJGC 3CCEA 2WIIB 1C7YA 1TS5A 3OTOL 3NBHB 1EFID 3M4OB 1STNA 1W3SA 4X65Q 5CV8A 1I6VC 2IT1A 1QNUA 2VS1A 1FD7D 4TKOB 4ZUJA 1WFQA 1ZEQX 1CM9A 2ZTCA 1BBXC 4LFCQ 1M8AA 2HQLA 1C0AA 1DGSA 1ICFB 2EYLA 2Z6KC 3C1EA 5C4XH 5A2QL 5K36H 1STBA 4KHPQ 1CA6A 3S1NH 2VL6A 4OL7A 1IKMA 3J81i 4G57A 3J80E 1OTCA 3GTMH 1I4PA 2IHEA 4DU9A 3GTQH 1R4PB 1U4LA 3J7ZC 4A93G 2VQFQ 3S16B 3GTGH 3UDGA 4X66L 1NE3A 4DV4L 4YY3L 4DV0Q 2Y0SG 1U4PA 2LXKA 1TVXA 5J3BA 3S2DB 5M5YH 3QJYA 1OXUA 5M3FG 5M3MG 1QOHA 4A3MG 1R9TB 3UDXA 2PMZB 4GN5A 4NXMQ 4JV5L 4O1NA 3U9SA 2RDHA 1VQIA 1YNNC 3GTPB 4LF8L 1EUJA 1JB3A 4ZKCB 3R3OA 4R9WA 1E2VA 1LT4D 5BN4A 1STYA 5K36G 2E2HB 1CKNB 2CHBD 4HIOA 4A3EG 2E5LQ 2PO4A 1N32Q 5C4JH 4I7ZC 1X55A 2BDOA 2NTSA 4HJ8A 4JI4L 3CKIB 1VQFA 1PMRA 5CV9A 1QVFA 2A69D 5H1SE 1PTOF 4WFN3 2EXDA 1YJNA 2F0NA 4AYBB 1PFMA 2J4XA 4GOPB 1STGA 1BCPD 3CCJA 3E9HA 1D5XC 4GLVB 1EL0A 2I46A 4BY1H 1SEBD 3ER0A 2JA7G 3GP7A 1HNWL 3HRZC 1C9OA 1EQVA 3KBGA 2F0QA 3MEHA 2DNEA 3QOJA 4Z9CB 3STBC 1JICA 2DNCA 4HCEA 1JJCB 1PDQA 3AYHB 1RODA 4DNIA 5C3XA 5JEAJ 1P8LA 4OWWB 2LY7A 3KBXA 1JOOA 3A54A 1PZKD 3HZXA 4HMJA 4JCVE 3HKZG 2YU9H 3E6ZX 2M00A 3A5UA 2WV6D 3R8BA 1EY6A 4UHVA 1HXYD 1R4QB 3SDZA 3DEOA 5ELNA 2GN5A 1ZYRC 4HJAA 1N33L 2F0MA 4EVOA 1EEFD 3PMFA 1B9NA 1NR4A 1Q1BA 4B3TL 2B2WA 5LL6X 2OF1A 2E76C 4A3DH 2N8NA 4K8JA 3NENA 1DM0B 2C9OA 2EYHA 3PCOB 3UE1A 1SNOA 4E6IA 3CC4A 1E7ZA 2ZM6Q 3D8GA 4R4CA 3DXJC 1TWHH 4A3JB 2B63G 3CD6A 4A3KG 3D3RA 3I91A 1T5XD 5BN3A 4OEMB 1H9MA 1WTVA 3QO2A 5C44G 2NZHA 4GOPC 1V9PA 3S1MH 1B3QA 2VB2X 3TEHB 1VQCA 1RD9D 5CYUA 3GTJH 4BBRH 1NR2A 1TIID 3M4PA 1AP0A 3ITPA 4RGTA 4CHTB 2IY5B 2EYPA 2WB1G 3G7LA 1IW7D 4RG1A 1XMQL 4JYAQ 2V1CC 3A55A 4AIMA 2K33A 1A0IA 2B2UA 1YBYA 5M5XB 3A7AB 1FNUA 5DM73 3P1HA 3ERSX 4P2CB 2Q2UA 1SMYC 4LF9Q 4RKLA 1I6HH 4A3CG 4JI1Q 5LHY1 4IFDG 2NVYB 2C35B 1DJRD 3GDEA 2Z4IA 1I50H 2RCNA 2Q8IB 3RD4A 4X3UA 2BDNA 4RCNA 3TZUA 2FXQA 1WI5A 1Q3LA 3PUVA 1Y1WG 1RF2D 1XJVA 4LF5Q 2A6EC 1JE4A 1SDFA 2ZJQA 4GKKL 2O4XA 2Z6KA 4ZCKA 4L5RC 4RGMA 1PFBA 3TP5A 1PTOD 5CBEE 2E75C 3NXWA 2R92H 1IBMQ 4BBRG 1MGSA 1U0LA 4LFAQ 3U9OA 4DUZQ 5I9OA 2VUMB 1V1PB 3T53B 1IL2A 3PGZA 3H3VC 5E4WC 1EU4A 4MTKA 1H95A 3P75A 5FLXE 1G291 3RZDB 1XWEA 4XTCS 1I94L 2JA6H 2KHSA 4DK3C 4R8NA 4GZYC 2I07B 2HQEA 3WDNA 4UP8A 2R7DA 1HH2P 3MHBA 1ILPA 3I7FA 1SBBB 1Y14B 3T4AC 5IIFA 4K2KA 2JA8B 5KRUA 3S1RH 3F2BA 4KLKA 2MO0A 3D4WA 3M85A 3PV0A 5CV4A 1VQ6A 4O42A 2JA9A 4XT3B 2Z9HA 4KI0A 5EKLA 5I9PA 4XT1B 1TWCB 1II3A 3T1HQ 1PRTF 2FHTA 4DAYB 4HSPA 2R7ZG 3U58A 1X3PA 4JI6L 4KHZA 2F0JA 2NZOA 2ES2A 2F4VQ 4IFDI 2NVXH 3J7A5 1YZ6A 2E2JH 5I6WA 3PO2G 5C3EH 1AFPA 4QCLA 3HP3A 5M3FB 1EY9A 1WOCA 1Y1VH 1L0WA 4A3MB 1A3UA 1GOZA 2AHOB 4IPGA 2K6AA 1PYWD 2ZTEA 4R8IA 4YWKA 5E7NA 4L6TB 1X3FA 1SYFA 2L5TA 1V43A 3URYA 4HIKA 1EFWA 4DR1Q 3T1YL 1UE7A 4C3HB 4G4KA 2V4DA 2KHIA 4QGUA 3J81L 1FYCA 5C0XG 1FNWA 1HTLD 3SK4A 3HOXH 5ELDA 3HOYH 1MIUA 4WORA 3OTOQ 4QQBX 1K3BC 3SHLA 2XSCA 1X6OA 3EN2A 4JBWA 4WRDA 1KHIA 3RNUA 4AQYL 4NW2A 2LMCB 1H9JA 4A3GG 1S3OA 4JI2L 1SAPA 4KD4A 1S5BD 1X65A 2QDBA 5AFWA 2BA0A 2XGTA 3MEFA 3NTIA 2DJFC 3Q6SA 4OO1H 1SLJA 4HR7B 1HR0L 1A2TA 3H15A 2AQ3B 3EBEA 3BZCA 1WTQA 1MKHA 4JG2A 3U4ZA 2EJMA 3HKZB 5LL6S 5DAUA 3SEBA 3TP8A 1IL8A 5GQOA 5JEAG 2JN4A 5ELEA 2MGSA 1LTSD 1WJJA 2B3GA 4X66Q 4ZKBB 4IUUA 3HOXG 3S17B 2K5VA 1PYBA 4GN4B 4IQZA 5CC4A 4DV4Q 4LF6L 2UU9L 1XMOL 3S16H 2LKVA 3RLOA 2NB0A 4B3ML 1TWGH 4IUPA 3CC7A 4XYOA 1VQMA 2F0HA 3G71A 3L2PA 4P74A 1GHKA 1YIJA 3VA7A 1UAPA 1I4HA 5NUCA 3I4NG 1EQTA 2JEBI 4JV5Q 5C44B 5IGDA 3J81c 5C5MA 4LF8Q 2UXDQ 3PSIA 1IYUA 5ELBA 5C0XI 1VQ8A 1PRTD 3S24A 1VQKA 3BDLA 3M7NA 4C3JH 2PQAB 1LT6D 3VYSA 2O5JC 1JC7A 1LACA 2P5ZX 1SYDA 4QJFA 2HHHL 2H1EA 2PMZE 4FO2A 2CWPA 4JI4Q 4A3BG 2OQ0A 3HOZG 5T1IA 3TSSA 2UUAL 1VMCA 3OHXC 1GUOA 2EE1A 1EY0A 3Q0AA 5GADC 2NYZD 1JCKB 1HZ9A 2K04A 3W1GA 5IT9E 4FNFA 3AB9A 1HNWQ 1K0RA 3A0JA 3NP8A 4C56C 4ALPA 2QA4A 1Y1WB 4OIJA 1K73C 1JWMD 3T13A 3TQYA 1M90C 1X3EA 3FHWA 1LTGD 2JP1A 2VB3X 4AYBE 4B9WA 1S4ZA 2WINB 5I2XA 2BA1A 4X62L 5C4ZA 4IPDA 5CGKA 1LT3D 3AFPA 5JPNC 4BS9A 2KCNA 1EYDA 2D5DA 3D31A 4V0BA 1S40A 3UI2A 1N33Q 4KMUC 2K14A 3DLLA 1XNRQ 4B3TQ 1HCZA 5TSSA 2E8GA 1Y8OB 1IYVA 4DXFA 4I7AA 2HIXA 2Q2HA 1EQRA 1GJXA 4DV5L 1CUKA 1CTMA 1GUNA 1TY2A 3PIOA 2X6LA 1ET9A 4JPBW 4TQUS 1IBKL 3TS0A 4QB4A 1QB5D 4XQJA 5FJ8G 4KV6A 1B70B 1V1PA 3T56B 3H3VH 1EU3A 2L11A 1X3QA 4OWXB 1GXDC 1J5EL 1LUZA 1RKNA 4QY7A 4DAPA 2CW0D 2KBNA 4DR5L 1H9KA 1XMQQ 2KUMA 2R7ZB 3FKIG 3FRPB 2WP8J 1NJIC 2RA4A 2F0OA 4KKUA 3TBIB 1VQJA 3TP7A 4EQ5A 2K7VA 1YNXA 3GTKH 4JI5L 1T5EA 3J81j 4XQQA 3LX0A 5M5XH 2PNRC 3PO2B 2MPMA 1EWCA 2F0VA 2B39A 1D5MC 2IPKD 1JJ2A 4YCWA 2ALYB 5IYCG 4FXDA 3MXNB 4J6HA 1BCPB
chains in the Genus database with same CATH topology
4BY7G 1O7IA 2ZJRA 4R1JA 4A76A 4A3IH 1IXRA 3FP9A 1XNQL 5K36G 1CKNB 1FJGL 4HIOA 4A3EG 2E5LQ 2A8VA 2R7ZH 3S2DH 1N32Q 1BBWA 5C4JH 4GS3A 4X64L 3CCQA 1X55A 1PH9A 4HJ8A 1VQEA 1YHBA 1R9TH 4JI4L 1VQFA 4GKKQ 3PO2H 1QVFA 5H1SE 3PUXA 4IPCA 4YCUA 4OX9L 3CQZH 3W5OA 2EXDA 4LUOA 1VQOA 1YJNA 4GOPB 2WAQG 1IYJB 1FJGQ 4OO1G 3CCJA 3E9HA 4GLVB 3GTPH 1K3RA 4L5SA 4DV7Q 4BY1H 3ER0A 2JA7G 1SFOH 3UDIA 1VQBA 2ID0A 1HNWL 1QZHA 1PHJA 2E2HH 4JC0A 5IYBG 4A75A 1VQHA 1C9OA 4OX9Q 4R4OA 4DV1L 1PV4A 4WJ3M 4O2DA 1I94Q 3STBC 1JMCA 1A62A 1KRSA 4GKJQ 4HJ9A 2I5HA 2D0PA 4A3FG 1UE6A 4JI0Q 1JJCB 1VQ5A 3AYHB 4DNIA 2NVQH 4LWCA 3AQQA 4O0AA 5JEAJ 1P8LA 4OWWB 5IYDH 2F3IA 4AH6A 3HOUG 1CSQA 2CKZB 4JCVE 3CCLA 3HKZG 3H0GH 2YU9H 3A5UA 3J80i 1N34L 1U5KA 1AE3A 1VCIA 1Q1EA 4X65L 4POGA 5ELNA 2GN5A 4HJAA 4IJLA 1N33L 1GO3E 5GAGC 1VQNA 3JAMc 4PG3A 3RLFA 2JA8H 2RF4A 3K80C 1Q1BA 4B3TL 2UXCL 4HJ7A 4DV3L 3KYHC 4A3GH 4LFCL 1Q82C 1KXLA 1V1QA 5LMNW 4A3DH 2N8NA 2H5XA 3NENA 1PH1A 1PH7A 4BBSH 4X6AH 4JI6Q 3PCOB 3UE1A 3CC4A 1E7ZA 2ZM6Q 1TWCH 1E22A 4R4CA 1X54A 5JJIA 1TWHH 2B63G 3CD6A 4KHPL 4A3KG 4XIGS 3GD7A 3PIPA 2YV5A 1NMFA 2IX1A 1RL2A 5C44G 3BZKA 2UUCQ 3KJOA 2NZHA 1N36L 3M3YH 2KCMA 4A3LH 4K0KL 5FLMH 4GOPC 1E1TA 1V9PA 3TEHB 4DUYL 1LM0A 2Z0SA 1VQCA 2VQFL 1B8AA 3I4MH 3S1MH 5GAEC 3GTJH 4BBRH 3S15H 2AWNA 1HNXL 1BVSA 1TWAH 3M4PA 3CAMA 3HOWG 2IY5B 4DV0L 2WB1G 4LF9L 1FVIA 2UXBL 1SE8A 4P75A 1Q46A 4RG1A 5IP9H 2V1CC 4DV6Q 4AIMA 1XMQL 1Q86C 4JYAQ 4B3RQ 1A0IA 4BXXG 1YBYA 3T1YQ 2K52A 4A3JH 1N36Q 1AE2A 1J6QA 1VS0A 4K0KQ 4YHHL 4OO1I 1S72A 4IOAA 1P16A 5GAHC 5IP7H 2ATWA 5LMNL 5JJKA 2K50A 3ERSX 1HZAA 3F2CA 1VQDA 2K5HA 1HNXQ 2Q2UA 4HJ5A 3WWVA 4NXNQ 4LF9Q 4NXML 1I6HH 4A3CG 1E1OA 1HZBA 2IHFA 4JI1Q 4IFDG 2C35B 1YI2A 2CQOA 2XTIA 1HNZL 4DR7Q 3CP0A 3GDEA 2QEXA 3I4NH 1I50H 3OYYA 2RCNA 3AEVA 3S14H 1CKNA 3ZJYC 1YJ9A 4HIMA 1PH4A 2FXQA 1WI5A 1VQPA 2E5LL 1TWFH 3RZOH 2GVBA 3PUVA 1Y1WG 1XJVA 4QIWE 1N32L 4LF5Q 1UE1A 4DUZL 1AH9A 1I3QH 1NY4A 3NELA 1PH8A 4Y7NH 1HNZQ 2ZJQA 4GKKL 2Z6KA 4JI2Q 5C0XJ 3W1BA 2AWOA 4DV2L 4GOPA 4Y52H 4L5RC 2B29A 5JJLA 1W2BA 4GLAC 2K75A 2PQAA 3ULJA 2NVYH 1YJWA 1GM5A 5C4XG 5LMUQ 4A3BH 2R92H 4DR3Q 1SROA 1IBMQ 3HOZH 1E3PA 1OXTA 1U0LA 4BBRG 2PI2E 4LFAQ 1PA6A 4DV7L 4DUZQ 3GTLH 4LF4Q 1HR0Q 3CCSA 2OCEA 1IL2A 1MJCA 3PGZA 3GO5A 4DV2Q 1H95A 3GTOH 1YITA 3Q8DA 2F52A 1G291 3L7ZC 1QVCA 1BKBA 1FGUA 1NTGA 1YHAA 2QGQA 2JA6H 4XTCS 1I94L 3ICEA 1EIFA 4JOIC 4IOCA 5M5WH 2A19A 4DK3C 3UE0A 4GKJL 4JI0L 4UPAA 5FLXc 1XPUA 1KAWA 1E24A 2ASBA 3PUYA 1YVCA 2MQHA 2VZAA 4UP8A 2R7DA 1IZ6A 1WCMH 2IX0A 3I55A 2UU9Q 4LF6Q 1HH2P 2R93G 2VUMH 4UP9A 2VQEQ 2D62A 3I7FA 1Y14B 1EIYB 4B3MQ 1N8RC 2BH2A 2CFMA 1NMGA 2VW9A 3S1RH 3F2BA 3KF8B 4KLKA 3HKZE 3KDFB 4PZ7A 2MO0A 3NEMA 1VQLA 4DR6Q 2LSSA 3M85A 3PV0A 1VQ6A 2L15A 3RZDH 2RHSB 3CCMA 1Q81C 1Z9FA 2JA9A 3KLWA 1OXSC 5HGQA 1KIXA 4KI0A 4GLXA 3CC2A 2YTYA 4PZ6A 3T1HQ 4A3IG 4DAYB 4ME3A 3KFUA 1XTDA 2R7ZG 3U58A 4JI6L 4KHZA 5IWAL 3TREA 3F8TA 1I5FA 2D0OA 2ZM6L 2NZOA 2ES2A 4OXPA 4RMFA 2F4VQ 4IFDI 4IPHA 2NVXH 1JE5A 4YCVA 2GVAA 3J7A5 1YZ6A 2E2JH 4YWMA 1CKOA 1D8LA 1K83H 3PO2G 4B3SQ 5C3EH 3CF5A 1RIPA 2YYZA 3HFZB 3TS2A 2MO1A 2DGYA 2DUDA 1L1OC 2R6GA 2UUCL 1WOCA 1Y1VH 1L0WA 1MJEA 5FJ8H 5IWAQ 2I5LX 2AHOB 4IPGA 3ULLA 4BY1G 3G6EA 5BR8Q 2JA5H 2ZTEA 4R4QA 3CPWA 4OONA 4DR2Q 1XPOA 4YWKA 4MNOA 1X56A 5E7NA 1WCMG 1X3FA 1UWVA 4GNXB 3CMEA 3I2ZA 2NN6G 4JYAL 4DV6L 3EIVA 2VUMG 4B3RL 1V43A 4HIKA 1EFWA 1LYLA 4DR1Q 3T1YL 4LNQA 5IE8A 1UE7A 1BBUA 3FKIH 4JI7Q 1HR0W 2KHIA 1PFSA 4QGUA 2N49A 4AYBG 5M3FH 1KRTA 5C0XG 1VQAA 5M3MH 4LFBL 3BJUA 3L0OA 1JB7A 4NXNL 4A3MH 3LGJA 3HOXH 2RHQB 4JI1L 5IYDG 3S1QH 2Y0SE 4P72A 1QUQB 3VDYA 3H3VI 1MIUA 3HOYH 2YTVA 4DR7L 3OTOQ 4QQBX 2NVTH 3H0GG 1X3GA 1X6OA 5IYCH 3EN2A 3CCUA 3G48A 4JBWA 5HY6A 3CCVA 4BY7H 4J15A 2JK8A 1KHIA 2EQSA 3RNUA 4LFBQ 2A1AA 4AQYL 4LUZA 4LF5L 4C3HH 1Q8KA 2JA8G 3U4VA 4A3EH 1X9NA 4APVA 1CKMA 3CXCA 4A3GG 3A74A 1S3OA 4JI2L 4A3DG 4PMWA 2HT1A 5IY0A 3SGIA 2KENA 1X65A 1Q12A 2YTXA 3E0EA 3KF6B 1PH5A 2R7FA 2BA0A 3DM3A 1QVGA 4BBSG 1A8VA 2XGTA 3MEFA 5LMUL 4P71A 4DR3L 1IBML 4DV5Q 1Q7YC 2JA5G 4JI3Q 4AQYQ 4LFAL 2UUBQ 1VQGA 4LF4L 1SLJA 4LUVA 3H15A 1HR0L 1PYSB 1JJGA 3I56A 2VY3A 3BZCA 3EBEA 2OQKA 4NPSA 2JA7H 5AJ3Q 3KJPA 2VNUD 1MKHA 1L1OB 4JG2A 3U4ZA 1GKHA 1D7QA 4A3LG 1IBKQ 3PUZA 2JE6I 3K8AA 5IYBH 5FLMG 4LF7L 3CCRA 3OW2A 3I4MG 1SN8A 1WYDA 1SR3A 5GQOA 2JJQA 2WAQE 5JEAG 3TRZA 5GROA 4L5TA 1J5EQ 4UY8C 1WJJA 1EYGA 4TVAB 3JAMi 2B3GA 4JI8L 4X66Q 3M9BA 1KQSA 3HOXG 2K5VA 1PYBA 4GN4B 5IP9G 2OWOA 4DV4Q 2ZTDA 4A3FH 4LF6L 4MTNA 2UU9L 4GNXC 4DR5Q 4A3JG 2MNAA 1K9MC 1XMOL 3S16H 1IBLL 2I5MX 2Q2TA 2VQEL 1EOVA 2EIFA 4LF7Q 2N78A 1Z47A 3KDFA 3RLOA 4B3ML 1OXVA 2AKWB 5IP7G 3RN5A 1TWGH 1VQMA 3CC7A 3HOUH 2UXDL 3G71A 3D0FA 4YWLA 2HIVA 3L2PA 4DR6L 4JI8Q 4EX5A 4POFA 4P74A 5EAYA 4JI5Q 3B6YA 2NN6I 1YIJA 4BA1I 3I4NG 3PF4A 3KOJA 1LTLA 2JEBI 1XMOQ 1IBLQ 4JV5Q 4JBKA 1VQ4A 4OWTB 3J81c 3T1HL 1QZGA 3HOVH 3S17H 4LF8Q 2UXDQ 4WJ4A 3PSIA 5C0XI 1VQ8A 4IFDJ 1KC8C 3S24A 1VQKA 4PZ8A 3UDFA 4DK6C 1KL9A 5ELOA 1XNQQ 4BA2I 3S2HH 3M7NA 1JT8A 2F4VL 4C3JH 2PQAB 4A4IA 1PVOA 4X64Q 4C3IH 3G4SA 3RLNA 4B3SL 2OTJA 1OXXK 2B63H 4QJFA 4A3KH 1VQ7A 2HHHL 2PMZE 4JI4Q 2CWPA 1NBWA 2JQOA 4DR4L 1YEZA 1PH2A 4R4IA 5DLQE 4DKAC 2E2IH 1KD1C 4A3BG 2OQ0A 2CCZA 2R92G 2MFIA 4IJHA 1CSPA 2ZJPA 1TXYA 3HOZG 5C44H 1A63A 4JBMA 4H02A 2UUAL 1K8GA 5BR8L 4GNXA 4UP7A 5GADC 4DR2L 1HZ9A 3W1GA 1UE5A 2HHHQ 1HNWQ 3HOWH 4NB3A 4JOIA 4DR4Q 3A5ZB 1K0RA 4DR1L 3K7AH 3A0JA 4DV1Q 4LW1A 2JA6G 3CMAA 4ALPA 4BXXH 1T9HA 4JI7L 2QA4A 2K5NA 2UUAQ 1K73C 1SMXA 3BU2A 5IT9c 3PF5A 4A93H 3TQYA 1ASYA 1XPRA 1X3EA 2KHJA 1QUQA 3FHWA 1HJPA 4AYBE 1M90C 3JC66 3CCEA 3RR5A 1K8AC 1C7YA 1EWIA 2PI2A 2CWAA 2WB1E 1PH3A 3OTOL 1XNRL 4A3CH 3HOVG 3NBHB 1HZCA 2BA1A 1M1KC 2PNHA 2Q2IA 4X62L 3E9IA 4IPDA 1L2FA 1N34Q 3F1ZA 1W3SA 4X65Q 3AFPA 2IT1A 3U50C 4R4TA 1G6PA 2VS1A 3D31A 1S40A 1N33Q 1Y1WH 3PO3H 4IO9A 3F2DA 3ULPA 2K14A 1WFQA 2ZTCA 3KF6A 3DLLA 1XNRQ 2I0QA 4B3TQ 2UXCQ 4DV3Q 3K81C 1N9WA 4LFCQ 2HQLA 2E8GA 1C0AA 4X62Q 1DGSA 2JEAI 4JBJA 2WFWA 1ASZA 2HIXA 2Q2HA 3CPFA 1EQRA 2Z6KC 3M4QA 4DV5L 1CUKA 1UEBA 4JI3L 5C4XH 3I4OA 2UUBL 3PIOA 1FL0A 2OTLA 5C3EG 3RN2A 1L1OA 4KHPQ 3CW2C 3AFQA 3S1NH 2VL6A 3M4OH 3IRBA 5AJ3L 4MZ9A 3J81i 4TQUS 1Y1VG 1OTCA 1IBKL 4FDBA 3TS0A 3GTMH 2IHEA 5FJ8G 4HIDA 3GTQH 1B70B 4GN3B 3H3VH 2N3SA 4DPGA 4OWXB 1G51A 3J7ZC 4DUYQ 4A93G 1GD7A 2VQFQ 1J5EL 1LUZA 4QY7A 3J80c 3GTGH 3UDGA 4X66L 1NE3A 2KBNA 4YY3L 4DV4L 4DV0Q 2Y0SG 4DR5L 2LXKA 2LXJA 2UXBQ 2AMCB 1XMQQ 1EQQA 2R93H 2K4KA 5J3BA 3FKIG 3K7UC 2WP8J 1NJIC 4C2MH 4YHHQ 5M5YH 1SRUA 1OXUA 5M3FG 1VQJA 4DAMA 1VQ9A 5M3MG 4P73A 4EQ5A 4L5QA 1YNXA 5LMNQ 3HKSA 3GTKH 4A3MG 4JI5L 3UDXA 3J81j 1GVPA 4GN5A 5M5XH 3STBD 1YHQA 3K0XA 4YY3Q 3PO3G 4NXMQ 3HOYG 4QL5A 1JJ2A 4YCWA 1B7YB 2KCTA 2ALYB 1PH6A 4JV5L 3PUWA 2BH8A 5IYCG 3MXNB 1VQIA 4LF8L 1EUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 G;  1O7I A;  2ZJR A;  4R1J A;  4A76 A;  4A3I H;  1IXR A;  3FP9 A;  1XNQ L;  5K36 G;  1CKN B;  1FJG L;  4HIO A;  4A3E G;  2E5L Q;  2A8V A;  2R7Z H;  3S2D H;  1N32 Q;  1BBW A;  5C4J H;  4GS3 A;  4X64 L;  3CCQ A;  1X55 A;  1PH9 A;  4HJ8 A;  1VQE A;  1YHB A;  1R9T H;  4JI4 L;  1VQF A;  4GKK Q;  3PO2 H;  1QVF A;  5H1S E;  3PUX A;  4IPC A;  4YCU A;  4OX9 L;  3CQZ H;  3W5O A;  2EXD A;  4LUO A;  1VQO A;  1YJN A;  4GOP B;  2WAQ G;  1IYJ B;  1FJG Q;  4OO1 G;  3CCJ A;  3E9H A;  4GLV B;  3GTP H;  1K3R A;  4L5S A;  4DV7 Q;  4BY1 H;  3ER0 A;  2JA7 G;  1SFO H;  3UDI A;  1VQB A;  2ID0 A;  1HNW L;  1QZH A;  1PHJ A;  2E2H H;  4JC0 A;  5IYB G;  4A75 A;  1VQH A;  1C9O A;  4OX9 Q;  4R4O A;  4DV1 L;  1PV4 A;  4WJ3 M;  4O2D A;  1I94 Q;  3STB C;  1JMC A;  1A62 A;  1KRS A;  4GKJ Q;  4HJ9 A;  2I5H A;  2D0P A;  4A3F G;  1UE6 A;  4JI0 Q;  1JJC B;  1VQ5 A;  3AYH B;  4DNI A;  2NVQ H;  4LWC A;  3AQQ A;  4O0A A;  5JEA J;  1P8L A;  4OWW B;  5IYD H;  2F3I A;  4AH6 A;  3HOU G;  1CSQ A;  2CKZ B;  4JCV E;  3CCL A;  3HKZ G;  3H0G H;  2YU9 H;  3A5U A;  3J80 i;  1N34 L;  1U5K A;  1AE3 A;  1VCI A;  1Q1E A;  4X65 L;  4POG A;  5ELN A;  2GN5 A;  4HJA A;  4IJL A;  1N33 L;  1GO3 E;  5GAG C;  1VQN A;  3JAM c;  4PG3 A;  3RLF A;  2JA8 H;  2RF4 A;  3K80 C;  1Q1B A;  4B3T L;  2UXC L;  4HJ7 A;  4DV3 L;  3KYH C;  4A3G H;  4LFC L;  1Q82 C;  1KXL A;  1V1Q A;  5LMN W;  4A3D H;  2N8N A;  2H5X A;  3NEN A;  1PH1 A;  1PH7 A;  4BBS H;  4X6A H;  4JI6 Q;  3PCO B;  3UE1 A;  3CC4 A;  1E7Z A;  2ZM6 Q;  1TWC H;  1E22 A;  4R4C A;  1X54 A;  5JJI A;  1TWH H;  2B63 G;  3CD6 A;  4KHP L;  4A3K G;  4XIG S;  3GD7 A;  3PIP A;  2YV5 A;  1NMF A;  2IX1 A;  1RL2 A;  5C44 G;  3BZK A;  2UUC Q;  3KJO A;  2NZH A;  1N36 L;  3M3Y H;  2KCM A;  4A3L H;  4K0K L;  5FLM H;  4GOP C;  1E1T A;  1V9P A;  3TEH B;  4DUY L;  1LM0 A;  2Z0S A;  1VQC A;  2VQF L;  1B8A A;  3I4M H;  3S1M H;  5GAE C;  3GTJ H;  4BBR H;  3S15 H;  2AWN A;  1HNX L;  1BVS A;  1TWA H;  3M4P A;  3CAM A;  3HOW G;  2IY5 B;  4DV0 L;  2WB1 G;  4LF9 L;  1FVI A;  2UXB L;  1SE8 A;  4P75 A;  1Q46 A;  4RG1 A;  5IP9 H;  2V1C C;  4DV6 Q;  4AIM A;  1XMQ L;  1Q86 C;  4JYA Q;  4B3R Q;  1A0I A;  4BXX G;  1YBY A;  3T1Y Q;  2K52 A;  4A3J H;  1N36 Q;  1AE2 A;  1J6Q A;  1VS0 A;  4K0K Q;  4YHH L;  4OO1 I;  1S72 A;  4IOA A;  1P16 A;  5GAH C;  5IP7 H;  2ATW A;  5LMN L;  5JJK A;  2K50 A;  3ERS X;  1HZA A;  3F2C A;  1VQD A;  2K5H A;  1HNX Q;  2Q2U A;  4HJ5 A;  3WWV A;  4NXN Q;  4LF9 Q;  4NXM L;  1I6H H;  4A3C G;  1E1O A;  1HZB A;  2IHF A;  4JI1 Q;  4IFD G;  2C35 B;  1YI2 A;  2CQO A;  2XTI A;  1HNZ L;  4DR7 Q;  3CP0 A;  3GDE A;  2QEX A;  3I4N H;  1I50 H;  3OYY A;  2RCN A;  3AEV A;  3S14 H;  1CKN A;  3ZJY C;  1YJ9 A;  4HIM A;  1PH4 A;  2FXQ A;  1WI5 A;  1VQP A;  2E5L L;  1TWF H;  3RZO H;  2GVB A;  3PUV A;  1Y1W G;  1XJV A;  4QIW E;  1N32 L;  4LF5 Q;  1UE1 A;  4DUZ L;  1AH9 A;  1I3Q H;  1NY4 A;  3NEL A;  1PH8 A;  4Y7N H;  1HNZ Q;  2ZJQ A;  4GKK L;  2Z6K A;  4JI2 Q;  5C0X J;  3W1B A;  2AWO A;  4DV2 L;  4GOP A;  4Y52 H;  4L5R C;  2B29 A;  5JJL A;  1W2B A;  4GLA C;  2K75 A;  2PQA A;  3ULJ A;  2NVY H;  1YJW A;  1GM5 A;  5C4X G;  5LMU Q;  4A3B H;  2R92 H;  4DR3 Q;  1SRO A;  1IBM Q;  3HOZ H;  1E3P A;  1OXT A;  1U0L A;  4BBR G;  2PI2 E;  4LFA Q;  1PA6 A;  4DV7 L;  4DUZ Q;  3GTL H;  4LF4 Q;  1HR0 Q;  3CCS A;  2OCE A;  1IL2 A;  1MJC A;  3PGZ A;  3GO5 A;  4DV2 Q;  1H95 A;  3GTO H;  1YIT A;  3Q8D A;  2F52 A;  1G29 1;  3L7Z C;  1QVC A;  1BKB A;  1FGU A;  1NTG A;  1YHA A;  2QGQ A;  2JA6 H;  4XTC S;  1I94 L;  3ICE A;  1EIF A;  4JOI C;  4IOC A;  5M5W H;  2A19 A;  4DK3 C;  3UE0 A;  4GKJ L;  4JI0 L;  4UPA A;  5FLX c;  1XPU A;  1KAW A;  1E24 A;  2ASB A;  3PUY A;  1YVC A;  2MQH A;  2VZA A;  4UP8 A;  2R7D A;  1IZ6 A;  1WCM H;  2IX0 A;  3I55 A;  2UU9 Q;  4LF6 Q;  1HH2 P;  2R93 G;  2VUM H;  4UP9 A;  2VQE Q;  2D62 A;  3I7F A;  1Y14 B;  1EIY B;  4B3M Q;  1N8R C;  2BH2 A;  2CFM A;  1NMG A;  2VW9 A;  3S1R H;  3F2B A;  3KF8 B;  4KLK A;  3HKZ E;  3KDF B;  4PZ7 A;  2MO0 A;  3NEM A;  1VQL A;  4DR6 Q;  2LSS A;  3M85 A;  3PV0 A;  1VQ6 A;  2L15 A;  3RZD H;  2RHS B;  3CCM A;  1Q81 C;  1Z9F A;  2JA9 A;  3KLW A;  1OXS C;  5HGQ A;  1KIX A;  4KI0 A;  4GLX A;  3CC2 A;  2YTY A;  4PZ6 A;  3T1H Q;  4A3I G;  4DAY B;  4ME3 A;  3KFU A;  1XTD A;  2R7Z G;  3U58 A;  4JI6 L;  4KHZ A;  5IWA L;  3TRE A;  3F8T A;  1I5F A;  2D0O A;  2ZM6 L;  2NZO A;  2ES2 A;  4OXP A;  4RMF A;  2F4V Q;  4IFD I;  4IPH A;  2NVX H;  1JE5 A;  4YCV A;  2GVA A;  3J7A 5;  1YZ6 A;  2E2J H;  4YWM A;  1CKO A;  1D8L A;  1K83 H;  3PO2 G;  4B3S Q;  5C3E H;  3CF5 A;  1RIP A;  2YYZ A;  3HFZ B;  3TS2 A;  2MO1 A;  2DGY A;  2DUD A;  1L1O C;  2R6G A;  2UUC L;  1WOC A;  1Y1V H;  1L0W A;  1MJE A;  5FJ8 H;  5IWA Q;  2I5L X;  2AHO B;  4IPG A;  3ULL A;  4BY1 G;  3G6E A;  5BR8 Q;  2JA5 H;  2ZTE A;  4R4Q A;  3CPW A;  4OON A;  4DR2 Q;  1XPO A;  4YWK A;  4MNO A;  1X56 A;  5E7N A;  1WCM G;  1X3F A;  1UWV A;  4GNX B;  3CME A;  3I2Z A;  2NN6 G;  4JYA L;  4DV6 L;  3EIV A;  2VUM G;  4B3R L;  1V43 A;  4HIK A;  1EFW A;  1LYL A;  4DR1 Q;  3T1Y L;  4LNQ A;  5IE8 A;  1UE7 A;  1BBU A;  3FKI H;  4JI7 Q;  1HR0 W;  2KHI A;  1PFS A;  4QGU A;  2N49 A;  4AYB G;  5M3F H;  1KRT A;  5C0X G;  1VQA A;  5M3M H;  4LFB L;  3BJU A;  3L0O A;  1JB7 A;  4NXN L;  4A3M H;  3LGJ A;  3HOX H;  2RHQ B;  4JI1 L;  5IYD G;  3S1Q H;  2Y0S E;  4P72 A;  1QUQ B;  3VDY A;  3H3V I;  1MIU A;  3HOY H;  2YTV A;  4DR7 L;  3OTO Q;  4QQB X;  2NVT H;  3H0G G;  1X3G A;  1X6O A;  5IYC H;  3EN2 A;  3CCU A;  3G48 A;  4JBW A;  5HY6 A;  3CCV A;  4BY7 H;  4J15 A;  2JK8 A;  1KHI A;  2EQS A;  3RNU A;  4LFB Q;  2A1A A;  4AQY L;  4LUZ A;  4LF5 L;  4C3H H;  1Q8K A;  2JA8 G;  3U4V A;  4A3E H;  1X9N A;  4APV A;  1CKM A;  3CXC A;  4A3G G;  3A74 A;  1S3O A;  4JI2 L;  4A3D G;  4PMW A;  2HT1 A;  5IY0 A;  3SGI A;  2KEN A;  1X65 A;  1Q12 A;  2YTX A;  3E0E A;  3KF6 B;  1PH5 A;  2R7F A;  2BA0 A;  3DM3 A;  1QVG A;  4BBS G;  1A8V A;  2XGT A;  3MEF A;  5LMU L;  4P71 A;  4DR3 L;  1IBM L;  4DV5 Q;  1Q7Y C;  2JA5 G;  4JI3 Q;  4AQY Q;  4LFA L;  2UUB Q;  1VQG A;  4LF4 L;  1SLJ A;  4LUV A;  3H15 A;  1HR0 L;  1PYS B;  1JJG A;  3I56 A;  2VY3 A;  3BZC A;  3EBE A;  2OQK A;  4NPS A;  2JA7 H;  5AJ3 Q;  3KJP A;  2VNU D;  1MKH A;  1L1O B;  4JG2 A;  3U4Z A;  1GKH A;  1D7Q A;  4A3L G;  1IBK Q;  3PUZ A;  2JE6 I;  3K8A A;  5IYB H;  5FLM G;  4LF7 L;  3CCR A;  3OW2 A;  3I4M G;  1SN8 A;  1WYD A;  1SR3 A;  5GQO A;  2JJQ A;  2WAQ E;  5JEA G;  3TRZ A;  5GRO A;  4L5T A;  1J5E Q;  4UY8 C;  1WJJ A;  1EYG A;  4TVA B;  3JAM i;  2B3G A;  4JI8 L;  4X66 Q;  3M9B A;  1KQS A;  3HOX G;  2K5V A;  1PYB A;  4GN4 B;  5IP9 G;  2OWO A;  4DV4 Q;  2ZTD A;  4A3F H;  4LF6 L;  4MTN A;  2UU9 L;  4GNX C;  4DR5 Q;  4A3J G;  2MNA A;  1K9M C;  1XMO L;  3S16 H;  1IBL L;  2I5M X;  2Q2T A;  2VQE L;  1EOV A;  2EIF A;  4LF7 Q;  2N78 A;  1Z47 A;  3KDF A;  3RLO A;  4B3M L;  1OXV A;  2AKW B;  5IP7 G;  3RN5 A;  1TWG H;  1VQM A;  3CC7 A;  3HOU H;  2UXD L;  3G71 A;  3D0F A;  4YWL A;  2HIV A;  3L2P A;  4DR6 L;  4JI8 Q;  4EX5 A;  4POF A;  4P74 A;  5EAY A;  4JI5 Q;  3B6Y A;  2NN6 I;  1YIJ A;  4BA1 I;  3I4N G;  3PF4 A;  3KOJ A;  1LTL A;  2JEB I;  1XMO Q;  1IBL Q;  4JV5 Q;  4JBK A;  1VQ4 A;  4OWT B;  3J81 c;  3T1H L;  1QZG A;  3HOV H;  3S17 H;  4LF8 Q;  2UXD Q;  4WJ4 A;  3PSI A;  5C0X I;  1VQ8 A;  4IFD J;  1KC8 C;  3S24 A;  1VQK A;  4PZ8 A;  3UDF A;  4DK6 C;  1KL9 A;  5ELO A;  1XNQ Q;  4BA2 I;  3S2H H;  3M7N A;  1JT8 A;  2F4V L;  4C3J H;  2PQA B;  4A4I A;  1PVO A;  4X64 Q;  4C3I H;  3G4S A;  3RLN A;  4B3S L;  2OTJ A;  1OXX K;  2B63 H;  4QJF A;  4A3K H;  1VQ7 A;  2HHH L;  2PMZ E;  4JI4 Q;  2CWP A;  1NBW A;  2JQO A;  4DR4 L;  1YEZ A;  1PH2 A;  4R4I A;  5DLQ E;  4DKA C;  2E2I H;  1KD1 C;  4A3B G;  2OQ0 A;  2CCZ A;  2R92 G;  2MFI A;  4IJH A;  1CSP A;  2ZJP A;  1TXY A;  3HOZ G;  5C44 H;  1A63 A;  4JBM A;  4H02 A;  2UUA L;  1K8G A;  5BR8 L;  4GNX A;  4UP7 A;  5GAD C;  4DR2 L;  1HZ9 A;  3W1G A;  1UE5 A;  2HHH Q;  1HNW Q;  3HOW H;  4NB3 A;  4JOI A;  4DR4 Q;  3A5Z B;  1K0R A;  4DR1 L;  3K7A H;  3A0J A;  4DV1 Q;  4LW1 A;  2JA6 G;  3CMA A;  4ALP A;  4BXX H;  1T9H A;  4JI7 L;  2QA4 A;  2K5N A;  2UUA Q;  1K73 C;  1SMX A;  3BU2 A;  5IT9 c;  3PF5 A;  4A93 H;  3TQY A;  1ASY A;  1XPR A;  1X3E A;  2KHJ A;  1QUQ A;  3FHW A;  1HJP A;  4AYB E;  1M90 C;  3JC6 6;  3CCE A;  3RR5 A;  1K8A C;  1C7Y A;  1EWI A;  2PI2 A;  2CWA A;  2WB1 E;  1PH3 A;  3OTO L;  1XNR L;  4A3C H;  3HOV G;  3NBH B;  1HZC A;  2BA1 A;  1M1K C;  2PNH A;  2Q2I A;  4X62 L;  3E9I A;  4IPD A;  1L2F A;  1N34 Q;  3F1Z A;  1W3S A;  4X65 Q;  3AFP A;  2IT1 A;  3U50 C;  4R4T A;  1G6P A;  2VS1 A;  3D31 A;  1S40 A;  1N33 Q;  1Y1W H;  3PO3 H;  4IO9 A;  3F2D A;  3ULP A;  2K14 A;  1WFQ A;  2ZTC A;  3KF6 A;  3DLL A;  1XNR Q;  2I0Q A;  4B3T Q;  2UXC Q;  4DV3 Q;  3K81 C;  1N9W A;  4LFC Q;  2HQL A;  2E8G A;  1C0A A;  4X62 Q;  1DGS A;  2JEA I;  4JBJ A;  2WFW A;  1ASZ A;  2HIX A;  2Q2H A;  3CPF A;  1EQR A;  2Z6K C;  3M4Q A;  4DV5 L;  1CUK A;  1UEB A;  4JI3 L;  5C4X H;  3I4O A;  2UUB L;  3PIO A;  1FL0 A;  2OTL A;  5C3E G;  3RN2 A;  1L1O A;  4KHP Q;  3CW2 C;  3AFQ A;  3S1N H;  2VL6 A;  3M4O H;  3IRB A;  5AJ3 L;  4MZ9 A;  3J81 i;  4TQU S;  1Y1V G;  1OTC A;  1IBK L;  4FDB A;  3TS0 A;  3GTM H;  2IHE A;  5FJ8 G;  4HID A;  3GTQ H;  1B70 B;  4GN3 B;  3H3V H;  2N3S A;  4DPG A;  4OWX B;  1G51 A;  3J7Z C;  4DUY Q;  4A93 G;  1GD7 A;  2VQF Q;  1J5E L;  1LUZ A;  4QY7 A;  3J80 c;  3GTG H;  3UDG A;  4X66 L;  1NE3 A;  2KBN A;  4YY3 L;  4DV4 L;  4DV0 Q;  2Y0S G;  4DR5 L;  2LXK A;  2LXJ A;  2UXB Q;  2AMC B;  1XMQ Q;  1EQQ A;  2R93 H;  2K4K A;  5J3B A;  3FKI G;  3K7U C;  2WP8 J;  1NJI C;  4C2M H;  4YHH Q;  5M5Y H;  1SRU A;  1OXU A;  5M3F G;  1VQJ A;  4DAM A;  1VQ9 A;  5M3M G;  4P73 A;  4EQ5 A;  4L5Q A;  1YNX A;  5LMN Q;  3HKS A;  3GTK H;  4A3M G;  4JI5 L;  3UDX A;  3J81 j;  1GVP A;  4GN5 A;  5M5X H;  3STB D;  1YHQ A;  3K0X A;  4YY3 Q;  3PO3 G;  4NXM Q;  3HOY G;  4QL5 A;  1JJ2 A;  4YCW A;  1B7Y B;  2KCT A;  2ALY B;  1PH6 A;  4JV5 L;  3PUW A;  2BH8 A;  5IYC G;  3MXN B;  1VQI A;  4LF8 L;  1EUJ A; 
#chains in the Genus database with same CATH topology
 4BY7 G;  1LO5 D;  3TME A;  2PQE A;  2AUK A;  3A56 A;  4ZK9 B;  4ODG A;  4A3I H;  2NTT A;  4FF2 A;  2WAC A;  1FJG L;  1BBW A;  4CGY B;  3R2I A;  1PH9 A;  1VQE A;  5L37 A;  4GKK Q;  4RHS A;  2F0E A;  2B2V A;  3OIP A;  2XN9 C;  4OX9 L;  3W5O A;  2G9D A;  2B2W C;  3HEJ A;  2WAQ G;  1ENC A;  1IYJ B;  2NVQ B;  2ZXP A;  2QCP X;  5KND A;  1XX8 A;  1K3R A;  3BYT B;  3I3C A;  1X32 A;  1SFO H;  3IFD A;  3V96 A;  3EA6 A;  1WTH A;  1QCB D;  2ID0 A;  4RAU C;  1QZH A;  3OWE B;  3N6R A;  4JC0 A;  1TS4 A;  2A68 D;  1PV4 A;  1I94 Q;  4UAI A;  1AZQ A;  4K5W A;  2IW3 A;  4A3F G;  3EFX D;  1JOK A;  2JSO A;  3NPP A;  1S5C D;  4O0A A;  3K59 A;  3FEW X;  5IYD H;  4AH6 A;  1CSQ A;  3H0G H;  2B2U C;  3A8K E;  1N34 L;  1E0B A;  1KDB A;  2L12 A;  3W3A A;  4KY6 A;  1VQN A;  2A69 C;  4PG3 A;  2JA8 H;  3K80 C;  4HJ7 A;  1S5E D;  2RSN A;  4X3K A;  3S15 B;  2F0W A;  1BCP C;  1B3A A;  4KY5 A;  4KHV A;  4KY7 A;  4OIK A;  4X6A H;  1EEI D;  4JI6 Q;  4BWG B;  3CHB D;  4C3I G;  1TWC H;  5CV7 A;  3VR2 A;  2CH4 A;  1KXL A;  3PIP A;  3H94 A;  1Y69 U;  2PPB C;  4DA2 A;  1NMF A;  3BZK A;  3KJO A;  1JWS D;  2F4I A;  4K0K L;  1E1T A;  1HHV A;  1LM0 A;  2Z0S A;  3I4M H;  2IX3 A;  2R93 B;  1HNX L;  3I4N B;  1F2Y A;  2G5D A;  1TWA H;  3HOW G;  1FVI A;  4P75 A;  1Q46 A;  1TQO A;  5IP9 H;  1Q86 C;  3T1Y Q;  1STE A;  1N36 Q;  3O13 A;  4XYQ A;  1P16 A;  5GAH C;  5IP7 H;  5LMN L;  2K50 A;  3BG3 A;  1HZA A;  3D4R A;  3F2C A;  1MBY A;  4HJ5 A;  3WWV A;  2IHF A;  1LTB D;  2CQO A;  2XTI A;  4IUV A;  4A3B B;  3CP0 A;  4K2L A;  1PTO B;  3OYY A;  4HIM A;  3VYR A;  1GUS A;  3RZO H;  2K5W A;  1PH8 A;  2EY1 A;  4Y7N H;  1HNZ Q;  3BVG A;  5C0X J;  4JI2 Q;  3W1B A;  2AWO A;  1Q90 A;  1W2B A;  2K75 A;  2PQA A;  4HAE A;  1WD1 A;  5M9O A;  5C4X G;  1SRO A;  1WCM B;  1OXT A;  1PA6 A;  4CDE C;  1DZ1 A;  4KTA A;  1IW7 C;  1HR0 Q;  3MFY A;  1MJC A;  1TU2 B;  4DV2 Q;  4ZUI A;  2F52 A;  1NSN S;  1LTR D;  3L7Z C;  2HCC A;  3NTK A;  4KN4 C;  4U68 A;  2B8G A;  1YHA A;  1VF5 C;  3K5L A;  2QGQ A;  3ICE A;  1DXM A;  4JOI C;  4IOC A;  1K28 A;  1EY4 A;  4GKJ L;  3K0Y A;  2LS0 1;  4JI0 L;  2F0T A;  1XPU A;  1KAW A;  2ASB A;  3PUY A;  2VZA A;  4FVM A;  4LF6 Q;  2UU9 Q;  2K28 A;  5F2D A;  3HG9 A;  4UP9 A;  2Z6B A;  4DXG A;  4H7B A;  3NQI A;  2D62 A;  1EIY B;  4B3M Q;  4ZRZ A;  5C4H A;  2BH2 A;  1HRJ A;  2CFM A;  5C6A A;  3HKZ E;  3E0J A;  3J7A F;  2LSS A;  2L15 A;  3CCM A;  1SYC A;  3KLW A;  4BBS B;  5HGQ A;  1KIX A;  4GLX A;  3A7L A;  3BZD B;  4KKS A;  3J80 L;  2FJ2 A;  3BDC A;  2NBF A;  1PTO C;  3JAM E;  4PNY A;  4ME3 A;  3KFU A;  3Q24 A;  5IWA L;  3F8T A;  1I5F A;  4OXP A;  2O5I C;  3M3Y B;  1JE5 A;  5C5L A;  1D8L A;  3CF5 A;  1CHQ D;  1HUN A;  2YYZ A;  4C1N K;  4QUF A;  2UUC L;  3MFG A;  1Z7T A;  4BY1 G;  2JA5 H;  4R4Q A;  2NVT B;  2PCF B;  4MNO A;  1F9R A;  4PQX A;  1UWV A;  4LJZ C;  5KGU A;  1BXT A;  4BY7 B;  5IE8 A;  3W2D A;  4QIW B;  1C48 A;  2OT2 A;  4ME5 A;  2FIN B;  2N49 A;  4UDU C;  2A5H A;  1KRT A;  5KYI A;  2RKS A;  4NXN L;  4LK1 C;  3LGJ A;  2PZU A;  4Q0F A;  3MAQ A;  4P72 A;  1Z6H A;  1TWF B;  5HGT A;  2QDL A;  2SEB D;  1RCV D;  2X69 A;  3G48 A;  1TY0 A;  3CCV A;  1UEA B;  4J15 A;  2JK8 A;  4LFB Q;  2EQS A;  1L0Y B;  3QB3 A;  3CRL C;  2GA4 B;  3MXN A;  3U4V A;  5G3L F;  1K8M A;  1LT5 D;  4A3D G;  4IAL A;  3GTL B;  4FXG C;  4HCS A;  1Y8N B;  3DM3 A;  4KD3 A;  4JW0 A;  5J1Z A;  5LMU L;  4P71 A;  5EKI A;  4A3F B;  4DV5 Q;  3GTO B;  2JA5 G;  1F9Q A;  3SK5 A;  4LF4 L;  5J39 A;  4DK0 A;  1IKL A;  2VY3 A;  4NPS A;  1HFN A;  4FXK C;  1IBK Q;  1SNM A;  5IYB H;  2QKI C;  4FF3 A;  1HPC A;  1SN8 A;  3TRZ A;  1SR3 A;  4J1M A;  5GRO A;  4L5T A;  1J5E Q;  2IJ0 A;  1EYG A;  5DEH A;  3M9B A;  3VYU A;  2OWO A;  5JAV A;  1G8Z D;  1KNE A;  1O7Y A;  2ZTD A;  4DR5 Q;  1WTW A;  2E2D C;  1K9M C;  3S2H B;  2I5M X;  2VQE L;  1EOV A;  1PRT B;  4LF7 Q;  2N78 A;  1Z47 A;  3E3X A;  4PMC A;  1BO0 A;  3NQT A;  3HOU H;  3L3O C;  1QIL A;  4YWL A;  3T16 A;  4JI8 Q;  1JOQ A;  5EPL A;  4JI5 Q;  3B6Y A;  2KJX A;  4HN7 A;  2XVS A;  3PF4 A;  2A74 C;  3KOJ A;  3MXG A;  4CJ1 B;  1IBL Q;  4JBK A;  2PW5 A;  4B08 A;  3MXP A;  4OWT B;  3HOV H;  4V19 0;  4WJ4 A;  2DY7 A;  1OO9 B;  3M4Y A;  1KC8 C;  5COR A;  2F3V A;  3UDF A;  5ELO A;  2F0U A;  5HUR A;  2RCF A;  3SK8 A;  3K7A B;  4MIU A;  4B3S L;  2OTJ A;  2O2L D;  2QW7 A;  3OMC A;  1J8I A;  1NBW A;  4DR4 L;  1YEZ A;  4A93 B;  5DLQ E;  2E2I H;  4DKA C;  1TS3 A;  1KD1 C;  2RQX A;  2R92 G;  3MC0 B;  4IJH A;  1TXY A;  1H9R A;  2Y0S B;  5A35 A;  1SE3 A;  4NDX A;  1B4O A;  5EPK A;  2J0T D;  4JOI A;  5KEE A;  5M3M B;  2B8F A;  2JA6 G;  2QIL A;  4BXX H;  1UUP A;  4JI7 L;  3BU2 A;  3PF5 A;  5I2Y A;  4I65 A;  2EYF A;  2TSS A;  2PI2 A;  2CWA A;  3ND8 A;  2PW7 A;  2EYM A;  2L0C A;  2XNA C;  5ISR A;  3HOV G;  4N9T A;  1M1K C;  1D1K A;  1PRT C;  2PNH A;  4A3E B;  4RGO S;  3S1N B;  2A6H D;  1N34 Q;  2AQ1 B;  5EQ0 A;  3F1Z A;  2F3W A;  1B1Z A;  4CKE A;  4F87 A;  4PMB A;  3PO3 H;  2ZXO A;  4IO9 A;  3KF6 A;  2F0G A;  5G3L D;  3P20 A;  3DMU A;  3GV6 A;  1SSO A;  3GTG B;  5EKK A;  4XXE A;  2WFW A;  1ASZ A;  3CPF A;  2JA7 B;  1HUM A;  3M4Q A;  1UEB A;  4JI3 L;  2K32 A;  3R2T A;  5C3E G;  3RN2 A;  3CW2 C;  1BF4 A;  3M4O H;  3IRB A;  2XWB B;  2EYJ A;  4MZ9 A;  3I70 A;  1Y1V G;  4FDB A;  4FF1 A;  4GN3 B;  2B2V C;  2N3S A;  3KUP A;  3OWF A;  4RGN A;  3NWT A;  2MUY A;  4NMZ A;  3MXU A;  2AMC B;  2C5C A;  3TDQ A;  2SOB A;  4OGQ C;  2R93 H;  2K4K A;  3K7U C;  1YNJ D;  5C4J B;  1ESR A;  1SRU A;  1VQ9 A;  1XTC D;  4P73 A;  4L5Q A;  4DNR B;  5LMN Q;  1VF7 A;  5D3D A;  1F9P A;  3K0X A;  4YY3 Q;  3PO3 G;  3HS0 C;  3HOY G;  1B7Y B;  2KCT A;  1PH6 A;  3KLS X;  2BH8 A;  1O80 A;  2L9H A;  1O7I A;  4KKT A;  2ZJR A;  4A76 A;  2B63 B;  1IXR A;  1CI3 M;  4A3K B;  5I4D A;  3S2D H;  3CCQ A;  4DAV A;  1MSG A;  1YHB A;  1R9T H;  2PYK A;  1F2M A;  4DGZ A;  2DN8 A;  4LUO A;  1VQO A;  3DWQ A;  4M1U B;  4OO1 G;  2CW0 C;  2WB1 B;  3GTP H;  4L5S A;  3I8Z A;  3PIO 3;  1VQB A;  2E2H H;  4NP5 A;  4A75 A;  3T51 B;  3K6O A;  1B9M A;  4R4O A;  2NN6 H;  3H09 A;  4DV1 L;  1ENA A;  1G2S A;  3K5N A;  2BE5 D;  2EVB A;  3OMG A;  3NHH A;  1KRS A;  2RVL A;  2BOS A;  4GKJ Q;  2D0P A;  2F0L A;  1UE6 A;  4JI0 Q;  1VQ5 A;  4LWC A;  3QIA A;  1D5Z C;  2CH4 W;  4NKL A;  3CCL A;  1TWH B;  5D65 A;  3J80 i;  2IWH A;  1U5K A;  3FPU B;  4POG A;  1NNX A;  4IJL A;  1SE2 A;  4DFA A;  2UXC L;  4HTH A;  4DV3 L;  3KYH C;  5CR3 A;  1V1Q A;  3FPP A;  2B2T C;  1A3V A;  4BBR B;  1CQF A;  3QG1 A;  4BBS H;  1GHJ A;  1PH1 A;  1PH7 A;  4C3J G;  3R93 A;  5JJI A;  2H4O A;  4RKB A;  2HCI A;  3GD7 A;  2A68 C;  1SYG A;  1AEX A;  5IGG A;  1B53 A;  3M3Y H;  1B2T A;  4CJ0 B;  2UUC Q;  4L63 B;  4A3L H;  4QF4 A;  5FLM H;  4CBV A;  4DUY L;  2DY8 A;  1B8A A;  5GAE C;  4TRD A;  1CFM A;  2E74 C;  1I50 B;  1ICW A;  4C2M B;  1DOM A;  3X3N A;  4LF9 L;  4ILW A;  2UXB L;  4KJN A;  2R61 A;  2K52 A;  4A3J H;  1AE2 A;  1J6Q A;  4OO1 I;  4YHH L;  2ICI A;  2FFK B;  4QMG A;  1NUC A;  5IGC A;  3C46 A;  3BVZ A;  4H0L C;  4NXN Q;  1SND A;  4ABN A;  1HZB A;  4CDD C;  1JQY D;  2Z1C A;  1YI2 A;  4ZQ3 A;  1EWH A;  4F8M A;  1KDC A;  2DJG C;  1MI2 A;  1WVL A;  3ZJY C;  1YJ9 A;  4IUN A;  1PH4 A;  2QEJ C;  1VQP A;  1TWF H;  2GVB A;  4QIW E;  1UE1 A;  4DUZ L;  1AH9 A;  3CQZ B;  1NY4 A;  2ENB A;  5C3W A;  2K5D A;  4Y52 H;  3D6C A;  5JJL A;  4GLA C;  3ULJ A;  2NVY H;  2OEO A;  1YJW A;  1GM5 A;  5LMU Q;  1LTI D;  5KNC A;  1E3P A;  1BR9 A;  4DV7 L;  3GTL H;  1SYE A;  3VYT A;  4LF4 Q;  3CCS A;  1ZKO A;  3GO5 A;  4HMI A;  1SJH D;  3PIP 3;  3DHQ A;  3GTO H;  3NBI A;  1BKB A;  1NTG A;  1EIF A;  5A2Q E;  1KAB A;  1LAB A;  5JPM C;  2Z4H A;  2FMM A;  2KEE A;  4UPA A;  3C1F A;  1E24 A;  2RDG A;  1F77 A;  3NE5 B;  1SE4 A;  5ELF A;  2VUM H;  2VQE Q;  1CA5 A;  1F9S A;  1TT2 A;  1NMG A;  3IL8 A;  1S5D D;  5C3E B;  1G6Z A;  3NEM A;  3NK9 A;  1VQL A;  4A3G B;  3J7Y W;  2A73 B;  3RZD H;  2RHS B;  3A8J E;  4S3S A;  1Q81 C;  1EY7 A;  4RCO A;  1D1I A;  3CC2 A;  2YTY A;  5BN5 A;  3FMC A;  2SNM A;  5FO7 B;  4A3I G;  2EY6 A;  1XTD A;  1BCP F;  2D0O A;  4RMF A;  1EYA A;  2ICE C;  3M7G A;  5K5P A;  1CKO A;  4B3S Q;  2XIW A;  2KEC A;  3TS2 A;  1HQM C;  2DUD A;  3IAY A;  1O78 A;  1L1O C;  2R6G A;  5EBC A;  5EJW A;  2N55 A;  1MJE A;  4RA8 A;  1QG7 A;  3HOX B;  2I5L X;  3ULL A;  1XYI A;  3LNN A;  5JJZ A;  2XRQ D;  4OON A;  1XPO A;  1HQR D;  3QR8 A;  1QWY A;  3N52 A;  4DV6 L;  2VUM G;  1IHZ A;  4B3R L;  4LNQ A;  4QUC A;  2K01 A;  4RWS C;  1HA5 A;  4FYD A;  1JOR A;  4XDX A;  4JI7 Q;  1HR0 W;  2KED A;  1PFS A;  5M3F H;  1VQA A;  5M3M H;  3S14 B;  2L55 A;  3L0O A;  1JB7 A;  3F2U A;  3SR1 A;  4A3M H;  2RHQ B;  5IYD G;  2Y0S E;  3H3V I;  4DR7 L;  1JR0 D;  2YTV A;  3ND9 A;  3H0G G;  4OHJ A;  1V1O A;  1I3Q B;  2EPB A;  1DYQ A;  1B50 A;  3AU7 A;  5HY6 A;  3X3M A;  1KLU D;  2A1A A;  3NTH A;  4X3T A;  3E5S A;  4C3H H;  1Q8K A;  2JA8 G;  2B2T A;  2SNS A;  4A3E H;  1X9N A;  2VXW A;  2B2Y C;  4DN4 M;  3H6M A;  3OIQ A;  3A74 A;  4PV1 C;  3HOZ B;  4PMW A;  3VR6 A;  5IY0 A;  1G91 A;  1Q12 A;  3KF6 B;  1ML0 D;  3DM1 A;  1A8V A;  4C1N I;  4DR3 L;  4JI3 Q;  4AQY Q;  1VQG A;  5IGB A;  3KLR A;  1PYS B;  1JJG A;  1TWG B;  2JA7 H;  5M5W B;  2VNU D;  1GKH A;  2JE6 I;  3K8A A;  3CCR A;  5JVG 3;  3I72 A;  3OW2 A;  3QWN A;  3I4M G;  1WYD A;  2JJQ A;  5DNF A;  3MWY W;  1K8O A;  5IP9 G;  4MTN A;  2MNA A;  1BUV T;  2Q2T A;  3CRK C;  2EIF A;  1ET6 A;  3KF8 A;  1KNA A;  3KDF A;  1OXV A;  2AKW B;  4C3J B;  5IP7 G;  2UXD L;  4DF7 A;  1LLR D;  4DR6 L;  2EJF C;  4G7O C;  1EY8 A;  4EX5 A;  2Z8L A;  3PQI A;  4C3H G;  5EAY A;  4POF A;  5EPJ A;  2OXP A;  3KK7 A;  1SYB A;  3BYY B;  2G9H D;  2R3Z A;  1LTL A;  1XMO Q;  1AN8 A;  2F0F A;  1VQ4 A;  4M8A A;  4RH6 A;  1QZG A;  3S17 H;  3S9W A;  4N8F A;  1K83 B;  2AQ2 B;  3IFT A;  1S5F D;  1FR3 A;  4PZ8 A;  4BA2 I;  1JT8 A;  1KL9 A;  5FO8 B;  3J7A V;  3DWP A;  4A4I A;  1PVO A;  4YIJ A;  5CV6 A;  3G4S A;  3RLN A;  3MVV A;  1OXX K;  2B63 H;  1PFN A;  4A3K H;  1VQ7 A;  2JQO A;  1TS2 A;  1CSP A;  2F0D A;  5C44 H;  4JBM A;  1DOL A;  2D2C C;  4H02 A;  1K8G A;  3A8I E;  5BR8 L;  4GNX A;  4UP7 A;  2CVR A;  1I4R A;  1PLF A;  1E2W A;  4DR2 L;  3FKI B;  1UE5 A;  2HHH Q;  3D6W A;  4FP5 D;  4DV1 Q;  1SNP A;  3CMA A;  1T9H A;  3S1Q B;  3G6J B;  2UUA Q;  3EJI A;  2KHJ A;  2KA7 A;  1QUQ A;  1HJP A;  1PZI D;  3JC6 6;  5E1F A;  3RR5 A;  1K8A C;  1K0S A;  1EWI A;  1XXG A;  2WB1 E;  1SNC A;  3RMH A;  1PH3 A;  1XNR L;  4A3C H;  4IFD H;  1HZC A;  1RJT A;  2Q2I A;  1RDP D;  3E9I A;  1L2F A;  1PXU A;  2AUJ D;  3MTS A;  2PZW A;  3U50 C;  4R4T A;  1EOT A;  1Y1W H;  1WTO A;  3F2D A;  3ULP A;  2I0Q A;  5FO9 B;  2UXC Q;  4DV3 Q;  2WAQ B;  3K81 C;  1N9W A;  4H44 C;  2J7Z A;  4X62 Q;  3SK6 A;  2JEA I;  4JBJ A;  1YNN D;  1AW7 A;  5FKA C;  2UUB L;  3I4O A;  4HED A;  1FL0 A;  1J9O A;  2OTL A;  1H9S B;  1L1O A;  4F7X A;  3AFQ A;  5CV5 A;  1HFG A;  1I4Q A;  5AJ3 L;  4K5X A;  3GTK B;  4FF4 A;  1O7Z A;  2K05 A;  3OSO A;  1HA6 A;  4HID A;  4DPG A;  1G51 A;  4DUY Q;  1I4X A;  1GD7 A;  1ILQ A;  3J80 c;  4IUQ A;  3BVM A;  2HDL A;  3ERQ A;  3SVM A;  2UXB Q;  2LXJ A;  2IL8 A;  1M4V A;  4A3I B;  1EQQ A;  2LFN A;  4TSS A;  3ERO A;  1KLG D;  2A6H C;  3JAM L;  4C2M H;  4YHH Q;  4DAM A;  1SJE D;  2JYO A;  2ZT9 C;  3K5O A;  4DK1 A;  1WTX A;  3HKS A;  1TR5 A;  1GVP A;  3STB D;  1YHQ A;  2KQ3 A;  4QL5 A;  1DD2 A;  3PUW A;  5KNB A;  1STH A;  1GUG A;  3MZ5 A;  2KVM A;  2F0K A;  4C3I B;  4R1J A;  5D3I B;  1SFO B;  2B2Y A;  1CHP D;  1EZ8 A;  3FP9 A;  3SE0 A;  3WOE A;  3J81 E;  1XNQ L;  5ELC A;  2A8V A;  2R7Z H;  1G2T A;  2FMC A;  4CKC A;  4GS3 A;  4X64 L;  5E3F A;  1ZYR D;  3PO2 H;  4IZ8 A;  3PUX A;  4IPC A;  2HUG A;  4YCU A;  3CQZ H;  4LAA A;  3AMU A;  1FJG Q;  3HOW B;  4B9X A;  2MHV A;  1FNV A;  4K8I A;  1L0X B;  4DV7 Q;  5D14 A;  4Q5V A;  4IN3 A;  1VMP A;  3UDI A;  4DNT B;  1PHJ A;  3H0G B;  5IYB G;  1VQH A;  1YNJ C;  3GV3 A;  1PZJ D;  4OX9 Q;  2PZT A;  2MP1 A;  4WJ3 M;  3ZYY X;  4O2D A;  1ESF A;  1JMC A;  1A62 A;  5E4X A;  4HJ9 A;  2I5H A;  3GQB A;  5EBD A;  5C0X H;  3NBH A;  2NVQ H;  3AQQ A;  3NWS A;  2EDG A;  2F0I A;  2NZ1 D;  2XRS D;  2F3I A;  3V05 A;  3OOC A;  2EY5 A;  3HOU G;  1ZXT A;  2CKZ B;  5JVH 3;  1CZG A;  1AE3 A;  1VCI A;  3I4L A;  1Q1E A;  2RDF A;  4X65 L;  4G7H C;  4EQP A;  1GO3 E;  1W6J A;  5GAG C;  3JAM c;  3RLF A;  1STA A;  2RF4 A;  4WJW A;  1SMY D;  5IGF A;  1JWU D;  2F0P A;  4LFC L;  1Q82 C;  4A3G H;  3I4M B;  5C4X B;  5LMN W;  2H5X A;  3OPO A;  1BDO A;  1TWA B;  2EXZ A;  4OEL B;  3C2P A;  1CQV A;  1E22 A;  1X54 A;  3GTM B;  4KHP L;  4XIG S;  2NWG A;  3GTQ B;  1Q8I A;  3LWE A;  2A6E D;  3TP6 A;  2HDM A;  4ZLT F;  1CZW A;  2YV5 A;  5FLX L;  2BE5 C;  2IX1 A;  1RL2 A;  3TN2 A;  1N36 L;  3DEP A;  2KCM A;  3P7J A;  2VQF L;  5DM6 3;  2N88 A;  5JEA H;  4XQN A;  2AWN A;  3NUC A;  4F88 A;  3S15 H;  1BVS A;  5CMD A;  3CAM A;  5M5Y B;  4DV0 L;  1QJO A;  1SE8 A;  1W6K A;  4DV6 Q;  4B3R Q;  2EYO A;  4BXX G;  2KCC A;  5JOB A;  2XWJ B;  3RZO B;  1VS0 A;  4K0K Q;  4RFB A;  1S72 A;  4IOA A;  1DCZ A;  2ATW A;  4Y7N B;  5JJK A;  1HNX Q;  1VQD A;  2K5H A;  2L1B A;  4NXM L;  1E1O A;  1ENF A;  1EIH A;  4DR7 Q;  1HNZ L;  1KTK A;  3MA2 B;  2K5Q A;  2QEX A;  3I4N H;  3Q22 A;  3AEV A;  3S14 H;  1MSH A;  1CKN A;  1I4G A;  3EQL C;  5KYL A;  4L8J A;  2E5L L;  1U9R A;  4ID6 A;  1N32 L;  1BOS A;  3K57 A;  2K03 A;  1I3Q H;  1LTT D;  3NEL A;  1AZP A;  4DV2 L;  4GOP A;  1U4R A;  2B29 A;  4BY1 B;  3D4D A;  4A3B H;  4DR3 Q;  3HOZ H;  1PTO H;  3RUZ A;  2PI2 E;  2HD3 A;  2QF7 A;  3IKJ A;  4JK1 C;  2OCE A;  2F0S A;  1MD2 D;  1D2B A;  4K6L A;  1U4M A;  1YIT A;  3Q8D A;  4JVZ A;  3VR5 A;  3OW7 A;  1QE6 A;  1QVC A;  2WKD A;  1FGU A;  2Q8R E;  1O7L A;  1BQQ T;  5CBA E;  4K6D A;  3DWA A;  4U67 3;  5M5W H;  2A19 A;  3LWU A;  4KN7 C;  4X3S A;  3UE0 A;  5FLX c;  2M2L A;  1YVC A;  2YU9 B;  2MQH A;  1KDA A;  3SXH A;  2IX0 A;  1IZ6 A;  1WCM H;  3I55 A;  2R93 G;  3WOF A;  4RHR A;  1N8R C;  1WTR A;  4K5V A;  2VW9 A;  3KF8 B;  1DOK A;  3KDF B;  4PZ7 A;  4DR6 Q;  1LTA D;  1EIG A;  3V2T A;  4A3D B;  4CKB A;  1CK1 A;  1Z9F A;  4EQN A;  1OXS C;  1QNK A;  3K5M A;  4ZAI A;  1EY5 A;  4PZ6 A;  3VR3 A;  1RTO A;  2L4N A;  2EOT A;  3FVQ A;  2JA5 B;  1E2Z A;  1A2U A;  3DUZ A;  1ONL A;  3TRE A;  2ZM6 L;  4IPH A;  4YCV A;  2GVA A;  1KAA A;  4YWM A;  1K83 H;  3KLS A;  2TMP A;  1RIP A;  4H13 C;  3S1M B;  3HFZ B;  2MO1 A;  1NCV A;  2DGY A;  3GTJ B;  2KOL A;  3K58 A;  4KJO A;  1TKW B;  1FGB D;  1A6X A;  1H9S A;  5FJ8 H;  5IWA Q;  1EYC A;  1A3T A;  3H91 A;  1VDZ A;  3TZD A;  5BR8 Q;  3G6E A;  3CPW A;  4DR2 Q;  1X56 A;  1WCM G;  2M9V A;  4GNX B;  2CQA A;  3CME A;  3I2Z A;  2NN6 G;  4JYA L;  3EIV A;  1C8C A;  1LYL A;  1BBU A;  1I6H B;  3FKI H;  1BNZ A;  2ZXR A;  4AYB G;  5IGE A;  4LFB L;  3BJU A;  4CJ2 C;  4JI1 L;  3S1Q H;  1QUQ B;  3VDY A;  2NVT H;  5FK9 C;  1X3G A;  5IYC H;  3CCU A;  5KIX A;  4CDF C;  4BY7 H;  1RTN A;  5J22 A;  1A15 A;  1EZ6 A;  3VA5 A;  3Q23 A;  4IUT A;  4LUZ A;  4LF5 L;  4APV A;  1CKM A;  3CXC A;  3ONA B;  2R92 B;  2HT1 A;  3SGI A;  2KEN A;  2YTX A;  3E0E A;  4BBS G;  1PH5 A;  2R7F A;  1QVG A;  2JXM B;  2F1M A;  1IBM L;  1GUT A;  1Q7Y C;  4LFA L;  3L9A X;  5I6Y A;  2UUB Q;  1C4Q A;  3VR4 A;  4LUV A;  1D6E C;  3I56 A;  2JA6 B;  5IT9 L;  4G7Z C;  2OQK A;  3HOU B;  5AJ3 Q;  3KJP A;  4ULL A;  2BCO A;  1L1O B;  1D7Q A;  3HGB A;  4A3L G;  3PUZ A;  5FLM G;  2F03 A;  4LF7 L;  4EGV A;  1CT1 D;  1GUW A;  2WAQ E;  4UY8 C;  3BDO A;  4TVA B;  3JAM i;  4JI8 L;  1RHP A;  1KQS A;  1LV9 A;  3HOV B;  3FDT A;  4A3F H;  4GNX C;  3S1R B;  4A3J G;  2Q8T A;  1IBL L;  3EVQ A;  1F2L A;  1G6P A;  3RN5 A;  5FOB B;  2K1B A;  3D0F A;  2HIV A;  1WTP A;  1F2Z A;  4J8Q A;  2MJ8 A;  2NN6 I;  2E2I B;  4BA1 I;  4ZYS A;  5T1G A;  4CDC C;  1B44 D;  2SDF A;  4DAY A;  2EY2 A;  2X6G A;  3I90 A;  3T1H L;  2NVX B;  2WKC A;  5EGT A;  4N9P A;  2E2J B;  4IFD J;  2NUC A;  4LMQ D;  3S2H H;  1UNS A;  4DK6 C;  1XNQ Q;  2F4V L;  5IOD A;  1Y1V B;  4X64 Q;  4C3I H;  3C3L A;  5COY A;  1WD0 A;  3CU7 A;  4HSV A;  1DON A;  3QOL A;  5IOC A;  4R4I A;  1PH2 A;  1SNQ A;  1HTP A;  2CCZ A;  2D9U A;  2MFI A;  4K14 A;  2ZJP A;  1A63 A;  2EZV A;  4EQO A;  1NAP A;  4MN3 A;  4KK7 A;  1V8Q A;  3HOW H;  4NB3 A;  4DR4 Q;  3I73 A;  3A5Z B;  4DR1 L;  3K7A H;  4LW1 A;  1MHW C;  3NSW A;  1Y8P B;  2K5N A;  2RBM A;  3PO3 B;  4MHE A;  2RSO A;  1SMX A;  4IUR A;  1SXT A;  5IT9 c;  3HOY B;  4A93 H;  4N8X 1;  1ASY A;  1XPR A;  3BS1 A;  2EJG C;  3CCE A;  2WII B;  1C7Y A;  1TS5 A;  3OTO L;  3NBH B;  1EFI D;  3M4O B;  1STN A;  1W3S A;  4X65 Q;  5CV8 A;  1I6V C;  2IT1 A;  1QNU A;  2VS1 A;  1FD7 D;  4TKO B;  4ZUJ A;  1WFQ A;  1ZEQ X;  1CM9 A;  2ZTC A;  1BBX C;  4LFC Q;  1M8A A;  2HQL A;  1C0A A;  1DGS A;  1ICF B;  2EYL A;  2Z6K C;  3C1E A;  5C4X H;  5A2Q L;  5K36 H;  1STB A;  4KHP Q;  1CA6 A;  3S1N H;  2VL6 A;  4OL7 A;  1IKM A;  3J81 i;  4G57 A;  3J80 E;  1OTC A;  3GTM H;  1I4P A;  2IHE A;  4DU9 A;  3GTQ H;  1R4P B;  1U4L A;  3J7Z C;  4A93 G;  2VQF Q;  3S16 B;  3GTG H;  3UDG A;  4X66 L;  1NE3 A;  4DV4 L;  4YY3 L;  4DV0 Q;  2Y0S G;  1U4P A;  2LXK A;  1TVX A;  5J3B A;  3S2D B;  5M5Y H;  3QJY A;  1OXU A;  5M3F G;  5M3M G;  1QOH A;  4A3M G;  1R9T B;  3UDX A;  2PMZ B;  4GN5 A;  4NXM Q;  4JV5 L;  4O1N A;  3U9S A;  2RDH A;  1VQI A;  1YNN C;  3GTP B;  4LF8 L;  1EUJ A;  1JB3 A;  4ZKC B;  3R3O A;  4R9W A;  1E2V A;  1LT4 D;  5BN4 A;  1STY A;  5K36 G;  2E2H B;  1CKN B;  2CHB D;  4HIO A;  4A3E G;  2E5L Q;  2PO4 A;  1N32 Q;  5C4J H;  4I7Z C;  1X55 A;  2BDO A;  2NTS A;  4HJ8 A;  4JI4 L;  3CKI B;  1VQF A;  1PMR A;  5CV9 A;  1QVF A;  2A69 D;  5H1S E;  1PTO F;  4WFN 3;  2EXD A;  1YJN A;  2F0N A;  4AYB B;  1PFM A;  2J4X A;  4GOP B;  1STG A;  1BCP D;  3CCJ A;  3E9H A;  1D5X C;  4GLV B;  1EL0 A;  2I46 A;  4BY1 H;  1SEB D;  3ER0 A;  2JA7 G;  3GP7 A;  1HNW L;  3HRZ C;  1C9O A;  1EQV A;  3KBG A;  2F0Q A;  3MEH A;  2DNE A;  3QOJ A;  4Z9C B;  3STB C;  1JIC A;  2DNC A;  4HCE A;  1JJC B;  1PDQ A;  3AYH B;  1ROD A;  4DNI A;  5C3X A;  5JEA J;  1P8L A;  4OWW B;  2LY7 A;  3KBX A;  1JOO A;  3A54 A;  1PZK D;  3HZX A;  4HMJ A;  4JCV E;  3HKZ G;  2YU9 H;  3E6Z X;  2M00 A;  3A5U A;  2WV6 D;  3R8B A;  1EY6 A;  4UHV A;  1HXY D;  1R4Q B;  3SDZ A;  3DEO A;  5ELN A;  2GN5 A;  1ZYR C;  4HJA A;  1N33 L;  2F0M A;  4EVO A;  1EEF D;  3PMF A;  1B9N A;  1NR4 A;  1Q1B A;  4B3T L;  2B2W A;  5LL6 X;  2OF1 A;  2E76 C;  4A3D H;  2N8N A;  4K8J A;  3NEN A;  1DM0 B;  2C9O A;  2EYH A;  3PCO B;  3UE1 A;  1SNO A;  4E6I A;  3CC4 A;  1E7Z A;  2ZM6 Q;  3D8G A;  4R4C A;  3DXJ C;  1TWH H;  4A3J B;  2B63 G;  3CD6 A;  4A3K G;  3D3R A;  3I91 A;  1T5X D;  5BN3 A;  4OEM B;  1H9M A;  1WTV A;  3QO2 A;  5C44 G;  2NZH A;  4GOP C;  1V9P A;  3S1M H;  1B3Q A;  2VB2 X;  3TEH B;  1VQC A;  1RD9 D;  5CYU A;  3GTJ H;  4BBR H;  1NR2 A;  1TII D;  3M4P A;  1AP0 A;  3ITP A;  4RGT A;  4CHT B;  2IY5 B;  2EYP A;  2WB1 G;  3G7L A;  1IW7 D;  4RG1 A;  1XMQ L;  4JYA Q;  2V1C C;  3A55 A;  4AIM A;  2K33 A;  1A0I A;  2B2U A;  1YBY A;  5M5X B;  3A7A B;  1FNU A;  5DM7 3;  3P1H A;  3ERS X;  4P2C B;  2Q2U A;  1SMY C;  4LF9 Q;  4RKL A;  1I6H H;  4A3C G;  4JI1 Q;  5LHY 1;  4IFD G;  2NVY B;  2C35 B;  1DJR D;  3GDE A;  2Z4I A;  1I50 H;  2RCN A;  2Q8I B;  3RD4 A;  4X3U A;  2BDN A;  4RCN A;  3TZU A;  2FXQ A;  1WI5 A;  1Q3L A;  3PUV A;  1Y1W G;  1RF2 D;  1XJV A;  4LF5 Q;  2A6E C;  1JE4 A;  1SDF A;  2ZJQ A;  4GKK L;  2O4X A;  2Z6K A;  4ZCK A;  4L5R C;  4RGM A;  1PFB A;  3TP5 A;  1PTO D;  5CBE E;  2E75 C;  3NXW A;  2R92 H;  1IBM Q;  4BBR G;  1MGS A;  1U0L A;  4LFA Q;  3U9O A;  4DUZ Q;  5I9O A;  2VUM B;  1V1P B;  3T53 B;  1IL2 A;  3PGZ A;  3H3V C;  5E4W C;  1EU4 A;  4MTK A;  1H95 A;  3P75 A;  5FLX E;  1G29 1;  3RZD B;  1XWE A;  4XTC S;  1I94 L;  2JA6 H;  2KHS A;  4DK3 C;  4R8N A;  4GZY C;  2I07 B;  2HQE A;  3WDN A;  4UP8 A;  2R7D A;  1HH2 P;  3MHB A;  1ILP A;  3I7F A;  1SBB B;  1Y14 B;  3T4A C;  5IIF A;  4K2K A;  2JA8 B;  5KRU A;  3S1R H;  3F2B A;  4KLK A;  2MO0 A;  3D4W A;  3M85 A;  3PV0 A;  5CV4 A;  1VQ6 A;  4O42 A;  2JA9 A;  4XT3 B;  2Z9H A;  4KI0 A;  5EKL A;  5I9P A;  4XT1 B;  1TWC B;  1II3 A;  3T1H Q;  1PRT F;  2FHT A;  4DAY B;  4HSP A;  2R7Z G;  3U58 A;  1X3P A;  4JI6 L;  4KHZ A;  2F0J A;  2NZO A;  2ES2 A;  2F4V Q;  4IFD I;  2NVX H;  3J7A 5;  1YZ6 A;  2E2J H;  5I6W A;  3PO2 G;  5C3E H;  1AFP A;  4QCL A;  3HP3 A;  5M3F B;  1EY9 A;  1WOC A;  1Y1V H;  1L0W A;  4A3M B;  1A3U A;  1GOZ A;  2AHO B;  4IPG A;  2K6A A;  1PYW D;  2ZTE A;  4R8I A;  4YWK A;  5E7N A;  4L6T B;  1X3F A;  1SYF A;  2L5T A;  1V43 A;  3URY A;  4HIK A;  1EFW A;  4DR1 Q;  3T1Y L;  1UE7 A;  4C3H B;  4G4K A;  2V4D A;  2KHI A;  4QGU A;  3J81 L;  1FYC A;  5C0X G;  1FNW A;  1HTL D;  3SK4 A;  3HOX H;  5ELD A;  3HOY H;  1MIU A;  4WOR A;  3OTO Q;  4QQB X;  1K3B C;  3SHL A;  2XSC A;  1X6O A;  3EN2 A;  4JBW A;  4WRD A;  1KHI A;  3RNU A;  4AQY L;  4NW2 A;  2LMC B;  1H9J A;  4A3G G;  1S3O A;  4JI2 L;  1SAP A;  4KD4 A;  1S5B D;  1X65 A;  2QDB A;  5AFW A;  2BA0 A;  2XGT A;  3MEF A;  3NTI A;  2DJF C;  3Q6S A;  4OO1 H;  1SLJ A;  4HR7 B;  1HR0 L;  1A2T A;  3H15 A;  2AQ3 B;  3EBE A;  3BZC A;  1WTQ A;  1MKH A;  4JG2 A;  3U4Z A;  2EJM A;  3HKZ B;  5LL6 S;  5DAU A;  3SEB A;  3TP8 A;  1IL8 A;  5GQO A;  5JEA G;  2JN4 A;  5ELE A;  2MGS A;  1LTS D;  1WJJ A;  2B3G A;  4X66 Q;  4ZKB B;  4IUU A;  3HOX G;  3S17 B;  2K5V A;  1PYB A;  4GN4 B;  4IQZ A;  5CC4 A;  4DV4 Q;  4LF6 L;  2UU9 L;  1XMO L;  3S16 H;  2LKV A;  3RLO A;  2NB0 A;  4B3M L;  1TWG H;  4IUP A;  3CC7 A;  4XYO A;  1VQM A;  2F0H A;  3G71 A;  3L2P A;  4P74 A;  1GHK A;  1YIJ A;  3VA7 A;  1UAP A;  1I4H A;  5NUC A;  3I4N G;  1EQT A;  2JEB I;  4JV5 Q;  5C44 B;  5IGD A;  3J81 c;  5C5M A;  4LF8 Q;  2UXD Q;  3PSI A;  1IYU A;  5ELB A;  5C0X I;  1VQ8 A;  1PRT D;  3S24 A;  1VQK A;  3BDL A;  3M7N A;  4C3J H;  2PQA B;  1LT6 D;  3VYS A;  2O5J C;  1JC7 A;  1LAC A;  2P5Z X;  1SYD A;  4QJF A;  2HHH L;  2H1E A;  2PMZ E;  4FO2 A;  2CWP A;  4JI4 Q;  4A3B G;  2OQ0 A;  3HOZ G;  5T1I A;  3TSS A;  2UUA L;  1VMC A;  3OHX C;  1GUO A;  2EE1 A;  1EY0 A;  3Q0A A;  5GAD C;  2NYZ D;  1JCK B;  1HZ9 A;  2K04 A;  3W1G A;  5IT9 E;  4FNF A;  3AB9 A;  1HNW Q;  1K0R A;  3A0J A;  3NP8 A;  4C56 C;  4ALP A;  2QA4 A;  1Y1W B;  4OIJ A;  1K73 C;  1JWM D;  3T13 A;  3TQY A;  1M90 C;  1X3E A;  3FHW A;  1LTG D;  2JP1 A;  2VB3 X;  4AYB E;  4B9W A;  1S4Z A;  2WIN B;  5I2X A;  2BA1 A;  4X62 L;  5C4Z A;  4IPD A;  5CGK A;  1LT3 D;  3AFP A;  5JPN C;  4BS9 A;  2KCN A;  1EYD A;  2D5D A;  3D31 A;  4V0B A;  1S40 A;  3UI2 A;  1N33 Q;  4KMU C;  2K14 A;  3DLL A;  1XNR Q;  4B3T Q;  1HCZ A;  5TSS A;  2E8G A;  1Y8O B;  1IYV A;  4DXF A;  4I7A A;  2HIX A;  2Q2H A;  1EQR A;  1GJX A;  4DV5 L;  1CUK A;  1CTM A;  1GUN A;  1TY2 A;  3PIO A;  2X6L A;  1ET9 A;  4JPB W;  4TQU S;  1IBK L;  3TS0 A;  4QB4 A;  1QB5 D;  4XQJ A;  5FJ8 G;  4KV6 A;  1B70 B;  1V1P A;  3T56 B;  3H3V H;  1EU3 A;  2L11 A;  1X3Q A;  4OWX B;  1GXD C;  1J5E L;  1LUZ A;  1RKN A;  4QY7 A;  4DAP A;  2CW0 D;  2KBN A;  4DR5 L;  1H9K A;  1XMQ Q;  2KUM A;  2R7Z B;  3FKI G;  3FRP B;  2WP8 J;  1NJI C;  2RA4 A;  2F0O A;  4KKU A;  3TBI B;  1VQJ A;  3TP7 A;  4EQ5 A;  2K7V A;  1YNX A;  3GTK H;  4JI5 L;  1T5E A;  3J81 j;  4XQQ A;  3LX0 A;  5M5X H;  2PNR C;  3PO2 B;  2MPM A;  1EWC A;  2F0V A;  2B39 A;  1D5M C;  2IPK D;  1JJ2 A;  4YCW A;  2ALY B;  5IYC G;  4FXD A;  3MXN B;  4J6H A;  1BCP B; 
#chains in the Genus database with same CATH homology
 4BY7 G;  1O7I A;  2ZJR A;  4R1J A;  4A76 A;  4A3I H;  1IXR A;  3FP9 A;  1XNQ L;  5K36 G;  1CKN B;  1FJG L;  4HIO A;  4A3E G;  2E5L Q;  2A8V A;  2R7Z H;  3S2D H;  1N32 Q;  1BBW A;  5C4J H;  4GS3 A;  4X64 L;  3CCQ A;  1X55 A;  1PH9 A;  4HJ8 A;  1VQE A;  1YHB A;  1R9T H;  4JI4 L;  1VQF A;  4GKK Q;  3PO2 H;  1QVF A;  5H1S E;  3PUX A;  4IPC A;  4YCU A;  4OX9 L;  3CQZ H;  3W5O A;  2EXD A;  4LUO A;  1VQO A;  1YJN A;  4GOP B;  2WAQ G;  1IYJ B;  1FJG Q;  4OO1 G;  3CCJ A;  3E9H A;  4GLV B;  3GTP H;  1K3R A;  4L5S A;  4DV7 Q;  4BY1 H;  3ER0 A;  2JA7 G;  1SFO H;  3UDI A;  1VQB A;  2ID0 A;  1HNW L;  1QZH A;  1PHJ A;  2E2H H;  4JC0 A;  5IYB G;  4A75 A;  1VQH A;  1C9O A;  4OX9 Q;  4R4O A;  4DV1 L;  1PV4 A;  4WJ3 M;  4O2D A;  1I94 Q;  3STB C;  1JMC A;  1A62 A;  1KRS A;  4GKJ Q;  4HJ9 A;  2I5H A;  2D0P A;  4A3F G;  1UE6 A;  4JI0 Q;  1JJC B;  1VQ5 A;  3AYH B;  4DNI A;  2NVQ H;  4LWC A;  3AQQ A;  4O0A A;  5JEA J;  1P8L A;  4OWW B;  5IYD H;  2F3I A;  4AH6 A;  3HOU G;  1CSQ A;  2CKZ B;  4JCV E;  3CCL A;  3HKZ G;  3H0G H;  2YU9 H;  3A5U A;  3J80 i;  1N34 L;  1U5K A;  1AE3 A;  1VCI A;  1Q1E A;  4X65 L;  4POG A;  5ELN A;  2GN5 A;  4HJA A;  4IJL A;  1N33 L;  1GO3 E;  5GAG C;  1VQN A;  3JAM c;  4PG3 A;  3RLF A;  2JA8 H;  2RF4 A;  3K80 C;  1Q1B A;  4B3T L;  2UXC L;  4HJ7 A;  4DV3 L;  3KYH C;  4A3G H;  4LFC L;  1Q82 C;  1KXL A;  1V1Q A;  5LMN W;  4A3D H;  2N8N A;  2H5X A;  3NEN A;  1PH1 A;  1PH7 A;  4BBS H;  4X6A H;  4JI6 Q;  3PCO B;  3UE1 A;  3CC4 A;  1E7Z A;  2ZM6 Q;  1TWC H;  1E22 A;  4R4C A;  1X54 A;  5JJI A;  1TWH H;  2B63 G;  3CD6 A;  4KHP L;  4A3K G;  4XIG S;  3GD7 A;  3PIP A;  2YV5 A;  1NMF A;  2IX1 A;  1RL2 A;  5C44 G;  3BZK A;  2UUC Q;  3KJO A;  2NZH A;  1N36 L;  3M3Y H;  2KCM A;  4A3L H;  4K0K L;  5FLM H;  4GOP C;  1E1T A;  1V9P A;  3TEH B;  4DUY L;  1LM0 A;  2Z0S A;  1VQC A;  2VQF L;  1B8A A;  3I4M H;  3S1M H;  5GAE C;  3GTJ H;  4BBR H;  3S15 H;  2AWN A;  1HNX L;  1BVS A;  1TWA H;  3M4P A;  3CAM A;  3HOW G;  2IY5 B;  4DV0 L;  2WB1 G;  4LF9 L;  1FVI A;  2UXB L;  1SE8 A;  4P75 A;  1Q46 A;  4RG1 A;  5IP9 H;  2V1C C;  4DV6 Q;  4AIM A;  1XMQ L;  1Q86 C;  4JYA Q;  4B3R Q;  1A0I A;  4BXX G;  1YBY A;  3T1Y Q;  2K52 A;  4A3J H;  1N36 Q;  1AE2 A;  1J6Q A;  1VS0 A;  4K0K Q;  4YHH L;  4OO1 I;  1S72 A;  4IOA A;  1P16 A;  5GAH C;  5IP7 H;  2ATW A;  5LMN L;  5JJK A;  2K50 A;  3ERS X;  1HZA A;  3F2C A;  1VQD A;  2K5H A;  1HNX Q;  2Q2U A;  4HJ5 A;  3WWV A;  4NXN Q;  4LF9 Q;  4NXM L;  1I6H H;  4A3C G;  1E1O A;  1HZB A;  2IHF A;  4JI1 Q;  4IFD G;  2C35 B;  1YI2 A;  2CQO A;  2XTI A;  1HNZ L;  4DR7 Q;  3CP0 A;  3GDE A;  2QEX A;  3I4N H;  1I50 H;  3OYY A;  2RCN A;  3AEV A;  3S14 H;  1CKN A;  3ZJY C;  1YJ9 A;  4HIM A;  1PH4 A;  2FXQ A;  1WI5 A;  1VQP A;  2E5L L;  1TWF H;  3RZO H;  2GVB A;  3PUV A;  1Y1W G;  1XJV A;  4QIW E;  1N32 L;  4LF5 Q;  1UE1 A;  4DUZ L;  1AH9 A;  1I3Q H;  1NY4 A;  3NEL A;  1PH8 A;  4Y7N H;  1HNZ Q;  2ZJQ A;  4GKK L;  2Z6K A;  4JI2 Q;  5C0X J;  3W1B A;  2AWO A;  4DV2 L;  4GOP A;  4Y52 H;  4L5R C;  2B29 A;  5JJL A;  1W2B A;  4GLA C;  2K75 A;  2PQA A;  3ULJ A;  2NVY H;  1YJW A;  1GM5 A;  5C4X G;  5LMU Q;  4A3B H;  2R92 H;  4DR3 Q;  1SRO A;  1IBM Q;  3HOZ H;  1E3P A;  1OXT A;  1U0L A;  4BBR G;  2PI2 E;  4LFA Q;  1PA6 A;  4DV7 L;  4DUZ Q;  3GTL H;  4LF4 Q;  1HR0 Q;  3CCS A;  2OCE A;  1IL2 A;  1MJC A;  3PGZ A;  3GO5 A;  4DV2 Q;  1H95 A;  3GTO H;  1YIT A;  3Q8D A;  2F52 A;  1G29 1;  3L7Z C;  1QVC A;  1BKB A;  1FGU A;  1NTG A;  1YHA A;  2QGQ A;  2JA6 H;  4XTC S;  1I94 L;  3ICE A;  1EIF A;  4JOI C;  4IOC A;  5M5W H;  2A19 A;  4DK3 C;  3UE0 A;  4GKJ L;  4JI0 L;  4UPA A;  5FLX c;  1XPU A;  1KAW A;  1E24 A;  2ASB A;  3PUY A;  1YVC A;  2MQH A;  2VZA A;  4UP8 A;  2R7D A;  1IZ6 A;  1WCM H;  2IX0 A;  3I55 A;  2UU9 Q;  4LF6 Q;  1HH2 P;  2R93 G;  2VUM H;  4UP9 A;  2VQE Q;  2D62 A;  3I7F A;  1Y14 B;  1EIY B;  4B3M Q;  1N8R C;  2BH2 A;  2CFM A;  1NMG A;  2VW9 A;  3S1R H;  3F2B A;  3KF8 B;  4KLK A;  3HKZ E;  3KDF B;  4PZ7 A;  2MO0 A;  3NEM A;  1VQL A;  4DR6 Q;  2LSS A;  3M85 A;  3PV0 A;  1VQ6 A;  2L15 A;  3RZD H;  2RHS B;  3CCM A;  1Q81 C;  1Z9F A;  2JA9 A;  3KLW A;  1OXS C;  5HGQ A;  1KIX A;  4KI0 A;  4GLX A;  3CC2 A;  2YTY A;  4PZ6 A;  3T1H Q;  4A3I G;  4DAY B;  4ME3 A;  3KFU A;  1XTD A;  2R7Z G;  3U58 A;  4JI6 L;  4KHZ A;  5IWA L;  3TRE A;  3F8T A;  1I5F A;  2D0O A;  2ZM6 L;  2NZO A;  2ES2 A;  4OXP A;  4RMF A;  2F4V Q;  4IFD I;  4IPH A;  2NVX H;  1JE5 A;  4YCV A;  2GVA A;  3J7A 5;  1YZ6 A;  2E2J H;  4YWM A;  1CKO A;  1D8L A;  1K83 H;  3PO2 G;  4B3S Q;  5C3E H;  3CF5 A;  1RIP A;  2YYZ A;  3HFZ B;  3TS2 A;  2MO1 A;  2DGY A;  2DUD A;  1L1O C;  2R6G A;  2UUC L;  1WOC A;  1Y1V H;  1L0W A;  1MJE A;  5FJ8 H;  5IWA Q;  2I5L X;  2AHO B;  4IPG A;  3ULL A;  4BY1 G;  3G6E A;  5BR8 Q;  2JA5 H;  2ZTE A;  4R4Q A;  3CPW A;  4OON A;  4DR2 Q;  1XPO A;  4YWK A;  4MNO A;  1X56 A;  5E7N A;  1WCM G;  1X3F A;  1UWV A;  4GNX B;  3CME A;  3I2Z A;  2NN6 G;  4JYA L;  4DV6 L;  3EIV A;  2VUM G;  4B3R L;  1V43 A;  4HIK A;  1EFW A;  1LYL A;  4DR1 Q;  3T1Y L;  4LNQ A;  5IE8 A;  1UE7 A;  1BBU A;  3FKI H;  4JI7 Q;  1HR0 W;  2KHI A;  1PFS A;  4QGU A;  2N49 A;  4AYB G;  5M3F H;  1KRT A;  5C0X G;  1VQA A;  5M3M H;  4LFB L;  3BJU A;  3L0O A;  1JB7 A;  4NXN L;  4A3M H;  3LGJ A;  3HOX H;  2RHQ B;  4JI1 L;  5IYD G;  3S1Q H;  2Y0S E;  4P72 A;  1QUQ B;  3VDY A;  3H3V I;  1MIU A;  3HOY H;  2YTV A;  4DR7 L;  3OTO Q;  4QQB X;  2NVT H;  3H0G G;  1X3G A;  1X6O A;  5IYC H;  3EN2 A;  3CCU A;  3G48 A;  4JBW A;  5HY6 A;  3CCV A;  4BY7 H;  4J15 A;  2JK8 A;  1KHI A;  2EQS A;  3RNU A;  4LFB Q;  2A1A A;  4AQY L;  4LUZ A;  4LF5 L;  4C3H H;  1Q8K A;  2JA8 G;  3U4V A;  4A3E H;  1X9N A;  4APV A;  1CKM A;  3CXC A;  4A3G G;  3A74 A;  1S3O A;  4JI2 L;  4A3D G;  4PMW A;  2HT1 A;  5IY0 A;  3SGI A;  2KEN A;  1X65 A;  1Q12 A;  2YTX A;  3E0E A;  3KF6 B;  1PH5 A;  2R7F A;  2BA0 A;  3DM3 A;  1QVG A;  4BBS G;  1A8V A;  2XGT A;  3MEF A;  5LMU L;  4P71 A;  4DR3 L;  1IBM L;  4DV5 Q;  1Q7Y C;  2JA5 G;  4JI3 Q;  4AQY Q;  4LFA L;  2UUB Q;  1VQG A;  4LF4 L;  1SLJ A;  4LUV A;  3H15 A;  1HR0 L;  1PYS B;  1JJG A;  3I56 A;  2VY3 A;  3BZC A;  3EBE A;  2OQK A;  4NPS A;  2JA7 H;  5AJ3 Q;  3KJP A;  2VNU D;  1MKH A;  1L1O B;  4JG2 A;  3U4Z A;  1GKH A;  1D7Q A;  4A3L G;  1IBK Q;  3PUZ A;  2JE6 I;  3K8A A;  5IYB H;  5FLM G;  4LF7 L;  3CCR A;  3OW2 A;  3I4M G;  1SN8 A;  1WYD A;  1SR3 A;  5GQO A;  2JJQ A;  2WAQ E;  5JEA G;  3TRZ A;  5GRO A;  4L5T A;  1J5E Q;  4UY8 C;  1WJJ A;  1EYG A;  4TVA B;  3JAM i;  2B3G A;  4JI8 L;  4X66 Q;  3M9B A;  1KQS A;  3HOX G;  2K5V A;  1PYB A;  4GN4 B;  5IP9 G;  2OWO A;  4DV4 Q;  2ZTD A;  4A3F H;  4LF6 L;  4MTN A;  2UU9 L;  4GNX C;  4DR5 Q;  4A3J G;  2MNA A;  1K9M C;  1XMO L;  3S16 H;  1IBL L;  2I5M X;  2Q2T A;  2VQE L;  1EOV A;  2EIF A;  4LF7 Q;  2N78 A;  1Z47 A;  3KDF A;  3RLO A;  4B3M L;  1OXV A;  2AKW B;  5IP7 G;  3RN5 A;  1TWG H;  1VQM A;  3CC7 A;  3HOU H;  2UXD L;  3G71 A;  3D0F A;  4YWL A;  2HIV A;  3L2P A;  4DR6 L;  4JI8 Q;  4EX5 A;  4POF A;  4P74 A;  5EAY A;  4JI5 Q;  3B6Y A;  2NN6 I;  1YIJ A;  4BA1 I;  3I4N G;  3PF4 A;  3KOJ A;  1LTL A;  2JEB I;  1XMO Q;  1IBL Q;  4JV5 Q;  4JBK A;  1VQ4 A;  4OWT B;  3J81 c;  3T1H L;  1QZG A;  3HOV H;  3S17 H;  4LF8 Q;  2UXD Q;  4WJ4 A;  3PSI A;  5C0X I;  1VQ8 A;  4IFD J;  1KC8 C;  3S24 A;  1VQK A;  4PZ8 A;  3UDF A;  4DK6 C;  1KL9 A;  5ELO A;  1XNQ Q;  4BA2 I;  3S2H H;  3M7N A;  1JT8 A;  2F4V L;  4C3J H;  2PQA B;  4A4I A;  1PVO A;  4X64 Q;  4C3I H;  3G4S A;  3RLN A;  4B3S L;  2OTJ A;  1OXX K;  2B63 H;  4QJF A;  4A3K H;  1VQ7 A;  2HHH L;  2PMZ E;  4JI4 Q;  2CWP A;  1NBW A;  2JQO A;  4DR4 L;  1YEZ A;  1PH2 A;  4R4I A;  5DLQ E;  4DKA C;  2E2I H;  1KD1 C;  4A3B G;  2OQ0 A;  2CCZ A;  2R92 G;  2MFI A;  4IJH A;  1CSP A;  2ZJP A;  1TXY A;  3HOZ G;  5C44 H;  1A63 A;  4JBM A;  4H02 A;  2UUA L;  1K8G A;  5BR8 L;  4GNX A;  4UP7 A;  5GAD C;  4DR2 L;  1HZ9 A;  3W1G A;  1UE5 A;  2HHH Q;  1HNW Q;  3HOW H;  4NB3 A;  4JOI A;  4DR4 Q;  3A5Z B;  1K0R A;  4DR1 L;  3K7A H;  3A0J A;  4DV1 Q;  4LW1 A;  2JA6 G;  3CMA A;  4ALP A;  4BXX H;  1T9H A;  4JI7 L;  2QA4 A;  2K5N A;  2UUA Q;  1K73 C;  1SMX A;  3BU2 A;  5IT9 c;  3PF5 A;  4A93 H;  3TQY A;  1ASY A;  1XPR A;  1X3E A;  2KHJ A;  1QUQ A;  3FHW A;  1HJP A;  4AYB E;  1M90 C;  3JC6 6;  3CCE A;  3RR5 A;  1K8A C;  1C7Y A;  1EWI A;  2PI2 A;  2CWA A;  2WB1 E;  1PH3 A;  3OTO L;  1XNR L;  4A3C H;  3HOV G;  3NBH B;  1HZC A;  2BA1 A;  1M1K C;  2PNH A;  2Q2I A;  4X62 L;  3E9I A;  4IPD A;  1L2F A;  1N34 Q;  3F1Z A;  1W3S A;  4X65 Q;  3AFP A;  2IT1 A;  3U50 C;  4R4T A;  1G6P A;  2VS1 A;  3D31 A;  1S40 A;  1N33 Q;  1Y1W H;  3PO3 H;  4IO9 A;  3F2D A;  3ULP A;  2K14 A;  1WFQ A;  2ZTC A;  3KF6 A;  3DLL A;  1XNR Q;  2I0Q A;  4B3T Q;  2UXC Q;  4DV3 Q;  3K81 C;  1N9W A;  4LFC Q;  2HQL A;  2E8G A;  1C0A A;  4X62 Q;  1DGS A;  2JEA I;  4JBJ A;  2WFW A;  1ASZ A;  2HIX A;  2Q2H A;  3CPF A;  1EQR A;  2Z6K C;  3M4Q A;  4DV5 L;  1CUK A;  1UEB A;  4JI3 L;  5C4X H;  3I4O A;  2UUB L;  3PIO A;  1FL0 A;  2OTL A;  5C3E G;  3RN2 A;  1L1O A;  4KHP Q;  3CW2 C;  3AFQ A;  3S1N H;  2VL6 A;  3M4O H;  3IRB A;  5AJ3 L;  4MZ9 A;  3J81 i;  4TQU S;  1Y1V G;  1OTC A;  1IBK L;  4FDB A;  3TS0 A;  3GTM H;  2IHE A;  5FJ8 G;  4HID A;  3GTQ H;  1B70 B;  4GN3 B;  3H3V H;  2N3S A;  4DPG A;  4OWX B;  1G51 A;  3J7Z C;  4DUY Q;  4A93 G;  1GD7 A;  2VQF Q;  1J5E L;  1LUZ A;  4QY7 A;  3J80 c;  3GTG H;  3UDG A;  4X66 L;  1NE3 A;  2KBN A;  4YY3 L;  4DV4 L;  4DV0 Q;  2Y0S G;  4DR5 L;  2LXK A;  2LXJ A;  2UXB Q;  2AMC B;  1XMQ Q;  1EQQ A;  2R93 H;  2K4K A;  5J3B A;  3FKI G;  3K7U C;  2WP8 J;  1NJI C;  4C2M H;  4YHH Q;  5M5Y H;  1SRU A;  1OXU A;  5M3F G;  1VQJ A;  4DAM A;  1VQ9 A;  5M3M G;  4P73 A;  4EQ5 A;  4L5Q A;  1YNX A;  5LMN Q;  3HKS A;  3GTK H;  4A3M G;  4JI5 L;  3UDX A;  3J81 j;  1GVP A;  4GN5 A;  5M5X H;  3STB D;  1YHQ A;  3K0X A;  4YY3 Q;  3PO3 G;  4NXM Q;  3HOY G;  4QL5 A;  1JJ2 A;  4YCW A;  1B7Y B;  2KCT A;  2ALY B;  1PH6 A;  4JV5 L;  3PUW A;  2BH8 A;  5IYC G;  3MXN B;  1VQI A;  4LF8 L;  1EUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...