1XMOL

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmoL00
1K3RA 3RLOA 2VY3A 1DGSA 2IX0A 2VZAA 3KLWA 1JB7A 3CC7A 3HOXG 3HOVG 4DV5L 4K0KL 4YWKA 3CMAA 3CD6A 3W5OA 2RCNA 4X66Q 1K0RA 1SRUA 2EIFA 3CP0A 4A3IH 2L15A 2WB1E 5GQOA 3UE0A 1PH2A 3CC4A 1LM0A 3S24A 4NXNL 1OTCA 2JA9A 4P74A 4A3GG 2K52A 3L2PA 1EWIA 2VQEL 1CUKA 3B6YA 4JI3L 1NTGA 4DR1Q 3TEHB 3OTOL 4YCVA 4AQYQ 1Q1EA 4A3JG 4LF6Q 2Q2HA 3PUVA 1SR3A 2N8NA 3RLFA 1C7YA 3PF4A 2UXBQ 4OWTB 4LFCQ 2UXCQ 3E0EA 4IPCA 5LMNL 3K0XA 1QVGA 3PO3H 3HOZH 3RLNA 3VDYA 1YIJA 4A3MH 2A19A 4LF9L 4DV0Q 1YEZA 3KF6B 2ZTDA 2D0PA 3GTKH 2VL6A 3J80i 2LXJA 1X9NA 1J5EL 1A62A 4DR7Q 2R93H 2RF4A 4P71A 1TWFH 4RG1A 2VUMH 1Q1BA 1QZHA 3M4OH 5BR8L 5FLMH 2Z6KA 4FDBA 1AE3A 1PH3A 4C3HH 3IRBA 1G51A 3J81i 2WFWA 1W3SA 4GS3A 4J15A 3RR5A 1HNWL 2I5MX 1XTDA 3NELA 4BA2I 2E2JH 4BXXG 1LTLA 2VNUD 4OONA 4YWMA 5IYCG 1PH8A 4A93G 3GTJH 2K75A 1VQDA 3EN2A 5IYBG 4YHHL 1AH9A 4BBRH 4UY8C 1GVPA 2VQEQ 2DUDA 5HGQA 2JA8G 2LXKA 4GN5A 4C3JH 1N9WA 3KOJA 4A3KH 4DR4L 4WJ3M 5C3EH 2WAQE 3BZCA 5IT9c 2VQFL 2MQHA 1YBYA 4X65Q 3ULLA 1E22A 2F4VL 3KYHC 2R7ZG 5M3MG 3PUXA 5HY6A 2NZHA 4OO1I 1OXSC 2D62A 1VQ4A 1WCMH 2AMCB 1IBLQ 1VQFA 4GLVB 3JAMi 4A3EH 4R4CA 4UP9A 1S40A 4P73A 3KJPA 4JI5Q 1QVFA 5M5XH 1IL2A 2Q2TA 2V1CC 4GN4B 1X56A 1E3PA 4JI7Q 1S3OA 3HFZB 4PMWA 4KLKA 4JV5L 1JE5A 5IWAQ 2QEXA 3U4VA 1PH6A 4JI6Q 1U0LA 5C4XH 1PYSB 1K83H 4QL5A 4YCUA 1B70B 1HZ9A 2Q2UA 1PYBA 4UPAA 5IP7H 1CKMA 4DUYQ 3CCLA 1CKNA 2CWAA 1A0IA 5FJ8H 4DV6L 1I3QH 2OQKA 1IBMQ 2JA5H 2JA7G 5IP9G 4A3LH 3AFPA 2ATWA 3BZKA 3S1RH 4AIMA 1HNZQ 1YJ9A 2K5HA 3HOYG 2R92G 2UXBL 3EBEA 2ZM6L 1EFWA 3GDEA 2K5VA 4YY3Q 1GKHA 3NENA 3M4QA 1TWHH 4IPGA 1N33Q 5JJIA 1QVCA 4DR6Q 1SROA 4Y7NH 1PH1A 1UE5A 4IFDI 1VQCA 1GD7A 1O7IA 4LUZA 5LMUQ 3J7ZC 4HIKA 3UDXA 2VW9A 4MTNA 4DNIA 2K50A 3I4OA 2R93G 4TQUS 4JOIC 3E9IA 4GOPA 1PFSA 2ES2A 2I5HA 4DR6L 3PF5A 4LF7Q 4C3IH 4DV2Q 5FLMG 4B3SL 1Z47A 3OW2A 2Z6KC 1A63A 1KHIA 4IJLA 1IBKL 5M5WH 4IFDG 4OX9Q 2QGQA 3PO2H 1Y14B 2ASBA 3WWVA 2NVQH 2MO1A 4B3RQ 5M3FG 4DV7Q 2JJQA 3CPWA 1VQAA 3HKZE 1VQKA 3GTPH 4K0KQ 1XMOQ 1OXVA 1T9HA 2KENA 4R1JA 1EYGA 2E5LQ 3HKSA 4KHPQ 3CCSA 1Y1WG 4DAYB 1VQNA 2BA0A 4O0AA 2AKWB 1FVIA 1KRTA 5ELNA 4QY7A 5AJ3L 4IOAA 3NBHB 4YCWA 1PHJA 2ZJPA 1SFOH 3EIVA 4O2DA 3F1ZA 2I0QA 2B63H 4A3BH 4NXNQ 1XNQL 3A0JA 2D0OA 1SE8A 1CSQA 1PH9A 2R7ZH 1HNWQ 5K36G 3ULJA 2HIVA 1G291 2OCEA 3PV0A 4R4OA 2IT1A 3KDFA 5LMNW 3RZOH 1I5FA 3BJUA 2YTVA 1GM5A 2YU9H 4BY7H 5AJ3Q 1I94L 1SLJA 4QIWE 2KCTA 3STBD 1EUJA 4LF8L 4JI1Q 4QQBX 3PSIA 4DR7L 1L0WA 4AH6A 1WYDA 1YVCA 5C44H 1UWVA 2JA6H 1XNRL 5C4XG 1JT8A 4POGA 2IHFA 3MEFA 4PG3A 1V9PA 1E7ZA 2KCMA 4QJFA 1XPRA 1Z9FA 2UUCQ 4LF8Q 3GTQH 5JJKA 3UDGA 1VQPA 4X64L 1VQ8A 5IYDH 5IYCH 4KHPL 4JYAL 1LUZA 2AHOB 1Q82C 3G6EA 2R92H 3KF8B 3S17H 4JI1L 2Y0SE 4HIMA 2N78A 2AWNA 3A5UA 1CKNB 1HR0Q 1VQLA 4R4IA 1YHBA 4TVAB 2YTXA 1NBWA 3GTGH 4JI7L 4BBSG 4JV5Q 4A3JH 5JEAJ 1ASZA 3UDIA 1M90C 5C3EG 4JI5L 4ALPA 2I5LX 5C0XI 1TWCH 3TS0A 3H3VH 3I4MH 4JG2A 1EIYB 3HOZG 4LFBL 3FKIG 1BKBA 3GD7A 4DV0L 1VQMA 1C0AA 3G48A 2HQLA 2GN5A 2PMZE 4IOCA 1HR0L 4JBMA 4A3CH 3JC66 2F52A 1J5EQ 4DR3Q 1XMQL 2XTIA 3CAMA 2HHHL 1I6HH 4GLXA 1VQ9A 1KD1C 4YY3L 1XMOL 3OTOQ 1BBUA 4KHZA 2CCZA 2NVXH 4AQYL 4L5QA 1X6OA 4APVA 4C2MH 4JI3Q 4LFCL 3K80C 2JE6I 3SGIA 1VQBA 1FJGQ 4A3IG 2JEAI 2CKZB 3DM3A 5IE8A 4GNXA 2IX1A 2MO0A 2WP8J 1YHAA 4DKAC 1VQ7A 3CCVA 4HJ8A 3GTOH 4GN3B 2IHEA 5IY0A 4A3FH 4LW1A 1PH7A 4A93H 3FP9A 1G6PA 4GNXC 2CQOA 4L5SA 1VS0A 3S16H 1E1OA 3G4SA 3GTLH 3E9HA 3PGZA 1FJGL 4BBRG 3S2DH 1QUQB 5ELOA 4X65L 5C4JH 1Q46A 2JA8H 2NVYH 4JI2L 1WJJA 4BY1G 1N36L 3A74A 3ZJYC 4JC0A 4A4IA 4AYBG 1HNZL 4GOPC 2UUAQ 4JOIA 2GVAA 4DV1Q 4GOPB 1W2BA 3HOWH 5J3BA 3CCRA 4A3DH 3H0GG 2BA1A 4XIGS 2KHIA 1PVOA 4WJ4A 4A3MG 3CCQA 4DR3L 3RNUA 1XMQQ 2N3SA 2NZOA 3CC2A 3J7A5 4Y52H 1VQJA 4LF5Q 1NJIC 5H1SE 3S1MH 1HZAA 1YITA 2UXCL 3PO2G 5E7NA 2KBNA 1WI5A 2OWOA 4B3SQ 3I56A 2QA4A 4LWCA 1IBKQ 5IWAL 4DV4Q 4OWXB 1VQ5A 2E2IH 5GAEC 2NN6I 1JMCA 3HKZG 3UDFA 3K8AA 4P75A 3W1BA 1YZ6A 3UE1A 2VQFQ 5IP9H 2HT1A 3W1GA 4XTCS 1N32Q 1J6QA 1IBLL 1HNXQ 4HJ7A 4OWWB 3D0FA 5IYBH 1XJVA 4B3ML 1JJCB 1WOCA 1JJ2A 3ICEA 1BBWA 3FKIH 5LMNQ 4IO9A 1E1TA 4L5RC 1EOVA 1QZGA 2FXQA 1VQEA 1N8RC 1XNRQ 1JJGA 2OTLA 2Y0SG 3I7FA 4YHHQ 4B3TL 1N34L 4H02A 4GNXB 1Q7YC 1K73C 3J81j 3M7NA 2Q2IA 3L0OA 5DLQE 4IPDA 2PQAB 4DV2L 1IBML 2BH8A 2OQ0A 1L1OB 1P16A 1OXTA 4DV7L 4DUYL 1L1OC 2A1AA 3CMEA 1YHQA 1Q81C 1X3FA 1Y1VH 1IYJB 1C9OA 4DK6C 3H15A 2XGTA 2K14A 1R9TH 5FLXc 1HH2P 1L2FA 2K5NA 3TRZA 1CSPA 4R4QA 1HZBA 3U4ZA 5IYDG 4JBKA 5GAGC 2ZTCA 1HR0W 1N33L 1TWGH 1XPOA 4POFA 2PQAA 4RMFA 1M1KC 2WB1G 3STBC 3AQQA 3CCUA 1PH4A 4NB3A 5JJLA 2A8VA 1B7YB 3DLLA 1TWAH 3CXCA 2B63G 2GVBA 2R6GA 1NY4A 3ULPA 1EQQA 4LF9Q 3AEVA 1LYLA 2ZTEA 3CW2C 4B3RL 3S15H 3TS2A 4KI0A 1D7QA 2RHQB 2E5LL 4DV6Q 3HOUH 3K7AH 1V43A 3KF6A 1HZCA 1X3EA 1RIPA 4GLAC 1KC8C 4DR1L 1WFQA 3K7UC 1FGUA 2F3IA 2K4KA 2R7FA 3D31A 3S2HH 5LMUL 3GTMH 2CWPA 1PH5A 1PV4A 2DGYA 4JI8L 3S1NH 3TQYA 2PNHA 5JEAG 3JAMc 5C44G 1YJWA 2UUBQ 3KDFB 2JA6G 3I4NH 1N32L 2YYZA 1IZ6A 2CFMA 1VCIA 5EAYA 4A76A 4GKKL 1D8LA 4LUVA 3CF5A 1AE2A 1SN8A 2E8GA 4OO1G 2VUMG 4JCVE 1VQOA 1SMXA 3H3VI 2BH2A 3BU2A 5M5YH 3HOXH 3HOVH 4DR4Q 3CCEA 1N34Q 4LF5L 4DV3Q 3Q8DA 2RHSB 1S72A 4OXPA 1E24A 2Z0SA 5GAHC 4DR2L 2VS1A 2JQOA 4HJAA 1FL0A 4LFBQ 4A3LG 3HOWG 4A3DG 4JI4L 3HOYH 2NN6G 4MZ9A 3ER0A 4JI2Q 2PI2A 4QGUA 1X65A 4R4TA 1B8AA 4DV1L 3NEMA 4A3CG 4LNQA 1KL9A 1UE6A 3PUYA 2N49A 2ALYB 3I2ZA 5GROA 1N36Q 1Y1VG 4X66L 2E2HH 4LF4L 1A8VA 4ME3A 1VQHA 4IPHA 4DV5Q 1V1QA 2JEBI 2PI2E 4JYAQ 1UE1A 2EQSA 2AWOA 4JI8Q 4YWLA 4JI4Q 2KHJA 3PIPA 3J80c 1X54A 3CCJA 1IXRA 3A5ZB 4HIDA 1WCMG 2ID0A 2MFIA 4X62L 1MJEA 2MNAA 1KQSA 4DR5Q 1H95A 4UP7A 4B3TQ 2ZM6Q 1MKHA 2OTJA 1MIUA 1VQ6A 1KRSA 5C0XJ 3T1YQ 4NXML 3RN2A 4AYBE 2IY5B 3MXNB 3PUWA 5M3FH 4A3FG 1OXUA 2HHHQ 2JK8A 4DK3C 3PIOA 4DV3L 3KFUA 3I55A 2R7DA 1Y1WH 1P8LA 2YV5A 1NMGA 4JBJA 4HIOA 4EQ5A 5IP7G 1YJNA 4BA1I 4X62Q 1GO3E 4BY1H 3M3YH 1PA6A 1ASYA 4JI0L 1KIXA 2UXDL 4PZ8A 4UP8A 4BXXH 4LF7L 4X6AH 3KJOA 3H0GH 4PZ7A 2HIXA 3LGJA 4A3BG 2YTYA 4A3GH 1UE7A 4DAMA 3U58A 5BR8Q 4MNOA 1KXLA 1QUQA 4NPSA 3AFQA 1XPUA 2F4VQ 2UXDQ 3I4NG 3G71A 1EQRA 1VQGA 4A3KG 1OXXK 1RL2A 4DPGA 4DUZQ 1I50H 4PZ6A 2NVTH 4DV4L 2LSSA 4P72A 1KAWA 3PO3G 2EXDA 2UUCL 3S1QH 5M3MH 3F2BA 1YNXA 4JBWA 3AYHB 5C0XG 3TREA 4A3EG 3K81C 3T1YL 3S14H 1U5KA 3PUZA 4L5TA 2UUAL 2H5XA 4HJ5A 1K9MC 3GO5A 4DR5L 2UU9L 3RZDH 1YI2A 1Q86C 4OX9L 4IFDJ 3CPFA 3RN5A 1HNXL 4GKJL 1NMFA 1CKOA 1EIFA 2UUBL 4LUOA 3J81c 3M9BA 3T1HQ 1L1OA 1HJPA 4LF4Q 1X55A 1BVSA 4GKKQ 1UEBA 3F8TA 4IJHA 1I94Q 4JI0Q 3HOUG 1Q8KA 4EX5A 1MJCA 3U50C 3F2CA 4GKJQ 5FJ8G 2JA5G 2B3GA 1NE3A 4LF6L 2JA7H 3M85A 4A75A 3OYYA 2UU9Q 3ERSX 1Q12A 4BBSH 3M4PA 4HJ9A 3T1HL 1K8AC 4LFAL 2C35B 5GADC 1K8GA 4DR2Q 1XNQQ 3I4MG 1TXYA 3CCMA 2ZJRA 2ZJQA 3FHWA 3CQZH 3PCOB 4X64Q 4DUZL 4JI6L 3F2DA 2WAQG 1VQIA 1X3GA 4NXMQ 4BY7G 4LFAQ 2B29A 4B3MQ 3L7ZC
chains in the Genus database with same CATH superfamily
5DM73 2VY3A 2B39A 5KYIA 3HOVG 3CMAA 3CD6A 2RCNA 1BNZA 1SRUA 2X69A 2L15A 2Z8LA 3D4RA 1EYCA 3KLRA 5D14A 5F2DA 4NXNL 1OTCA 4EGVA 2G9DA 1EQTA 4A3GG 1RODA 3L2PA 1EWIA 3VYUA 1CUKA 4DR1Q 3QG1A 4LF6Q 1WTWA 2Q2HA 2UXBQ 5LMNL 3K0XA 4KMUC 4FXGC 4R8IA 2A19A 1EY9A 2KA7A 2D0PA 5TSSA 4DNRB 2LXJA 3D6CA 1J5EL 4WFN3 4O42A 1GUWA 3M4OH 5FLMH 3KBXA 1AE3A 5IOCA 4C3HH 4O1NA 4XYOA 3RMHA 3A7AB 1PRTB 4WJWA 5CR3A 1HNWL 3NELA 5HURA 4OONA 3IKJA 1PH8A 3OHXC 2K75A 2F0QA 1AH9A 1EY4A 5EJWA 4HCSA 2DUDA 2EZVA 1S5FD 1RTOA 1X32A 3BZCA 2J7ZA 3OPOA 5ELFA 5JEAH 2NZHA 4K5VA 2LKVA 1F2YA 4GLVB 4A3EH 1LTTD 1WTOA 5D3IB 5G3LD 1A3UA 1S40A 1IL8A 5M5XH 1R9TB 4GN4B 1X56A 5CV4A 1EU4A 3LNNA 5IWAQ 1PH6A 1AZQA 1U0LA 5C4XH 1PYSB 4YCUA 1CQVA 4G7ZC 1B70B 3FDTA 4WRDA 1CKMA 3CCLA 1LTID 4K5XA 2X6LA 2G9HD 5IP9G 3C2PA 1YJ9A 2K5HA 2UXBL 2R92G 1S5ED 3U9OA 2J0TD 2O5JC 1QVCA 2F0IA 1SROA 4HAEA 5DAUA 1DZ1A 1UE5A 2AUJD 1GD7A 4HIKA 1XXGA 3UDXA 2VW9A 4MTNA 2R93G 3MVVA 4TQUS 2I5HA 3W2DA 4A3FB 1Z47A 4DN4M 2A6HD 2Z6KC 1HRJA 3PO2H 4ZAIA 3TZUA 1AW7A 3WWVA 3KLSX 1Z6HA 2JJQA 4K6LA 5FKAC 3CPWA 1H9JA 4R1JA 5FK9C 1XMOQ 2M00A 3HKSA 2VB3X 3PO3B 1VQNA 3RD4A 2SOBA 4O0AA 1FVIA 4NKLA 4KY5A 5AJ3L 1PHJA 4MTKA 1IKMA 1XTCD 2BE5D 3EIVA 4O2DA 2JA7B 2M9VA 3MA2B 4NXNQ 5CV7A 3S16B 5C4XB 4RGMA 1PH9A 2R7ZH 3ULJA 2HIVA 2B2YA 2YTVA 1GM5A 2XSCA 4IN3A 5C3EB 4KY7A 4LF8L 1GUOA 1UEAB 5L37A 5CV5A 2JA6H 1CZWA 1JT8A 4P2CB 1TR5A 3TN2A 3GTQH 2WV6D 5K5PA 4X64L 1VQ8A 1T5EA 2E74C 5IYCH 1LUZA 3G6EA 5D3DA 4JI1L 2ZT9C 4RGNA 3A5UA 1HR0Q 1G6ZA 3OMGA 1YHBA 4TVAB 3JAML 5ELDA 2YTXA 1EZ6A 4ZRZA 1NR4A 4A3JH 1ASZA 3J7AF 4JI5L 5JPMC 5JVG3 1IKLA 1LT3D 1PRTF 2PYKA 4FXKC 5C0XI 3H3VH 4LFBL 1EIYB 3NPPA 1BKBA 3G48A 4IOCA 4A3CH 1I6HH 1XMQL 3A8IE 3HOXB 4KD3A 3HG9A 3OW7A 4KHZA 3WOFA 1ICFB 1X6OA 4C2MH 4IUQA 3NE5B 2JE6I 3SGIA 1VQBA 2B8GA 1STGA 1FJGQ 4A3IG 3DM3A 2MO0A 2WP8J 4Q5VA 3J7AV 3CCVA 4C1NK 1QWYA 4L63B 2KUMA 4L8JA 4CDDC 1WTQA 1ET6A 4GNXC 4L5SA 1VS0A 3S16H 3L3OC 3E9HA 2OT2A 5C4JH 4DK0A 1WJJA 3A74A 1Q3LA 4H0LC 4JVZA 1A3TA 4K14A 4GOPC 4JOIA 1J5EQ 2BA1A 1XWEA 2KCCA 3BG3A 3FRPB 4IZ8A 3CCQA 3J7A5 4LF5Q 1EY5A 3BYTB 1K8MA 5C5LA 2KBNA 3A54A 2OWOA 5COYA 4LWCA 5IWAL 4OWXB 1II3A 1QJOA 3N6RA 1UUPA 3GV6A 2FHTA 1QOHA 1KABA 4MN3A 2HT1A 5T1IA 4XTCS 2D9UA 2RVLA 4B3ML 1JJCB 1WOCA 5I6YA 3FKIH 1QZGA 1XNRQ 4DU9A 2ICEC 1JJGA 4YHHQ 4B3TL 3DXJC 4GNXB 1O7YA 5M3FB 1HXYD 2I07B 3M7NA 1LTGD 4IPDA 4DV2L 2OQ0A 2F1MA 5M3MB 1P16A 1WVLA 4DUYL 2A1AA 2V4DA 1C9OA 3TMEA 5KRUA 2QEJC 3OIQA 5I2YA 1CA6A 3IAYA 3U4ZA 1N33L 5GAGC 1HR0W 1G91A 1PFBA 3NXWA 2ZXOA 3Q24A 1M1KC 4C3HG 3D8GA 1F9QA 4XQNA 4ILWA 3T56B 4CKBA 3DLLA 4N9TA 1SNMA 2R6GA 4LF9Q 2JA5B 3ULPA 3VA5A 2GA4B 1V1PB 4B3RL 4Z9CB 1D7QA 2RHQB 3TP6A 1V43A 3EA6A 3KF6A 4RKLA 4R9WA 4GLAC 1WFQA 1FGUA 1F2ZA 4N9PA 3T13A 2CWPA 1B3AA 2DGYA 5EBCA 3S1NH 1YJWA 2JA6G 2UUBQ 3I4NH 1ICWA 4A3JB 4A76A 2K03A 5C3WA 2XVSA 4LUVA 1AE2A 5ELEA 2A6HC 2TSSA 4JCVE 5ELBA 5CMDA 4KK7A 1EQVA 1ENAA 5C0XH 4TRDA 1BCPC 5C4HA 3DUZA 5GAHC 4HJAA 4LFBQ 2WAQB 4C1NI 4A3DG 1SNPA 2L12A 1X65A 4FXDA 1Y8OB 3ND8A 4X66L 4LF4L 4RGOS 5KIXA 1VQHA 4DV5Q 4JYAQ 1GUSA 1UE1A 2B2WC 4X3UA 5LL6S 4FYDA 3A5ZB 4X62L 1U4PA 4DR5Q 4K5WA 5C44B 2ZM6Q 1DXMA 1VQ6A 4NXML 4B9WA 3S14B 3RN2A 4A3FG 1WTPA 1B50A 2A73B 4CBVA 1F9PA 3H6MA 4XYQA 2B8FA 2MJ8A 2YV5A 4JBJA 1TWAB 4EQ5A 1JWUD 1GO3E 2CHBD 2EXZA 4X3SA 4HR7B 4UP8A 4CHTB 4NMZA 4LF7L 1F9SA 4X6AH 2HDLA 3H0GH 2HIXA 4A3BG 1FGBD 1QUQA 5EBDA 5K36H 1WCMB 4C3JG 1EQRA 5KEEA 1A2UA 3A55A 1OXXK 4A3KG 2FINB 2NVTH 4DV4L 3MXGA 3PO3G 2EXDA 2UUCL 3S1QH 3F2BA 2RQXA 3TREA 3VYRA 2NVQB 3T1YL 3S14H 4L5TA 2UUAL 2PZTA 2UU9L 1Q86C 2F0HA 3UI2A 4PQXA 2UUBL 3SEBA 4HSPA 1IYUA 5IIFA 2EYFA 5EPKA 1HJPA 4IJHA 1Y69U 2JA5G 2JA7H 1ILQA 1NE3A 3OYYA 1JQYD 3GTGB 3M4PA 3MAQA 2SNMA 3E6ZX 3MFYA 1STNA 2QDBA 1K8GA 2J4XA 3LWEA 3PCOB 4DUZL 3IFTA 5C3XA 4BY7G 2F0PA 2BCOA 3URYA 1SE2A 1I3QB 2IX0A 2F0OA 1JB7A 3CC7A 3HOXG 4DV5L 3K58A 1K0RA 3S9WA 4A3IH 3UE0A 1LM0A 4DK1A 5IGBA 3S24A 1HPCA 2JA9A 3V2TA 2K52A 2ENBA 1HUMA 4QB4A 4YCVA 3T53B 4BBRB 1Q1EA 2NUCA 4A3JG 4CJ1B 1V8QA 3PUVA 3RLFA 1C7YA 3OOCA 1YNJD 2CVRA 4IPCA 3VA7A 2F0GA 1YNJC 1EOTA 1YIJA 1FD7D 1CHPD 2D5DA 4MIUA 2ZTDA 2IL8A 3J80i 1X9NA 2DY7A 1A62A 3KK7A 1G2TA 2RF4A 2K6AA 1Q1BA 5A2QL 1QZHA 2PW5A 5BR8L 2Z9HA 2F3VA 3IRBA 5EKIA 4J15A 2I5MX 4K2KA 4Y7NB 3N52A 1E2WA 3Q22A 5IT9E 1VQDA 4YHHL 2LXKA 4FF2A 1N9WA 2B2WA 1GHKA 2FFKB 5IT9c 1U4LA 2BE5C 2MQHA 1YBYA 4KV6A 2A6ED 2F4VL 3NWTA 5M3MG 4HEDA 2B2UA 2D62A 2AMCB 1HHVA 1IBLQ 4R4CA 1QVFA 4IUPA 1E3PA 3HFZB 1JE5A 1C0AA 2Q2UA 1K83H 4DUYQ 5CV6A 2JA5H 2JA7G 1I3QH 2OQKA 4A3LH 4PMCA 3AFPA 1IHZA 3BZKA 3HOYG 1HNZQ 2F0KA 3EBEA 2VB2X 2ZM6L 1EY8A 2AUKA 3C46A 4YY3Q 2K5VA 3DWQA 4DAYA 4I7ZC 1I4RA 1N33Q 1HFNA 3MEHA 1LT4D 4NW2A 4Y7NH 1PH1A 1F2MA 1O7IA 5LMUQ 3J7ZC 1DOLA 3NQIA 4ZUIA 3GTMB 1NUCA 3P20A 4DNIA 1TT2A 4KN4C 1FNVA 1D5MC 4LF7Q 4C3IH 5FLMG 4HSVA 4LJZC 1A63A 3EQLC 5JOBA 1IBKL 4ZLTF 1BF4A 3GTPH 3I3CA 1EYGA 4KHPQ 3J80E 4CJ0B 1CI3M 1Y1WG 2XNAC 1D5XC 2BA0A 5KNDA 4OL7A 4BBSB 2ZJPA 2Y0SB 3BYYB 1TIID 1LACA 3NHHA 2D0OA 1SE8A 1F77A 3X3MA 2OCEA 4R4OA 3PV0A 3KDFA 4NDXA 2YU9H 2L11A 2XWJB 4BY7H 5AJ3Q 4A93B 3K5MA 4QIWE 3VR2A 2EE1A 2QW7A 1JE4A 3PSIA 4DAPA 4DR7L 1L0WA 1YVCA 1QE6A 4PG3A 3NBHA 1XX8A 3S15B 5JJKA 2KCMA 3BVGA 1Z9FA 1LABA 1T5XD 1ZEQX 4OELB 5IYDH 2R92H 1RDPD 1TY2A 4HIMA 2N78A 1VQLA 4R4IA 4RWSC 1SJHD 5D65A 1NBWA 3NSWA 5BN3A 3GTGH 2K7VA 1M90C 4HN7A 1QB5D 3MWYW 5J39A 4JG2A 2EVBA 1VQMA 2GN5A 1HR0L 4JBMA 3S1MB 1C48A 4DR3Q 2HHHL 1NNXA 4GLXA 2R92B 2PW7A 1KD1C 3HOVB 5M5YB 1D5ZC 4DA2A 2EY1A 3OTOQ 4ZKCB 2NVXH 4CDEC 3OMCA 2JEAI 5IE8A 4GNXA 4G7HC 4DKAC 3GTOH 1EYDA 5IY0A 4A3FH 1PH7A 4A93H 3S2HB 2CQOA 2PCFB 1E1OA 3GTLH 2L1BA 3U9SA 3I4NB 3S2DH 5ELOA 1PTOC 5AFWA 3ZJYC 4A4IA 1H9SB 1WTRA 3HOUB 1K3BC 1W2BA 5J3BA 3A8KE 3H0GG 1BBXC 2KHIA 1PVOA 4UAIA 4A3MG 1AFPA 2N3SA 3CRLC 1KDAA 3S1MH 2B2VA 2F0EA 2F0WA 1YITA 3PO2G 2A6EC 2F0VA 3I8ZA 2QA4A 1V1PA 2X6GA 1MHWC 1SMYD 2E2DC 1AEXA 5GAEC 2IWHA 2EJMA 4LMQD 1LTRD 1C4QA 3K8AA 1E2ZA 1FR3A 4U673 1BCPB 4M1UB 1EY6A 2BDOA 3D0FA 1EU3A 3ICEA 2XN9C 5LMNQ 1E1TA 1SAPA 2FXQA 1V1OA 2LFNA 2Y0SG 4HTHA 3DM1A 3EJIA 3J81j 2NN6H 1IYVA 3L0OA 5DLQE 2IX3A 2B2YC 1OXTA 1L1OC 1STEA 3CMEA 1YHQA 4QMGA 1Y1VH 2YU9B 1G8ZD 1M8AA 3K5OA 2XGTA 2IJ0A 1CTMA 3T16A 5EKKA 5LHY1 5FLXc 4RCOA 5IYDG 2ZTCA 3MZ5A 5BN5A 1NSNS 2AQ1B 3SHLA 1HQRD 3I73A 3SXHA 1JWMD 4JPBW 3STBC 1ESRA 3MFGA 1PH4A 4NB3A 3S17B 1B7YB 4V190 3CXCA 5I6WA 1NY4A 1X3QA 2K04A 4ABNA 3CW2C 1FYCA 5EPLA 1B9NA 1HZCA 1PFNA 1KTKA 3K7UC 4ULLA 2K4KA 3D31A 3GTMH 3NQTA 4FO2A 1PV4A 4F7XA 5JEAG 3JAMc 2WINB 1MSHA 4BY1B 2CFMA 3NTKA 5EAYA 1WTXA 1D8LA 1JCKB 1TU2B 4ZQ3A 1JB3A 2AQ3B 2E8GA 4OO1G 4DF7A 3D4DA 1SMXA 2PPBC 3L9AX 2Q8RE 4UDUC 1N34Q 1BDOA 1S72A 4OXPA 1E24A 1NCVA 1SNQA 1B9MA 1HTPA 4JI4L 3HOYH 1TWCB 2NVYB 1TS4A 1SE4A 4KKSA 2EYPA 4JI2Q 1IW7D 2JP1A 4QGUA 1PTOD 1B8AA 1NAPA 1BQQT 4LNQA 1KL9A 3I2ZA 1Y8NB 2F0LA 1N36Q 4ME3A 1V1QA 2EQSA 2AWOA 4YWLA 2RA4A 1DD2A 1CT1D 2MFIA 3R2TA 2MNAA 4UP7A 2MPMA 1H9KA 1MKHA 3DWAA 3MXNB 3PUWA 3S1RB 2HHHQ 2B2VC 4DK3C 3PIOA 1VMPA 3KFUA 3E5SA 1Y1WH 1P8LA 4IALA 2Z6BA 1B1ZA 4BY1H 1PA6A 1ASYA 2DJGC 4PZ8A 4BXXH 2DNCA 1K28A 3A8JE 3LGJA 2YTYA 2HUGA 1UE7A 4A3GH 3U58A 2CH4A 3AFQA 3OWEB 5CBEE 3G71A 1VQGA 1R4PB 1RL2A 2QF7A 4QIWB 4DPGA 4DUZQ 1HA5A 3OWFA 2LSSA 2SNSA 4C3JB 1YNXA 3MC0B 1DCZA 5C0XG 1D6EC 3NTIA 2IW3A 3K81C 2K05A 3PUZA 4IFDH 2H5XA 1SMYC 1YI2A 4G4KA 4BS9A 3CPFA 1CKOA 1EIFA 3DEPA 3PO2B 3IFDA 4LF4Q 2LS01 1LLRD 3F2CA 2B63B 2B3GA 3M85A 4KJOA 4A75A 2UU9Q 2VUMB 3T1HL 4LFAL 5JJZA 3NP8A 4DR2Q 4XXEA 1RTNA 3GTQB 1VMCA 4X64Q 2L4NA 5M9OA 4JI6L 2WAQG 1VQIA 1HTLD 4LFAQ 1NTGA 1K3RA 3RLOA 1O7LA 1DGSA 5C4ZA 3KLWA 5EGTA 2MUYA 4K0KL 4YWKA 3W5OA 4X66Q 1SYEA 2EIFA 2RKSA 1ML0D 3CP0A 3O13A 4K6DA 2WB1E 1SDFA 4ME5A 4P74A 2QILA 1UAPA 2PMZB 2VQEL 1B4OA 1VF7A 4XT1B 1WD0A 2E76C 4AQYQ 3PF4A 1SR3A 4L6TB 2WACA 3PO3H 1BCPD 1QVGA 3HOZH 2PNRC 3RLNA 5JPNC 5I2XA 4DV0Q 1YEZA 2KJXA 2Z4HA 5IT9L 4DR7Q 3HZXA 2E75C 3GTLB 3I91A 3GV3A 4P71A 1TWFH 4RG1A 2VUMH 4CDFC 5FO7B 3GP7A 3J81E 1X3PA 1KDCA 4XQJA 1YNNC 1W3SA 2WFWA 3K7AB 4GS3A 4N8FA 1XTDA 1SYCA 4BXXG 1LTLA 4YWMA 1OO9B 3R3OA 4A93G 1STYA 3EN2A 1QNUA 1GVPA 1EY7A 4C3JH 4A3KH 4WJ3M 5C3EH 2B2TC 4X65Q 5CGKA 1E22A 2EY2A 4OO1I 3NBIA 2RDHA 4EQPA 1VQ4A 2F0NA 4LK1C 4TSSA 2XRQD 3C1FA 4P73A 1IL2A 3CKIB 3R8BA 2V1CC 4JI7Q 4JV5L 4PMWA 4KLKA 3PIP3 1HQMC 3U4VA 4JI6Q 4QL5A 3SK6A 3E3XA 1HZ9A 2B2UC 1PYBA 4UPAA 5KNBA 3S1QB 1CKNA 1A0IA 3C3LA 4DV6L 1IBMQ 2ATWA 3S1RH 1JOOA 4AIMA 1BUVT 3M4YA 1SJED 4FVMA 4F88A 3GDEA 3M4QA 1TWHH 4DR6Q 2HDMA 4IFDI 1VQCA 3EFXD 3ZYYX 3Q6SA 5EQ0A 3I4OA 1TQOA 2ES2A 4DR6L 3PF5A 3M4OB 3A7LA 4DV2Q 4B3SL 2NTTA 3QOJA 3OW2A 3BVMA 4IJLA 2RSOA 5M5WH 4IFDG 4OX9Q 1HA6A 2ASBA 4B3RQ 5M3FG 1VQAA 1VQKA 2E5LQ 1TWHB 1EEID 3RZDB 1FNWA 3E0JA 1TS5A 3CCSA 3EVQA 2AKWB 2VXWA 3I70A 1KRTA 5M5XB 4YCWA 5IGEA 2PQEA 3F1ZA 1EIHA 4A3GB 4KKTA 1I6VC 2KOLA 3FEWX 1CSQA 3C1EA 4OGQC 4CKCA 3ITPA 1HNWQ 1G291 1JOQA 3HKZB 5LMNW 2JSOA 3RZOH 3BJUA 3RUZA 4EQNA 1SLJA 3QB3A 2KCTA 1AP0A 1MGSA 1EUJA 2ZXPA 1WYDA 3BS1A 1UWVA 5C4XG 3MEFA 1SYFA 3ERQA 1XPRA 4LF8Q 3CQZB 1VQPA 3BDLA 4KHPL 1Q82C 2AHOB 3DWPA 5A35A 3S17H 3HP3A 2Y0SE 2AWNA 1I6HB 1YNND 2BOSA 3TZDA 2OF1A 4JI7L 4JV5Q 3K5LA 3UDIA 5C3EG 4ALPA 4ZKBB 2I5LX 3TS0A 1TWCH 4A3IB 3HOZG 3FKIG 2K5DA 4DV0L 2E2HB 2HQLA 3CRKC 3JC66 2F52A 4EVOA 4ZCKA 5KNCA 2XTIA 3CAMA 2WIIB 3EROA 4RAUC 5CC4A 1VQ9A 3ONAB 4PMBA 1KAAA 1XMOL 2L5TA 3PIO3 1PYWD 4AQYL 4S3SA 4JI3Q 4BWGB 5C5MA 2MGSA 4F8MA 1VQ7A 2IHEA 3T4AC 1G6PA 1AN8A 2KEDA 1ZXTA 1BOSA 1PXUA 3PGZA 1FJGL 1PRTC 1QUQB 1Q90A 1Q46A 3R2IA 4KTAA 2A68C 1PLFA 4BY1G 4JI2L 3M3YB 4AYBG 1HCZA 4JC0A 3HOWH 1J8IA 1J9OA 1GUNA 5JAVA 1SYBA 3D4WA 3TDQA 1B2TA 4DR3L 2PZUA 2L9HA 3CC2A 1VQJA 1PTOF 5G3LF 1NJIC 5H1SE 1RF2D 1SEBD 1WI5A 1IW7C 3I56A 3MXNA 3SK8A 2OEOA 1IBKQ 1DOKA 2F4IA 4DV4Q 1VQ5A 3AMUA 3UDFA 3W1BA 1BXTA 1YZ6A 5EKLA 4MHEA 3K5NA 2VQFQ 3W1GA 1J6QA 2R61A 1E0BA 3H91A 1HNXQ 2DN8A 4OWWB 5IYBH 3A56A 4IO9A 4L5RC 1EOVA 1N8RC 2K01A 1MI2A 1LTAD 2K5WA 1N34L 1KLGD 1B53A 1Z7TA 3FVQA 2Q2IA 1IBML 2PQAB 1L1OB 4G57A 4DV7L 1VDZA 3BZDB 2KQ3A 4RA8A 4DK6C 3TBIB 2K14A 1R9TH 1HH2P 3TP5A 1L2FA 2K5NA 1CSPA 1HZBA 1TWGH 1TY0A 4C2MB 4IUVA 2PQAA 2R93B 3CCUA 3G7LA 4OIJA 5E4XA 2A8VA 3WOEA 3GTKB 2QKIC 1D2BA 1O7ZA 2GVBA 1EQQA 1CZGA 1LYLA 2ZTEA 3S15H 1LT5D 3TS2A 4KI0A 3HOUH 2E5LL 4DV6Q 3K7AH 2EYHA 3I90A 4FF1A 1NR2A 1RIPA 1E2VA 1KC8C 2F3IA 4A3DB 3S2HH 3M7GA 4BY7B 5LMUL 3K0YA 4FP5D 3SDZA 1PH5A 4JI8L 2PNHA 1U9RA 1N32L 1IZ6A 4RKBA 4C3HB 3K57A 1EFID 3VR6A 3WDNA 1VCIA 2N88A 3SE0A 3TSSA 1SN8A 1FNUA 2VUMG 1RKNA 1EWHA 4IURA 5M5YH 3HOVH 4K2LA 4DR4Q 4UHVA 3CCEA 1STAA 3F2UA 2K5QA 3H09A 3AB9A 4FF4A 2CW0C 5IGCA 2NBFA 4A3LG 3VR3A 3SK4A 2NN6G 3VR4A 1EY0A 2EJGC 2P5ZX 4DV1L 3NEMA 3PUYA 2H4OA 4RCNA 2N49A 5GROA 1A8VA 4B08A 2PZWA 1HUNA 2PI2E 1MSGA 3KUPA 5FO9B 3J81L 4PV1C 3J7YW 2HQEA 4JI4Q 3QR8A 2KHJA 3PIPA 4U68A 2E2IB 1K0SA 2EYMA 3CCJA 1JICA 4IUTA 1WCMG 2ID0A 4QCLA 3JAME 4ZUJA 1KQSA 1H95A 2OTJA 2K32A 5C0XJ 4AYBE 5M3FH 1S4ZA 5E4WC 3NWSA 3CU7A 1LTSD 4DV3L 1D1IA 3I55A 2R7DA 1PFMA 1QILA 1STHA 3QIAA 1YJNA 1KIXA 2JYOA 5M5WB 1ENFA 2JA8B 1TVXA 1ZYRC 1KDBA 2A5HA 4DAMA 4ZK9B 1KXLA 3MTSA 4NPSA 4CDCC 4KD4A 3I4NG 2MP1A 4ID6A 1EYAA 1Y1VB 1LO5D 2WKDA 2FMCA 1SFOB 2O4XA 1STBA 1U4MA 4JBWA 4KY6A 3MXUA 4KN7C 2EPBA 1U5KA 1QNKA 1K9MC 4IFDJ 4GKJL 3RN5A 1HNXL 1NMFA 4K8IA 4E6IA 4XT3B 3J81c 4A3EB 2K28A 1WTVA 1C8CA 2DNEA 2FMMA 1X55A 3LWUA 4AYBB 1I94Q 4JI0Q 2N55A 4GKJQ 5FJ8G 3I72A 2DJFC 3ERSX 1TKWB 1U4RA 4B9XA 4XQQA 3VYTA 2C35B 5GADC 1XNQQ 3HGBA 3PQIA 3FHWA 4A3KB 1PZID 3F2DA 3FKIB 4NXMQ 4J1MA 1PDQA 4OO1H 2VZAA 4R8NA 4RHSA 4KHVA 4XDXA 1S5BD 2R3ZA 1DONA 1S5CD 5GQOA 5IGDA 1PH2A 3CC4A 1GUGA 4KKUA 1TWFB 1AZPA 4A3BB 1KNAA 3B6YA 2EDGA 4JI3L 3TEHB 1L0YB 1PRTD 2M2LA 3OTOL 4EQOA 2N8NA 1Y8PB 4OWTB 4LFCQ 2UXCQ 3E0EA 3OIPA 3VDYA 4A3MH 4LF9L 4QUFA 2EOTA 3KF6B 4J8QA 3GTKH 2VL6A 2Z4IA 5C4JB 4GZYC 1I4PA 2R93H 1MD2D 1SBBB 3G6JB 5EPJA 5C6AA 1HFGA 1TWGB 2C5CA 1A3VA 4I7AA 1SNOA 4C3IG 2Z6KA 4FDBA 4H13C 1PH3A 2CQAA 1ILPA 3QJYA 1G51A 3J81i 1K8OA 3VYSA 3RR5A 2BDNA 2WKCA 3IL8A 2E2JH 4BA2I 2VNUD 1LTBD 5IYCG 3T51B 3GTJH 1KLUD 1RHPA 3NUCA 4RFBA 5IYBG 2WB1B 2JXMB 3KF8A 3LX0A 4BBRH 4UY8C 2VQEQ 3ND9A 5HGQA 2JA8G 4GN5A 5CV9A 4H7BA 3GQBA 3KOJA 4DR4L 2O2LD 2WAQE 4H44C 2VQFL 2NVTB 4DGZA 1JORA 3ULLA 3KYHC 2R7ZG 3PUXA 5HY6A 1W6KA 1OXSC 1WCMH 4G7OC 1VQFA 3JAMi 1SNDA 4UP9A 3H0GB 4JI5Q 3KJPA 2FJ2A 4RH6A 2QCPX 1JOKA 2Q2TA 5I4DA 1S3OA 2XWBB 2QEXA 5A2QE 3HOZB 5IP7H 2CWAA 3OSOA 3I4LA 5FJ8H 1I50B 1RD9D 2KEEA 1CA5A 2Q8TA 5CORA 4DXGA 3Q23A 3K59A 1EFWA 5KGUA 1PZKD 1GKHA 3NENA 4IPGA 4M8AA 5JJIA 3D3RA 2E2JB 4JK1C 5E1FA 4LUZA 2D2CC 2K50A 4JOIC 2EJFC 3E9IA 4ODGA 1PFSA 4GOPA 5CV8A 3X3NA 1KHIA 1I4HA 2QGQA 1Y14B 2NVQH 2MO1A 4DV7Q 2CW0D 3HKZE 4K0KQ 1OXVA 1T9HA 2KENA 5FOBB 1ENCA 4RHRA 3V05A 4DAYB 1CM9A 1EEFD 3DEOA 1PMRA 4OHJA 5ELNA 2NWGA 4QY7A 4IOAA 3NBHB 2A69D 1JR0D 2JN4A 5FLXE 1SFOH 5E3FA 1H9RA 2I0QA 2B63H 4A3BH 2A69C 1LT6D 2I46A 1XNQL 3A0JA 3BDOA 4DAVA 3PMFA 5K36G 4IUUA 5DM63 1DJRD 2IT1A 5LL6X 1I5FA 3TP7A 1GHJA 2F0FA 1I94L 2ICIA 3STBD 2NVXB 4JI1Q 3HS0C 4QQBX 4AH6A 3AU7A 5C44H 1M4VA 1XNRL 3VR5A 4POGA 1MBYA 2IHFA 1QG7A 4HCEA 5BN4A 4LAAA 1V9PA 1E7ZA 1PTOB 4QJFA 5HGTA 2RDFA 2UUCQ 3UDGA 4JYAL 2L0CA 3KF8B 4LF6L 1CKNB 3KLSA 2F0JA 4Q0FA 1TS2A 2B2TA 4BBSG 2KCNA 5JEAJ 1GUTA 3HEJA 5IGGA 1O80A 5FLXL 1BO0A 1BCPF 1XYIA 4I65A 3BDCA 5CBAE 2NYZD 3I4MH 1Q8IA 3GD7A 4A3MB 2HCIA 2PMZE 1DOMA 1UNSA 4F87A 2NZ1D 4JW0A 4FNFA 1R4QB 4YY3L 1I4XA 1PTOH 1BBUA 1JWSD 2CCZA 2F0DA 2G5DA 4L5QA 4APVA 4LFCL 3K80C 2KECA 2CKZB 2IX1A 1YHAA 1F2LA 4HJ8A 1ONLA 4GN3B 1G2SA 4LW1A 2F0TA 3FP9A 3FPPA 3G4SA 1SSOA 4BBRG 4X65L 3HRZC 1D1KA 2NVYH 2JA8H 3HOYB 1EWCA 1O78A 5J22A 1N36L 4K8JA 1HNZL 2UUAQ 3MHBA 2GVAA 4DFAA 4DV1Q 4GOPB 4A3DH 1A2TA 1SXTA 3QWNA 3CCRA 4XIGS 1PZJD 2K1BA 4OEMB 4WJ4A 1ESFA 2F03A 5ELCA 1XMQQ 3RNUA 4DXFA 2NZOA 4N8X1 4Y52H 2KVMA 3SK5A 2NB0A 1HZAA 4KJNA 2UXCL 5E7NA 4NP5A 4C3IB 4B3SQ 4CKEA 2RCFA 2LMCB 4IUNA 2E2IH 3P1HA 2NN6I 1JMCA 3HKZG 4HMJA 4P75A 3UE1A 1L0XB 5IP9H 1H9SA 1N32Q 1IBLL 1I4GA 1W6JA 4HJ7A 2RSNA 3FMCA 1XJVA 3KBGA 1JJ2A 2CH4W 1BBWA 4C56C 2MHVA 5DNFA 1I4QA 1VQEA 1GXDC 1GJXA 1EZ8A 2NTSA 2OTLA 3I7FA 4ZYSA 3W3AA 1K83B 2KHSA 4H02A 2Z1CA 1Q7YC 1K73C 2BH8A 4HMIA 1Q81C 1X3FA 4IQZA 1IYJB 2F0MA 2EYLA 3H15A 2DY8A 3TRZA 3S2DB 1CQFA 4R4QA 4X3TA 3MXPA 3NK9A 4JBKA 1SE3A 4TKOB 3SR1A 1XPOA 1ET9A 3R93A 4POFA 4RMFA 2WB1G 3AQQA 1A6XA 2F0SA 2XRSD 1B44D 4V0BA 5JJLA 1JC7A 2EYOA 1TWAH 4QUCA 2B63G 3NTHA 3AEVA 3FPUB 2L55A 2A74C 4PNYA 5JVH3 3I4MB 1X3EA 4DR1L 3HOWB 2EY6A 2R7FA 2Q8IB 3TQYA 5C44G 3KDFB 2O5IC 2YYZA 1ZKOA 2R7ZB 3H94A 4J6HA 1TS3A 4GKKL 1CK1A 2B29A 2SDFA 3P7JA 3CF5A 2RDGA 3J80L 2HD3A 1VQOA 2F3WA 3H3VI 2BH2A 3BU2A 3QOLA 3HOXH 3QO2A 4LF5L 5T1GA 1A15A 3Q8DA 4DV3Q 2RHSB 2QDLA 2Z0SA 4DR2L 1ZYRD 2JQOA 1H9MA 2VS1A 1FL0A 2OXPA 5CYUA 3H3VC 3HOWG 1EL0A 4MZ9A 3ER0A 2PI2A 3P75A 1SYDA 4R4TA 4A3CG 1UE6A 4WORA 2ALYB 2E2HH 1Y1VG 3GTOB 4IPHA 5IGFA 3TP8A 1CHQD 2JEBI 2ZXRA 1QCBD 4OIKA 4JI8Q 3S1NB 3J80c 1X54A 2IPKD 1IXRA 5J1ZA 2A68D 4HIDA 1MJEA 5ISRA 4CJ2C 1WD1A 1DM0B 4B3TQ 2JA6B 1MIUA 4FF3A 1KRSA 3T1YQ 3K6OA 2IY5B 3DMUA 1OXUA 5NUCA 2JK8A 2XIWA 5FO8B 5IODA 3CHBD 3SVMA 1NMGA 4HIOA 1B3QA 5IP7G 3GTPB 4BA1I 4X62Q 3M3YH 1SYGA 4JI0L 1BR9A 2UXDL 2EYJA 3KJOA 2K33A 4PZ7A 3Q0AA 5BR8Q 4MNOA 3RZOB 2HCCA 5KYLA 1XPUA 2F4VQ 2UXDQ 1DYQA 1S5DD 4CGYB 1I50H 4PZ6A 1F9RA 2LY7A 1KAWA 4P72A 1Y1WB 1WTHA 5M3MH 3AYHB 1SNCA 4YIJA 4A3EG 2C9OA 2H1EA 2ZJQA 2EY5A 4QF4A 4HJ5A 3GO5A 4DR5L 3RZDH 4OX9L 5DEHA 5I9PA 1KNEA 4LUOA 3M9BA 3T1HQ 3D6WA 1L1OA 4GKKQ 1BVSA 2RBMA 2TMPA 1RJTA 1UEBA 3F8TA 2SEBD 3V96A 3HOUG 1Q8KA 4EX5A 1MJCA 3U50C 2F0UA 1Q12A 4BBSH 4X3KA 4HJ9A 1K8AC 1EIGA 1VF5C 1GOZA 3I4MG 1TXYA 5I9OA 3CCMA 2ZJRA 3DHQA 4RGTA 3CQZH 3GTJB 3BVZA 1LV9A 1RCVD 1X3GA 2AQ2B 1CFMA 4DNTB 2PO4A 4B3MQ 3L7ZC
chains in the Genus database with same CATH topology
1K3RA 3RLOA 2VY3A 1DGSA 2IX0A 2VZAA 3KLWA 1JB7A 3CC7A 3HOXG 3HOVG 4DV5L 4K0KL 4YWKA 3CMAA 3CD6A 3W5OA 2RCNA 4X66Q 1K0RA 1SRUA 2EIFA 3CP0A 4A3IH 2L15A 2WB1E 5GQOA 3UE0A 1PH2A 3CC4A 1LM0A 3S24A 4NXNL 1OTCA 2JA9A 4P74A 4A3GG 2K52A 3L2PA 1EWIA 2VQEL 1CUKA 3B6YA 4JI3L 1NTGA 4DR1Q 3TEHB 3OTOL 4YCVA 4AQYQ 1Q1EA 4A3JG 4LF6Q 2Q2HA 3PUVA 1SR3A 2N8NA 3RLFA 1C7YA 3PF4A 2UXBQ 4OWTB 4LFCQ 2UXCQ 3E0EA 4IPCA 5LMNL 3K0XA 1QVGA 3PO3H 3HOZH 3RLNA 3VDYA 1YIJA 4A3MH 2A19A 4LF9L 4DV0Q 1YEZA 3KF6B 2ZTDA 2D0PA 3GTKH 2VL6A 3J80i 2LXJA 1X9NA 1J5EL 1A62A 4DR7Q 2R93H 2RF4A 4P71A 1TWFH 4RG1A 2VUMH 1Q1BA 1QZHA 3M4OH 5BR8L 5FLMH 2Z6KA 4FDBA 1AE3A 1PH3A 4C3HH 3IRBA 1G51A 3J81i 2WFWA 1W3SA 4GS3A 4J15A 3RR5A 1HNWL 2I5MX 1XTDA 3NELA 4BA2I 2E2JH 4BXXG 1LTLA 2VNUD 4OONA 4YWMA 5IYCG 1PH8A 4A93G 3GTJH 2K75A 1VQDA 3EN2A 5IYBG 4YHHL 1AH9A 4BBRH 4UY8C 1GVPA 2VQEQ 2DUDA 5HGQA 2JA8G 2LXKA 4GN5A 4C3JH 1N9WA 3KOJA 4A3KH 4DR4L 4WJ3M 5C3EH 2WAQE 3BZCA 5IT9c 2VQFL 2MQHA 1YBYA 4X65Q 3ULLA 1E22A 2F4VL 3KYHC 2R7ZG 5M3MG 3PUXA 5HY6A 2NZHA 4OO1I 1OXSC 2D62A 1VQ4A 1WCMH 2AMCB 1IBLQ 1VQFA 4GLVB 3JAMi 4A3EH 4R4CA 4UP9A 1S40A 4P73A 3KJPA 4JI5Q 1QVFA 5M5XH 1IL2A 2Q2TA 2V1CC 4GN4B 1X56A 1E3PA 4JI7Q 1S3OA 3HFZB 4PMWA 4KLKA 4JV5L 1JE5A 5IWAQ 2QEXA 3U4VA 1PH6A 4JI6Q 1U0LA 5C4XH 1PYSB 1K83H 4QL5A 4YCUA 1B70B 1HZ9A 2Q2UA 1PYBA 4UPAA 5IP7H 1CKMA 4DUYQ 3CCLA 1CKNA 2CWAA 1A0IA 5FJ8H 4DV6L 1I3QH 2OQKA 1IBMQ 2JA5H 2JA7G 5IP9G 4A3LH 3AFPA 2ATWA 3BZKA 3S1RH 4AIMA 1HNZQ 1YJ9A 2K5HA 3HOYG 2R92G 2UXBL 3EBEA 2ZM6L 1EFWA 3GDEA 2K5VA 4YY3Q 1GKHA 3NENA 3M4QA 1TWHH 4IPGA 1N33Q 5JJIA 1QVCA 4DR6Q 1SROA 4Y7NH 1PH1A 1UE5A 4IFDI 1VQCA 1GD7A 1O7IA 4LUZA 5LMUQ 3J7ZC 4HIKA 3UDXA 2VW9A 4MTNA 4DNIA 2K50A 3I4OA 2R93G 4TQUS 4JOIC 3E9IA 4GOPA 1PFSA 2ES2A 2I5HA 4DR6L 3PF5A 4LF7Q 4C3IH 4DV2Q 5FLMG 4B3SL 1Z47A 3OW2A 2Z6KC 1A63A 1KHIA 4IJLA 1IBKL 5M5WH 4IFDG 4OX9Q 2QGQA 3PO2H 1Y14B 2ASBA 3WWVA 2NVQH 2MO1A 4B3RQ 5M3FG 4DV7Q 2JJQA 3CPWA 1VQAA 3HKZE 1VQKA 3GTPH 4K0KQ 1XMOQ 1OXVA 1T9HA 2KENA 4R1JA 1EYGA 2E5LQ 3HKSA 4KHPQ 3CCSA 1Y1WG 4DAYB 1VQNA 2BA0A 4O0AA 2AKWB 1FVIA 1KRTA 5ELNA 4QY7A 5AJ3L 4IOAA 3NBHB 4YCWA 1PHJA 2ZJPA 1SFOH 3EIVA 4O2DA 3F1ZA 2I0QA 2B63H 4A3BH 4NXNQ 1XNQL 3A0JA 2D0OA 1SE8A 1CSQA 1PH9A 2R7ZH 1HNWQ 5K36G 3ULJA 2HIVA 1G291 2OCEA 3PV0A 4R4OA 2IT1A 3KDFA 5LMNW 3RZOH 1I5FA 3BJUA 2YTVA 1GM5A 2YU9H 4BY7H 5AJ3Q 1I94L 1SLJA 4QIWE 2KCTA 3STBD 1EUJA 4LF8L 4JI1Q 4QQBX 3PSIA 4DR7L 1L0WA 4AH6A 1WYDA 1YVCA 5C44H 1UWVA 2JA6H 1XNRL 5C4XG 1JT8A 4POGA 2IHFA 3MEFA 4PG3A 1V9PA 1E7ZA 2KCMA 4QJFA 1XPRA 1Z9FA 2UUCQ 4LF8Q 3GTQH 5JJKA 3UDGA 1VQPA 4X64L 1VQ8A 5IYDH 5IYCH 4KHPL 4JYAL 1LUZA 2AHOB 1Q82C 3G6EA 2R92H 3KF8B 3S17H 4JI1L 2Y0SE 4HIMA 2N78A 2AWNA 3A5UA 1CKNB 1HR0Q 1VQLA 4R4IA 1YHBA 4TVAB 2YTXA 1NBWA 3GTGH 4JI7L 4BBSG 4JV5Q 4A3JH 5JEAJ 1ASZA 3UDIA 1M90C 5C3EG 4JI5L 4ALPA 2I5LX 5C0XI 1TWCH 3TS0A 3H3VH 3I4MH 4JG2A 1EIYB 3HOZG 4LFBL 3FKIG 1BKBA 3GD7A 4DV0L 1VQMA 1C0AA 3G48A 2HQLA 2GN5A 2PMZE 4IOCA 1HR0L 4JBMA 4A3CH 3JC66 2F52A 1J5EQ 4DR3Q 1XMQL 2XTIA 3CAMA 2HHHL 1I6HH 4GLXA 1VQ9A 1KD1C 4YY3L 1XMOL 3OTOQ 1BBUA 4KHZA 2CCZA 2NVXH 4AQYL 4L5QA 1X6OA 4APVA 4C2MH 4JI3Q 4LFCL 3K80C 2JE6I 3SGIA 1VQBA 1FJGQ 4A3IG 2JEAI 2CKZB 3DM3A 5IE8A 4GNXA 2IX1A 2MO0A 2WP8J 1YHAA 4DKAC 1VQ7A 3CCVA 4HJ8A 3GTOH 4GN3B 2IHEA 5IY0A 4A3FH 4LW1A 1PH7A 4A93H 3FP9A 1G6PA 4GNXC 2CQOA 4L5SA 1VS0A 3S16H 1E1OA 3G4SA 3GTLH 3E9HA 3PGZA 1FJGL 4BBRG 3S2DH 1QUQB 5ELOA 4X65L 5C4JH 1Q46A 2JA8H 2NVYH 4JI2L 1WJJA 4BY1G 1N36L 3A74A 3ZJYC 4JC0A 4A4IA 4AYBG 1HNZL 4GOPC 2UUAQ 4JOIA 2GVAA 4DV1Q 4GOPB 1W2BA 3HOWH 5J3BA 3CCRA 4A3DH 3H0GG 2BA1A 4XIGS 2KHIA 1PVOA 4WJ4A 4A3MG 3CCQA 4DR3L 3RNUA 1XMQQ 2N3SA 2NZOA 3CC2A 3J7A5 4Y52H 1VQJA 4LF5Q 1NJIC 5H1SE 3S1MH 1HZAA 1YITA 2UXCL 3PO2G 5E7NA 2KBNA 1WI5A 2OWOA 4B3SQ 3I56A 2QA4A 4LWCA 1IBKQ 5IWAL 4DV4Q 4OWXB 1VQ5A 2E2IH 5GAEC 2NN6I 1JMCA 3HKZG 3UDFA 3K8AA 4P75A 3W1BA 1YZ6A 3UE1A 2VQFQ 5IP9H 2HT1A 3W1GA 4XTCS 1N32Q 1J6QA 1IBLL 1HNXQ 4HJ7A 4OWWB 3D0FA 5IYBH 1XJVA 4B3ML 1JJCB 1WOCA 1JJ2A 3ICEA 1BBWA 3FKIH 5LMNQ 4IO9A 1E1TA 4L5RC 1EOVA 1QZGA 2FXQA 1VQEA 1N8RC 1XNRQ 1JJGA 2OTLA 2Y0SG 3I7FA 4YHHQ 4B3TL 1N34L 4H02A 4GNXB 1Q7YC 1K73C 3J81j 3M7NA 2Q2IA 3L0OA 5DLQE 4IPDA 2PQAB 4DV2L 1IBML 2BH8A 2OQ0A 1L1OB 1P16A 1OXTA 4DV7L 4DUYL 1L1OC 2A1AA 3CMEA 1YHQA 1Q81C 1X3FA 1Y1VH 1IYJB 1C9OA 4DK6C 3H15A 2XGTA 2K14A 1R9TH 5FLXc 1HH2P 1L2FA 2K5NA 3TRZA 1CSPA 4R4QA 1HZBA 3U4ZA 5IYDG 4JBKA 5GAGC 2ZTCA 1HR0W 1N33L 1TWGH 1XPOA 4POFA 2PQAA 4RMFA 1M1KC 2WB1G 3STBC 3AQQA 3CCUA 1PH4A 4NB3A 5JJLA 2A8VA 1B7YB 3DLLA 1TWAH 3CXCA 2B63G 2GVBA 2R6GA 1NY4A 3ULPA 1EQQA 4LF9Q 3AEVA 1LYLA 2ZTEA 3CW2C 4B3RL 3S15H 3TS2A 4KI0A 1D7QA 2RHQB 2E5LL 4DV6Q 3HOUH 3K7AH 1V43A 3KF6A 1HZCA 1X3EA 1RIPA 4GLAC 1KC8C 4DR1L 1WFQA 3K7UC 1FGUA 2F3IA 2K4KA 2R7FA 3D31A 3S2HH 5LMUL 3GTMH 2CWPA 1PH5A 1PV4A 2DGYA 4JI8L 3S1NH 3TQYA 2PNHA 5JEAG 3JAMc 5C44G 1YJWA 2UUBQ 3KDFB 2JA6G 3I4NH 1N32L 2YYZA 1IZ6A 2CFMA 1VCIA 5EAYA 4A76A 4GKKL 1D8LA 4LUVA 3CF5A 1AE2A 1SN8A 2E8GA 4OO1G 2VUMG 4JCVE 1VQOA 1SMXA 3H3VI 2BH2A 3BU2A 5M5YH 3HOXH 3HOVH 4DR4Q 3CCEA 1N34Q 4LF5L 4DV3Q 3Q8DA 2RHSB 1S72A 4OXPA 1E24A 2Z0SA 5GAHC 4DR2L 2VS1A 2JQOA 4HJAA 1FL0A 4LFBQ 4A3LG 3HOWG 4A3DG 4JI4L 3HOYH 2NN6G 4MZ9A 3ER0A 4JI2Q 2PI2A 4QGUA 1X65A 4R4TA 1B8AA 4DV1L 3NEMA 4A3CG 4LNQA 1KL9A 1UE6A 3PUYA 2N49A 2ALYB 3I2ZA 5GROA 1N36Q 1Y1VG 4X66L 2E2HH 4LF4L 1A8VA 4ME3A 1VQHA 4IPHA 4DV5Q 1V1QA 2JEBI 2PI2E 4JYAQ 1UE1A 2EQSA 2AWOA 4JI8Q 4YWLA 4JI4Q 2KHJA 3PIPA 3J80c 1X54A 3CCJA 1IXRA 3A5ZB 4HIDA 1WCMG 2ID0A 2MFIA 4X62L 1MJEA 2MNAA 1KQSA 4DR5Q 1H95A 4UP7A 4B3TQ 2ZM6Q 1MKHA 2OTJA 1MIUA 1VQ6A 1KRSA 5C0XJ 3T1YQ 4NXML 3RN2A 4AYBE 2IY5B 3MXNB 3PUWA 5M3FH 4A3FG 1OXUA 2HHHQ 2JK8A 4DK3C 3PIOA 4DV3L 3KFUA 3I55A 2R7DA 1Y1WH 1P8LA 2YV5A 1NMGA 4JBJA 4HIOA 4EQ5A 5IP7G 1YJNA 4BA1I 4X62Q 1GO3E 4BY1H 3M3YH 1PA6A 1ASYA 4JI0L 1KIXA 2UXDL 4PZ8A 4UP8A 4BXXH 4LF7L 4X6AH 3KJOA 3H0GH 4PZ7A 2HIXA 3LGJA 4A3BG 2YTYA 4A3GH 1UE7A 4DAMA 3U58A 5BR8Q 4MNOA 1KXLA 1QUQA 4NPSA 3AFQA 1XPUA 2F4VQ 2UXDQ 3I4NG 3G71A 1EQRA 1VQGA 4A3KG 1OXXK 1RL2A 4DPGA 4DUZQ 1I50H 4PZ6A 2NVTH 4DV4L 2LSSA 4P72A 1KAWA 3PO3G 2EXDA 2UUCL 3S1QH 5M3MH 3F2BA 1YNXA 4JBWA 3AYHB 5C0XG 3TREA 4A3EG 3K81C 3T1YL 3S14H 1U5KA 3PUZA 4L5TA 2UUAL 2H5XA 4HJ5A 1K9MC 3GO5A 4DR5L 2UU9L 3RZDH 1YI2A 1Q86C 4OX9L 4IFDJ 3CPFA 3RN5A 1HNXL 4GKJL 1NMFA 1CKOA 1EIFA 2UUBL 4LUOA 3J81c 3M9BA 3T1HQ 1L1OA 1HJPA 4LF4Q 1X55A 1BVSA 4GKKQ 1UEBA 3F8TA 4IJHA 1I94Q 4JI0Q 3HOUG 1Q8KA 4EX5A 1MJCA 3U50C 3F2CA 4GKJQ 5FJ8G 2JA5G 2B3GA 1NE3A 4LF6L 2JA7H 3M85A 4A75A 3OYYA 2UU9Q 3ERSX 1Q12A 4BBSH 3M4PA 4HJ9A 3T1HL 1K8AC 4LFAL 2C35B 5GADC 1K8GA 4DR2Q 1XNQQ 3I4MG 1TXYA 3CCMA 2ZJRA 2ZJQA 3FHWA 3CQZH 3PCOB 4X64Q 4DUZL 4JI6L 3F2DA 2WAQG 1VQIA 1X3GA 4NXMQ 4BY7G 4LFAQ 2B29A 4B3MQ 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3R A;  3RLO A;  2VY3 A;  1DGS A;  2IX0 A;  2VZA A;  3KLW A;  1JB7 A;  3CC7 A;  3HOX G;  3HOV G;  4DV5 L;  4K0K L;  4YWK A;  3CMA A;  3CD6 A;  3W5O A;  2RCN A;  4X66 Q;  1K0R A;  1SRU A;  2EIF A;  3CP0 A;  4A3I H;  2L15 A;  2WB1 E;  5GQO A;  3UE0 A;  1PH2 A;  3CC4 A;  1LM0 A;  3S24 A;  4NXN L;  1OTC A;  2JA9 A;  4P74 A;  4A3G G;  2K52 A;  3L2P A;  1EWI A;  2VQE L;  1CUK A;  3B6Y A;  4JI3 L;  1NTG A;  4DR1 Q;  3TEH B;  3OTO L;  4YCV A;  4AQY Q;  1Q1E A;  4A3J G;  4LF6 Q;  2Q2H A;  3PUV A;  1SR3 A;  2N8N A;  3RLF A;  1C7Y A;  3PF4 A;  2UXB Q;  4OWT B;  4LFC Q;  2UXC Q;  3E0E A;  4IPC A;  5LMN L;  3K0X A;  1QVG A;  3PO3 H;  3HOZ H;  3RLN A;  3VDY A;  1YIJ A;  4A3M H;  2A19 A;  4LF9 L;  4DV0 Q;  1YEZ A;  3KF6 B;  2ZTD A;  2D0P A;  3GTK H;  2VL6 A;  3J80 i;  2LXJ A;  1X9N A;  1J5E L;  1A62 A;  4DR7 Q;  2R93 H;  2RF4 A;  4P71 A;  1TWF H;  4RG1 A;  2VUM H;  1Q1B A;  1QZH A;  3M4O H;  5BR8 L;  5FLM H;  2Z6K A;  4FDB A;  1AE3 A;  1PH3 A;  4C3H H;  3IRB A;  1G51 A;  3J81 i;  2WFW A;  1W3S A;  4GS3 A;  4J15 A;  3RR5 A;  1HNW L;  2I5M X;  1XTD A;  3NEL A;  4BA2 I;  2E2J H;  4BXX G;  1LTL A;  2VNU D;  4OON A;  4YWM A;  5IYC G;  1PH8 A;  4A93 G;  3GTJ H;  2K75 A;  1VQD A;  3EN2 A;  5IYB G;  4YHH L;  1AH9 A;  4BBR H;  4UY8 C;  1GVP A;  2VQE Q;  2DUD A;  5HGQ A;  2JA8 G;  2LXK A;  4GN5 A;  4C3J H;  1N9W A;  3KOJ A;  4A3K H;  4DR4 L;  4WJ3 M;  5C3E H;  2WAQ E;  3BZC A;  5IT9 c;  2VQF L;  2MQH A;  1YBY A;  4X65 Q;  3ULL A;  1E22 A;  2F4V L;  3KYH C;  2R7Z G;  5M3M G;  3PUX A;  5HY6 A;  2NZH A;  4OO1 I;  1OXS C;  2D62 A;  1VQ4 A;  1WCM H;  2AMC B;  1IBL Q;  1VQF A;  4GLV B;  3JAM i;  4A3E H;  4R4C A;  4UP9 A;  1S40 A;  4P73 A;  3KJP A;  4JI5 Q;  1QVF A;  5M5X H;  1IL2 A;  2Q2T A;  2V1C C;  4GN4 B;  1X56 A;  1E3P A;  4JI7 Q;  1S3O A;  3HFZ B;  4PMW A;  4KLK A;  4JV5 L;  1JE5 A;  5IWA Q;  2QEX A;  3U4V A;  1PH6 A;  4JI6 Q;  1U0L A;  5C4X H;  1PYS B;  1K83 H;  4QL5 A;  4YCU A;  1B70 B;  1HZ9 A;  2Q2U A;  1PYB A;  4UPA A;  5IP7 H;  1CKM A;  4DUY Q;  3CCL A;  1CKN A;  2CWA A;  1A0I A;  5FJ8 H;  4DV6 L;  1I3Q H;  2OQK A;  1IBM Q;  2JA5 H;  2JA7 G;  5IP9 G;  4A3L H;  3AFP A;  2ATW A;  3BZK A;  3S1R H;  4AIM A;  1HNZ Q;  1YJ9 A;  2K5H A;  3HOY G;  2R92 G;  2UXB L;  3EBE A;  2ZM6 L;  1EFW A;  3GDE A;  2K5V A;  4YY3 Q;  1GKH A;  3NEN A;  3M4Q A;  1TWH H;  4IPG A;  1N33 Q;  5JJI A;  1QVC A;  4DR6 Q;  1SRO A;  4Y7N H;  1PH1 A;  1UE5 A;  4IFD I;  1VQC A;  1GD7 A;  1O7I A;  4LUZ A;  5LMU Q;  3J7Z C;  4HIK A;  3UDX A;  2VW9 A;  4MTN A;  4DNI A;  2K50 A;  3I4O A;  2R93 G;  4TQU S;  4JOI C;  3E9I A;  4GOP A;  1PFS A;  2ES2 A;  2I5H A;  4DR6 L;  3PF5 A;  4LF7 Q;  4C3I H;  4DV2 Q;  5FLM G;  4B3S L;  1Z47 A;  3OW2 A;  2Z6K C;  1A63 A;  1KHI A;  4IJL A;  1IBK L;  5M5W H;  4IFD G;  4OX9 Q;  2QGQ A;  3PO2 H;  1Y14 B;  2ASB A;  3WWV A;  2NVQ H;  2MO1 A;  4B3R Q;  5M3F G;  4DV7 Q;  2JJQ A;  3CPW A;  1VQA A;  3HKZ E;  1VQK A;  3GTP H;  4K0K Q;  1XMO Q;  1OXV A;  1T9H A;  2KEN A;  4R1J A;  1EYG A;  2E5L Q;  3HKS A;  4KHP Q;  3CCS A;  1Y1W G;  4DAY B;  1VQN A;  2BA0 A;  4O0A A;  2AKW B;  1FVI A;  1KRT A;  5ELN A;  4QY7 A;  5AJ3 L;  4IOA A;  3NBH B;  4YCW A;  1PHJ A;  2ZJP A;  1SFO H;  3EIV A;  4O2D A;  3F1Z A;  2I0Q A;  2B63 H;  4A3B H;  4NXN Q;  1XNQ L;  3A0J A;  2D0O A;  1SE8 A;  1CSQ A;  1PH9 A;  2R7Z H;  1HNW Q;  5K36 G;  3ULJ A;  2HIV A;  1G29 1;  2OCE A;  3PV0 A;  4R4O A;  2IT1 A;  3KDF A;  5LMN W;  3RZO H;  1I5F A;  3BJU A;  2YTV A;  1GM5 A;  2YU9 H;  4BY7 H;  5AJ3 Q;  1I94 L;  1SLJ A;  4QIW E;  2KCT A;  3STB D;  1EUJ A;  4LF8 L;  4JI1 Q;  4QQB X;  3PSI A;  4DR7 L;  1L0W A;  4AH6 A;  1WYD A;  1YVC A;  5C44 H;  1UWV A;  2JA6 H;  1XNR L;  5C4X G;  1JT8 A;  4POG A;  2IHF A;  3MEF A;  4PG3 A;  1V9P A;  1E7Z A;  2KCM A;  4QJF A;  1XPR A;  1Z9F A;  2UUC Q;  4LF8 Q;  3GTQ H;  5JJK A;  3UDG A;  1VQP A;  4X64 L;  1VQ8 A;  5IYD H;  5IYC H;  4KHP L;  4JYA L;  1LUZ A;  2AHO B;  1Q82 C;  3G6E A;  2R92 H;  3KF8 B;  3S17 H;  4JI1 L;  2Y0S E;  4HIM A;  2N78 A;  2AWN A;  3A5U A;  1CKN B;  1HR0 Q;  1VQL A;  4R4I A;  1YHB A;  4TVA B;  2YTX A;  1NBW A;  3GTG H;  4JI7 L;  4BBS G;  4JV5 Q;  4A3J H;  5JEA J;  1ASZ A;  3UDI A;  1M90 C;  5C3E G;  4JI5 L;  4ALP A;  2I5L X;  5C0X I;  1TWC H;  3TS0 A;  3H3V H;  3I4M H;  4JG2 A;  1EIY B;  3HOZ G;  4LFB L;  3FKI G;  1BKB A;  3GD7 A;  4DV0 L;  1VQM A;  1C0A A;  3G48 A;  2HQL A;  2GN5 A;  2PMZ E;  4IOC A;  1HR0 L;  4JBM A;  4A3C H;  3JC6 6;  2F52 A;  1J5E Q;  4DR3 Q;  1XMQ L;  2XTI A;  3CAM A;  2HHH L;  1I6H H;  4GLX A;  1VQ9 A;  1KD1 C;  4YY3 L;  1XMO L;  3OTO Q;  1BBU A;  4KHZ A;  2CCZ A;  2NVX H;  4AQY L;  4L5Q A;  1X6O A;  4APV A;  4C2M H;  4JI3 Q;  4LFC L;  3K80 C;  2JE6 I;  3SGI A;  1VQB A;  1FJG Q;  4A3I G;  2JEA I;  2CKZ B;  3DM3 A;  5IE8 A;  4GNX A;  2IX1 A;  2MO0 A;  2WP8 J;  1YHA A;  4DKA C;  1VQ7 A;  3CCV A;  4HJ8 A;  3GTO H;  4GN3 B;  2IHE A;  5IY0 A;  4A3F H;  4LW1 A;  1PH7 A;  4A93 H;  3FP9 A;  1G6P A;  4GNX C;  2CQO A;  4L5S A;  1VS0 A;  3S16 H;  1E1O A;  3G4S A;  3GTL H;  3E9H A;  3PGZ A;  1FJG L;  4BBR G;  3S2D H;  1QUQ B;  5ELO A;  4X65 L;  5C4J H;  1Q46 A;  2JA8 H;  2NVY H;  4JI2 L;  1WJJ A;  4BY1 G;  1N36 L;  3A74 A;  3ZJY C;  4JC0 A;  4A4I A;  4AYB G;  1HNZ L;  4GOP C;  2UUA Q;  4JOI A;  2GVA A;  4DV1 Q;  4GOP B;  1W2B A;  3HOW H;  5J3B A;  3CCR A;  4A3D H;  3H0G G;  2BA1 A;  4XIG S;  2KHI A;  1PVO A;  4WJ4 A;  4A3M G;  3CCQ A;  4DR3 L;  3RNU A;  1XMQ Q;  2N3S A;  2NZO A;  3CC2 A;  3J7A 5;  4Y52 H;  1VQJ A;  4LF5 Q;  1NJI C;  5H1S E;  3S1M H;  1HZA A;  1YIT A;  2UXC L;  3PO2 G;  5E7N A;  2KBN A;  1WI5 A;  2OWO A;  4B3S Q;  3I56 A;  2QA4 A;  4LWC A;  1IBK Q;  5IWA L;  4DV4 Q;  4OWX B;  1VQ5 A;  2E2I H;  5GAE C;  2NN6 I;  1JMC A;  3HKZ G;  3UDF A;  3K8A A;  4P75 A;  3W1B A;  1YZ6 A;  3UE1 A;  2VQF Q;  5IP9 H;  2HT1 A;  3W1G A;  4XTC S;  1N32 Q;  1J6Q A;  1IBL L;  1HNX Q;  4HJ7 A;  4OWW B;  3D0F A;  5IYB H;  1XJV A;  4B3M L;  1JJC B;  1WOC A;  1JJ2 A;  3ICE A;  1BBW A;  3FKI H;  5LMN Q;  4IO9 A;  1E1T A;  4L5R C;  1EOV A;  1QZG A;  2FXQ A;  1VQE A;  1N8R C;  1XNR Q;  1JJG A;  2OTL A;  2Y0S G;  3I7F A;  4YHH Q;  4B3T L;  1N34 L;  4H02 A;  4GNX B;  1Q7Y C;  1K73 C;  3J81 j;  3M7N A;  2Q2I A;  3L0O A;  5DLQ E;  4IPD A;  2PQA B;  4DV2 L;  1IBM L;  2BH8 A;  2OQ0 A;  1L1O B;  1P16 A;  1OXT A;  4DV7 L;  4DUY L;  1L1O C;  2A1A A;  3CME A;  1YHQ A;  1Q81 C;  1X3F A;  1Y1V H;  1IYJ B;  1C9O A;  4DK6 C;  3H15 A;  2XGT A;  2K14 A;  1R9T H;  5FLX c;  1HH2 P;  1L2F A;  2K5N A;  3TRZ A;  1CSP A;  4R4Q A;  1HZB A;  3U4Z A;  5IYD G;  4JBK A;  5GAG C;  2ZTC A;  1HR0 W;  1N33 L;  1TWG H;  1XPO A;  4POF A;  2PQA A;  4RMF A;  1M1K C;  2WB1 G;  3STB C;  3AQQ A;  3CCU A;  1PH4 A;  4NB3 A;  5JJL A;  2A8V A;  1B7Y B;  3DLL A;  1TWA H;  3CXC A;  2B63 G;  2GVB A;  2R6G A;  1NY4 A;  3ULP A;  1EQQ A;  4LF9 Q;  3AEV A;  1LYL A;  2ZTE A;  3CW2 C;  4B3R L;  3S15 H;  3TS2 A;  4KI0 A;  1D7Q A;  2RHQ B;  2E5L L;  4DV6 Q;  3HOU H;  3K7A H;  1V43 A;  3KF6 A;  1HZC A;  1X3E A;  1RIP A;  4GLA C;  1KC8 C;  4DR1 L;  1WFQ A;  3K7U C;  1FGU A;  2F3I A;  2K4K A;  2R7F A;  3D31 A;  3S2H H;  5LMU L;  3GTM H;  2CWP A;  1PH5 A;  1PV4 A;  2DGY A;  4JI8 L;  3S1N H;  3TQY A;  2PNH A;  5JEA G;  3JAM c;  5C44 G;  1YJW A;  2UUB Q;  3KDF B;  2JA6 G;  3I4N H;  1N32 L;  2YYZ A;  1IZ6 A;  2CFM A;  1VCI A;  5EAY A;  4A76 A;  4GKK L;  1D8L A;  4LUV A;  3CF5 A;  1AE2 A;  1SN8 A;  2E8G A;  4OO1 G;  2VUM G;  4JCV E;  1VQO A;  1SMX A;  3H3V I;  2BH2 A;  3BU2 A;  5M5Y H;  3HOX H;  3HOV H;  4DR4 Q;  3CCE A;  1N34 Q;  4LF5 L;  4DV3 Q;  3Q8D A;  2RHS B;  1S72 A;  4OXP A;  1E24 A;  2Z0S A;  5GAH C;  4DR2 L;  2VS1 A;  2JQO A;  4HJA A;  1FL0 A;  4LFB Q;  4A3L G;  3HOW G;  4A3D G;  4JI4 L;  3HOY H;  2NN6 G;  4MZ9 A;  3ER0 A;  4JI2 Q;  2PI2 A;  4QGU A;  1X65 A;  4R4T A;  1B8A A;  4DV1 L;  3NEM A;  4A3C G;  4LNQ A;  1KL9 A;  1UE6 A;  3PUY A;  2N49 A;  2ALY B;  3I2Z A;  5GRO A;  1N36 Q;  1Y1V G;  4X66 L;  2E2H H;  4LF4 L;  1A8V A;  4ME3 A;  1VQH A;  4IPH A;  4DV5 Q;  1V1Q A;  2JEB I;  2PI2 E;  4JYA Q;  1UE1 A;  2EQS A;  2AWO A;  4JI8 Q;  4YWL A;  4JI4 Q;  2KHJ A;  3PIP A;  3J80 c;  1X54 A;  3CCJ A;  1IXR A;  3A5Z B;  4HID A;  1WCM G;  2ID0 A;  2MFI A;  4X62 L;  1MJE A;  2MNA A;  1KQS A;  4DR5 Q;  1H95 A;  4UP7 A;  4B3T Q;  2ZM6 Q;  1MKH A;  2OTJ A;  1MIU A;  1VQ6 A;  1KRS A;  5C0X J;  3T1Y Q;  4NXM L;  3RN2 A;  4AYB E;  2IY5 B;  3MXN B;  3PUW A;  5M3F H;  4A3F G;  1OXU A;  2HHH Q;  2JK8 A;  4DK3 C;  3PIO A;  4DV3 L;  3KFU A;  3I55 A;  2R7D A;  1Y1W H;  1P8L A;  2YV5 A;  1NMG A;  4JBJ A;  4HIO A;  4EQ5 A;  5IP7 G;  1YJN A;  4BA1 I;  4X62 Q;  1GO3 E;  4BY1 H;  3M3Y H;  1PA6 A;  1ASY A;  4JI0 L;  1KIX A;  2UXD L;  4PZ8 A;  4UP8 A;  4BXX H;  4LF7 L;  4X6A H;  3KJO A;  3H0G H;  4PZ7 A;  2HIX A;  3LGJ A;  4A3B G;  2YTY A;  4A3G H;  1UE7 A;  4DAM A;  3U58 A;  5BR8 Q;  4MNO A;  1KXL A;  1QUQ A;  4NPS A;  3AFQ A;  1XPU A;  2F4V Q;  2UXD Q;  3I4N G;  3G71 A;  1EQR A;  1VQG A;  4A3K G;  1OXX K;  1RL2 A;  4DPG A;  4DUZ Q;  1I50 H;  4PZ6 A;  2NVT H;  4DV4 L;  2LSS A;  4P72 A;  1KAW A;  3PO3 G;  2EXD A;  2UUC L;  3S1Q H;  5M3M H;  3F2B A;  1YNX A;  4JBW A;  3AYH B;  5C0X G;  3TRE A;  4A3E G;  3K81 C;  3T1Y L;  3S14 H;  1U5K A;  3PUZ A;  4L5T A;  2UUA L;  2H5X A;  4HJ5 A;  1K9M C;  3GO5 A;  4DR5 L;  2UU9 L;  3RZD H;  1YI2 A;  1Q86 C;  4OX9 L;  4IFD J;  3CPF A;  3RN5 A;  1HNX L;  4GKJ L;  1NMF A;  1CKO A;  1EIF A;  2UUB L;  4LUO A;  3J81 c;  3M9B A;  3T1H Q;  1L1O A;  1HJP A;  4LF4 Q;  1X55 A;  1BVS A;  4GKK Q;  1UEB A;  3F8T A;  4IJH A;  1I94 Q;  4JI0 Q;  3HOU G;  1Q8K A;  4EX5 A;  1MJC A;  3U50 C;  3F2C A;  4GKJ Q;  5FJ8 G;  2JA5 G;  2B3G A;  1NE3 A;  4LF6 L;  2JA7 H;  3M85 A;  4A75 A;  3OYY A;  2UU9 Q;  3ERS X;  1Q12 A;  4BBS H;  3M4P A;  4HJ9 A;  3T1H L;  1K8A C;  4LFA L;  2C35 B;  5GAD C;  1K8G A;  4DR2 Q;  1XNQ Q;  3I4M G;  1TXY A;  3CCM A;  2ZJR A;  2ZJQ A;  3FHW A;  3CQZ H;  3PCO B;  4X64 Q;  4DUZ L;  4JI6 L;  3F2D A;  2WAQ G;  1VQI A;  1X3G A;  4NXM Q;  4BY7 G;  4LFA Q;  2B29 A;  4B3M Q;  3L7Z C; 
#chains in the Genus database with same CATH topology
 5DM7 3;  2VY3 A;  2B39 A;  5KYI A;  3HOV G;  3CMA A;  3CD6 A;  2RCN A;  1BNZ A;  1SRU A;  2X69 A;  2L15 A;  2Z8L A;  3D4R A;  1EYC A;  3KLR A;  5D14 A;  5F2D A;  4NXN L;  1OTC A;  4EGV A;  2G9D A;  1EQT A;  4A3G G;  1ROD A;  3L2P A;  1EWI A;  3VYU A;  1CUK A;  4DR1 Q;  3QG1 A;  4LF6 Q;  1WTW A;  2Q2H A;  2UXB Q;  5LMN L;  3K0X A;  4KMU C;  4FXG C;  4R8I A;  2A19 A;  1EY9 A;  2KA7 A;  2D0P A;  5TSS A;  4DNR B;  2LXJ A;  3D6C A;  1J5E L;  4WFN 3;  4O42 A;  1GUW A;  3M4O H;  5FLM H;  3KBX A;  1AE3 A;  5IOC A;  4C3H H;  4O1N A;  4XYO A;  3RMH A;  3A7A B;  1PRT B;  4WJW A;  5CR3 A;  1HNW L;  3NEL A;  5HUR A;  4OON A;  3IKJ A;  1PH8 A;  3OHX C;  2K75 A;  2F0Q A;  1AH9 A;  1EY4 A;  5EJW A;  4HCS A;  2DUD A;  2EZV A;  1S5F D;  1RTO A;  1X32 A;  3BZC A;  2J7Z A;  3OPO A;  5ELF A;  5JEA H;  2NZH A;  4K5V A;  2LKV A;  1F2Y A;  4GLV B;  4A3E H;  1LTT D;  1WTO A;  5D3I B;  5G3L D;  1A3U A;  1S40 A;  1IL8 A;  5M5X H;  1R9T B;  4GN4 B;  1X56 A;  5CV4 A;  1EU4 A;  3LNN A;  5IWA Q;  1PH6 A;  1AZQ A;  1U0L A;  5C4X H;  1PYS B;  4YCU A;  1CQV A;  4G7Z C;  1B70 B;  3FDT A;  4WRD A;  1CKM A;  3CCL A;  1LTI D;  4K5X A;  2X6L A;  2G9H D;  5IP9 G;  3C2P A;  1YJ9 A;  2K5H A;  2UXB L;  2R92 G;  1S5E D;  3U9O A;  2J0T D;  2O5J C;  1QVC A;  2F0I A;  1SRO A;  4HAE A;  5DAU A;  1DZ1 A;  1UE5 A;  2AUJ D;  1GD7 A;  4HIK A;  1XXG A;  3UDX A;  2VW9 A;  4MTN A;  2R93 G;  3MVV A;  4TQU S;  2I5H A;  3W2D A;  4A3F B;  1Z47 A;  4DN4 M;  2A6H D;  2Z6K C;  1HRJ A;  3PO2 H;  4ZAI A;  3TZU A;  1AW7 A;  3WWV A;  3KLS X;  1Z6H A;  2JJQ A;  4K6L A;  5FKA C;  3CPW A;  1H9J A;  4R1J A;  5FK9 C;  1XMO Q;  2M00 A;  3HKS A;  2VB3 X;  3PO3 B;  1VQN A;  3RD4 A;  2SOB A;  4O0A A;  1FVI A;  4NKL A;  4KY5 A;  5AJ3 L;  1PHJ A;  4MTK A;  1IKM A;  1XTC D;  2BE5 D;  3EIV A;  4O2D A;  2JA7 B;  2M9V A;  3MA2 B;  4NXN Q;  5CV7 A;  3S16 B;  5C4X B;  4RGM A;  1PH9 A;  2R7Z H;  3ULJ A;  2HIV A;  2B2Y A;  2YTV A;  1GM5 A;  2XSC A;  4IN3 A;  5C3E B;  4KY7 A;  4LF8 L;  1GUO A;  1UEA B;  5L37 A;  5CV5 A;  2JA6 H;  1CZW A;  1JT8 A;  4P2C B;  1TR5 A;  3TN2 A;  3GTQ H;  2WV6 D;  5K5P A;  4X64 L;  1VQ8 A;  1T5E A;  2E74 C;  5IYC H;  1LUZ A;  3G6E A;  5D3D A;  4JI1 L;  2ZT9 C;  4RGN A;  3A5U A;  1HR0 Q;  1G6Z A;  3OMG A;  1YHB A;  4TVA B;  3JAM L;  5ELD A;  2YTX A;  1EZ6 A;  4ZRZ A;  1NR4 A;  4A3J H;  1ASZ A;  3J7A F;  4JI5 L;  5JPM C;  5JVG 3;  1IKL A;  1LT3 D;  1PRT F;  2PYK A;  4FXK C;  5C0X I;  3H3V H;  4LFB L;  1EIY B;  3NPP A;  1BKB A;  3G48 A;  4IOC A;  4A3C H;  1I6H H;  1XMQ L;  3A8I E;  3HOX B;  4KD3 A;  3HG9 A;  3OW7 A;  4KHZ A;  3WOF A;  1ICF B;  1X6O A;  4C2M H;  4IUQ A;  3NE5 B;  2JE6 I;  3SGI A;  1VQB A;  2B8G A;  1STG A;  1FJG Q;  4A3I G;  3DM3 A;  2MO0 A;  2WP8 J;  4Q5V A;  3J7A V;  3CCV A;  4C1N K;  1QWY A;  4L63 B;  2KUM A;  4L8J A;  4CDD C;  1WTQ A;  1ET6 A;  4GNX C;  4L5S A;  1VS0 A;  3S16 H;  3L3O C;  3E9H A;  2OT2 A;  5C4J H;  4DK0 A;  1WJJ A;  3A74 A;  1Q3L A;  4H0L C;  4JVZ A;  1A3T A;  4K14 A;  4GOP C;  4JOI A;  1J5E Q;  2BA1 A;  1XWE A;  2KCC A;  3BG3 A;  3FRP B;  4IZ8 A;  3CCQ A;  3J7A 5;  4LF5 Q;  1EY5 A;  3BYT B;  1K8M A;  5C5L A;  2KBN A;  3A54 A;  2OWO A;  5COY A;  4LWC A;  5IWA L;  4OWX B;  1II3 A;  1QJO A;  3N6R A;  1UUP A;  3GV6 A;  2FHT A;  1QOH A;  1KAB A;  4MN3 A;  2HT1 A;  5T1I A;  4XTC S;  2D9U A;  2RVL A;  4B3M L;  1JJC B;  1WOC A;  5I6Y A;  3FKI H;  1QZG A;  1XNR Q;  4DU9 A;  2ICE C;  1JJG A;  4YHH Q;  4B3T L;  3DXJ C;  4GNX B;  1O7Y A;  5M3F B;  1HXY D;  2I07 B;  3M7N A;  1LTG D;  4IPD A;  4DV2 L;  2OQ0 A;  2F1M A;  5M3M B;  1P16 A;  1WVL A;  4DUY L;  2A1A A;  2V4D A;  1C9O A;  3TME A;  5KRU A;  2QEJ C;  3OIQ A;  5I2Y A;  1CA6 A;  3IAY A;  3U4Z A;  1N33 L;  5GAG C;  1HR0 W;  1G91 A;  1PFB A;  3NXW A;  2ZXO A;  3Q24 A;  1M1K C;  4C3H G;  3D8G A;  1F9Q A;  4XQN A;  4ILW A;  3T56 B;  4CKB A;  3DLL A;  4N9T A;  1SNM A;  2R6G A;  4LF9 Q;  2JA5 B;  3ULP A;  3VA5 A;  2GA4 B;  1V1P B;  4B3R L;  4Z9C B;  1D7Q A;  2RHQ B;  3TP6 A;  1V43 A;  3EA6 A;  3KF6 A;  4RKL A;  4R9W A;  4GLA C;  1WFQ A;  1FGU A;  1F2Z A;  4N9P A;  3T13 A;  2CWP A;  1B3A A;  2DGY A;  5EBC A;  3S1N H;  1YJW A;  2JA6 G;  2UUB Q;  3I4N H;  1ICW A;  4A3J B;  4A76 A;  2K03 A;  5C3W A;  2XVS A;  4LUV A;  1AE2 A;  5ELE A;  2A6H C;  2TSS A;  4JCV E;  5ELB A;  5CMD A;  4KK7 A;  1EQV A;  1ENA A;  5C0X H;  4TRD A;  1BCP C;  5C4H A;  3DUZ A;  5GAH C;  4HJA A;  4LFB Q;  2WAQ B;  4C1N I;  4A3D G;  1SNP A;  2L12 A;  1X65 A;  4FXD A;  1Y8O B;  3ND8 A;  4X66 L;  4LF4 L;  4RGO S;  5KIX A;  1VQH A;  4DV5 Q;  4JYA Q;  1GUS A;  1UE1 A;  2B2W C;  4X3U A;  5LL6 S;  4FYD A;  3A5Z B;  4X62 L;  1U4P A;  4DR5 Q;  4K5W A;  5C44 B;  2ZM6 Q;  1DXM A;  1VQ6 A;  4NXM L;  4B9W A;  3S14 B;  3RN2 A;  4A3F G;  1WTP A;  1B50 A;  2A73 B;  4CBV A;  1F9P A;  3H6M A;  4XYQ A;  2B8F A;  2MJ8 A;  2YV5 A;  4JBJ A;  1TWA B;  4EQ5 A;  1JWU D;  1GO3 E;  2CHB D;  2EXZ A;  4X3S A;  4HR7 B;  4UP8 A;  4CHT B;  4NMZ A;  4LF7 L;  1F9S A;  4X6A H;  2HDL A;  3H0G H;  2HIX A;  4A3B G;  1FGB D;  1QUQ A;  5EBD A;  5K36 H;  1WCM B;  4C3J G;  1EQR A;  5KEE A;  1A2U A;  3A55 A;  1OXX K;  4A3K G;  2FIN B;  2NVT H;  4DV4 L;  3MXG A;  3PO3 G;  2EXD A;  2UUC L;  3S1Q H;  3F2B A;  2RQX A;  3TRE A;  3VYR A;  2NVQ B;  3T1Y L;  3S14 H;  4L5T A;  2UUA L;  2PZT A;  2UU9 L;  1Q86 C;  2F0H A;  3UI2 A;  4PQX A;  2UUB L;  3SEB A;  4HSP A;  1IYU A;  5IIF A;  2EYF A;  5EPK A;  1HJP A;  4IJH A;  1Y69 U;  2JA5 G;  2JA7 H;  1ILQ A;  1NE3 A;  3OYY A;  1JQY D;  3GTG B;  3M4P A;  3MAQ A;  2SNM A;  3E6Z X;  3MFY A;  1STN A;  2QDB A;  1K8G A;  2J4X A;  3LWE A;  3PCO B;  4DUZ L;  3IFT A;  5C3X A;  4BY7 G;  2F0P A;  2BCO A;  3URY A;  1SE2 A;  1I3Q B;  2IX0 A;  2F0O A;  1JB7 A;  3CC7 A;  3HOX G;  4DV5 L;  3K58 A;  1K0R A;  3S9W A;  4A3I H;  3UE0 A;  1LM0 A;  4DK1 A;  5IGB A;  3S24 A;  1HPC A;  2JA9 A;  3V2T A;  2K52 A;  2ENB A;  1HUM A;  4QB4 A;  4YCV A;  3T53 B;  4BBR B;  1Q1E A;  2NUC A;  4A3J G;  4CJ1 B;  1V8Q A;  3PUV A;  3RLF A;  1C7Y A;  3OOC A;  1YNJ D;  2CVR A;  4IPC A;  3VA7 A;  2F0G A;  1YNJ C;  1EOT A;  1YIJ A;  1FD7 D;  1CHP D;  2D5D A;  4MIU A;  2ZTD A;  2IL8 A;  3J80 i;  1X9N A;  2DY7 A;  1A62 A;  3KK7 A;  1G2T A;  2RF4 A;  2K6A A;  1Q1B A;  5A2Q L;  1QZH A;  2PW5 A;  5BR8 L;  2Z9H A;  2F3V A;  3IRB A;  5EKI A;  4J15 A;  2I5M X;  4K2K A;  4Y7N B;  3N52 A;  1E2W A;  3Q22 A;  5IT9 E;  1VQD A;  4YHH L;  2LXK A;  4FF2 A;  1N9W A;  2B2W A;  1GHK A;  2FFK B;  5IT9 c;  1U4L A;  2BE5 C;  2MQH A;  1YBY A;  4KV6 A;  2A6E D;  2F4V L;  3NWT A;  5M3M G;  4HED A;  2B2U A;  2D62 A;  2AMC B;  1HHV A;  1IBL Q;  4R4C A;  1QVF A;  4IUP A;  1E3P A;  3HFZ B;  1JE5 A;  1C0A A;  2Q2U A;  1K83 H;  4DUY Q;  5CV6 A;  2JA5 H;  2JA7 G;  1I3Q H;  2OQK A;  4A3L H;  4PMC A;  3AFP A;  1IHZ A;  3BZK A;  3HOY G;  1HNZ Q;  2F0K A;  3EBE A;  2VB2 X;  2ZM6 L;  1EY8 A;  2AUK A;  3C46 A;  4YY3 Q;  2K5V A;  3DWQ A;  4DAY A;  4I7Z C;  1I4R A;  1N33 Q;  1HFN A;  3MEH A;  1LT4 D;  4NW2 A;  4Y7N H;  1PH1 A;  1F2M A;  1O7I A;  5LMU Q;  3J7Z C;  1DOL A;  3NQI A;  4ZUI A;  3GTM B;  1NUC A;  3P20 A;  4DNI A;  1TT2 A;  4KN4 C;  1FNV A;  1D5M C;  4LF7 Q;  4C3I H;  5FLM G;  4HSV A;  4LJZ C;  1A63 A;  3EQL C;  5JOB A;  1IBK L;  4ZLT F;  1BF4 A;  3GTP H;  3I3C A;  1EYG A;  4KHP Q;  3J80 E;  4CJ0 B;  1CI3 M;  1Y1W G;  2XNA C;  1D5X C;  2BA0 A;  5KND A;  4OL7 A;  4BBS B;  2ZJP A;  2Y0S B;  3BYY B;  1TII D;  1LAC A;  3NHH A;  2D0O A;  1SE8 A;  1F77 A;  3X3M A;  2OCE A;  4R4O A;  3PV0 A;  3KDF A;  4NDX A;  2YU9 H;  2L11 A;  2XWJ B;  4BY7 H;  5AJ3 Q;  4A93 B;  3K5M A;  4QIW E;  3VR2 A;  2EE1 A;  2QW7 A;  1JE4 A;  3PSI A;  4DAP A;  4DR7 L;  1L0W A;  1YVC A;  1QE6 A;  4PG3 A;  3NBH A;  1XX8 A;  3S15 B;  5JJK A;  2KCM A;  3BVG A;  1Z9F A;  1LAB A;  1T5X D;  1ZEQ X;  4OEL B;  5IYD H;  2R92 H;  1RDP D;  1TY2 A;  4HIM A;  2N78 A;  1VQL A;  4R4I A;  4RWS C;  1SJH D;  5D65 A;  1NBW A;  3NSW A;  5BN3 A;  3GTG H;  2K7V A;  1M90 C;  4HN7 A;  1QB5 D;  3MWY W;  5J39 A;  4JG2 A;  2EVB A;  1VQM A;  2GN5 A;  1HR0 L;  4JBM A;  3S1M B;  1C48 A;  4DR3 Q;  2HHH L;  1NNX A;  4GLX A;  2R92 B;  2PW7 A;  1KD1 C;  3HOV B;  5M5Y B;  1D5Z C;  4DA2 A;  2EY1 A;  3OTO Q;  4ZKC B;  2NVX H;  4CDE C;  3OMC A;  2JEA I;  5IE8 A;  4GNX A;  4G7H C;  4DKA C;  3GTO H;  1EYD A;  5IY0 A;  4A3F H;  1PH7 A;  4A93 H;  3S2H B;  2CQO A;  2PCF B;  1E1O A;  3GTL H;  2L1B A;  3U9S A;  3I4N B;  3S2D H;  5ELO A;  1PTO C;  5AFW A;  3ZJY C;  4A4I A;  1H9S B;  1WTR A;  3HOU B;  1K3B C;  1W2B A;  5J3B A;  3A8K E;  3H0G G;  1BBX C;  2KHI A;  1PVO A;  4UAI A;  4A3M G;  1AFP A;  2N3S A;  3CRL C;  1KDA A;  3S1M H;  2B2V A;  2F0E A;  2F0W A;  1YIT A;  3PO2 G;  2A6E C;  2F0V A;  3I8Z A;  2QA4 A;  1V1P A;  2X6G A;  1MHW C;  1SMY D;  2E2D C;  1AEX A;  5GAE C;  2IWH A;  2EJM A;  4LMQ D;  1LTR D;  1C4Q A;  3K8A A;  1E2Z A;  1FR3 A;  4U67 3;  1BCP B;  4M1U B;  1EY6 A;  2BDO A;  3D0F A;  1EU3 A;  3ICE A;  2XN9 C;  5LMN Q;  1E1T A;  1SAP A;  2FXQ A;  1V1O A;  2LFN A;  2Y0S G;  4HTH A;  3DM1 A;  3EJI A;  3J81 j;  2NN6 H;  1IYV A;  3L0O A;  5DLQ E;  2IX3 A;  2B2Y C;  1OXT A;  1L1O C;  1STE A;  3CME A;  1YHQ A;  4QMG A;  1Y1V H;  2YU9 B;  1G8Z D;  1M8A A;  3K5O A;  2XGT A;  2IJ0 A;  1CTM A;  3T16 A;  5EKK A;  5LHY 1;  5FLX c;  4RCO A;  5IYD G;  2ZTC A;  3MZ5 A;  5BN5 A;  1NSN S;  2AQ1 B;  3SHL A;  1HQR D;  3I73 A;  3SXH A;  1JWM D;  4JPB W;  3STB C;  1ESR A;  3MFG A;  1PH4 A;  4NB3 A;  3S17 B;  1B7Y B;  4V19 0;  3CXC A;  5I6W A;  1NY4 A;  1X3Q A;  2K04 A;  4ABN A;  3CW2 C;  1FYC A;  5EPL A;  1B9N A;  1HZC A;  1PFN A;  1KTK A;  3K7U C;  4ULL A;  2K4K A;  3D31 A;  3GTM H;  3NQT A;  4FO2 A;  1PV4 A;  4F7X A;  5JEA G;  3JAM c;  2WIN B;  1MSH A;  4BY1 B;  2CFM A;  3NTK A;  5EAY A;  1WTX A;  1D8L A;  1JCK B;  1TU2 B;  4ZQ3 A;  1JB3 A;  2AQ3 B;  2E8G A;  4OO1 G;  4DF7 A;  3D4D A;  1SMX A;  2PPB C;  3L9A X;  2Q8R E;  4UDU C;  1N34 Q;  1BDO A;  1S72 A;  4OXP A;  1E24 A;  1NCV A;  1SNQ A;  1B9M A;  1HTP A;  4JI4 L;  3HOY H;  1TWC B;  2NVY B;  1TS4 A;  1SE4 A;  4KKS A;  2EYP A;  4JI2 Q;  1IW7 D;  2JP1 A;  4QGU A;  1PTO D;  1B8A A;  1NAP A;  1BQQ T;  4LNQ A;  1KL9 A;  3I2Z A;  1Y8N B;  2F0L A;  1N36 Q;  4ME3 A;  1V1Q A;  2EQS A;  2AWO A;  4YWL A;  2RA4 A;  1DD2 A;  1CT1 D;  2MFI A;  3R2T A;  2MNA A;  4UP7 A;  2MPM A;  1H9K A;  1MKH A;  3DWA A;  3MXN B;  3PUW A;  3S1R B;  2HHH Q;  2B2V C;  4DK3 C;  3PIO A;  1VMP A;  3KFU A;  3E5S A;  1Y1W H;  1P8L A;  4IAL A;  2Z6B A;  1B1Z A;  4BY1 H;  1PA6 A;  1ASY A;  2DJG C;  4PZ8 A;  4BXX H;  2DNC A;  1K28 A;  3A8J E;  3LGJ A;  2YTY A;  2HUG A;  1UE7 A;  4A3G H;  3U58 A;  2CH4 A;  3AFQ A;  3OWE B;  5CBE E;  3G71 A;  1VQG A;  1R4P B;  1RL2 A;  2QF7 A;  4QIW B;  4DPG A;  4DUZ Q;  1HA5 A;  3OWF A;  2LSS A;  2SNS A;  4C3J B;  1YNX A;  3MC0 B;  1DCZ A;  5C0X G;  1D6E C;  3NTI A;  2IW3 A;  3K81 C;  2K05 A;  3PUZ A;  4IFD H;  2H5X A;  1SMY C;  1YI2 A;  4G4K A;  4BS9 A;  3CPF A;  1CKO A;  1EIF A;  3DEP A;  3PO2 B;  3IFD A;  4LF4 Q;  2LS0 1;  1LLR D;  3F2C A;  2B63 B;  2B3G A;  3M85 A;  4KJO A;  4A75 A;  2UU9 Q;  2VUM B;  3T1H L;  4LFA L;  5JJZ A;  3NP8 A;  4DR2 Q;  4XXE A;  1RTN A;  3GTQ B;  1VMC A;  4X64 Q;  2L4N A;  5M9O A;  4JI6 L;  2WAQ G;  1VQI A;  1HTL D;  4LFA Q;  1NTG A;  1K3R A;  3RLO A;  1O7L A;  1DGS A;  5C4Z A;  3KLW A;  5EGT A;  2MUY A;  4K0K L;  4YWK A;  3W5O A;  4X66 Q;  1SYE A;  2EIF A;  2RKS A;  1ML0 D;  3CP0 A;  3O13 A;  4K6D A;  2WB1 E;  1SDF A;  4ME5 A;  4P74 A;  2QIL A;  1UAP A;  2PMZ B;  2VQE L;  1B4O A;  1VF7 A;  4XT1 B;  1WD0 A;  2E76 C;  4AQY Q;  3PF4 A;  1SR3 A;  4L6T B;  2WAC A;  3PO3 H;  1BCP D;  1QVG A;  3HOZ H;  2PNR C;  3RLN A;  5JPN C;  5I2X A;  4DV0 Q;  1YEZ A;  2KJX A;  2Z4H A;  5IT9 L;  4DR7 Q;  3HZX A;  2E75 C;  3GTL B;  3I91 A;  3GV3 A;  4P71 A;  1TWF H;  4RG1 A;  2VUM H;  4CDF C;  5FO7 B;  3GP7 A;  3J81 E;  1X3P A;  1KDC A;  4XQJ A;  1YNN C;  1W3S A;  2WFW A;  3K7A B;  4GS3 A;  4N8F A;  1XTD A;  1SYC A;  4BXX G;  1LTL A;  4YWM A;  1OO9 B;  3R3O A;  4A93 G;  1STY A;  3EN2 A;  1QNU A;  1GVP A;  1EY7 A;  4C3J H;  4A3K H;  4WJ3 M;  5C3E H;  2B2T C;  4X65 Q;  5CGK A;  1E22 A;  2EY2 A;  4OO1 I;  3NBI A;  2RDH A;  4EQP A;  1VQ4 A;  2F0N A;  4LK1 C;  4TSS A;  2XRQ D;  3C1F A;  4P73 A;  1IL2 A;  3CKI B;  3R8B A;  2V1C C;  4JI7 Q;  4JV5 L;  4PMW A;  4KLK A;  3PIP 3;  1HQM C;  3U4V A;  4JI6 Q;  4QL5 A;  3SK6 A;  3E3X A;  1HZ9 A;  2B2U C;  1PYB A;  4UPA A;  5KNB A;  3S1Q B;  1CKN A;  1A0I A;  3C3L A;  4DV6 L;  1IBM Q;  2ATW A;  3S1R H;  1JOO A;  4AIM A;  1BUV T;  3M4Y A;  1SJE D;  4FVM A;  4F88 A;  3GDE A;  3M4Q A;  1TWH H;  4DR6 Q;  2HDM A;  4IFD I;  1VQC A;  3EFX D;  3ZYY X;  3Q6S A;  5EQ0 A;  3I4O A;  1TQO A;  2ES2 A;  4DR6 L;  3PF5 A;  3M4O B;  3A7L A;  4DV2 Q;  4B3S L;  2NTT A;  3QOJ A;  3OW2 A;  3BVM A;  4IJL A;  2RSO A;  5M5W H;  4IFD G;  4OX9 Q;  1HA6 A;  2ASB A;  4B3R Q;  5M3F G;  1VQA A;  1VQK A;  2E5L Q;  1TWH B;  1EEI D;  3RZD B;  1FNW A;  3E0J A;  1TS5 A;  3CCS A;  3EVQ A;  2AKW B;  2VXW A;  3I70 A;  1KRT A;  5M5X B;  4YCW A;  5IGE A;  2PQE A;  3F1Z A;  1EIH A;  4A3G B;  4KKT A;  1I6V C;  2KOL A;  3FEW X;  1CSQ A;  3C1E A;  4OGQ C;  4CKC A;  3ITP A;  1HNW Q;  1G29 1;  1JOQ A;  3HKZ B;  5LMN W;  2JSO A;  3RZO H;  3BJU A;  3RUZ A;  4EQN A;  1SLJ A;  3QB3 A;  2KCT A;  1AP0 A;  1MGS A;  1EUJ A;  2ZXP A;  1WYD A;  3BS1 A;  1UWV A;  5C4X G;  3MEF A;  1SYF A;  3ERQ A;  1XPR A;  4LF8 Q;  3CQZ B;  1VQP A;  3BDL A;  4KHP L;  1Q82 C;  2AHO B;  3DWP A;  5A35 A;  3S17 H;  3HP3 A;  2Y0S E;  2AWN A;  1I6H B;  1YNN D;  2BOS A;  3TZD A;  2OF1 A;  4JI7 L;  4JV5 Q;  3K5L A;  3UDI A;  5C3E G;  4ALP A;  4ZKB B;  2I5L X;  3TS0 A;  1TWC H;  4A3I B;  3HOZ G;  3FKI G;  2K5D A;  4DV0 L;  2E2H B;  2HQL A;  3CRK C;  3JC6 6;  2F52 A;  4EVO A;  4ZCK A;  5KNC A;  2XTI A;  3CAM A;  2WII B;  3ERO A;  4RAU C;  5CC4 A;  1VQ9 A;  3ONA B;  4PMB A;  1KAA A;  1XMO L;  2L5T A;  3PIO 3;  1PYW D;  4AQY L;  4S3S A;  4JI3 Q;  4BWG B;  5C5M A;  2MGS A;  4F8M A;  1VQ7 A;  2IHE A;  3T4A C;  1G6P A;  1AN8 A;  2KED A;  1ZXT A;  1BOS A;  1PXU A;  3PGZ A;  1FJG L;  1PRT C;  1QUQ B;  1Q90 A;  1Q46 A;  3R2I A;  4KTA A;  2A68 C;  1PLF A;  4BY1 G;  4JI2 L;  3M3Y B;  4AYB G;  1HCZ A;  4JC0 A;  3HOW H;  1J8I A;  1J9O A;  1GUN A;  5JAV A;  1SYB A;  3D4W A;  3TDQ A;  1B2T A;  4DR3 L;  2PZU A;  2L9H A;  3CC2 A;  1VQJ A;  1PTO F;  5G3L F;  1NJI C;  5H1S E;  1RF2 D;  1SEB D;  1WI5 A;  1IW7 C;  3I56 A;  3MXN A;  3SK8 A;  2OEO A;  1IBK Q;  1DOK A;  2F4I A;  4DV4 Q;  1VQ5 A;  3AMU A;  3UDF A;  3W1B A;  1BXT A;  1YZ6 A;  5EKL A;  4MHE A;  3K5N A;  2VQF Q;  3W1G A;  1J6Q A;  2R61 A;  1E0B A;  3H91 A;  1HNX Q;  2DN8 A;  4OWW B;  5IYB H;  3A56 A;  4IO9 A;  4L5R C;  1EOV A;  1N8R C;  2K01 A;  1MI2 A;  1LTA D;  2K5W A;  1N34 L;  1KLG D;  1B53 A;  1Z7T A;  3FVQ A;  2Q2I A;  1IBM L;  2PQA B;  1L1O B;  4G57 A;  4DV7 L;  1VDZ A;  3BZD B;  2KQ3 A;  4RA8 A;  4DK6 C;  3TBI B;  2K14 A;  1R9T H;  1HH2 P;  3TP5 A;  1L2F A;  2K5N A;  1CSP A;  1HZB A;  1TWG H;  1TY0 A;  4C2M B;  4IUV A;  2PQA A;  2R93 B;  3CCU A;  3G7L A;  4OIJ A;  5E4X A;  2A8V A;  3WOE A;  3GTK B;  2QKI C;  1D2B A;  1O7Z A;  2GVB A;  1EQQ A;  1CZG A;  1LYL A;  2ZTE A;  3S15 H;  1LT5 D;  3TS2 A;  4KI0 A;  3HOU H;  2E5L L;  4DV6 Q;  3K7A H;  2EYH A;  3I90 A;  4FF1 A;  1NR2 A;  1RIP A;  1E2V A;  1KC8 C;  2F3I A;  4A3D B;  3S2H H;  3M7G A;  4BY7 B;  5LMU L;  3K0Y A;  4FP5 D;  3SDZ A;  1PH5 A;  4JI8 L;  2PNH A;  1U9R A;  1N32 L;  1IZ6 A;  4RKB A;  4C3H B;  3K57 A;  1EFI D;  3VR6 A;  3WDN A;  1VCI A;  2N88 A;  3SE0 A;  3TSS A;  1SN8 A;  1FNU A;  2VUM G;  1RKN A;  1EWH A;  4IUR A;  5M5Y H;  3HOV H;  4K2L A;  4DR4 Q;  4UHV A;  3CCE A;  1STA A;  3F2U A;  2K5Q A;  3H09 A;  3AB9 A;  4FF4 A;  2CW0 C;  5IGC A;  2NBF A;  4A3L G;  3VR3 A;  3SK4 A;  2NN6 G;  3VR4 A;  1EY0 A;  2EJG C;  2P5Z X;  4DV1 L;  3NEM A;  3PUY A;  2H4O A;  4RCN A;  2N49 A;  5GRO A;  1A8V A;  4B08 A;  2PZW A;  1HUN A;  2PI2 E;  1MSG A;  3KUP A;  5FO9 B;  3J81 L;  4PV1 C;  3J7Y W;  2HQE A;  4JI4 Q;  3QR8 A;  2KHJ A;  3PIP A;  4U68 A;  2E2I B;  1K0S A;  2EYM A;  3CCJ A;  1JIC A;  4IUT A;  1WCM G;  2ID0 A;  4QCL A;  3JAM E;  4ZUJ A;  1KQS A;  1H95 A;  2OTJ A;  2K32 A;  5C0X J;  4AYB E;  5M3F H;  1S4Z A;  5E4W C;  3NWS A;  3CU7 A;  1LTS D;  4DV3 L;  1D1I A;  3I55 A;  2R7D A;  1PFM A;  1QIL A;  1STH A;  3QIA A;  1YJN A;  1KIX A;  2JYO A;  5M5W B;  1ENF A;  2JA8 B;  1TVX A;  1ZYR C;  1KDB A;  2A5H A;  4DAM A;  4ZK9 B;  1KXL A;  3MTS A;  4NPS A;  4CDC C;  4KD4 A;  3I4N G;  2MP1 A;  4ID6 A;  1EYA A;  1Y1V B;  1LO5 D;  2WKD A;  2FMC A;  1SFO B;  2O4X A;  1STB A;  1U4M A;  4JBW A;  4KY6 A;  3MXU A;  4KN7 C;  2EPB A;  1U5K A;  1QNK A;  1K9M C;  4IFD J;  4GKJ L;  3RN5 A;  1HNX L;  1NMF A;  4K8I A;  4E6I A;  4XT3 B;  3J81 c;  4A3E B;  2K28 A;  1WTV A;  1C8C A;  2DNE A;  2FMM A;  1X55 A;  3LWU A;  4AYB B;  1I94 Q;  4JI0 Q;  2N55 A;  4GKJ Q;  5FJ8 G;  3I72 A;  2DJF C;  3ERS X;  1TKW B;  1U4R A;  4B9X A;  4XQQ A;  3VYT A;  2C35 B;  5GAD C;  1XNQ Q;  3HGB A;  3PQI A;  3FHW A;  4A3K B;  1PZI D;  3F2D A;  3FKI B;  4NXM Q;  4J1M A;  1PDQ A;  4OO1 H;  2VZA A;  4R8N A;  4RHS A;  4KHV A;  4XDX A;  1S5B D;  2R3Z A;  1DON A;  1S5C D;  5GQO A;  5IGD A;  1PH2 A;  3CC4 A;  1GUG A;  4KKU A;  1TWF B;  1AZP A;  4A3B B;  1KNA A;  3B6Y A;  2EDG A;  4JI3 L;  3TEH B;  1L0Y B;  1PRT D;  2M2L A;  3OTO L;  4EQO A;  2N8N A;  1Y8P B;  4OWT B;  4LFC Q;  2UXC Q;  3E0E A;  3OIP A;  3VDY A;  4A3M H;  4LF9 L;  4QUF A;  2EOT A;  3KF6 B;  4J8Q A;  3GTK H;  2VL6 A;  2Z4I A;  5C4J B;  4GZY C;  1I4P A;  2R93 H;  1MD2 D;  1SBB B;  3G6J B;  5EPJ A;  5C6A A;  1HFG A;  1TWG B;  2C5C A;  1A3V A;  4I7A A;  1SNO A;  4C3I G;  2Z6K A;  4FDB A;  4H13 C;  1PH3 A;  2CQA A;  1ILP A;  3QJY A;  1G51 A;  3J81 i;  1K8O A;  3VYS A;  3RR5 A;  2BDN A;  2WKC A;  3IL8 A;  2E2J H;  4BA2 I;  2VNU D;  1LTB D;  5IYC G;  3T51 B;  3GTJ H;  1KLU D;  1RHP A;  3NUC A;  4RFB A;  5IYB G;  2WB1 B;  2JXM B;  3KF8 A;  3LX0 A;  4BBR H;  4UY8 C;  2VQE Q;  3ND9 A;  5HGQ A;  2JA8 G;  4GN5 A;  5CV9 A;  4H7B A;  3GQB A;  3KOJ A;  4DR4 L;  2O2L D;  2WAQ E;  4H44 C;  2VQF L;  2NVT B;  4DGZ A;  1JOR A;  3ULL A;  3KYH C;  2R7Z G;  3PUX A;  5HY6 A;  1W6K A;  1OXS C;  1WCM H;  4G7O C;  1VQF A;  3JAM i;  1SND A;  4UP9 A;  3H0G B;  4JI5 Q;  3KJP A;  2FJ2 A;  4RH6 A;  2QCP X;  1JOK A;  2Q2T A;  5I4D A;  1S3O A;  2XWB B;  2QEX A;  5A2Q E;  3HOZ B;  5IP7 H;  2CWA A;  3OSO A;  3I4L A;  5FJ8 H;  1I50 B;  1RD9 D;  2KEE A;  1CA5 A;  2Q8T A;  5COR A;  4DXG A;  3Q23 A;  3K59 A;  1EFW A;  5KGU A;  1PZK D;  1GKH A;  3NEN A;  4IPG A;  4M8A A;  5JJI A;  3D3R A;  2E2J B;  4JK1 C;  5E1F A;  4LUZ A;  2D2C C;  2K50 A;  4JOI C;  2EJF C;  3E9I A;  4ODG A;  1PFS A;  4GOP A;  5CV8 A;  3X3N A;  1KHI A;  1I4H A;  2QGQ A;  1Y14 B;  2NVQ H;  2MO1 A;  4DV7 Q;  2CW0 D;  3HKZ E;  4K0K Q;  1OXV A;  1T9H A;  2KEN A;  5FOB B;  1ENC A;  4RHR A;  3V05 A;  4DAY B;  1CM9 A;  1EEF D;  3DEO A;  1PMR A;  4OHJ A;  5ELN A;  2NWG A;  4QY7 A;  4IOA A;  3NBH B;  2A69 D;  1JR0 D;  2JN4 A;  5FLX E;  1SFO H;  5E3F A;  1H9R A;  2I0Q A;  2B63 H;  4A3B H;  2A69 C;  1LT6 D;  2I46 A;  1XNQ L;  3A0J A;  3BDO A;  4DAV A;  3PMF A;  5K36 G;  4IUU A;  5DM6 3;  1DJR D;  2IT1 A;  5LL6 X;  1I5F A;  3TP7 A;  1GHJ A;  2F0F A;  1I94 L;  2ICI A;  3STB D;  2NVX B;  4JI1 Q;  3HS0 C;  4QQB X;  4AH6 A;  3AU7 A;  5C44 H;  1M4V A;  1XNR L;  3VR5 A;  4POG A;  1MBY A;  2IHF A;  1QG7 A;  4HCE A;  5BN4 A;  4LAA A;  1V9P A;  1E7Z A;  1PTO B;  4QJF A;  5HGT A;  2RDF A;  2UUC Q;  3UDG A;  4JYA L;  2L0C A;  3KF8 B;  4LF6 L;  1CKN B;  3KLS A;  2F0J A;  4Q0F A;  1TS2 A;  2B2T A;  4BBS G;  2KCN A;  5JEA J;  1GUT A;  3HEJ A;  5IGG A;  1O80 A;  5FLX L;  1BO0 A;  1BCP F;  1XYI A;  4I65 A;  3BDC A;  5CBA E;  2NYZ D;  3I4M H;  1Q8I A;  3GD7 A;  4A3M B;  2HCI A;  2PMZ E;  1DOM A;  1UNS A;  4F87 A;  2NZ1 D;  4JW0 A;  4FNF A;  1R4Q B;  4YY3 L;  1I4X A;  1PTO H;  1BBU A;  1JWS D;  2CCZ A;  2F0D A;  2G5D A;  4L5Q A;  4APV A;  4LFC L;  3K80 C;  2KEC A;  2CKZ B;  2IX1 A;  1YHA A;  1F2L A;  4HJ8 A;  1ONL A;  4GN3 B;  1G2S A;  4LW1 A;  2F0T A;  3FP9 A;  3FPP A;  3G4S A;  1SSO A;  4BBR G;  4X65 L;  3HRZ C;  1D1K A;  2NVY H;  2JA8 H;  3HOY B;  1EWC A;  1O78 A;  5J22 A;  1N36 L;  4K8J A;  1HNZ L;  2UUA Q;  3MHB A;  2GVA A;  4DFA A;  4DV1 Q;  4GOP B;  4A3D H;  1A2T A;  1SXT A;  3QWN A;  3CCR A;  4XIG S;  1PZJ D;  2K1B A;  4OEM B;  4WJ4 A;  1ESF A;  2F03 A;  5ELC A;  1XMQ Q;  3RNU A;  4DXF A;  2NZO A;  4N8X 1;  4Y52 H;  2KVM A;  3SK5 A;  2NB0 A;  1HZA A;  4KJN A;  2UXC L;  5E7N A;  4NP5 A;  4C3I B;  4B3S Q;  4CKE A;  2RCF A;  2LMC B;  4IUN A;  2E2I H;  3P1H A;  2NN6 I;  1JMC A;  3HKZ G;  4HMJ A;  4P75 A;  3UE1 A;  1L0X B;  5IP9 H;  1H9S A;  1N32 Q;  1IBL L;  1I4G A;  1W6J A;  4HJ7 A;  2RSN A;  3FMC A;  1XJV A;  3KBG A;  1JJ2 A;  2CH4 W;  1BBW A;  4C56 C;  2MHV A;  5DNF A;  1I4Q A;  1VQE A;  1GXD C;  1GJX A;  1EZ8 A;  2NTS A;  2OTL A;  3I7F A;  4ZYS A;  3W3A A;  1K83 B;  2KHS A;  4H02 A;  2Z1C A;  1Q7Y C;  1K73 C;  2BH8 A;  4HMI A;  1Q81 C;  1X3F A;  4IQZ A;  1IYJ B;  2F0M A;  2EYL A;  3H15 A;  2DY8 A;  3TRZ A;  3S2D B;  1CQF A;  4R4Q A;  4X3T A;  3MXP A;  3NK9 A;  4JBK A;  1SE3 A;  4TKO B;  3SR1 A;  1XPO A;  1ET9 A;  3R93 A;  4POF A;  4RMF A;  2WB1 G;  3AQQ A;  1A6X A;  2F0S A;  2XRS D;  1B44 D;  4V0B A;  5JJL A;  1JC7 A;  2EYO A;  1TWA H;  4QUC A;  2B63 G;  3NTH A;  3AEV A;  3FPU B;  2L55 A;  2A74 C;  4PNY A;  5JVH 3;  3I4M B;  1X3E A;  4DR1 L;  3HOW B;  2EY6 A;  2R7F A;  2Q8I B;  3TQY A;  5C44 G;  3KDF B;  2O5I C;  2YYZ A;  1ZKO A;  2R7Z B;  3H94 A;  4J6H A;  1TS3 A;  4GKK L;  1CK1 A;  2B29 A;  2SDF A;  3P7J A;  3CF5 A;  2RDG A;  3J80 L;  2HD3 A;  1VQO A;  2F3W A;  3H3V I;  2BH2 A;  3BU2 A;  3QOL A;  3HOX H;  3QO2 A;  4LF5 L;  5T1G A;  1A15 A;  3Q8D A;  4DV3 Q;  2RHS B;  2QDL A;  2Z0S A;  4DR2 L;  1ZYR D;  2JQO A;  1H9M A;  2VS1 A;  1FL0 A;  2OXP A;  5CYU A;  3H3V C;  3HOW G;  1EL0 A;  4MZ9 A;  3ER0 A;  2PI2 A;  3P75 A;  1SYD A;  4R4T A;  4A3C G;  1UE6 A;  4WOR A;  2ALY B;  2E2H H;  1Y1V G;  3GTO B;  4IPH A;  5IGF A;  3TP8 A;  1CHQ D;  2JEB I;  2ZXR A;  1QCB D;  4OIK A;  4JI8 Q;  3S1N B;  3J80 c;  1X54 A;  2IPK D;  1IXR A;  5J1Z A;  2A68 D;  4HID A;  1MJE A;  5ISR A;  4CJ2 C;  1WD1 A;  1DM0 B;  4B3T Q;  2JA6 B;  1MIU A;  4FF3 A;  1KRS A;  3T1Y Q;  3K6O A;  2IY5 B;  3DMU A;  1OXU A;  5NUC A;  2JK8 A;  2XIW A;  5FO8 B;  5IOD A;  3CHB D;  3SVM A;  1NMG A;  4HIO A;  1B3Q A;  5IP7 G;  3GTP B;  4BA1 I;  4X62 Q;  3M3Y H;  1SYG A;  4JI0 L;  1BR9 A;  2UXD L;  2EYJ A;  3KJO A;  2K33 A;  4PZ7 A;  3Q0A A;  5BR8 Q;  4MNO A;  3RZO B;  2HCC A;  5KYL A;  1XPU A;  2F4V Q;  2UXD Q;  1DYQ A;  1S5D D;  4CGY B;  1I50 H;  4PZ6 A;  1F9R A;  2LY7 A;  1KAW A;  4P72 A;  1Y1W B;  1WTH A;  5M3M H;  3AYH B;  1SNC A;  4YIJ A;  4A3E G;  2C9O A;  2H1E A;  2ZJQ A;  2EY5 A;  4QF4 A;  4HJ5 A;  3GO5 A;  4DR5 L;  3RZD H;  4OX9 L;  5DEH A;  5I9P A;  1KNE A;  4LUO A;  3M9B A;  3T1H Q;  3D6W A;  1L1O A;  4GKK Q;  1BVS A;  2RBM A;  2TMP A;  1RJT A;  1UEB A;  3F8T A;  2SEB D;  3V96 A;  3HOU G;  1Q8K A;  4EX5 A;  1MJC A;  3U50 C;  2F0U A;  1Q12 A;  4BBS H;  4X3K A;  4HJ9 A;  1K8A C;  1EIG A;  1VF5 C;  1GOZ A;  3I4M G;  1TXY A;  5I9O A;  3CCM A;  2ZJR A;  3DHQ A;  4RGT A;  3CQZ H;  3GTJ B;  3BVZ A;  1LV9 A;  1RCV D;  1X3G A;  2AQ2 B;  1CFM A;  4DNT B;  2PO4 A;  4B3M Q;  3L7Z C; 
#chains in the Genus database with same CATH homology
 1K3R A;  3RLO A;  2VY3 A;  1DGS A;  2IX0 A;  2VZA A;  3KLW A;  1JB7 A;  3CC7 A;  3HOX G;  3HOV G;  4DV5 L;  4K0K L;  4YWK A;  3CMA A;  3CD6 A;  3W5O A;  2RCN A;  4X66 Q;  1K0R A;  1SRU A;  2EIF A;  3CP0 A;  4A3I H;  2L15 A;  2WB1 E;  5GQO A;  3UE0 A;  1PH2 A;  3CC4 A;  1LM0 A;  3S24 A;  4NXN L;  1OTC A;  2JA9 A;  4P74 A;  4A3G G;  2K52 A;  3L2P A;  1EWI A;  2VQE L;  1CUK A;  3B6Y A;  4JI3 L;  1NTG A;  4DR1 Q;  3TEH B;  3OTO L;  4YCV A;  4AQY Q;  1Q1E A;  4A3J G;  4LF6 Q;  2Q2H A;  3PUV A;  1SR3 A;  2N8N A;  3RLF A;  1C7Y A;  3PF4 A;  2UXB Q;  4OWT B;  4LFC Q;  2UXC Q;  3E0E A;  4IPC A;  5LMN L;  3K0X A;  1QVG A;  3PO3 H;  3HOZ H;  3RLN A;  3VDY A;  1YIJ A;  4A3M H;  2A19 A;  4LF9 L;  4DV0 Q;  1YEZ A;  3KF6 B;  2ZTD A;  2D0P A;  3GTK H;  2VL6 A;  3J80 i;  2LXJ A;  1X9N A;  1J5E L;  1A62 A;  4DR7 Q;  2R93 H;  2RF4 A;  4P71 A;  1TWF H;  4RG1 A;  2VUM H;  1Q1B A;  1QZH A;  3M4O H;  5BR8 L;  5FLM H;  2Z6K A;  4FDB A;  1AE3 A;  1PH3 A;  4C3H H;  3IRB A;  1G51 A;  3J81 i;  2WFW A;  1W3S A;  4GS3 A;  4J15 A;  3RR5 A;  1HNW L;  2I5M X;  1XTD A;  3NEL A;  4BA2 I;  2E2J H;  4BXX G;  1LTL A;  2VNU D;  4OON A;  4YWM A;  5IYC G;  1PH8 A;  4A93 G;  3GTJ H;  2K75 A;  1VQD A;  3EN2 A;  5IYB G;  4YHH L;  1AH9 A;  4BBR H;  4UY8 C;  1GVP A;  2VQE Q;  2DUD A;  5HGQ A;  2JA8 G;  2LXK A;  4GN5 A;  4C3J H;  1N9W A;  3KOJ A;  4A3K H;  4DR4 L;  4WJ3 M;  5C3E H;  2WAQ E;  3BZC A;  5IT9 c;  2VQF L;  2MQH A;  1YBY A;  4X65 Q;  3ULL A;  1E22 A;  2F4V L;  3KYH C;  2R7Z G;  5M3M G;  3PUX A;  5HY6 A;  2NZH A;  4OO1 I;  1OXS C;  2D62 A;  1VQ4 A;  1WCM H;  2AMC B;  1IBL Q;  1VQF A;  4GLV B;  3JAM i;  4A3E H;  4R4C A;  4UP9 A;  1S40 A;  4P73 A;  3KJP A;  4JI5 Q;  1QVF A;  5M5X H;  1IL2 A;  2Q2T A;  2V1C C;  4GN4 B;  1X56 A;  1E3P A;  4JI7 Q;  1S3O A;  3HFZ B;  4PMW A;  4KLK A;  4JV5 L;  1JE5 A;  5IWA Q;  2QEX A;  3U4V A;  1PH6 A;  4JI6 Q;  1U0L A;  5C4X H;  1PYS B;  1K83 H;  4QL5 A;  4YCU A;  1B70 B;  1HZ9 A;  2Q2U A;  1PYB A;  4UPA A;  5IP7 H;  1CKM A;  4DUY Q;  3CCL A;  1CKN A;  2CWA A;  1A0I A;  5FJ8 H;  4DV6 L;  1I3Q H;  2OQK A;  1IBM Q;  2JA5 H;  2JA7 G;  5IP9 G;  4A3L H;  3AFP A;  2ATW A;  3BZK A;  3S1R H;  4AIM A;  1HNZ Q;  1YJ9 A;  2K5H A;  3HOY G;  2R92 G;  2UXB L;  3EBE A;  2ZM6 L;  1EFW A;  3GDE A;  2K5V A;  4YY3 Q;  1GKH A;  3NEN A;  3M4Q A;  1TWH H;  4IPG A;  1N33 Q;  5JJI A;  1QVC A;  4DR6 Q;  1SRO A;  4Y7N H;  1PH1 A;  1UE5 A;  4IFD I;  1VQC A;  1GD7 A;  1O7I A;  4LUZ A;  5LMU Q;  3J7Z C;  4HIK A;  3UDX A;  2VW9 A;  4MTN A;  4DNI A;  2K50 A;  3I4O A;  2R93 G;  4TQU S;  4JOI C;  3E9I A;  4GOP A;  1PFS A;  2ES2 A;  2I5H A;  4DR6 L;  3PF5 A;  4LF7 Q;  4C3I H;  4DV2 Q;  5FLM G;  4B3S L;  1Z47 A;  3OW2 A;  2Z6K C;  1A63 A;  1KHI A;  4IJL A;  1IBK L;  5M5W H;  4IFD G;  4OX9 Q;  2QGQ A;  3PO2 H;  1Y14 B;  2ASB A;  3WWV A;  2NVQ H;  2MO1 A;  4B3R Q;  5M3F G;  4DV7 Q;  2JJQ A;  3CPW A;  1VQA A;  3HKZ E;  1VQK A;  3GTP H;  4K0K Q;  1XMO Q;  1OXV A;  1T9H A;  2KEN A;  4R1J A;  1EYG A;  2E5L Q;  3HKS A;  4KHP Q;  3CCS A;  1Y1W G;  4DAY B;  1VQN A;  2BA0 A;  4O0A A;  2AKW B;  1FVI A;  1KRT A;  5ELN A;  4QY7 A;  5AJ3 L;  4IOA A;  3NBH B;  4YCW A;  1PHJ A;  2ZJP A;  1SFO H;  3EIV A;  4O2D A;  3F1Z A;  2I0Q A;  2B63 H;  4A3B H;  4NXN Q;  1XNQ L;  3A0J A;  2D0O A;  1SE8 A;  1CSQ A;  1PH9 A;  2R7Z H;  1HNW Q;  5K36 G;  3ULJ A;  2HIV A;  1G29 1;  2OCE A;  3PV0 A;  4R4O A;  2IT1 A;  3KDF A;  5LMN W;  3RZO H;  1I5F A;  3BJU A;  2YTV A;  1GM5 A;  2YU9 H;  4BY7 H;  5AJ3 Q;  1I94 L;  1SLJ A;  4QIW E;  2KCT A;  3STB D;  1EUJ A;  4LF8 L;  4JI1 Q;  4QQB X;  3PSI A;  4DR7 L;  1L0W A;  4AH6 A;  1WYD A;  1YVC A;  5C44 H;  1UWV A;  2JA6 H;  1XNR L;  5C4X G;  1JT8 A;  4POG A;  2IHF A;  3MEF A;  4PG3 A;  1V9P A;  1E7Z A;  2KCM A;  4QJF A;  1XPR A;  1Z9F A;  2UUC Q;  4LF8 Q;  3GTQ H;  5JJK A;  3UDG A;  1VQP A;  4X64 L;  1VQ8 A;  5IYD H;  5IYC H;  4KHP L;  4JYA L;  1LUZ A;  2AHO B;  1Q82 C;  3G6E A;  2R92 H;  3KF8 B;  3S17 H;  4JI1 L;  2Y0S E;  4HIM A;  2N78 A;  2AWN A;  3A5U A;  1CKN B;  1HR0 Q;  1VQL A;  4R4I A;  1YHB A;  4TVA B;  2YTX A;  1NBW A;  3GTG H;  4JI7 L;  4BBS G;  4JV5 Q;  4A3J H;  5JEA J;  1ASZ A;  3UDI A;  1M90 C;  5C3E G;  4JI5 L;  4ALP A;  2I5L X;  5C0X I;  1TWC H;  3TS0 A;  3H3V H;  3I4M H;  4JG2 A;  1EIY B;  3HOZ G;  4LFB L;  3FKI G;  1BKB A;  3GD7 A;  4DV0 L;  1VQM A;  1C0A A;  3G48 A;  2HQL A;  2GN5 A;  2PMZ E;  4IOC A;  1HR0 L;  4JBM A;  4A3C H;  3JC6 6;  2F52 A;  1J5E Q;  4DR3 Q;  1XMQ L;  2XTI A;  3CAM A;  2HHH L;  1I6H H;  4GLX A;  1VQ9 A;  1KD1 C;  4YY3 L;  1XMO L;  3OTO Q;  1BBU A;  4KHZ A;  2CCZ A;  2NVX H;  4AQY L;  4L5Q A;  1X6O A;  4APV A;  4C2M H;  4JI3 Q;  4LFC L;  3K80 C;  2JE6 I;  3SGI A;  1VQB A;  1FJG Q;  4A3I G;  2JEA I;  2CKZ B;  3DM3 A;  5IE8 A;  4GNX A;  2IX1 A;  2MO0 A;  2WP8 J;  1YHA A;  4DKA C;  1VQ7 A;  3CCV A;  4HJ8 A;  3GTO H;  4GN3 B;  2IHE A;  5IY0 A;  4A3F H;  4LW1 A;  1PH7 A;  4A93 H;  3FP9 A;  1G6P A;  4GNX C;  2CQO A;  4L5S A;  1VS0 A;  3S16 H;  1E1O A;  3G4S A;  3GTL H;  3E9H A;  3PGZ A;  1FJG L;  4BBR G;  3S2D H;  1QUQ B;  5ELO A;  4X65 L;  5C4J H;  1Q46 A;  2JA8 H;  2NVY H;  4JI2 L;  1WJJ A;  4BY1 G;  1N36 L;  3A74 A;  3ZJY C;  4JC0 A;  4A4I A;  4AYB G;  1HNZ L;  4GOP C;  2UUA Q;  4JOI A;  2GVA A;  4DV1 Q;  4GOP B;  1W2B A;  3HOW H;  5J3B A;  3CCR A;  4A3D H;  3H0G G;  2BA1 A;  4XIG S;  2KHI A;  1PVO A;  4WJ4 A;  4A3M G;  3CCQ A;  4DR3 L;  3RNU A;  1XMQ Q;  2N3S A;  2NZO A;  3CC2 A;  3J7A 5;  4Y52 H;  1VQJ A;  4LF5 Q;  1NJI C;  5H1S E;  3S1M H;  1HZA A;  1YIT A;  2UXC L;  3PO2 G;  5E7N A;  2KBN A;  1WI5 A;  2OWO A;  4B3S Q;  3I56 A;  2QA4 A;  4LWC A;  1IBK Q;  5IWA L;  4DV4 Q;  4OWX B;  1VQ5 A;  2E2I H;  5GAE C;  2NN6 I;  1JMC A;  3HKZ G;  3UDF A;  3K8A A;  4P75 A;  3W1B A;  1YZ6 A;  3UE1 A;  2VQF Q;  5IP9 H;  2HT1 A;  3W1G A;  4XTC S;  1N32 Q;  1J6Q A;  1IBL L;  1HNX Q;  4HJ7 A;  4OWW B;  3D0F A;  5IYB H;  1XJV A;  4B3M L;  1JJC B;  1WOC A;  1JJ2 A;  3ICE A;  1BBW A;  3FKI H;  5LMN Q;  4IO9 A;  1E1T A;  4L5R C;  1EOV A;  1QZG A;  2FXQ A;  1VQE A;  1N8R C;  1XNR Q;  1JJG A;  2OTL A;  2Y0S G;  3I7F A;  4YHH Q;  4B3T L;  1N34 L;  4H02 A;  4GNX B;  1Q7Y C;  1K73 C;  3J81 j;  3M7N A;  2Q2I A;  3L0O A;  5DLQ E;  4IPD A;  2PQA B;  4DV2 L;  1IBM L;  2BH8 A;  2OQ0 A;  1L1O B;  1P16 A;  1OXT A;  4DV7 L;  4DUY L;  1L1O C;  2A1A A;  3CME A;  1YHQ A;  1Q81 C;  1X3F A;  1Y1V H;  1IYJ B;  1C9O A;  4DK6 C;  3H15 A;  2XGT A;  2K14 A;  1R9T H;  5FLX c;  1HH2 P;  1L2F A;  2K5N A;  3TRZ A;  1CSP A;  4R4Q A;  1HZB A;  3U4Z A;  5IYD G;  4JBK A;  5GAG C;  2ZTC A;  1HR0 W;  1N33 L;  1TWG H;  1XPO A;  4POF A;  2PQA A;  4RMF A;  1M1K C;  2WB1 G;  3STB C;  3AQQ A;  3CCU A;  1PH4 A;  4NB3 A;  5JJL A;  2A8V A;  1B7Y B;  3DLL A;  1TWA H;  3CXC A;  2B63 G;  2GVB A;  2R6G A;  1NY4 A;  3ULP A;  1EQQ A;  4LF9 Q;  3AEV A;  1LYL A;  2ZTE A;  3CW2 C;  4B3R L;  3S15 H;  3TS2 A;  4KI0 A;  1D7Q A;  2RHQ B;  2E5L L;  4DV6 Q;  3HOU H;  3K7A H;  1V43 A;  3KF6 A;  1HZC A;  1X3E A;  1RIP A;  4GLA C;  1KC8 C;  4DR1 L;  1WFQ A;  3K7U C;  1FGU A;  2F3I A;  2K4K A;  2R7F A;  3D31 A;  3S2H H;  5LMU L;  3GTM H;  2CWP A;  1PH5 A;  1PV4 A;  2DGY A;  4JI8 L;  3S1N H;  3TQY A;  2PNH A;  5JEA G;  3JAM c;  5C44 G;  1YJW A;  2UUB Q;  3KDF B;  2JA6 G;  3I4N H;  1N32 L;  2YYZ A;  1IZ6 A;  2CFM A;  1VCI A;  5EAY A;  4A76 A;  4GKK L;  1D8L A;  4LUV A;  3CF5 A;  1AE2 A;  1SN8 A;  2E8G A;  4OO1 G;  2VUM G;  4JCV E;  1VQO A;  1SMX A;  3H3V I;  2BH2 A;  3BU2 A;  5M5Y H;  3HOX H;  3HOV H;  4DR4 Q;  3CCE A;  1N34 Q;  4LF5 L;  4DV3 Q;  3Q8D A;  2RHS B;  1S72 A;  4OXP A;  1E24 A;  2Z0S A;  5GAH C;  4DR2 L;  2VS1 A;  2JQO A;  4HJA A;  1FL0 A;  4LFB Q;  4A3L G;  3HOW G;  4A3D G;  4JI4 L;  3HOY H;  2NN6 G;  4MZ9 A;  3ER0 A;  4JI2 Q;  2PI2 A;  4QGU A;  1X65 A;  4R4T A;  1B8A A;  4DV1 L;  3NEM A;  4A3C G;  4LNQ A;  1KL9 A;  1UE6 A;  3PUY A;  2N49 A;  2ALY B;  3I2Z A;  5GRO A;  1N36 Q;  1Y1V G;  4X66 L;  2E2H H;  4LF4 L;  1A8V A;  4ME3 A;  1VQH A;  4IPH A;  4DV5 Q;  1V1Q A;  2JEB I;  2PI2 E;  4JYA Q;  1UE1 A;  2EQS A;  2AWO A;  4JI8 Q;  4YWL A;  4JI4 Q;  2KHJ A;  3PIP A;  3J80 c;  1X54 A;  3CCJ A;  1IXR A;  3A5Z B;  4HID A;  1WCM G;  2ID0 A;  2MFI A;  4X62 L;  1MJE A;  2MNA A;  1KQS A;  4DR5 Q;  1H95 A;  4UP7 A;  4B3T Q;  2ZM6 Q;  1MKH A;  2OTJ A;  1MIU A;  1VQ6 A;  1KRS A;  5C0X J;  3T1Y Q;  4NXM L;  3RN2 A;  4AYB E;  2IY5 B;  3MXN B;  3PUW A;  5M3F H;  4A3F G;  1OXU A;  2HHH Q;  2JK8 A;  4DK3 C;  3PIO A;  4DV3 L;  3KFU A;  3I55 A;  2R7D A;  1Y1W H;  1P8L A;  2YV5 A;  1NMG A;  4JBJ A;  4HIO A;  4EQ5 A;  5IP7 G;  1YJN A;  4BA1 I;  4X62 Q;  1GO3 E;  4BY1 H;  3M3Y H;  1PA6 A;  1ASY A;  4JI0 L;  1KIX A;  2UXD L;  4PZ8 A;  4UP8 A;  4BXX H;  4LF7 L;  4X6A H;  3KJO A;  3H0G H;  4PZ7 A;  2HIX A;  3LGJ A;  4A3B G;  2YTY A;  4A3G H;  1UE7 A;  4DAM A;  3U58 A;  5BR8 Q;  4MNO A;  1KXL A;  1QUQ A;  4NPS A;  3AFQ A;  1XPU A;  2F4V Q;  2UXD Q;  3I4N G;  3G71 A;  1EQR A;  1VQG A;  4A3K G;  1OXX K;  1RL2 A;  4DPG A;  4DUZ Q;  1I50 H;  4PZ6 A;  2NVT H;  4DV4 L;  2LSS A;  4P72 A;  1KAW A;  3PO3 G;  2EXD A;  2UUC L;  3S1Q H;  5M3M H;  3F2B A;  1YNX A;  4JBW A;  3AYH B;  5C0X G;  3TRE A;  4A3E G;  3K81 C;  3T1Y L;  3S14 H;  1U5K A;  3PUZ A;  4L5T A;  2UUA L;  2H5X A;  4HJ5 A;  1K9M C;  3GO5 A;  4DR5 L;  2UU9 L;  3RZD H;  1YI2 A;  1Q86 C;  4OX9 L;  4IFD J;  3CPF A;  3RN5 A;  1HNX L;  4GKJ L;  1NMF A;  1CKO A;  1EIF A;  2UUB L;  4LUO A;  3J81 c;  3M9B A;  3T1H Q;  1L1O A;  1HJP A;  4LF4 Q;  1X55 A;  1BVS A;  4GKK Q;  1UEB A;  3F8T A;  4IJH A;  1I94 Q;  4JI0 Q;  3HOU G;  1Q8K A;  4EX5 A;  1MJC A;  3U50 C;  3F2C A;  4GKJ Q;  5FJ8 G;  2JA5 G;  2B3G A;  1NE3 A;  4LF6 L;  2JA7 H;  3M85 A;  4A75 A;  3OYY A;  2UU9 Q;  3ERS X;  1Q12 A;  4BBS H;  3M4P A;  4HJ9 A;  3T1H L;  1K8A C;  4LFA L;  2C35 B;  5GAD C;  1K8G A;  4DR2 Q;  1XNQ Q;  3I4M G;  1TXY A;  3CCM A;  2ZJR A;  2ZJQ A;  3FHW A;  3CQZ H;  3PCO B;  4X64 Q;  4DUZ L;  4JI6 L;  3F2D A;  2WAQ G;  1VQI A;  1X3G A;  4NXM Q;  4BY7 G;  4LFA Q;  2B29 A;  4B3M Q;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...