1XMOM

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xmoM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xmoM02
1K3WA 1IBKM 4B3RM 4JV5M 5LMUM 1PM5A 2F5OA 3J7AS 4NRVA 3GP1A 2VQEM 5IT9S 4PDGA 3T1YM 5IWAM 2UXCM 2F5PA 2UUAM 1K3XA 4LFCM 1HNZM 1HR0M 1HNWM 2F5SA 4DR1M 1R2ZA 4G4RA 3OTOM 3SASA 4X62M 3VK8A 1IBMM 3U6LA 1R2YA 4B3MM 4NXNM 3SARA 3GO8A 1N36M 3GPUA 3GQ4A 5LMNM 3U6EA 5ITXE 1N33M 4MB7A 4DV7M 4GKJM 4JYAM 4DV4M 3U6SA 4KHPM 2HKJA 3SAVA 1TDZA 4JI1M 4DV0M 3J81S 1TDHA 4DUZM 4LFBM 4X64M 3T1HM 4GKKM 4B3TM 5ITYA 2UUCM 1L2BA 5ITQA 4DR6M 4LF5M 1XNQM 1I94M 4PCZA 2ZM6M 1K82A 2XZFA 1FJGM 4LF6M 1PJIA 3A45A 1N34M 4ITQA 3JR4A 3W0FA 4DUYM 4B3SM 2E5LM 4JI7M 4JI0M 2ZBKB 5ITTA 3DOAA 3U6QA 4JI2M 3GQ5A 2XZUA 1Z59A 1IBLM 5FLXS 3C58A 3TWLA 2Q2EB 3SBJA 1Q3BA 3GPXA 3U6OA 4DV6M 4LF4M 4JI3M 3TWMA 1XMOM 4JI6M 1L1TA 4DR7M 4OX9M 4NRWA 4LF9M 4YY3M 1L1ZA 2OQ4A 2VQFM 4G4QA 1XC8A 3SAUA 4JI4M 4DV3M 3JAMS 4LF7M 5ITRA 4X66M 1MX0A 4YHHM 3GQ3A 1Q3CA 3U6PA 2HHHM 4JI8M 3SATA 1Z5CA 2UU9M 4DV5M 3GPYA 4LFAM 1KFVA 5A2QS 4G4OA 4JI5M 4X65M 1NNJA 1HNXM 1PJJA 4PDIA 4DR3M 2F5QA 3A42A 3VK7A 2F5NA 3A46A 1EE8A 5ITUA 4DR2M 1J5EM 4K0KM 1N32M 4NXMM 4AQYM 3TWKA 4G4NA 3U6CA 1Z5AA 4DV1M 2OPFA 1L2CA 5BR8M 1MU5A 1XMQM 1L2DA 1Q39A 4DV2M 4CISA 2UXBM 3GPPA 3U6MA 3U6DA 5ITXA 2UXDM 4PD2A 3J80S 3SAWA 3JR5A 2F4VM 1Z5BA 2UUBM 4DR5M 2EA0A 4LF8M 1XNRM 4DR4M
chains in the Genus database with same CATH superfamily
2ZAOA 3FRIA 5EXSA 4KLNA 3R8FA 2DWMA 2N35A 1T43A 2G5GX 4NRVA 2VQEM 2QBYA 2DZOB 2MROB 2O5RA 4RKUF 3WHLA 4PDGA 3PFIA 1L8QA 2CV0A 2JUJA 1HT2E 3KXEC 1GL6A 4RNAA 4REZA 1HR0M 4D82A 3K1JA 4KO8A 3SMSA 5KO3A 2LVQD 2LHCA 3LCVB 1S3SA 3SASA 2D7GA 1IN6A 2LVNC 2ZTCA 5DFLA 3GLHE 3E4RA 1CUKA 2LNHC 3MMPA 5LMNM 5F3WA 1IFYA 4GIPA 1IY2A 3U6SA 4KHPM 1TDZA 1Z6TA 1OTRA 2RRUA 4M9ZA 4DUZM 2L4FA 2DZLA 4B3TM 1FNNA 4ZPXA 2Y21A 3B7NA 1PJQA 2RKOA 3R9XB 3KOZE 3FYCA 2ZM6M 4LGMA 1TF0B 4BB9A 5C18A 1NV9A 2DHYA 1PJSA 2R45A 4GHAA 4R7GA 3W0FA 1AUAA 3LVVA 1G59A 4JI7M 2ZBKB 3T15A 2KRUA 4JI2M 2DI0A 1JR3E 1ZQ9A 2V6ZM 1JQJC 1NSFA 3SYLA 3C58A 4LF4M 3MJ5A 1GVNA 2DXIA 1XXHE 3M6AA 3BXWA 5EP2A 4DBGB 3E9SA 1ZMVA 5FTMA 2QP9X 3B74A 3VDUA 4LF9M 2L6OA 1E9SA 3AOEA 3RGPA 2ZAMA 2WSEF 3DFZA 3KSXA 1D2NA 1TH3A 1D0KA 4IBEA 4LF7M 4Y28F 1OQYA 4IIWA 4X66M 2KRKA 4YHHM 3GQ3A 3U6PA 3FUUA 4JI8M 2KZSA 3NBXX 2QCUA 3ZQJA 1IN5A 3L26A 3VKGA 3SYKA 3KP0E 2A5YB 3HHWA 3VLFB 1TH2A 2M5ZA 3FTDA 3HZJA 4X65M 2V1CA 4R3DA 1JB0F 3HGIA 1HNXM 1V34A 3K2LA 5EP3A 3TWMA 2LTUA 1EE8A 3I51A 5ITUA 2EKKA 1DGHA 2Y0QA 4NXMM 2XSZA 3TWKA 4WURA 3K92A 2KZUA 5FTJA 4DV1M 2C5RA 3HX3A 1PJTA 3UJNA 1V92A 1V33A 3UZUA 5BR8M 4L6V6 3THGA 1L2DA 1SXJB 2XEPA 4FWHA 1Q39A 2UXBM 4HLQA 4GMQA 1WR1B 2J7NA 3U6DA 2GNOA 2ZTDA 3FUVA 5KPZA 3SAWA 1G71A 3W67A 2R62A 1YSYA 2JP7A 2EA0A 4GC9A 3U60A 1LV7A 1IXSB 1Q02A 4LJ8A 2X49A 2QHOB 2P5TA 2LVAA 3HHZA 2CV2A 4B3RM 4B7HA 2C96A 2C9OA 3AL0C 2VDBB 2QENA 1TGUA 1DO2A 2GQFA 3GRRA 3WHKA 3GP1A 1J7KA 5IT9S 2LVPC 3UGJA 5KPTA 1QDTA 1QYRA 2J7OA 4NSRA 2KA6B 3AKZA 1BVSA 3LW5F 3SAVA 1HNZM 2JY7A 1N78A 4DR1M 1A5TA 1G8PA 2W82A 1WIVA 3VK8A 3AV0A 4LJ4A 1R2YA 2BWBA 4NXNM 4B3MM 1OKSA 2C98A 5FTNA 1W5TA 3GPUA 3FUXA 3U6EA 2YFQA 5ITXE 3C3DA 1N33M 4L4UA 1F4IA 4DV4M 1NJFA 1HT1E 2CEAA 2HKJA 3L2AA 1ZAEA 2R65A 3GLHA 1TDHA 2YQZA 5EXPA 3V76A 2JZ1A 1DGBA 2L4EA 2LBCA 2OOBA 3FUTA 1R6BX 3VFDA 3T1HM 4NL4H 5ITQA 1OFIA 3FD9A 4MGKE 4LF5M 1I94M 2QNJA 3F92A 5EQTA 3GLFA 1Y8GA 4II7A 2M60A 2QZ4A 2KDLA 3H4MA 1PJIA 1N34M 2X8AA 2R44A 2JY8A 3SFZA 5FTLA 2Z7JA 4G3OA 1QQWA 4CGYB 4FCWA 4UN2B 4JI0M 5ITTA 2Z3XA 4NOOB 3U6QA 2RGOA 3IG5A 2DAGA 1Z59A 1NVMA 2DAIA 2LVOC 2NQ8C 3SHFA 3UK6A 1HQCA 3KS8A 3HKPA 2Q2EB 2LHGA 1Q3BA 2D7EA 3GPXA 4DV6M 2FH0A 2R46A 2R18A 4JI3M 1DGGA 4AG6A 3SC3A 2R4JA 4LY6A 4CHTB 1SG9A 2G3QA 3L27A 3FE3A 2O01F 2VIIA 4IBKA 2KXEA 4LJ5A 4NRWA 1L1ZA 3QAUA 4LG2A 4MM3B 1VG5A 3NWLA 1UM8A 5E6JA 2KEBA 1IY0A 1T6OA 1YUBA 3HHXA 1HQYE 3L25A 1QDRA 3HJ8A 1VEJA 1IM2A 4IJFA 1WHCA 4XK8F 1MX0A 1QAMA 3U61B 3J2PB 1WGLA 2XSZD 3SATA 1Z5CA 2MJ5B 3GLFE 2DZNB 1VDLA 2K9DA 3GPYA 3L29A 5EXXA 4FWGA 4KT0F 1OIPA 1QZMA 3KP1E 5EJCA 4EIWA 4IBJA 4A3VB 1QZEA 4LZZA 2ERCA 4Z6YA 2F5QA 4Q7JA 3A42A 2KNAA 2DNAA 3T6PA 3U61A 4M9SA 4K0KM 1N32M 3I01M 3TL4X 1AIPC 2KHHA 3LQQA 4S12A 4ANRA 1MJGM 4G4NA 4QHTA 2CFOA 3KOYE 3VKHA 1T3TA 1PGYA 2DKLA 1MU5A 1G41A 1RU3A 1DO0A 2WSCF 4MGZE 2FOIC 2CHGA 2H1RA 3GLGB 1D0MA 2Z4RA 1E32A 1J09A 1SXJD 1IXZA 5EP1A 3GLIA 4F1IA 4FCVA 4LRSA 2K6BA 5DNYA 3JR5A 2F4VM 1H6UA 4I4LA 3B89A 4DR5M 3SHGB 3Q8GA 2JA2A 3AOEC 4B08A 1XNRM 4JV5M 4DR4M 5E26A 1K3WA 3K9PA 1NHWC 3J27B 2DENA 4L15A 2KNZA 2CE7A 3GLIB 2FS1A 4P16A 1C1KA 2APLA 3ZH9B 4LFCM 3DA1A 4I8OA 3CTWB 1GKIA 3PNVA 3C9PA 4CIZA 2L7IA 3E46A 4LJ7A 3OTOM 3KFUG 3IECA 1IBMM 4LCBA 1ZV1A 3KVWA 2MGWA 4OVZA 3U6LA 1LTMA 2QSFX 3NBIA 2EKFA 1N36M 2BJVA 4GH9A 4QHSA 3B7QA 3T38A 3GQ4A 3GLGE 3AOGA 4D81A 4M0DA 4QNMA 4MB7A 4JYAM 3GRYA 2Z8YM 3RE8A 4NSOB 4JI1M 4DV0M 1IXRC 7CATA 2BWEA 4Z8XA 1XB2B 4LFBM 4GKKM 4LZJA 2CRUA 1R5LA 3CF2A 5ITYA 3PNYA 2G8LA 3M0EA 4HEOA 5C1BA 3CF0A 1QAOA 3FKEA 1DV0A 1W5SA 3IHPA 2FE8A 1XNQM 3AFHA 3I4VA 1FJGM 4LRTA 2Z4SA 3A45A 4GHLA 1NV8A 4ITQA 3H4JA 3KOXE 4DUYM 4NC6A 4B3SM 1I4WA 2E5LM 2VF7A 4GRIA 1IN7A 2HCBA 1TTEA 5EXTA 3GLFB 3GQ5A 4JXJA 2LH0A 2WSFF 3VDPA 3LMMA 1XXHA 2Y0TA 3TWLA 4WW0A 3U6OA 2EJSA 1R4GA 3RFWA 1XMOM 3HY5A 1WJ7A 4JI6M 2OO9A 3PXGA 4G6ZA 1L1TA 4HL4A 4F2LA 1PRBA 1SXJA 1WXQA 2L7HA 3I04M 4YY3M 4L8RC 2FFJA 2DWNA 2LXEA 2D7HA 5BPVA 3SAUA 4JI4M 1YE9A 3CF6E 4M9XA 4DV3M 3ZC7B 3JAMS 1SXJE 4MGYE 5ITRA 3TE6A 4IBCA 2ZANA 1Q3CA 4RF1A 2CV1A 1EFUB 4QNRA 4M0WA 3U5ZB 1IN8A 3FRHA 4LFAM 1KFVA 4D80A 3ILKA 5A2QS 1NNUC 4G4OA 4GEWA 1WGNA 1P3QQ 2DAKA 2XFTA 3QYEA 5IREB 3KOWE 4IBBA 1PJJA 1VQ1A 4DR3M 2F5NA 3HJQA 3A98B 3VK7A 1J5EM 2HL7A 4IBDA 1GO5A 4AQYM 1E94E 3D8BA 1R7RA 5KPRA 4IBIA 3U6CA 3RGSA 3QWLA 5GKNA 4AKHA 1L2CA 1XMQM 2HWJA 2MH8A 4FD2A 2WZJA 1OFHA 2DAMA 3IG8A 1KSFX 1N77A 1NY6A 5IZ7D 3GPPA 3U6MA 2L09A 1OJLA 4BBAA 3QYBA 3KS4A 4PD2A 3J80S 1GABA 2O25A 1QVRA 1TH4A 3W0LB 1GL7A 4R71A 5DYGA 4XBOA 3SMPA 4GITA 4LF8M 3B7ZA 3TPZA 3FTCA 3K8ZA 3FTFA 1YLAA 1IBKM 2DHRA 5LMUM 1PM5A 2F5OA 1QAQA 4MGHA 2XF3A 3J7BA 3J7AS 2CP8A 2B3TA 2V1UA 4MGIE 3T1YM 4IBFA 1SXJC 4FWDA 5IWAM 4B7FA 1VDDA 2K0BX 1K3XA 2F5PA 2UUAM 2UXCM 2Y20A 3M7GA 4PT5A 4RF0A 1HNWM 4AZFA 3MHVC 2BJWA 4I81A 2XLJA 2F5SA 3BOSA 1R2ZA 4G4RA 2BNKA 2JY6B 2JNHA 4X62M 3B9PA 4FCTA 2DWZB 1E9RA 5DYIA 2J5YA 3PVSA 3GO8A 3SARA 4JN6A 1XHBA 2AHMA 3LQRA 4IJEA 4DV7M 4GKJM 4WP2A 1X37A 2I7PA 2XH9A 4AG5A 3J81S 1OAIA 4X64M 3FTEA 2XGNA 3GLGA 2UUCM 3AJIB 3EIHA 5FTKA 1L2BA 2RGHA 2VF8A 4DR6M 3KSJA 2X4AA 3HU1A 1GJSA 3Q8XA 3ZCBB 4PCZA 1DGFA 1NJGA 3GRVA 1K82A 2XZFA 4LF6M 1HJPA 2R0IA 3HWSA 4L16A 3JR4A 1DGHB 1TR8A 4KODA 3UMMA 4P17A 4AW4A 1KYIA 4L78A 2H5XA 5JI3E 3DOAA 4XGIA 2MR9A 2XZUA 2CHQA 3HHYA 1IBLM 5FLXS 3L28A 3KDSE 4LJ9A 2CWBA 3GRUA 3SBJA 2I7NA 1VEGA 1OIZA 1ZMWA 4GC5A 4LGYA 3BBZA 3EIEA 2CHVA 2YR0A 4IBGA 4DR7M 4OX9M 1IQPA 4FVMA 1D0LA 3D8LA 1XXHB 2K47A 2OQ4A 3U60B 2VQFM 2R4EA 3LCUA 4CJ6A 4G4QA 2DWLA 4QOZC 1XC8A 2JWSA 4OVZB 1NO1A 1ORYB 2R6FA 1IXSA 5L8RF 5JI2E 3HJSA 4FW9A 2EO2A 2XFSA 3HU2A 1EIJA 2HHHM 1JR3D 1N75A 1VEKA 2UU9M 3K9OA 4DV5M 3TQSA 1XWIA 2QQ8A 4AKGA 8CATA 4JI5M 4W5WA 4QOSA 1QUTA 1NNJA 3FUWA 2KNVA 2HAKA 3KW6A 3MK6A 4OW0A 4B7GA 4AKIA 1G4AE 4PDIA 1GJTA 2CUZA 4I5SA 4OU7A 1JR3A 1QUSA 1IN4A 2JZ0A 4MH0E 2YNMD 3A46A 3U5ZA 4AI6A 4DR2M 2FNAA 2EUCA 2QPAA 2JXNA 4BLCA 5KQ8A 1QANA 2KW0A 1IY1A 1Z5AA 3FYDA 4LJAA 1C7YA 1OAOC 2OPFA 1NHGC 2C9CA 3CGWA 2DVWB 3GLIE 2OOAA 1ZMUA 5KQDA 1GLNA 2LWXA 4DV2M 4CISA 2JY5A 1UFZA 2L2DA 2QBYB 5H37D 3GLHB 3I4YA 5ITXA 2DAEA 3E21A 2UXDM 2C99A 1NY5A 5FSWA 1MN3A 1Z5BA 4TUWA 2UUBM 3HU3A 3DZDA 1G3IA 4LJ6A 3W68A 3C3EA 5EP4A 3LVWA
chains in the Genus database with same CATH topology
2ZAOA 5EXSA 4KLNA 3R8FA 2DWMA 2G5GX 4NRVA 2VQEM 2QBYA 2DZOB 2O5RA 3WHLA 4PDGA 3PFIA 1L8QA 2CV0A 1HT2E 3KXEC 1GL6A 4RNAA 4REZA 1HR0M 4D82A 3K1JA 4KO8A 3SMSA 5KO3A 1S3SA 3SASA 2D7GA 1IN6A 3E4RA 5LMNM 2LNHC 5F3WA 4GIPA 1IY2A 3U6SA 4KHPM 1TDZA 1Z6TA 4M9ZA 4DUZM 4B3TM 1FNNA 4ZPXA 2Y21A 2RKOA 3R9XB 3KOZE 3FYCA 2ZM6M 4LGMA 4BB9A 5C18A 2R45A 4GHAA 4R7GA 3W0FA 3LVVA 1G59A 4JI7M 2ZBKB 3T15A 2KRUA 4JI2M 1ZQ9A 2V6ZM 1JQJC 1NSFA 3SYLA 3C58A 4LF4M 3MJ5A 1GVNA 2DXIA 3M6AA 5EP2A 3E9SA 5FTMA 2QP9X 3VDUA 4LF9M 2L6OA 1E9SA 3AOEA 3RGPA 2ZAMA 3DFZA 3KSXA 1D2NA 1TH3A 4IBEA 4LF7M 4IIWA 4X66M 2KRKA 4YHHM 3GQ3A 3U6PA 3FUUA 4JI8M 2KZSA 2QCUA 1IN5A 3L26A 3VKGA 3SYKA 3KP0E 2A5YB 3HHWA 3VLFB 1TH2A 2M5ZA 3FTDA 4X65M 2V1CA 4R3DA 3HGIA 1HNXM 3K2LA 5EP3A 3TWMA 1EE8A 3I51A 5ITUA 1DGHA 2Y0QA 4NXMM 2XSZA 3TWKA 4WURA 3K92A 2KZUA 5FTJA 4DV1M 2C5RA 3UJNA 3UZUA 5BR8M 3THGA 1L2DA 4FWHA 1SXJB 2XEPA 1Q39A 2UXBM 4HLQA 4GMQA 2J7NA 3U6DA 3FUVA 5KPZA 3SAWA 2R62A 1YSYA 2EA0A 4GC9A 3U60A 1LV7A 1IXSB 4LJ8A 2X49A 2P5TA 3HHZA 2CV2A 4B3RM 4B7HA 2C96A 2C9OA 3AL0C 2QENA 1TGUA 1DO2A 3WHKA 3GRRA 3GP1A 1J7KA 5IT9S 3UGJA 5KPTA 1QYRA 2J7OA 4NSRA 2KA6B 3AKZA 1HNZM 3SAVA 1N78A 4DR1M 1G8PA 2W82A 3VK8A 3AV0A 4LJ4A 1R2YA 4B3MM 4NXNM 5FTNA 2C98A 1W5TA 3GPUA 3FUXA 3U6EA 2YFQA 5ITXE 1N33M 4L4UA 4DV4M 1NJFA 1HT1E 2CEAA 2HKJA 3L2AA 1ZAEA 2R65A 3GLHA 1TDHA 2YQZA 5EXPA 3W0LB 3T1HM 1DGBA 3VFDA 3FUTA 1R6BX 4NL4H 5ITQA 1OFIA 3FD9A 4MGKE 4LF5M 1I94M 5EQTA 3GLFA 4II7A 2M60A 2QZ4A 3H4MA 1PJIA 1N34M 2X8AA 5FTLA 3SFZA 2Z7JA 1QQWA 4CGYB 4FCWA 4JI0M 5ITTA 2Z3XA 4NOOB 3U6QA 2RGOA 3IG5A 1Z59A 1NVMA 2NQ8C 3SHFA 3UK6A 1HQCA 3KS8A 3HKPA 2Q2EB 1Q3BA 2D7EA 3GPXA 4DV6M 4JI3M 2R46A 2R18A 4CHTB 1DGGA 4AG6A 3SC3A 2R4JA 4LY6A 5JI3E 3L27A 2VIIA 4IBKA 4LJ5A 2KXEA 4NRWA 1L1ZA 3QAUA 4LG2A 4MM3B 3NWLA 1UM8A 5E6JA 2KEBA 1IY0A 1YUBA 3HHXA 1HQYE 3L25A 3HJ8A 1IM2A 4IJFA 1MX0A 1QAMA 3U61B 3J2PB 2XSZD 3SATA 1Z5CA 2DZNB 3GPYA 3L29A 5EXXA 4FWGA 1QZMA 3KP1E 5EJCA 4EIWA 4IBJA 4A3VB 4LZZA 2ERCA 4Z6YA 2F5QA 3A42A 3U61A 1N32M 4M9SA 4K0KM 3TL4X 3LQQA 4S12A 4G4NA 4QHTA 2CFOA 3KOYE 3VKHA 1T3TA 1MU5A 1G41A 1DO0A 4MGZE 2FOIC 2CHGA 2H1RA 3GLGB 2Z4RA 1E32A 1J09A 1SXJD 1IXZA 5EP1A 3GLIA 4FCVA 4LRSA 5DNYA 3JR5A 2F4VM 1H6UA 4I4LA 4DR5M 3SHGB 2JA2A 3AOEC 4B08A 1XNRM 4JV5M 4DR4M 5E26A 1K3WA 1NHWC 3J27B 4L15A 2CE7A 3GLIB 4P16A 1C1KA 3ZH9B 4LFCM 3DA1A 4I8OA 3CTWB 1GKIA 3PNVA 2L7IA 4LJ7A 3OTOM 3KFUG 1IBMM 4LCBA 3KVWA 4OVZA 3U6LA 3NBIA 1N36M 2BJVA 4GH9A 4QHSA 3T38A 3GQ4A 3AOGA 4D81A 4M0DA 4QNMA 4MB7A 4JYAM 3GRYA 3RE8A 4NSOB 4JI1M 4DV0M 1IXRC 7CATA 4Z8XA 4LFBM 4GKKM 4LZJA 3CF2A 5ITYA 3PNYA 2G8LA 3M0EA 5C1BA 3CF0A 1QAOA 3FKEA 1W5SA 2FE8A 1XNQM 3AFHA 3I4VA 1FJGM 4LRTA 2Z4SA 3A45A 4GHLA 4ITQA 3KOXE 4DUYM 4B3SM 1I4WA 2E5LM 4GRIA 1IN7A 2HCBA 5EXTA 3GLFB 3GQ5A 4JXJA 2LH0A 3VDPA 3LMMA 1XXHA 2Y0TA 3TWLA 4WW0A 3U6OA 3RFWA 1XMOM 4JI6M 3PXGA 4G6ZA 1L1TA 4HL4A 1SXJA 1WXQA 2L7HA 4YY3M 4L8RC 2FFJA 2DWNA 2LXEA 2D7HA 5BPVA 3SAUA 4JI4M 1YE9A 3CF6E 4M9XA 4DV3M 3ZC7B 3JAMS 1SXJE 4MGYE 5ITRA 3TE6A 4IBCA 2ZANA 1Q3CA 4RF1A 2CV1A 4QNRA 4M0WA 3U5ZB 1IN8A 4LFAM 1KFVA 4D80A 3ILKA 5A2QS 1NNUC 4G4OA 2XFTA 5IREB 3KOWE 4IBBA 1PJJA 4DR3M 2F5NA 3HJQA 3A98B 3VK7A 1J5EM 2HL7A 4IBDA 4AQYM 1E94E 3D8BA 1R7RA 5KPRA 4IBIA 3U6CA 3RGSA 3QWLA 5GKNA 4AKHA 1L2CA 1XMQM 4FD2A 1OFHA 3IG8A 1KSFX 1N77A 1NY6A 5IZ7D 3GPPA 3U6MA 2L09A 1OJLA 4BBAA 3KS4A 4PD2A 3J80S 1QVRA 1TH4A 1GL7A 5DYGA 4XBOA 3SMPA 4GITA 4LF8M 3TPZA 3K8ZA 3FTCA 3FTFA 1IBKM 2DHRA 5LMUM 1PM5A 2F5OA 1QAQA 4MGHA 2XF3A 3J7BA 3J7AS 2V1UA 4MGIE 3T1YM 4IBFA 1SXJC 4FWDA 5IWAM 4B7FA 1VDDA 2F5PA 1K3XA 2UUAM 2UXCM 2Y20A 3M7GA 4PT5A 4RF0A 1HNWM 4AZFA 3MHVC 2BJWA 4I81A 2XLJA 2F5SA 3BOSA 1R2ZA 4G4RA 2BNKA 4X62M 3B9PA 4FCTA 2DWZB 1E9RA 5DYIA 3PVSA 3GO8A 3SARA 4JN6A 1XHBA 2AHMA 3LQRA 4IJEA 4DV7M 4GKJM 1X37A 2I7PA 2XH9A 4AG5A 3J81S 4X64M 3FTEA 2XGNA 3GLGA 2UUCM 3AJIB 3EIHA 5FTKA 1L2BA 2RGHA 4DR6M 3KSJA 2X4AA 3HU1A 3Q8XA 3ZCBB 4PCZA 1DGFA 1NJGA 3GRVA 1K82A 2XZFA 4LF6M 3HWSA 4L16A 3JR4A 1DGHB 4KODA 3UMMA 4AW4A 1KYIA 4L78A 3DOAA 4XGIA 2XZUA 2CHQA 3HHYA 1IBLM 5FLXS 3L28A 3KDSE 4LJ9A 3GRUA 3SBJA 2I7NA 4LGYA 4GC5A 3EIEA 2CHVA 2YR0A 4IBGA 4DR7M 4OX9M 1IQPA 4FVMA 3D8LA 2OQ4A 1XXHB 2K47A 3U60B 2VQFM 2R4EA 4G4QA 2DWLA 4QOZC 1XC8A 4OVZB 1ORYB 5JI2E 3HJSA 4FW9A 2EO2A 2XFSA 3HU2A 2HHHM 1JR3D 1N75A 2UU9M 4DV5M 3TQSA 1XWIA 4AKGA 8CATA 4JI5M 4W5WA 4QOSA 1NNJA 3FUWA 4OW0A 3KW6A 3MK6A 4B7GA 4AKIA 1G4AE 4PDIA 4OU7A 2CUZA 4I5SA 3U5ZA 1JR3A 1IN4A 4AI6A 4MH0E 2YNMD 3A46A 4DR2M 2FNAA 2EUCA 2QPAA 4BLCA 5KQ8A 1QANA 2KW0A 1IY1A 1Z5AA 3FYDA 4LJAA 2OPFA 1NHGC 2C9CA 2DVWB 5KQDA 1GLNA 2LWXA 4DV2M 4CISA 2QBYB 5H37D 3GLHB 3I4YA 5ITXA 2UXDM 2C99A 1NY5A 5FSWA 1Z5BA 4TUWA 2UUBM 3HU3A 3DZDA 1G3IA 4LJ6A 5EP4A 3LVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3W A;  1IBK M;  4B3R M;  4JV5 M;  5LMU M;  1PM5 A;  2F5O A;  3J7A S;  4NRV A;  3GP1 A;  2VQE M;  5IT9 S;  4PDG A;  3T1Y M;  5IWA M;  2UXC M;  2F5P A;  2UUA M;  1K3X A;  4LFC M;  1HNZ M;  1HR0 M;  1HNW M;  2F5S A;  4DR1 M;  1R2Z A;  4G4R A;  3OTO M;  3SAS A;  4X62 M;  3VK8 A;  1IBM M;  3U6L A;  1R2Y A;  4B3M M;  4NXN M;  3SAR A;  3GO8 A;  1N36 M;  3GPU A;  3GQ4 A;  5LMN M;  3U6E A;  5ITX E;  1N33 M;  4MB7 A;  4DV7 M;  4GKJ M;  4JYA M;  4DV4 M;  3U6S A;  4KHP M;  2HKJ A;  3SAV A;  1TDZ A;  4JI1 M;  4DV0 M;  3J81 S;  1TDH A;  4DUZ M;  4LFB M;  4X64 M;  3T1H M;  4GKK M;  4B3T M;  5ITY A;  2UUC M;  1L2B A;  5ITQ A;  4DR6 M;  4LF5 M;  1XNQ M;  1I94 M;  4PCZ A;  2ZM6 M;  1K82 A;  2XZF A;  1FJG M;  4LF6 M;  1PJI A;  3A45 A;  1N34 M;  4ITQ A;  3JR4 A;  3W0F A;  4DUY M;  4B3S M;  2E5L M;  4JI7 M;  4JI0 M;  2ZBK B;  5ITT A;  3DOA A;  3U6Q A;  4JI2 M;  3GQ5 A;  2XZU A;  1Z59 A;  1IBL M;  5FLX S;  3C58 A;  3TWL A;  2Q2E B;  3SBJ A;  1Q3B A;  3GPX A;  3U6O A;  4DV6 M;  4LF4 M;  4JI3 M;  3TWM A;  1XMO M;  4JI6 M;  1L1T A;  4DR7 M;  4OX9 M;  4NRW A;  4LF9 M;  4YY3 M;  1L1Z A;  2OQ4 A;  2VQF M;  4G4Q A;  1XC8 A;  3SAU A;  4JI4 M;  4DV3 M;  3JAM S;  4LF7 M;  5ITR A;  4X66 M;  1MX0 A;  4YHH M;  3GQ3 A;  1Q3C A;  3U6P A;  2HHH M;  4JI8 M;  3SAT A;  1Z5C A;  2UU9 M;  4DV5 M;  3GPY A;  4LFA M;  1KFV A;  5A2Q S;  4G4O A;  4JI5 M;  4X65 M;  1NNJ A;  1HNX M;  1PJJ A;  4PDI A;  4DR3 M;  2F5Q A;  3A42 A;  3VK7 A;  2F5N A;  3A46 A;  1EE8 A;  5ITU A;  4DR2 M;  1J5E M;  4K0K M;  1N32 M;  4NXM M;  4AQY M;  3TWK A;  4G4N A;  3U6C A;  1Z5A A;  4DV1 M;  2OPF A;  1L2C A;  5BR8 M;  1MU5 A;  1XMQ M;  1L2D A;  1Q39 A;  4DV2 M;  4CIS A;  2UXB M;  3GPP A;  3U6M A;  3U6D A;  5ITX A;  2UXD M;  4PD2 A;  3J80 S;  3SAW A;  3JR5 A;  2F4V M;  1Z5B A;  2UUB M;  4DR5 M;  2EA0 A;  4LF8 M;  1XNR M;  4DR4 M; 
#chains in the Genus database with same CATH topology
 2ZAO A;  3FRI A;  5EXS A;  4KLN A;  3R8F A;  2DWM A;  2N35 A;  1T43 A;  2G5G X;  4NRV A;  2VQE M;  2QBY A;  2DZO B;  2MRO B;  2O5R A;  4RKU F;  3WHL A;  4PDG A;  3PFI A;  1L8Q A;  2CV0 A;  2JUJ A;  1HT2 E;  3KXE C;  1GL6 A;  4RNA A;  4REZ A;  1HR0 M;  4D82 A;  3K1J A;  4KO8 A;  3SMS A;  5KO3 A;  2LVQ D;  2LHC A;  3LCV B;  1S3S A;  3SAS A;  2D7G A;  1IN6 A;  2LVN C;  2ZTC A;  5DFL A;  3GLH E;  3E4R A;  1CUK A;  2LNH C;  3MMP A;  5LMN M;  5F3W A;  1IFY A;  4GIP A;  1IY2 A;  3U6S A;  4KHP M;  1TDZ A;  1Z6T A;  1OTR A;  2RRU A;  4M9Z A;  4DUZ M;  2L4F A;  2DZL A;  4B3T M;  1FNN A;  4ZPX A;  2Y21 A;  3B7N A;  1PJQ A;  2RKO A;  3R9X B;  3KOZ E;  3FYC A;  2ZM6 M;  4LGM A;  1TF0 B;  4BB9 A;  5C18 A;  1NV9 A;  2DHY A;  1PJS A;  2R45 A;  4GHA A;  4R7G A;  3W0F A;  1AUA A;  3LVV A;  1G59 A;  4JI7 M;  2ZBK B;  3T15 A;  2KRU A;  4JI2 M;  2DI0 A;  1JR3 E;  1ZQ9 A;  2V6Z M;  1JQJ C;  1NSF A;  3SYL A;  3C58 A;  4LF4 M;  3MJ5 A;  1GVN A;  2DXI A;  1XXH E;  3M6A A;  3BXW A;  5EP2 A;  4DBG B;  3E9S A;  1ZMV A;  5FTM A;  2QP9 X;  3B74 A;  3VDU A;  4LF9 M;  2L6O A;  1E9S A;  3AOE A;  3RGP A;  2ZAM A;  2WSE F;  3DFZ A;  3KSX A;  1D2N A;  1TH3 A;  1D0K A;  4IBE A;  4LF7 M;  4Y28 F;  1OQY A;  4IIW A;  4X66 M;  2KRK A;  4YHH M;  3GQ3 A;  3U6P A;  3FUU A;  4JI8 M;  2KZS A;  3NBX X;  2QCU A;  3ZQJ A;  1IN5 A;  3L26 A;  3VKG A;  3SYK A;  3KP0 E;  2A5Y B;  3HHW A;  3VLF B;  1TH2 A;  2M5Z A;  3FTD A;  3HZJ A;  4X65 M;  2V1C A;  4R3D A;  1JB0 F;  3HGI A;  1HNX M;  1V34 A;  3K2L A;  5EP3 A;  3TWM A;  2LTU A;  1EE8 A;  3I51 A;  5ITU A;  2EKK A;  1DGH A;  2Y0Q A;  4NXM M;  2XSZ A;  3TWK A;  4WUR A;  3K92 A;  2KZU A;  5FTJ A;  4DV1 M;  2C5R A;  3HX3 A;  1PJT A;  3UJN A;  1V92 A;  1V33 A;  3UZU A;  5BR8 M;  4L6V 6;  3THG A;  1L2D A;  1SXJ B;  2XEP A;  4FWH A;  1Q39 A;  2UXB M;  4HLQ A;  4GMQ A;  1WR1 B;  2J7N A;  3U6D A;  2GNO A;  2ZTD A;  3FUV A;  5KPZ A;  3SAW A;  1G71 A;  3W67 A;  2R62 A;  1YSY A;  2JP7 A;  2EA0 A;  4GC9 A;  3U60 A;  1LV7 A;  1IXS B;  1Q02 A;  4LJ8 A;  2X49 A;  2QHO B;  2P5T A;  2LVA A;  3HHZ A;  2CV2 A;  4B3R M;  4B7H A;  2C96 A;  2C9O A;  3AL0 C;  2VDB B;  2QEN A;  1TGU A;  1DO2 A;  2GQF A;  3GRR A;  3WHK A;  3GP1 A;  1J7K A;  5IT9 S;  2LVP C;  3UGJ A;  5KPT A;  1QDT A;  1QYR A;  2J7O A;  4NSR A;  2KA6 B;  3AKZ A;  1BVS A;  3LW5 F;  3SAV A;  1HNZ M;  2JY7 A;  1N78 A;  4DR1 M;  1A5T A;  1G8P A;  2W82 A;  1WIV A;  3VK8 A;  3AV0 A;  4LJ4 A;  1R2Y A;  2BWB A;  4NXN M;  4B3M M;  1OKS A;  2C98 A;  5FTN A;  1W5T A;  3GPU A;  3FUX A;  3U6E A;  2YFQ A;  5ITX E;  3C3D A;  1N33 M;  4L4U A;  1F4I A;  4DV4 M;  1NJF A;  1HT1 E;  2CEA A;  2HKJ A;  3L2A A;  1ZAE A;  2R65 A;  3GLH A;  1TDH A;  2YQZ A;  5EXP A;  3V76 A;  2JZ1 A;  1DGB A;  2L4E A;  2LBC A;  2OOB A;  3FUT A;  1R6B X;  3VFD A;  3T1H M;  4NL4 H;  5ITQ A;  1OFI A;  3FD9 A;  4MGK E;  4LF5 M;  1I94 M;  2QNJ A;  3F92 A;  5EQT A;  3GLF A;  1Y8G A;  4II7 A;  2M60 A;  2QZ4 A;  2KDL A;  3H4M A;  1PJI A;  1N34 M;  2X8A A;  2R44 A;  2JY8 A;  3SFZ A;  5FTL A;  2Z7J A;  4G3O A;  1QQW A;  4CGY B;  4FCW A;  4UN2 B;  4JI0 M;  5ITT A;  2Z3X A;  4NOO B;  3U6Q A;  2RGO A;  3IG5 A;  2DAG A;  1Z59 A;  1NVM A;  2DAI A;  2LVO C;  2NQ8 C;  3SHF A;  3UK6 A;  1HQC A;  3KS8 A;  3HKP A;  2Q2E B;  2LHG A;  1Q3B A;  2D7E A;  3GPX A;  4DV6 M;  2FH0 A;  2R46 A;  2R18 A;  4JI3 M;  1DGG A;  4AG6 A;  3SC3 A;  2R4J A;  4LY6 A;  4CHT B;  1SG9 A;  2G3Q A;  3L27 A;  3FE3 A;  2O01 F;  2VII A;  4IBK A;  2KXE A;  4LJ5 A;  4NRW A;  1L1Z A;  3QAU A;  4LG2 A;  4MM3 B;  1VG5 A;  3NWL A;  1UM8 A;  5E6J A;  2KEB A;  1IY0 A;  1T6O A;  1YUB A;  3HHX A;  1HQY E;  3L25 A;  1QDR A;  3HJ8 A;  1VEJ A;  1IM2 A;  4IJF A;  1WHC A;  4XK8 F;  1MX0 A;  1QAM A;  3U61 B;  3J2P B;  1WGL A;  2XSZ D;  3SAT A;  1Z5C A;  2MJ5 B;  3GLF E;  2DZN B;  1VDL A;  2K9D A;  3GPY A;  3L29 A;  5EXX A;  4FWG A;  4KT0 F;  1OIP A;  1QZM A;  3KP1 E;  5EJC A;  4EIW A;  4IBJ A;  4A3V B;  1QZE A;  4LZZ A;  2ERC A;  4Z6Y A;  2F5Q A;  4Q7J A;  3A42 A;  2KNA A;  2DNA A;  3T6P A;  3U61 A;  4M9S A;  4K0K M;  1N32 M;  3I01 M;  3TL4 X;  1AIP C;  2KHH A;  3LQQ A;  4S12 A;  4ANR A;  1MJG M;  4G4N A;  4QHT A;  2CFO A;  3KOY E;  3VKH A;  1T3T A;  1PGY A;  2DKL A;  1MU5 A;  1G41 A;  1RU3 A;  1DO0 A;  2WSC F;  4MGZ E;  2FOI C;  2CHG A;  2H1R A;  3GLG B;  1D0M A;  2Z4R A;  1E32 A;  1J09 A;  1SXJ D;  1IXZ A;  5EP1 A;  3GLI A;  4F1I A;  4FCV A;  4LRS A;  2K6B A;  5DNY A;  3JR5 A;  2F4V M;  1H6U A;  4I4L A;  3B89 A;  4DR5 M;  3SHG B;  3Q8G A;  2JA2 A;  3AOE C;  4B08 A;  1XNR M;  4JV5 M;  4DR4 M;  5E26 A;  1K3W A;  3K9P A;  1NHW C;  3J27 B;  2DEN A;  4L15 A;  2KNZ A;  2CE7 A;  3GLI B;  2FS1 A;  4P16 A;  1C1K A;  2APL A;  3ZH9 B;  4LFC M;  3DA1 A;  4I8O A;  3CTW B;  1GKI A;  3PNV A;  3C9P A;  4CIZ A;  2L7I A;  3E46 A;  4LJ7 A;  3OTO M;  3KFU G;  3IEC A;  1IBM M;  4LCB A;  1ZV1 A;  3KVW A;  2MGW A;  4OVZ A;  3U6L A;  1LTM A;  2QSF X;  3NBI A;  2EKF A;  1N36 M;  2BJV A;  4GH9 A;  4QHS A;  3B7Q A;  3T38 A;  3GQ4 A;  3GLG E;  3AOG A;  4D81 A;  4M0D A;  4QNM A;  4MB7 A;  4JYA M;  3GRY A;  2Z8Y M;  3RE8 A;  4NSO B;  4JI1 M;  4DV0 M;  1IXR C;  7CAT A;  2BWE A;  4Z8X A;  1XB2 B;  4LFB M;  4GKK M;  4LZJ A;  2CRU A;  1R5L A;  3CF2 A;  5ITY A;  3PNY A;  2G8L A;  3M0E A;  4HEO A;  5C1B A;  3CF0 A;  1QAO A;  3FKE A;  1DV0 A;  1W5S A;  3IHP A;  2FE8 A;  1XNQ M;  3AFH A;  3I4V A;  1FJG M;  4LRT A;  2Z4S A;  3A45 A;  4GHL A;  1NV8 A;  4ITQ A;  3H4J A;  3KOX E;  4DUY M;  4NC6 A;  4B3S M;  1I4W A;  2E5L M;  2VF7 A;  4GRI A;  1IN7 A;  2HCB A;  1TTE A;  5EXT A;  3GLF B;  3GQ5 A;  4JXJ A;  2LH0 A;  2WSF F;  3VDP A;  3LMM A;  1XXH A;  2Y0T A;  3TWL A;  4WW0 A;  3U6O A;  2EJS A;  1R4G A;  3RFW A;  1XMO M;  3HY5 A;  1WJ7 A;  4JI6 M;  2OO9 A;  3PXG A;  4G6Z A;  1L1T A;  4HL4 A;  4F2L A;  1PRB A;  1SXJ A;  1WXQ A;  2L7H A;  3I04 M;  4YY3 M;  4L8R C;  2FFJ A;  2DWN A;  2LXE A;  2D7H A;  5BPV A;  3SAU A;  4JI4 M;  1YE9 A;  3CF6 E;  4M9X A;  4DV3 M;  3ZC7 B;  3JAM S;  1SXJ E;  4MGY E;  5ITR A;  3TE6 A;  4IBC A;  2ZAN A;  1Q3C A;  4RF1 A;  2CV1 A;  1EFU B;  4QNR A;  4M0W A;  3U5Z B;  1IN8 A;  3FRH A;  4LFA M;  1KFV A;  4D80 A;  3ILK A;  5A2Q S;  1NNU C;  4G4O A;  4GEW A;  1WGN A;  1P3Q Q;  2DAK A;  2XFT A;  3QYE A;  5IRE B;  3KOW E;  4IBB A;  1PJJ A;  1VQ1 A;  4DR3 M;  2F5N A;  3HJQ A;  3A98 B;  3VK7 A;  1J5E M;  2HL7 A;  4IBD A;  1GO5 A;  4AQY M;  1E94 E;  3D8B A;  1R7R A;  5KPR A;  4IBI A;  3U6C A;  3RGS A;  3QWL A;  5GKN A;  4AKH A;  1L2C A;  1XMQ M;  2HWJ A;  2MH8 A;  4FD2 A;  2WZJ A;  1OFH A;  2DAM A;  3IG8 A;  1KSF X;  1N77 A;  1NY6 A;  5IZ7 D;  3GPP A;  3U6M A;  2L09 A;  1OJL A;  4BBA A;  3QYB A;  3KS4 A;  4PD2 A;  3J80 S;  1GAB A;  2O25 A;  1QVR A;  1TH4 A;  3W0L B;  1GL7 A;  4R71 A;  5DYG A;  4XBO A;  3SMP A;  4GIT A;  4LF8 M;  3B7Z A;  3TPZ A;  3FTC A;  3K8Z A;  3FTF A;  1YLA A;  1IBK M;  2DHR A;  5LMU M;  1PM5 A;  2F5O A;  1QAQ A;  4MGH A;  2XF3 A;  3J7B A;  3J7A S;  2CP8 A;  2B3T A;  2V1U A;  4MGI E;  3T1Y M;  4IBF A;  1SXJ C;  4FWD A;  5IWA M;  4B7F A;  1VDD A;  2K0B X;  1K3X A;  2F5P A;  2UUA M;  2UXC M;  2Y20 A;  3M7G A;  4PT5 A;  4RF0 A;  1HNW M;  4AZF A;  3MHV C;  2BJW A;  4I81 A;  2XLJ A;  2F5S A;  3BOS A;  1R2Z A;  4G4R A;  2BNK A;  2JY6 B;  2JNH A;  4X62 M;  3B9P A;  4FCT A;  2DWZ B;  1E9R A;  5DYI A;  2J5Y A;  3PVS A;  3GO8 A;  3SAR A;  4JN6 A;  1XHB A;  2AHM A;  3LQR A;  4IJE A;  4DV7 M;  4GKJ M;  4WP2 A;  1X37 A;  2I7P A;  2XH9 A;  4AG5 A;  3J81 S;  1OAI A;  4X64 M;  3FTE A;  2XGN A;  3GLG A;  2UUC M;  3AJI B;  3EIH A;  5FTK A;  1L2B A;  2RGH A;  2VF8 A;  4DR6 M;  3KSJ A;  2X4A A;  3HU1 A;  1GJS A;  3Q8X A;  3ZCB B;  4PCZ A;  1DGF A;  1NJG A;  3GRV A;  1K82 A;  2XZF A;  4LF6 M;  1HJP A;  2R0I A;  3HWS A;  4L16 A;  3JR4 A;  1DGH B;  1TR8 A;  4KOD A;  3UMM A;  4P17 A;  4AW4 A;  1KYI A;  4L78 A;  2H5X A;  5JI3 E;  3DOA A;  4XGI A;  2MR9 A;  2XZU A;  2CHQ A;  3HHY A;  1IBL M;  5FLX S;  3L28 A;  3KDS E;  4LJ9 A;  2CWB A;  3GRU A;  3SBJ A;  2I7N A;  1VEG A;  1OIZ A;  1ZMW A;  4GC5 A;  4LGY A;  3BBZ A;  3EIE A;  2CHV A;  2YR0 A;  4IBG A;  4DR7 M;  4OX9 M;  1IQP A;  4FVM A;  1D0L A;  3D8L A;  1XXH B;  2K47 A;  2OQ4 A;  3U60 B;  2VQF M;  2R4E A;  3LCU A;  4CJ6 A;  4G4Q A;  2DWL A;  4QOZ C;  1XC8 A;  2JWS A;  4OVZ B;  1NO1 A;  1ORY B;  2R6F A;  1IXS A;  5L8R F;  5JI2 E;  3HJS A;  4FW9 A;  2EO2 A;  2XFS A;  3HU2 A;  1EIJ A;  2HHH M;  1JR3 D;  1N75 A;  1VEK A;  2UU9 M;  3K9O A;  4DV5 M;  3TQS A;  1XWI A;  2QQ8 A;  4AKG A;  8CAT A;  4JI5 M;  4W5W A;  4QOS A;  1QUT A;  1NNJ A;  3FUW A;  2KNV A;  2HAK A;  3KW6 A;  3MK6 A;  4OW0 A;  4B7G A;  4AKI A;  1G4A E;  4PDI A;  1GJT A;  2CUZ A;  4I5S A;  4OU7 A;  1JR3 A;  1QUS A;  1IN4 A;  2JZ0 A;  4MH0 E;  2YNM D;  3A46 A;  3U5Z A;  4AI6 A;  4DR2 M;  2FNA A;  2EUC A;  2QPA A;  2JXN A;  4BLC A;  5KQ8 A;  1QAN A;  2KW0 A;  1IY1 A;  1Z5A A;  3FYD A;  4LJA A;  1C7Y A;  1OAO C;  2OPF A;  1NHG C;  2C9C A;  3CGW A;  2DVW B;  3GLI E;  2OOA A;  1ZMU A;  5KQD A;  1GLN A;  2LWX A;  4DV2 M;  4CIS A;  2JY5 A;  1UFZ A;  2L2D A;  2QBY B;  5H37 D;  3GLH B;  3I4Y A;  5ITX A;  2DAE A;  3E21 A;  2UXD M;  2C99 A;  1NY5 A;  5FSW A;  1MN3 A;  1Z5B A;  4TUW A;  2UUB M;  3HU3 A;  3DZD A;  1G3I A;  4LJ6 A;  3W68 A;  3C3E A;  5EP4 A;  3LVW A; 
#chains in the Genus database with same CATH homology
 2ZAO A;  5EXS A;  4KLN A;  3R8F A;  2DWM A;  2G5G X;  4NRV A;  2VQE M;  2QBY A;  2DZO B;  2O5R A;  3WHL A;  4PDG A;  3PFI A;  1L8Q A;  2CV0 A;  1HT2 E;  3KXE C;  1GL6 A;  4RNA A;  4REZ A;  1HR0 M;  4D82 A;  3K1J A;  4KO8 A;  3SMS A;  5KO3 A;  1S3S A;  3SAS A;  2D7G A;  1IN6 A;  3E4R A;  5LMN M;  2LNH C;  5F3W A;  4GIP A;  1IY2 A;  3U6S A;  4KHP M;  1TDZ A;  1Z6T A;  4M9Z A;  4DUZ M;  4B3T M;  1FNN A;  4ZPX A;  2Y21 A;  2RKO A;  3R9X B;  3KOZ E;  3FYC A;  2ZM6 M;  4LGM A;  4BB9 A;  5C18 A;  2R45 A;  4GHA A;  4R7G A;  3W0F A;  3LVV A;  1G59 A;  4JI7 M;  2ZBK B;  3T15 A;  2KRU A;  4JI2 M;  1ZQ9 A;  2V6Z M;  1JQJ C;  1NSF A;  3SYL A;  3C58 A;  4LF4 M;  3MJ5 A;  1GVN A;  2DXI A;  3M6A A;  5EP2 A;  3E9S A;  5FTM A;  2QP9 X;  3VDU A;  4LF9 M;  2L6O A;  1E9S A;  3AOE A;  3RGP A;  2ZAM A;  3DFZ A;  3KSX A;  1D2N A;  1TH3 A;  4IBE A;  4LF7 M;  4IIW A;  4X66 M;  2KRK A;  4YHH M;  3GQ3 A;  3U6P A;  3FUU A;  4JI8 M;  2KZS A;  2QCU A;  1IN5 A;  3L26 A;  3VKG A;  3SYK A;  3KP0 E;  2A5Y B;  3HHW A;  3VLF B;  1TH2 A;  2M5Z A;  3FTD A;  4X65 M;  2V1C A;  4R3D A;  3HGI A;  1HNX M;  3K2L A;  5EP3 A;  3TWM A;  1EE8 A;  3I51 A;  5ITU A;  1DGH A;  2Y0Q A;  4NXM M;  2XSZ A;  3TWK A;  4WUR A;  3K92 A;  2KZU A;  5FTJ A;  4DV1 M;  2C5R A;  3UJN A;  3UZU A;  5BR8 M;  3THG A;  1L2D A;  4FWH A;  1SXJ B;  2XEP A;  1Q39 A;  2UXB M;  4HLQ A;  4GMQ A;  2J7N A;  3U6D A;  3FUV A;  5KPZ A;  3SAW A;  2R62 A;  1YSY A;  2EA0 A;  4GC9 A;  3U60 A;  1LV7 A;  1IXS B;  4LJ8 A;  2X49 A;  2P5T A;  3HHZ A;  2CV2 A;  4B3R M;  4B7H A;  2C96 A;  2C9O A;  3AL0 C;  2QEN A;  1TGU A;  1DO2 A;  3WHK A;  3GRR A;  3GP1 A;  1J7K A;  5IT9 S;  3UGJ A;  5KPT A;  1QYR A;  2J7O A;  4NSR A;  2KA6 B;  3AKZ A;  1HNZ M;  3SAV A;  1N78 A;  4DR1 M;  1G8P A;  2W82 A;  3VK8 A;  3AV0 A;  4LJ4 A;  1R2Y A;  4B3M M;  4NXN M;  5FTN A;  2C98 A;  1W5T A;  3GPU A;  3FUX A;  3U6E A;  2YFQ A;  5ITX E;  1N33 M;  4L4U A;  4DV4 M;  1NJF A;  1HT1 E;  2CEA A;  2HKJ A;  3L2A A;  1ZAE A;  2R65 A;  3GLH A;  1TDH A;  2YQZ A;  5EXP A;  3W0L B;  3T1H M;  1DGB A;  3VFD A;  3FUT A;  1R6B X;  4NL4 H;  5ITQ A;  1OFI A;  3FD9 A;  4MGK E;  4LF5 M;  1I94 M;  5EQT A;  3GLF A;  4II7 A;  2M60 A;  2QZ4 A;  3H4M A;  1PJI A;  1N34 M;  2X8A A;  5FTL A;  3SFZ A;  2Z7J A;  1QQW A;  4CGY B;  4FCW A;  4JI0 M;  5ITT A;  2Z3X A;  4NOO B;  3U6Q A;  2RGO A;  3IG5 A;  1Z59 A;  1NVM A;  2NQ8 C;  3SHF A;  3UK6 A;  1HQC A;  3KS8 A;  3HKP A;  2Q2E B;  1Q3B A;  2D7E A;  3GPX A;  4DV6 M;  4JI3 M;  2R46 A;  2R18 A;  4CHT B;  1DGG A;  4AG6 A;  3SC3 A;  2R4J A;  4LY6 A;  5JI3 E;  3L27 A;  2VII A;  4IBK A;  4LJ5 A;  2KXE A;  4NRW A;  1L1Z A;  3QAU A;  4LG2 A;  4MM3 B;  3NWL A;  1UM8 A;  5E6J A;  2KEB A;  1IY0 A;  1YUB A;  3HHX A;  1HQY E;  3L25 A;  3HJ8 A;  1IM2 A;  4IJF A;  1MX0 A;  1QAM A;  3U61 B;  3J2P B;  2XSZ D;  3SAT A;  1Z5C A;  2DZN B;  3GPY A;  3L29 A;  5EXX A;  4FWG A;  1QZM A;  3KP1 E;  5EJC A;  4EIW A;  4IBJ A;  4A3V B;  4LZZ A;  2ERC A;  4Z6Y A;  2F5Q A;  3A42 A;  3U61 A;  1N32 M;  4M9S A;  4K0K M;  3TL4 X;  3LQQ A;  4S12 A;  4G4N A;  4QHT A;  2CFO A;  3KOY E;  3VKH A;  1T3T A;  1MU5 A;  1G41 A;  1DO0 A;  4MGZ E;  2FOI C;  2CHG A;  2H1R A;  3GLG B;  2Z4R A;  1E32 A;  1J09 A;  1SXJ D;  1IXZ A;  5EP1 A;  3GLI A;  4FCV A;  4LRS A;  5DNY A;  3JR5 A;  2F4V M;  1H6U A;  4I4L A;  4DR5 M;  3SHG B;  2JA2 A;  3AOE C;  4B08 A;  1XNR M;  4JV5 M;  4DR4 M;  5E26 A;  1K3W A;  1NHW C;  3J27 B;  4L15 A;  2CE7 A;  3GLI B;  4P16 A;  1C1K A;  3ZH9 B;  4LFC M;  3DA1 A;  4I8O A;  3CTW B;  1GKI A;  3PNV A;  2L7I A;  4LJ7 A;  3OTO M;  3KFU G;  1IBM M;  4LCB A;  3KVW A;  4OVZ A;  3U6L A;  3NBI A;  1N36 M;  2BJV A;  4GH9 A;  4QHS A;  3T38 A;  3GQ4 A;  3AOG A;  4D81 A;  4M0D A;  4QNM A;  4MB7 A;  4JYA M;  3GRY A;  3RE8 A;  4NSO B;  4JI1 M;  4DV0 M;  1IXR C;  7CAT A;  4Z8X A;  4LFB M;  4GKK M;  4LZJ A;  3CF2 A;  5ITY A;  3PNY A;  2G8L A;  3M0E A;  5C1B A;  3CF0 A;  1QAO A;  3FKE A;  1W5S A;  2FE8 A;  1XNQ M;  3AFH A;  3I4V A;  1FJG M;  4LRT A;  2Z4S A;  3A45 A;  4GHL A;  4ITQ A;  3KOX E;  4DUY M;  4B3S M;  1I4W A;  2E5L M;  4GRI A;  1IN7 A;  2HCB A;  5EXT A;  3GLF B;  3GQ5 A;  4JXJ A;  2LH0 A;  3VDP A;  3LMM A;  1XXH A;  2Y0T A;  3TWL A;  4WW0 A;  3U6O A;  3RFW A;  1XMO M;  4JI6 M;  3PXG A;  4G6Z A;  1L1T A;  4HL4 A;  1SXJ A;  1WXQ A;  2L7H A;  4YY3 M;  4L8R C;  2FFJ A;  2DWN A;  2LXE A;  2D7H A;  5BPV A;  3SAU A;  4JI4 M;  1YE9 A;  3CF6 E;  4M9X A;  4DV3 M;  3ZC7 B;  3JAM S;  1SXJ E;  4MGY E;  5ITR A;  3TE6 A;  4IBC A;  2ZAN A;  1Q3C A;  4RF1 A;  2CV1 A;  4QNR A;  4M0W A;  3U5Z B;  1IN8 A;  4LFA M;  1KFV A;  4D80 A;  3ILK A;  5A2Q S;  1NNU C;  4G4O A;  2XFT A;  5IRE B;  3KOW E;  4IBB A;  1PJJ A;  4DR3 M;  2F5N A;  3HJQ A;  3A98 B;  3VK7 A;  1J5E M;  2HL7 A;  4IBD A;  4AQY M;  1E94 E;  3D8B A;  1R7R A;  5KPR A;  4IBI A;  3U6C A;  3RGS A;  3QWL A;  5GKN A;  4AKH A;  1L2C A;  1XMQ M;  4FD2 A;  1OFH A;  3IG8 A;  1KSF X;  1N77 A;  1NY6 A;  5IZ7 D;  3GPP A;  3U6M A;  2L09 A;  1OJL A;  4BBA A;  3KS4 A;  4PD2 A;  3J80 S;  1QVR A;  1TH4 A;  1GL7 A;  5DYG A;  4XBO A;  3SMP A;  4GIT A;  4LF8 M;  3TPZ A;  3K8Z A;  3FTC A;  3FTF A;  1IBK M;  2DHR A;  5LMU M;  1PM5 A;  2F5O A;  1QAQ A;  4MGH A;  2XF3 A;  3J7B A;  3J7A S;  2V1U A;  4MGI E;  3T1Y M;  4IBF A;  1SXJ C;  4FWD A;  5IWA M;  4B7F A;  1VDD A;  2F5P A;  1K3X A;  2UUA M;  2UXC M;  2Y20 A;  3M7G A;  4PT5 A;  4RF0 A;  1HNW M;  4AZF A;  3MHV C;  2BJW A;  4I81 A;  2XLJ A;  2F5S A;  3BOS A;  1R2Z A;  4G4R A;  2BNK A;  4X62 M;  3B9P A;  4FCT A;  2DWZ B;  1E9R A;  5DYI A;  3PVS A;  3GO8 A;  3SAR A;  4JN6 A;  1XHB A;  2AHM A;  3LQR A;  4IJE A;  4DV7 M;  4GKJ M;  1X37 A;  2I7P A;  2XH9 A;  4AG5 A;  3J81 S;  4X64 M;  3FTE A;  2XGN A;  3GLG A;  2UUC M;  3AJI B;  3EIH A;  5FTK A;  1L2B A;  2RGH A;  4DR6 M;  3KSJ A;  2X4A A;  3HU1 A;  3Q8X A;  3ZCB B;  4PCZ A;  1DGF A;  1NJG A;  3GRV A;  1K82 A;  2XZF A;  4LF6 M;  3HWS A;  4L16 A;  3JR4 A;  1DGH B;  4KOD A;  3UMM A;  4AW4 A;  1KYI A;  4L78 A;  3DOA A;  4XGI A;  2XZU A;  2CHQ A;  3HHY A;  1IBL M;  5FLX S;  3L28 A;  3KDS E;  4LJ9 A;  3GRU A;  3SBJ A;  2I7N A;  4LGY A;  4GC5 A;  3EIE A;  2CHV A;  2YR0 A;  4IBG A;  4DR7 M;  4OX9 M;  1IQP A;  4FVM A;  3D8L A;  2OQ4 A;  1XXH B;  2K47 A;  3U60 B;  2VQF M;  2R4E A;  4G4Q A;  2DWL A;  4QOZ C;  1XC8 A;  4OVZ B;  1ORY B;  5JI2 E;  3HJS A;  4FW9 A;  2EO2 A;  2XFS A;  3HU2 A;  2HHH M;  1JR3 D;  1N75 A;  2UU9 M;  4DV5 M;  3TQS A;  1XWI A;  4AKG A;  8CAT A;  4JI5 M;  4W5W A;  4QOS A;  1NNJ A;  3FUW A;  4OW0 A;  3KW6 A;  3MK6 A;  4B7G A;  4AKI A;  1G4A E;  4PDI A;  4OU7 A;  2CUZ A;  4I5S A;  3U5Z A;  1JR3 A;  1IN4 A;  4AI6 A;  4MH0 E;  2YNM D;  3A46 A;  4DR2 M;  2FNA A;  2EUC A;  2QPA A;  4BLC A;  5KQ8 A;  1QAN A;  2KW0 A;  1IY1 A;  1Z5A A;  3FYD A;  4LJA A;  2OPF A;  1NHG C;  2C9C A;  2DVW B;  5KQD A;  1GLN A;  2LWX A;  4DV2 M;  4CIS A;  2QBY B;  5H37 D;  3GLH B;  3I4Y A;  5ITX A;  2UXD M;  2C99 A;  1NY5 A;  5FSW A;  1Z5B A;  4TUW A;  2UUB M;  3HU3 A;  3DZD A;  1G3I A;  4LJ6 A;  5EP4 A;  3LVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...