1XMOM

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xmoM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xmoM02
4DUYM 1Q3BA 3DOAA 1Z59A 4X66M 4JI4M 4NRVA 4G4RA 4JI1M 4LF8M 4B3SM 2VQEM 2VQFM 4DV3M 3GQ3A 3U6MA 4DR1M 3A45A 1XMQM 4LFAM 5FLXS 5LMNM 4JI7M 2F5OA 4LFBM 5ITTA 4JYAM 1N32M 1N33M 3SAWA 2HKJA 4JI8M 1IBMM 3TWMA 3SBJA 3C58A 3GPYA 4DV1M 2UU9M 4YY3M 2UUAM 2UXDM 3SARA 4JI6M 4DR7M 1HNWM 3GP1A 3T1YM 4JI5M 4GKKM 3JAMS 4LF6M 4LF7M 3U6SA 4JV5M 1XC8A 5ITXE 4X65M 3U6DA 4OX9M 3VK8A 3U6CA 3SAVA 3SATA 4LFCM 3J7AS 2Q2EB 2UXBM 4AQYM 1K3XA 4DR2M 4YHHM 1L2DA 2E5LM 3GQ4A 4LF9M 4PD2A 5LMUM 1HNZM 1N34M 3W0FA 1EE8A 3U6OA 1J5EM 1TDHA 5ITXA 4B3MM 3GO8A 4DV2M 4MB7A 3T1HM 4B3RM 1Q3CA 4X64M 2F5QA 4LF4M 3GPPA 1K3WA 1L1TA 3VK7A 3GQ5A 4DV6M 1XNQM 4K0KM 3GPUA 2UUCM 4B3TM 1XNRM 2F5PA 2ZBKB 4DUZM 2XZUA 1FJGM 3A46A 1PJJA 3SASA 4JI2M 3U6LA 1I94M 1L2CA 4JI3M 3SAUA 5ITUA 2F5SA 4DR6M 4GKJM 1Q39A 4NRWA 2OQ4A 3OTOM 5IWAM 4DV7M 4ITQA 4G4OA 1MU5A 1PM5A 1IBKM 2OPFA 3TWKA 5ITYA 4JI0M 1PJIA 4DR5M 4DR4M 4DV5M 4DV0M 3J81S 4PCZA 4G4NA 5ITQA 4DR3M 1HR0M 4PDIA 1NNJA 3TWLA 1IBLM 2UUBM 2HHHM 1XMOM 1N36M 3U6EA 1L1ZA 2XZFA 3J80S 2UXCM 4CISA 5BR8M 1Z5AA 4LF5M 1K82A 1MX0A 3JR4A 4NXNM 4X62M 3U6PA 1Z5CA 4KHPM 2EA0A 2ZM6M 3A42A 1TDZA 1HNXM 1L2BA 4PDGA 3JR5A 5A2QS 5IT9S 2F5NA 1R2YA 4DV4M 3U6QA 4NXMM 2F4VM 1KFVA 4G4QA 1R2ZA 3GPXA 5ITRA 1Z5BA
chains in the Genus database with same CATH superfamily
3C3EA 3GRRA 4L4UA 4FCVA 3PNYA 3GLFB 1HJPA 2ZAOA 3BOSA 2O25A 2B3TA 3MK6A 2L4FA 2Y0QA 3E46A 4LCBA 4X66M 2JY7A 4NRVA 4D82A 3I01M 3U60B 1IQPA 3RE8A 1C1KA 1HT2E 2R0IA 3J27B 1KYIA 2VQEM 1NJFA 3FUXA 1PJTA 4DV3M 4MGYE 3U6MA 4DR1M 4LFAM 2C5RA 5FLXS 2CE7A 5EP2A 2F5OA 2LVQD 4LFBM 1N33M 1N32M 2HAKA 2RKOA 1PRBA 1AIPC 3TWMA 4KODA 2L7HA 2R4EA 2Z7JA 4OU7A 4NC6A 1IM2A 1OAOC 4AG6A 3KS4A 5FTMA 2ZTDA 2UUAM 2UXDM 2FOIC 4I4LA 2ZTCA 3SARA 2OOAA 5KPRA 3TE6A 2KHHA 3THGA 4JI6M 5C18A 1NV9A 2APLA 2JXNA 1NVMA 2DENA 3LQRA 3UJNA 2G3QA 1OIPA 1DV0A 2DVWB 1KSFX 2M60A 4L78A 5IZ7D 3U6DA 1XC8A 2QSFX 3VK8A 3J2PB 3SATA 3K8ZA 2DAKA 1D0KA 1YUBA 4AQYM 2NQ8C 5L8RF 4MH0E 3CF0A 1X37A 3HHZA 1N77A 1IXZA 1VEKA 1IY1A 3CTWB 4DR2M 1G59A 1XWIA 1SXJD 3GQ4A 2E5LM 5KPTA 5LMUM 3T38A 1T6OA 3KSXA 2QENA 1EE8A 3HHXA 4NSRA 1WXQA 2QHOB 4B3MM 1JB0F 4FCWA 3GLIE 4MB7A 4X64M 4HEOA 5EXTA 1IN7A 4P17A 1Q02A 1IY0A 4LJ9A 4AKIA 3KDSE 1SXJE 4PT5A 1MJGM 1TH2A 1K3WA 1V34A 3GQ5A 2JY6B 4DV6M 4QHSA 1XNQM 4FCTA 4K0KM 3KOWE 1PJQA 3HJ8A 2Z4RA 1DGHB 1P3QQ 2XZUA 1FJGM 2YR0A 5KPZA 1QDRA 5F3WA 1NY5A 4QOSA 3U6LA 4FVMA 3SYLA 4JI3M 1UM8A 2I7NA 4HLQA 2JY5A 1W5TA 3BBZA 1HT1E 5E6JA 3SHGB 4ITQA 3GLIB 2R45A 4CJ6A 1QZMA 1MU5A 3KXEC 1IBKM 4FWDA 2CEAA 4ANRA 2DWNA 3GLHA 5ITYA 4JI0M 3L28A 3KOXE 3VKGA 3HX3A 4DR4M 3J81S 4G4NA 4RF0A 3MJ5A 1TH3A 2XEPA 4MGHA 1NNJA 3U61A 1ZAEA 3SMSA 3GRYA 4AW4A 1IY2A 1QDTA 1QZEA 2RRUA 4IBDA 5C1BA 1DO2A 4GIPA 1GLNA 2JY8A 4IBCA 4KHPM 1GVNA 4NXNM 2XSZA 4X62M 1Z5CA 2FH0A 2JWSA 1ZMUA 1R5LA 3AJIB 1DGFA 3PXGA 3GLFA 1E94E 1JR3D 3JR5A 3U60A 2X8AA 3Q8XA 4DV4M 2LHGA 2JP7A 2F4VM 1IN6A 1F4IA 1R4GA 1XHBA 1R2ZA 3K9OA 2HKJA 1Z5BA 1LV7A 2Y21A 4UN2B 4BB9A 5H37D 2XFTA 3SC3A 2MGWA 2YFQA 1Z59A 1QVRA 1JR3E 1WIVA 4G4RA 4JI1M 2LHCA 3HWSA 3VKHA 2Z4SA 3I4YA 3GLHB 3MHVC 4W5WA 1GL7A 2C96A 2R65A 1G4AE 3IHPA 4FWGA 3Q8GA 4GMQA 3GQ3A 3FD9A 3FE3A 2MJ5B 1IN4A 2EUCA 5ITTA 3GRVA 4JYAM 4NL4H 4LJAA 5JI2E 3IECA 1QANA 1IFYA 3RGPA 1QUTA 4IIWA 2CV0A 3K9PA 5KQ8A 2JZ0A 3GPYA 4DV1M 2K0BX 2DWMA 2BWEA 3L27A 4M9SA 1TTEA 4F2LA 2R46A 4D80A 1QYRA 4GKKM 2DZNB 2D7GA 3U6SA 2CRUA 1R7RA 2QQ8A 4NOOB 5ITXE 2LWXA 3UZUA 2FFJA 1NHWC 1J7KA 1DGBA 3K1JA 4LFCM 2LXEA 4WW0A 5EP3A 4RKUF 3J7AS 2Q2EB 2WZJA 3AOEA 2GNOA 3T6PA 4B7HA 1AUAA 1GO5A 3VLFB 5EP1A 3FTCA 4LF9M 2BJWA 4PD2A 2H1RA 2CV2A 3RFWA 1XXHE 2KEBA 3W0FA 4QOZC 2X49A 1J5EM 3GO8A 1VG5A 2EJSA 3B7NA 3KOYE 4IBFA 4LJ4A 3SYKA 3T15A 1W5SA 3T1HM 3L25A 4B3RM 1DGHA 3EIHA 1T43A 3J7BA 4RNAA 3AOEC 3PNVA 3V76A 3GPPA 1MN3A 5DYIA 1QAOA 5EJCA 2WSCF 3KFUG 1Y8GA 3ZCBB 1WGNA 3M0EA 1PGYA 3GPUA 2UUCM 3SHFA 2L6OA 4NSOB 1XNRM 2F5PA 5DNYA 4CHTB 2I7PA 3LQQA 3GLIA 3A46A 2O01F 3CGWA 4JN6A 2DAIA 1T3TA 2H5XA 2P5TA 1I94M 1OAIA 2JUJA 1L2CA 3SAUA 2LVPC 1SXJA 1OTRA 4KT0F 1XXHB 2G8LA 1Q39A 2R62A 3D8LA 4IBEA 2XF3A 4NRWA 2OQ4A 2CHGA 1EIJA 1OFHA 3OTOM 3L26A 4DV7M 3E4RA 2DNAA 4G4OA 4AKHA 1Z6TA 4CGYB 2G5GX 2O5RA 3W0LB 3FTEA 3DA1A 3A98B 3E9SA 2HL7A 2OPFA 2CWBA 4EIWA 4QNMA 1SG9A 4FW9A 1G41A 4DR3M 4PCZA 1HR0M 1SXJC 2HWJA 4PDIA 2DI0A 2N35A 3TWLA 1IBLM 2UUBM 2DAGA 1XMOM 3HJQA 3U6EA 2Z8YM 2CP8A 1PJSA 2DHYA 4XGIA 5EXPA 3B7ZA 2CUZA 3KVWA 4B7GA 1Z5AA 5BR8M 5IREB 2D7EA 2LBCA 3JR4A 2CHVA 1G71A 3AOGA 3HU2A 3TQSA 3A42A 4GRIA 3KOZE 2ZANA 5DFLA 5IT9S 2DWZB 5EXSA 3B9PA 3UK6A 2V6ZM 3U6QA 2YNMD 1NHGC 3M6AA 2C9CA 1I4WA 2LVOC 4IBGA 2LVNC 1SXJB 4DUYM 4OVZB 4ZPXA 1Q3BA 3QAUA 3R9XB 3DOAA 4JI4M 3GLGE 3H4JA 4P16A 1JQJC 4IBBA 4WURA 1OQYA 3DFZA 4IJFA 7CATA 4LF8M 5EP4A 3IG5A 3I04M 2KRKA 2C9OA 4REZA 5KQDA 3PVSA 5E26A 1XMQM 1YLAA 3A45A 1OFIA 1NY6A 5LMNM 2JNHA 3IG8A 4LJ6A 2LTUA 5FTNA 3SAWA 4LRSA 1IBMM 1IN8A 3M7GA 1IN5A 1JR3A 4IBJA 3SBJA 3C58A 2L7IA 3R8FA 1ZQ9A 3KP1E 4AKGA 4YY3M 4II7A 4Q7JA 3ILKA 2CHQA 3QYBA 3NWLA 4Y28F 1TF0B 2LNHC 2XGNA 4GHAA 4QHTA 1HNWM 3AFHA 3C3DA 3T1YM 4JI5M 1R6BX 2BJVA 3FUTA 3GLGB 4WP2A 1WGLA 1QAQA 4GHLA 2HCBA 3TPZA 2EKKA 4OX9M 4LGYA 4L8RC 1WHCA 1WJ7A 3HKPA 2OO9A 3HU1A 4MM3B 3WHLA 2AHMA 1L2DA 2M5ZA 1IXSB 1GL6A 4GEWA 4R71A 4XBOA 1HQCA 1N34M 2DHRA 1HNZM 3U6OA 1YE9A 3PFIA 2GQFA 2MROB 1TDHA 2K9DA 4MGIE 5ITXA 1VEJA 4AG5A 2VF7A 2KXEA 4LJ8A 1Q3CA 2BNKA 2KZUA 2F5QA 1ZMVA 2L4EA 4LZZA 4R7GA 2K47A 1NNUC 3LMMA 4QNRA 2DXIA 3VK7A 3KSJA 4Z8XA 3FKEA 2Y0TA 1GJSA 4DBGB 4B3TM 4I8OA 2QBYB 1XXHA 2YQZA 2KZSA 3QWLA 5FTKA 4L16A 2J7OA 1OIZA 1PJJA 3BXWA 4JI2M 4LRTA 4GC9A 2L09A 1DO0A 2J5YA 4LJ5A 4IJEA 2FS1A 5ITUA 2F5SA 4DR6M 4F1IA 2QP9X 4GC5A 4LGMA 3I4VA 4LY6A 5DYGA 2QCUA 5GKNA 3TWKA 1BVSA 1PJIA 4DR5M 1S3SA 2DAEA 1YSYA 3DZDA 2QNJA 2XFSA 5ITQA 4IBIA 4AI6A 1FNNA 2KNAA 3HHWA 1N75A 2WSFF 1OKSA 3H4MA 1D0LA 1N36M 2QPAA 2KNVA 1IXRC 2XZFA 1XB2B 3J80S 4LF5M 4JXJA 4FWHA 4R3DA 3F92A 3NBIA 3NBXX 1DGGA 2R6FA 2KRUA 2EA0A 2ZM6M 2DAMA 2ZAMA 4LG2A 1H6UA 1GJTA 2KNZA 1V33A 1NSFA 1EFUB 2EKFA 2VF8A 4OVZA 1TDZA 2A5YB 4XK8F 3UGJA 2F5NA 1R2YA 1E9SA 2KW0A 3GRUA 4LJ7A 5BPVA 1KFVA 4A3VB 1NJGA 8CATA 3U5ZA 4MGKE 4OW0A 1ZMWA 4AZFA 1VDDA 2C98A 2C99A 3MMPA 3EIEA 4B3SM 3FTDA 3WHKA 2EO2A 3ZH9B 1VQ1A 4BBAA 2VQFM 1VDLA 3ZC7B 2XH9A 4M0WA 2ERCA 3FYDA 4JI7M 2RGOA 4KO8A 2KA6B 3L2AA 4JI8M 3FUUA 4HL4A 3RGSA 3GLGA 4G6ZA 2WSEF 2CV1A 3VFDA 2UU9M 1NV8A 2K6BA 3AKZA 3VDPA 1D0MA 1C7YA 3CF6E 2FNAA 3KW6A 4FD2A 3I51A 2V1CA 4DR7M 3GP1A 3AV0A 3JAMS 2Z3XA 4LF6M 2V1UA 4LF7M 3W68A 4JV5M 3FRIA 4X65M 4BLCA 4G3OA 1IXSA 1ZV1A 3B74A 3KP0E 3U6CA 3SAVA 2X4AA 3HY5A 3D8BA 1VEGA 4IBKA 2UXBM 1K3XA 2LH0A 1GKIA 4M9XA 4L15A 5KO3A 3U5ZB 4YHHM 3L29A 3SFZA 3LVVA 4GH9A 5EXXA 4M0DA 3ZQJA 3K2LA 4DV2M 2DKLA 2QBYA 2R44A 4KLNA 1OJLA 3QYEA 2VDBB 3HHYA 1E9RA 3FUVA 3HJSA 4RF1A 4LF4M 2BWBA 1CUKA 1TH4A 2Y20A 3C9PA 3HU3A 4I5SA 1QUSA 4D81A 5FSWA 1L1TA 5FTLA 3W67A 1GABA 1LTMA 3B89A 5JI3E 3E21A 2J7NA 2ZBKB 4DUZM 1A5TA 3AL0C 1L8QA 4Z6YA 3KS8A 1ORYB 3GLHE 3SASA 2LVAA 4S12A 5FTJA 2KDLA 3SMPA 2XLJA 2XSZD 1UFZA 1HQYE 4GKJM 2MH8A 2FE8A 1TR8A 2DZOB 2QZ4A 5IWAM 1RU3A 1V92A 2CFOA 1PM5A 3K92A 4B7FA 1TGUA 3LCVB 1WR1B 3TL4X 4DV5M 4DV0M 2MR9A 2R18A 3GLFE 1D2NA 2L2DA 1QQWA 2D7HA 3FTFA 2HHHM 3UMMA 2DZLA 1G8PA 1L1ZA 3HZJA 4B08A 4CIZA 2DWLA 2UXCM 4CISA 4TUWA 3FRHA 4GITA 1J09A 4I81A 5EQTA 1K82A 3LVWA 1G3IA 1MX0A 2R4JA 3LCUA 3FYCA 3U6PA 3U61B 3B7QA 2JZ1A 4L6V6 4LZJA 3LW5F 2OOBA 1HNXM 1L2BA 4PDGA 2RGHA 5A2QS 1E32A 1NO1A 3CF2A 4MGZE 1QAMA 3FUWA 4NXMM 4M9ZA 1N78A 4G4QA 2VIIA 2W82A 3VDUA 3HGIA 3GPXA 5ITRA 2JA2A
chains in the Genus database with same CATH topology
3GRRA 4L4UA 4FCVA 3PNYA 3GLFB 4LCBA 2ZAOA 3BOSA 3MK6A 2Y0QA 4X66M 4D82A 3U60B 4NRVA 1IQPA 3RE8A 1C1KA 1HT2E 3J27B 1KYIA 2VQEM 1NJFA 3FUXA 4DV3M 4MGYE 3U6MA 4DR1M 4LFAM 2C5RA 5FLXS 2CE7A 5EP2A 2F5OA 4LFBM 1N33M 1N32M 2RKOA 3TWMA 4KODA 2L7HA 2R4EA 2Z7JA 4OU7A 1IM2A 4AG6A 3KS4A 5FTMA 2UUAM 2UXDM 2FOIC 4I4LA 3SARA 5KPRA 3TE6A 3THGA 4JI6M 5C18A 3LQRA 3UJNA 1NVMA 2DVWB 1KSFX 2M60A 4L78A 5IZ7D 3U6DA 1XC8A 3VK8A 3J2PB 3SATA 3K8ZA 1YUBA 4AQYM 2NQ8C 4MH0E 3CF0A 1X37A 3HHZA 1N77A 1IXZA 1IY1A 3CTWB 4DR2M 1G59A 1XWIA 1SXJD 3GQ4A 2E5LM 5KPTA 5LMUM 3T38A 3KSXA 2QENA 1EE8A 3HHXA 4NSRA 1WXQA 4B3MM 4FCWA 4MB7A 4X64M 5EXTA 1IN7A 1IY0A 4LJ9A 4AKIA 3KDSE 1SXJE 4PT5A 1K3WA 1TH2A 3GQ5A 4DV6M 4QHSA 1XNQM 4FCTA 4K0KM 3KOWE 3HJ8A 2Z4RA 1DGHB 2XZUA 1FJGM 2YR0A 5KPZA 5F3WA 1NY5A 4QOSA 3U6LA 4FVMA 3SYLA 4JI3M 1UM8A 2I7NA 4HLQA 1W5TA 1HT1E 5E6JA 3SHGB 4ITQA 3GLIB 2R45A 1QZMA 1MU5A 3KXEC 1IBKM 4FWDA 2CEAA 2DWNA 3GLHA 5ITYA 4JI0M 3L28A 3KOXE 3VKGA 4DR4M 3J81S 4G4NA 4RF0A 3MJ5A 1TH3A 2XEPA 4MGHA 1NNJA 3U61A 1ZAEA 3SMSA 3GRYA 4AW4A 1IY2A 5C1BA 4IBDA 1DO2A 4GIPA 1GLNA 4IBCA 4KHPM 1GVNA 4NXNM 2XSZA 4X62M 1Z5CA 3AJIB 1DGFA 3PXGA 3GLFA 1E94E 1JR3D 3JR5A 3U60A 2X8AA 3Q8XA 4DV4M 2F4VM 1IN6A 1XHBA 1R2ZA 2HKJA 1Z5BA 1LV7A 2Y21A 4BB9A 5H37D 2XFTA 3SC3A 2YFQA 1Z59A 1QVRA 4G4RA 4JI1M 3HWSA 3VKHA 2Z4SA 3I4YA 3GLHB 3MHVC 4W5WA 1GL7A 2C96A 2R65A 1G4AE 4FWGA 4GMQA 3GQ3A 3FD9A 1IN4A 2EUCA 5ITTA 3GRVA 4JYAM 4NL4H 4LJAA 5JI2E 1QANA 3RGPA 4IIWA 2CV0A 5KQ8A 3GPYA 4DV1M 2DWMA 3L27A 4M9SA 2R46A 4D80A 1QYRA 4GKKM 2DZNB 2D7GA 3U6SA 1R7RA 4NOOB 5ITXE 2LWXA 3UZUA 2FFJA 1NHWC 1J7KA 1DGBA 3K1JA 4LFCM 2LXEA 4WW0A 5EP3A 3J7AS 2Q2EB 3AOEA 4B7HA 3VLFB 5EP1A 3FTCA 4LF9M 2BJWA 4PD2A 2H1RA 2CV2A 3RFWA 3W0FA 2KEBA 4QOZC 2X49A 1J5EM 3GO8A 4LJ4A 3SYKA 3KOYE 4IBFA 3T15A 1W5SA 3T1HM 3L25A 4B3RM 1DGHA 3EIHA 3J7BA 4RNAA 3AOEC 3PNVA 3GPPA 5DYIA 1QAOA 5EJCA 3KFUG 3ZCBB 3M0EA 3GPUA 2UUCM 3SHFA 2L6OA 4NSOB 1XNRM 2F5PA 5DNYA 4CHTB 2I7PA 3LQQA 3GLIA 3A46A 4JN6A 1T3TA 2P5TA 1I94M 1L2CA 3SAUA 1SXJA 1XXHB 2G8LA 1Q39A 2R62A 3D8LA 4IBEA 2XF3A 4NRWA 2OQ4A 2CHGA 1OFHA 3OTOM 3L26A 4DV7M 3E4RA 4G4OA 4AKHA 1Z6TA 4CGYB 2G5GX 2O5RA 3W0LB 3FTEA 3DA1A 3A98B 3E9SA 2HL7A 2OPFA 4EIWA 4QNMA 4FW9A 1G41A 4DR3M 4PCZA 1HR0M 1SXJC 4PDIA 3TWLA 1IBLM 2UUBM 1XMOM 3HJQA 3U6EA 4XGIA 5EXPA 2CUZA 3KVWA 4B7GA 1Z5AA 5BR8M 5IREB 2D7EA 3JR4A 2CHVA 3HU2A 3AOGA 3TQSA 3A42A 4GRIA 3KOZE 2ZANA 5IT9S 2DWZB 5EXSA 3B9PA 3UK6A 2V6ZM 3U6QA 2YNMD 1NHGC 3M6AA 2C9CA 1I4WA 4IBGA 1SXJB 4DUYM 4OVZB 4ZPXA 1Q3BA 3QAUA 3R9XB 3DOAA 4JI4M 4P16A 1JQJC 4IBBA 4WURA 3DFZA 4IJFA 7CATA 4LF8M 5EP4A 3IG5A 4REZA 2KRKA 2C9OA 5KQDA 3PVSA 5E26A 1XMQM 3A45A 1OFIA 1NY6A 5LMNM 3IG8A 4LJ6A 5FTNA 3SAWA 4LRSA 1IBMM 1IN8A 3M7GA 1IN5A 1JR3A 4IBJA 3SBJA 3C58A 2L7IA 3R8FA 1ZQ9A 3KP1E 4AKGA 4YY3M 4II7A 3ILKA 2CHQA 3NWLA 2LNHC 2XGNA 4GHAA 4QHTA 1HNWM 3AFHA 3T1YM 4JI5M 1R6BX 2BJVA 3FUTA 3GLGB 1QAQA 4GHLA 2HCBA 3TPZA 4OX9M 4LGYA 4L8RC 3HKPA 3HU1A 4MM3B 3WHLA 2AHMA 1L2DA 2M5ZA 1IXSB 1GL6A 1HNZM 4XBOA 1HQCA 1N34M 2DHRA 3U6OA 1YE9A 3PFIA 1TDHA 4MGIE 5ITXA 4AG5A 2KXEA 4LJ8A 1Q3CA 2BNKA 2KZUA 2F5QA 4LZZA 4R7GA 2K47A 1NNUC 3LMMA 4QNRA 2DXIA 3VK7A 3KSJA 4Z8XA 3FKEA 2Y0TA 4B3TM 4I8OA 2QBYB 1XXHA 2YQZA 2KZSA 3QWLA 5FTKA 4L16A 2J7OA 1PJJA 4JI2M 4LRTA 4GC9A 2L09A 1DO0A 4LJ5A 4IJEA 5ITUA 2F5SA 4DR6M 2QP9X 4GC5A 4LGMA 3I4VA 4LY6A 5DYGA 2QCUA 5GKNA 3TWKA 1PJIA 4DR5M 1S3SA 3DZDA 1YSYA 2XFSA 5ITQA 4IBIA 4AI6A 1FNNA 3HHWA 1N75A 3H4MA 1N36M 2QPAA 1IXRC 2XZFA 3J80S 4LF5M 4JXJA 4FWHA 4R3DA 3NBIA 1DGGA 2KRUA 2EA0A 2ZM6M 4LG2A 2ZAMA 1H6UA 4OVZA 1NSFA 1TDZA 2A5YB 3UGJA 2F5NA 1R2YA 1E9SA 2KW0A 3GRUA 4LJ7A 5BPVA 1KFVA 4A3VB 1NJGA 8CATA 3U5ZA 4MGKE 4OW0A 4AZFA 1VDDA 2C98A 2C99A 3EIEA 4B3SM 3FTDA 3WHKA 2EO2A 3ZH9B 4BBAA 2VQFM 3ZC7B 2XH9A 4M0WA 2ERCA 3FYDA 4JI7M 2RGOA 4KO8A 2KA6B 3L2AA 4JI8M 3FUUA 4HL4A 3RGSA 3GLGA 4G6ZA 2CV1A 3VFDA 2UU9M 3AKZA 3VDPA 3CF6E 2FNAA 3KW6A 4FD2A 3I51A 2V1CA 4DR7M 3GP1A 3AV0A 3JAMS 2Z3XA 4LF6M 2V1UA 4LF7M 4JV5M 4X65M 4BLCA 3KP0E 3U6CA 3SAVA 2X4AA 3D8BA 4IBKA 2UXBM 1K3XA 2LH0A 1GKIA 4M9XA 4L15A 5KO3A 3U5ZB 4YHHM 3L29A 3SFZA 3LVVA 4GH9A 5EXXA 4M0DA 3K2LA 4DV2M 2QBYA 4KLNA 1OJLA 3HHYA 1E9RA 3FUVA 3HJSA 4RF1A 4LF4M 2Y20A 3HU3A 1TH4A 4I5SA 1L1TA 4D81A 5FSWA 5FTLA 5JI3E 2J7NA 2ZBKB 4DUZM 3AL0C 3KS8A 1L8QA 4Z6YA 1ORYB 3SASA 4S12A 5FTJA 3SMPA 2XLJA 2XSZD 1HQYE 4GKJM 2FE8A 2QZ4A 2DZOB 5IWAM 2CFOA 1PM5A 3K92A 4B7FA 1TGUA 3TL4X 4DV5M 4DV0M 2R18A 1D2NA 1QQWA 2D7HA 3FTFA 2HHHM 3UMMA 1G8PA 1L1ZA 4B08A 2DWLA 2UXCM 4CISA 4TUWA 4GITA 1J09A 4I81A 5EQTA 1K82A 3LVWA 1G3IA 1MX0A 2R4JA 3U6PA 3FYCA 3U61B 4LZJA 1HNXM 1L2BA 4PDGA 2RGHA 5A2QS 1E32A 3CF2A 4MGZE 1QAMA 3FUWA 4NXMM 4M9ZA 1N78A 4G4QA 2VIIA 2W82A 3VDUA 3HGIA 3GPXA 5ITRA 2JA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY M;  1Q3B A;  3DOA A;  1Z59 A;  4X66 M;  4JI4 M;  4NRV A;  4G4R A;  4JI1 M;  4LF8 M;  4B3S M;  2VQE M;  2VQF M;  4DV3 M;  3GQ3 A;  3U6M A;  4DR1 M;  3A45 A;  1XMQ M;  4LFA M;  5FLX S;  5LMN M;  4JI7 M;  2F5O A;  4LFB M;  5ITT A;  4JYA M;  1N32 M;  1N33 M;  3SAW A;  2HKJ A;  4JI8 M;  1IBM M;  3TWM A;  3SBJ A;  3C58 A;  3GPY A;  4DV1 M;  2UU9 M;  4YY3 M;  2UUA M;  2UXD M;  3SAR A;  4JI6 M;  4DR7 M;  1HNW M;  3GP1 A;  3T1Y M;  4JI5 M;  4GKK M;  3JAM S;  4LF6 M;  4LF7 M;  3U6S A;  4JV5 M;  1XC8 A;  5ITX E;  4X65 M;  3U6D A;  4OX9 M;  3VK8 A;  3U6C A;  3SAV A;  3SAT A;  4LFC M;  3J7A S;  2Q2E B;  2UXB M;  4AQY M;  1K3X A;  4DR2 M;  4YHH M;  1L2D A;  2E5L M;  3GQ4 A;  4LF9 M;  4PD2 A;  5LMU M;  1HNZ M;  1N34 M;  3W0F A;  1EE8 A;  3U6O A;  1J5E M;  1TDH A;  5ITX A;  4B3M M;  3GO8 A;  4DV2 M;  4MB7 A;  3T1H M;  4B3R M;  1Q3C A;  4X64 M;  2F5Q A;  4LF4 M;  3GPP A;  1K3W A;  1L1T A;  3VK7 A;  3GQ5 A;  4DV6 M;  1XNQ M;  4K0K M;  3GPU A;  2UUC M;  4B3T M;  1XNR M;  2F5P A;  2ZBK B;  4DUZ M;  2XZU A;  1FJG M;  3A46 A;  1PJJ A;  3SAS A;  4JI2 M;  3U6L A;  1I94 M;  1L2C A;  4JI3 M;  3SAU A;  5ITU A;  2F5S A;  4DR6 M;  4GKJ M;  1Q39 A;  4NRW A;  2OQ4 A;  3OTO M;  5IWA M;  4DV7 M;  4ITQ A;  4G4O A;  1MU5 A;  1PM5 A;  1IBK M;  2OPF A;  3TWK A;  5ITY A;  4JI0 M;  1PJI A;  4DR5 M;  4DR4 M;  4DV5 M;  4DV0 M;  3J81 S;  4PCZ A;  4G4N A;  5ITQ A;  4DR3 M;  1HR0 M;  4PDI A;  1NNJ A;  3TWL A;  1IBL M;  2UUB M;  2HHH M;  1XMO M;  1N36 M;  3U6E A;  1L1Z A;  2XZF A;  3J80 S;  2UXC M;  4CIS A;  5BR8 M;  1Z5A A;  4LF5 M;  1K82 A;  1MX0 A;  3JR4 A;  4NXN M;  4X62 M;  3U6P A;  1Z5C A;  4KHP M;  2EA0 A;  2ZM6 M;  3A42 A;  1TDZ A;  1HNX M;  1L2B A;  4PDG A;  3JR5 A;  5A2Q S;  5IT9 S;  2F5N A;  1R2Y A;  4DV4 M;  3U6Q A;  4NXM M;  2F4V M;  1KFV A;  4G4Q A;  1R2Z A;  3GPX A;  5ITR A;  1Z5B A; 
#chains in the Genus database with same CATH topology
 3C3E A;  3GRR A;  4L4U A;  4FCV A;  3PNY A;  3GLF B;  1HJP A;  2ZAO A;  3BOS A;  2O25 A;  2B3T A;  3MK6 A;  2L4F A;  2Y0Q A;  3E46 A;  4LCB A;  4X66 M;  2JY7 A;  4NRV A;  4D82 A;  3I01 M;  3U60 B;  1IQP A;  3RE8 A;  1C1K A;  1HT2 E;  2R0I A;  3J27 B;  1KYI A;  2VQE M;  1NJF A;  3FUX A;  1PJT A;  4DV3 M;  4MGY E;  3U6M A;  4DR1 M;  4LFA M;  2C5R A;  5FLX S;  2CE7 A;  5EP2 A;  2F5O A;  2LVQ D;  4LFB M;  1N33 M;  1N32 M;  2HAK A;  2RKO A;  1PRB A;  1AIP C;  3TWM A;  4KOD A;  2L7H A;  2R4E A;  2Z7J A;  4OU7 A;  4NC6 A;  1IM2 A;  1OAO C;  4AG6 A;  3KS4 A;  5FTM A;  2ZTD A;  2UUA M;  2UXD M;  2FOI C;  4I4L A;  2ZTC A;  3SAR A;  2OOA A;  5KPR A;  3TE6 A;  2KHH A;  3THG A;  4JI6 M;  5C18 A;  1NV9 A;  2APL A;  2JXN A;  1NVM A;  2DEN A;  3LQR A;  3UJN A;  2G3Q A;  1OIP A;  1DV0 A;  2DVW B;  1KSF X;  2M60 A;  4L78 A;  5IZ7 D;  3U6D A;  1XC8 A;  2QSF X;  3VK8 A;  3J2P B;  3SAT A;  3K8Z A;  2DAK A;  1D0K A;  1YUB A;  4AQY M;  2NQ8 C;  5L8R F;  4MH0 E;  3CF0 A;  1X37 A;  3HHZ A;  1N77 A;  1IXZ A;  1VEK A;  1IY1 A;  3CTW B;  4DR2 M;  1G59 A;  1XWI A;  1SXJ D;  3GQ4 A;  2E5L M;  5KPT A;  5LMU M;  3T38 A;  1T6O A;  3KSX A;  2QEN A;  1EE8 A;  3HHX A;  4NSR A;  1WXQ A;  2QHO B;  4B3M M;  1JB0 F;  4FCW A;  3GLI E;  4MB7 A;  4X64 M;  4HEO A;  5EXT A;  1IN7 A;  4P17 A;  1Q02 A;  1IY0 A;  4LJ9 A;  4AKI A;  3KDS E;  1SXJ E;  4PT5 A;  1MJG M;  1TH2 A;  1K3W A;  1V34 A;  3GQ5 A;  2JY6 B;  4DV6 M;  4QHS A;  1XNQ M;  4FCT A;  4K0K M;  3KOW E;  1PJQ A;  3HJ8 A;  2Z4R A;  1DGH B;  1P3Q Q;  2XZU A;  1FJG M;  2YR0 A;  5KPZ A;  1QDR A;  5F3W A;  1NY5 A;  4QOS A;  3U6L A;  4FVM A;  3SYL A;  4JI3 M;  1UM8 A;  2I7N A;  4HLQ A;  2JY5 A;  1W5T A;  3BBZ A;  1HT1 E;  5E6J A;  3SHG B;  4ITQ A;  3GLI B;  2R45 A;  4CJ6 A;  1QZM A;  1MU5 A;  3KXE C;  1IBK M;  4FWD A;  2CEA A;  4ANR A;  2DWN A;  3GLH A;  5ITY A;  4JI0 M;  3L28 A;  3KOX E;  3VKG A;  3HX3 A;  4DR4 M;  3J81 S;  4G4N A;  4RF0 A;  3MJ5 A;  1TH3 A;  2XEP A;  4MGH A;  1NNJ A;  3U61 A;  1ZAE A;  3SMS A;  3GRY A;  4AW4 A;  1IY2 A;  1QDT A;  1QZE A;  2RRU A;  4IBD A;  5C1B A;  1DO2 A;  4GIP A;  1GLN A;  2JY8 A;  4IBC A;  4KHP M;  1GVN A;  4NXN M;  2XSZ A;  4X62 M;  1Z5C A;  2FH0 A;  2JWS A;  1ZMU A;  1R5L A;  3AJI B;  1DGF A;  3PXG A;  3GLF A;  1E94 E;  1JR3 D;  3JR5 A;  3U60 A;  2X8A A;  3Q8X A;  4DV4 M;  2LHG A;  2JP7 A;  2F4V M;  1IN6 A;  1F4I A;  1R4G A;  1XHB A;  1R2Z A;  3K9O A;  2HKJ A;  1Z5B A;  1LV7 A;  2Y21 A;  4UN2 B;  4BB9 A;  5H37 D;  2XFT A;  3SC3 A;  2MGW A;  2YFQ A;  1Z59 A;  1QVR A;  1JR3 E;  1WIV A;  4G4R A;  4JI1 M;  2LHC A;  3HWS A;  3VKH A;  2Z4S A;  3I4Y A;  3GLH B;  3MHV C;  4W5W A;  1GL7 A;  2C96 A;  2R65 A;  1G4A E;  3IHP A;  4FWG A;  3Q8G A;  4GMQ A;  3GQ3 A;  3FD9 A;  3FE3 A;  2MJ5 B;  1IN4 A;  2EUC A;  5ITT A;  3GRV A;  4JYA M;  4NL4 H;  4LJA A;  5JI2 E;  3IEC A;  1QAN A;  1IFY A;  3RGP A;  1QUT A;  4IIW A;  2CV0 A;  3K9P A;  5KQ8 A;  2JZ0 A;  3GPY A;  4DV1 M;  2K0B X;  2DWM A;  2BWE A;  3L27 A;  4M9S A;  1TTE A;  4F2L A;  2R46 A;  4D80 A;  1QYR A;  4GKK M;  2DZN B;  2D7G A;  3U6S A;  2CRU A;  1R7R A;  2QQ8 A;  4NOO B;  5ITX E;  2LWX A;  3UZU A;  2FFJ A;  1NHW C;  1J7K A;  1DGB A;  3K1J A;  4LFC M;  2LXE A;  4WW0 A;  5EP3 A;  4RKU F;  3J7A S;  2Q2E B;  2WZJ A;  3AOE A;  2GNO A;  3T6P A;  4B7H A;  1AUA A;  1GO5 A;  3VLF B;  5EP1 A;  3FTC A;  4LF9 M;  2BJW A;  4PD2 A;  2H1R A;  2CV2 A;  3RFW A;  1XXH E;  2KEB A;  3W0F A;  4QOZ C;  2X49 A;  1J5E M;  3GO8 A;  1VG5 A;  2EJS A;  3B7N A;  3KOY E;  4IBF A;  4LJ4 A;  3SYK A;  3T15 A;  1W5S A;  3T1H M;  3L25 A;  4B3R M;  1DGH A;  3EIH A;  1T43 A;  3J7B A;  4RNA A;  3AOE C;  3PNV A;  3V76 A;  3GPP A;  1MN3 A;  5DYI A;  1QAO A;  5EJC A;  2WSC F;  3KFU G;  1Y8G A;  3ZCB B;  1WGN A;  3M0E A;  1PGY A;  3GPU A;  2UUC M;  3SHF A;  2L6O A;  4NSO B;  1XNR M;  2F5P A;  5DNY A;  4CHT B;  2I7P A;  3LQQ A;  3GLI A;  3A46 A;  2O01 F;  3CGW A;  4JN6 A;  2DAI A;  1T3T A;  2H5X A;  2P5T A;  1I94 M;  1OAI A;  2JUJ A;  1L2C A;  3SAU A;  2LVP C;  1SXJ A;  1OTR A;  4KT0 F;  1XXH B;  2G8L A;  1Q39 A;  2R62 A;  3D8L A;  4IBE A;  2XF3 A;  4NRW A;  2OQ4 A;  2CHG A;  1EIJ A;  1OFH A;  3OTO M;  3L26 A;  4DV7 M;  3E4R A;  2DNA A;  4G4O A;  4AKH A;  1Z6T A;  4CGY B;  2G5G X;  2O5R A;  3W0L B;  3FTE A;  3DA1 A;  3A98 B;  3E9S A;  2HL7 A;  2OPF A;  2CWB A;  4EIW A;  4QNM A;  1SG9 A;  4FW9 A;  1G41 A;  4DR3 M;  4PCZ A;  1HR0 M;  1SXJ C;  2HWJ A;  4PDI A;  2DI0 A;  2N35 A;  3TWL A;  1IBL M;  2UUB M;  2DAG A;  1XMO M;  3HJQ A;  3U6E A;  2Z8Y M;  2CP8 A;  1PJS A;  2DHY A;  4XGI A;  5EXP A;  3B7Z A;  2CUZ A;  3KVW A;  4B7G A;  1Z5A A;  5BR8 M;  5IRE B;  2D7E A;  2LBC A;  3JR4 A;  2CHV A;  1G71 A;  3AOG A;  3HU2 A;  3TQS A;  3A42 A;  4GRI A;  3KOZ E;  2ZAN A;  5DFL A;  5IT9 S;  2DWZ B;  5EXS A;  3B9P A;  3UK6 A;  2V6Z M;  3U6Q A;  2YNM D;  1NHG C;  3M6A A;  2C9C A;  1I4W A;  2LVO C;  4IBG A;  2LVN C;  1SXJ B;  4DUY M;  4OVZ B;  4ZPX A;  1Q3B A;  3QAU A;  3R9X B;  3DOA A;  4JI4 M;  3GLG E;  3H4J A;  4P16 A;  1JQJ C;  4IBB A;  4WUR A;  1OQY A;  3DFZ A;  4IJF A;  7CAT A;  4LF8 M;  5EP4 A;  3IG5 A;  3I04 M;  2KRK A;  2C9O A;  4REZ A;  5KQD A;  3PVS A;  5E26 A;  1XMQ M;  1YLA A;  3A45 A;  1OFI A;  1NY6 A;  5LMN M;  2JNH A;  3IG8 A;  4LJ6 A;  2LTU A;  5FTN A;  3SAW A;  4LRS A;  1IBM M;  1IN8 A;  3M7G A;  1IN5 A;  1JR3 A;  4IBJ A;  3SBJ A;  3C58 A;  2L7I A;  3R8F A;  1ZQ9 A;  3KP1 E;  4AKG A;  4YY3 M;  4II7 A;  4Q7J A;  3ILK A;  2CHQ A;  3QYB A;  3NWL A;  4Y28 F;  1TF0 B;  2LNH C;  2XGN A;  4GHA A;  4QHT A;  1HNW M;  3AFH A;  3C3D A;  3T1Y M;  4JI5 M;  1R6B X;  2BJV A;  3FUT A;  3GLG B;  4WP2 A;  1WGL A;  1QAQ A;  4GHL A;  2HCB A;  3TPZ A;  2EKK A;  4OX9 M;  4LGY A;  4L8R C;  1WHC A;  1WJ7 A;  3HKP A;  2OO9 A;  3HU1 A;  4MM3 B;  3WHL A;  2AHM A;  1L2D A;  2M5Z A;  1IXS B;  1GL6 A;  4GEW A;  4R71 A;  4XBO A;  1HQC A;  1N34 M;  2DHR A;  1HNZ M;  3U6O A;  1YE9 A;  3PFI A;  2GQF A;  2MRO B;  1TDH A;  2K9D A;  4MGI E;  5ITX A;  1VEJ A;  4AG5 A;  2VF7 A;  2KXE A;  4LJ8 A;  1Q3C A;  2BNK A;  2KZU A;  2F5Q A;  1ZMV A;  2L4E A;  4LZZ A;  4R7G A;  2K47 A;  1NNU C;  3LMM A;  4QNR A;  2DXI A;  3VK7 A;  3KSJ A;  4Z8X A;  3FKE A;  2Y0T A;  1GJS A;  4DBG B;  4B3T M;  4I8O A;  2QBY B;  1XXH A;  2YQZ A;  2KZS A;  3QWL A;  5FTK A;  4L16 A;  2J7O A;  1OIZ A;  1PJJ A;  3BXW A;  4JI2 M;  4LRT A;  4GC9 A;  2L09 A;  1DO0 A;  2J5Y A;  4LJ5 A;  4IJE A;  2FS1 A;  5ITU A;  2F5S A;  4DR6 M;  4F1I A;  2QP9 X;  4GC5 A;  4LGM A;  3I4V A;  4LY6 A;  5DYG A;  2QCU A;  5GKN A;  3TWK A;  1BVS A;  1PJI A;  4DR5 M;  1S3S A;  2DAE A;  1YSY A;  3DZD A;  2QNJ A;  2XFS A;  5ITQ A;  4IBI A;  4AI6 A;  1FNN A;  2KNA A;  3HHW A;  1N75 A;  2WSF F;  1OKS A;  3H4M A;  1D0L A;  1N36 M;  2QPA A;  2KNV A;  1IXR C;  2XZF A;  1XB2 B;  3J80 S;  4LF5 M;  4JXJ A;  4FWH A;  4R3D A;  3F92 A;  3NBI A;  3NBX X;  1DGG A;  2R6F A;  2KRU A;  2EA0 A;  2ZM6 M;  2DAM A;  2ZAM A;  4LG2 A;  1H6U A;  1GJT A;  2KNZ A;  1V33 A;  1NSF A;  1EFU B;  2EKF A;  2VF8 A;  4OVZ A;  1TDZ A;  2A5Y B;  4XK8 F;  3UGJ A;  2F5N A;  1R2Y A;  1E9S A;  2KW0 A;  3GRU A;  4LJ7 A;  5BPV A;  1KFV A;  4A3V B;  1NJG A;  8CAT A;  3U5Z A;  4MGK E;  4OW0 A;  1ZMW A;  4AZF A;  1VDD A;  2C98 A;  2C99 A;  3MMP A;  3EIE A;  4B3S M;  3FTD A;  3WHK A;  2EO2 A;  3ZH9 B;  1VQ1 A;  4BBA A;  2VQF M;  1VDL A;  3ZC7 B;  2XH9 A;  4M0W A;  2ERC A;  3FYD A;  4JI7 M;  2RGO A;  4KO8 A;  2KA6 B;  3L2A A;  4JI8 M;  3FUU A;  4HL4 A;  3RGS A;  3GLG A;  4G6Z A;  2WSE F;  2CV1 A;  3VFD A;  2UU9 M;  1NV8 A;  2K6B A;  3AKZ A;  3VDP A;  1D0M A;  1C7Y A;  3CF6 E;  2FNA A;  3KW6 A;  4FD2 A;  3I51 A;  2V1C A;  4DR7 M;  3GP1 A;  3AV0 A;  3JAM S;  2Z3X A;  4LF6 M;  2V1U A;  4LF7 M;  3W68 A;  4JV5 M;  3FRI A;  4X65 M;  4BLC A;  4G3O A;  1IXS A;  1ZV1 A;  3B74 A;  3KP0 E;  3U6C A;  3SAV A;  2X4A A;  3HY5 A;  3D8B A;  1VEG A;  4IBK A;  2UXB M;  1K3X A;  2LH0 A;  1GKI A;  4M9X A;  4L15 A;  5KO3 A;  3U5Z B;  4YHH M;  3L29 A;  3SFZ A;  3LVV A;  4GH9 A;  5EXX A;  4M0D A;  3ZQJ A;  3K2L A;  4DV2 M;  2DKL A;  2QBY A;  2R44 A;  4KLN A;  1OJL A;  3QYE A;  2VDB B;  3HHY A;  1E9R A;  3FUV A;  3HJS A;  4RF1 A;  4LF4 M;  2BWB A;  1CUK A;  1TH4 A;  2Y20 A;  3C9P A;  3HU3 A;  4I5S A;  1QUS A;  4D81 A;  5FSW A;  1L1T A;  5FTL A;  3W67 A;  1GAB A;  1LTM A;  3B89 A;  5JI3 E;  3E21 A;  2J7N A;  2ZBK B;  4DUZ M;  1A5T A;  3AL0 C;  1L8Q A;  4Z6Y A;  3KS8 A;  1ORY B;  3GLH E;  3SAS A;  2LVA A;  4S12 A;  5FTJ A;  2KDL A;  3SMP A;  2XLJ A;  2XSZ D;  1UFZ A;  1HQY E;  4GKJ M;  2MH8 A;  2FE8 A;  1TR8 A;  2DZO B;  2QZ4 A;  5IWA M;  1RU3 A;  1V92 A;  2CFO A;  1PM5 A;  3K92 A;  4B7F A;  1TGU A;  3LCV B;  1WR1 B;  3TL4 X;  4DV5 M;  4DV0 M;  2MR9 A;  2R18 A;  3GLF E;  1D2N A;  2L2D A;  1QQW A;  2D7H A;  3FTF A;  2HHH M;  3UMM A;  2DZL A;  1G8P A;  1L1Z A;  3HZJ A;  4B08 A;  4CIZ A;  2DWL A;  2UXC M;  4CIS A;  4TUW A;  3FRH A;  4GIT A;  1J09 A;  4I81 A;  5EQT A;  1K82 A;  3LVW A;  1G3I A;  1MX0 A;  2R4J A;  3LCU A;  3FYC A;  3U6P A;  3U61 B;  3B7Q A;  2JZ1 A;  4L6V 6;  4LZJ A;  3LW5 F;  2OOB A;  1HNX M;  1L2B A;  4PDG A;  2RGH A;  5A2Q S;  1E32 A;  1NO1 A;  3CF2 A;  4MGZ E;  1QAM A;  3FUW A;  4NXM M;  4M9Z A;  1N78 A;  4G4Q A;  2VII A;  2W82 A;  3VDU A;  3HGI A;  3GPX A;  5ITR A;  2JA2 A; 
#chains in the Genus database with same CATH homology
 3GRR A;  4L4U A;  4FCV A;  3PNY A;  3GLF B;  4LCB A;  2ZAO A;  3BOS A;  3MK6 A;  2Y0Q A;  4X66 M;  4D82 A;  3U60 B;  4NRV A;  1IQP A;  3RE8 A;  1C1K A;  1HT2 E;  3J27 B;  1KYI A;  2VQE M;  1NJF A;  3FUX A;  4DV3 M;  4MGY E;  3U6M A;  4DR1 M;  4LFA M;  2C5R A;  5FLX S;  2CE7 A;  5EP2 A;  2F5O A;  4LFB M;  1N33 M;  1N32 M;  2RKO A;  3TWM A;  4KOD A;  2L7H A;  2R4E A;  2Z7J A;  4OU7 A;  1IM2 A;  4AG6 A;  3KS4 A;  5FTM A;  2UUA M;  2UXD M;  2FOI C;  4I4L A;  3SAR A;  5KPR A;  3TE6 A;  3THG A;  4JI6 M;  5C18 A;  3LQR A;  3UJN A;  1NVM A;  2DVW B;  1KSF X;  2M60 A;  4L78 A;  5IZ7 D;  3U6D A;  1XC8 A;  3VK8 A;  3J2P B;  3SAT A;  3K8Z A;  1YUB A;  4AQY M;  2NQ8 C;  4MH0 E;  3CF0 A;  1X37 A;  3HHZ A;  1N77 A;  1IXZ A;  1IY1 A;  3CTW B;  4DR2 M;  1G59 A;  1XWI A;  1SXJ D;  3GQ4 A;  2E5L M;  5KPT A;  5LMU M;  3T38 A;  3KSX A;  2QEN A;  1EE8 A;  3HHX A;  4NSR A;  1WXQ A;  4B3M M;  4FCW A;  4MB7 A;  4X64 M;  5EXT A;  1IN7 A;  1IY0 A;  4LJ9 A;  4AKI A;  3KDS E;  1SXJ E;  4PT5 A;  1K3W A;  1TH2 A;  3GQ5 A;  4DV6 M;  4QHS A;  1XNQ M;  4FCT A;  4K0K M;  3KOW E;  3HJ8 A;  2Z4R A;  1DGH B;  2XZU A;  1FJG M;  2YR0 A;  5KPZ A;  5F3W A;  1NY5 A;  4QOS A;  3U6L A;  4FVM A;  3SYL A;  4JI3 M;  1UM8 A;  2I7N A;  4HLQ A;  1W5T A;  1HT1 E;  5E6J A;  3SHG B;  4ITQ A;  3GLI B;  2R45 A;  1QZM A;  1MU5 A;  3KXE C;  1IBK M;  4FWD A;  2CEA A;  2DWN A;  3GLH A;  5ITY A;  4JI0 M;  3L28 A;  3KOX E;  3VKG A;  4DR4 M;  3J81 S;  4G4N A;  4RF0 A;  3MJ5 A;  1TH3 A;  2XEP A;  4MGH A;  1NNJ A;  3U61 A;  1ZAE A;  3SMS A;  3GRY A;  4AW4 A;  1IY2 A;  5C1B A;  4IBD A;  1DO2 A;  4GIP A;  1GLN A;  4IBC A;  4KHP M;  1GVN A;  4NXN M;  2XSZ A;  4X62 M;  1Z5C A;  3AJI B;  1DGF A;  3PXG A;  3GLF A;  1E94 E;  1JR3 D;  3JR5 A;  3U60 A;  2X8A A;  3Q8X A;  4DV4 M;  2F4V M;  1IN6 A;  1XHB A;  1R2Z A;  2HKJ A;  1Z5B A;  1LV7 A;  2Y21 A;  4BB9 A;  5H37 D;  2XFT A;  3SC3 A;  2YFQ A;  1Z59 A;  1QVR A;  4G4R A;  4JI1 M;  3HWS A;  3VKH A;  2Z4S A;  3I4Y A;  3GLH B;  3MHV C;  4W5W A;  1GL7 A;  2C96 A;  2R65 A;  1G4A E;  4FWG A;  4GMQ A;  3GQ3 A;  3FD9 A;  1IN4 A;  2EUC A;  5ITT A;  3GRV A;  4JYA M;  4NL4 H;  4LJA A;  5JI2 E;  1QAN A;  3RGP A;  4IIW A;  2CV0 A;  5KQ8 A;  3GPY A;  4DV1 M;  2DWM A;  3L27 A;  4M9S A;  2R46 A;  4D80 A;  1QYR A;  4GKK M;  2DZN B;  2D7G A;  3U6S A;  1R7R A;  4NOO B;  5ITX E;  2LWX A;  3UZU A;  2FFJ A;  1NHW C;  1J7K A;  1DGB A;  3K1J A;  4LFC M;  2LXE A;  4WW0 A;  5EP3 A;  3J7A S;  2Q2E B;  3AOE A;  4B7H A;  3VLF B;  5EP1 A;  3FTC A;  4LF9 M;  2BJW A;  4PD2 A;  2H1R A;  2CV2 A;  3RFW A;  3W0F A;  2KEB A;  4QOZ C;  2X49 A;  1J5E M;  3GO8 A;  4LJ4 A;  3SYK A;  3KOY E;  4IBF A;  3T15 A;  1W5S A;  3T1H M;  3L25 A;  4B3R M;  1DGH A;  3EIH A;  3J7B A;  4RNA A;  3AOE C;  3PNV A;  3GPP A;  5DYI A;  1QAO A;  5EJC A;  3KFU G;  3ZCB B;  3M0E A;  3GPU A;  2UUC M;  3SHF A;  2L6O A;  4NSO B;  1XNR M;  2F5P A;  5DNY A;  4CHT B;  2I7P A;  3LQQ A;  3GLI A;  3A46 A;  4JN6 A;  1T3T A;  2P5T A;  1I94 M;  1L2C A;  3SAU A;  1SXJ A;  1XXH B;  2G8L A;  1Q39 A;  2R62 A;  3D8L A;  4IBE A;  2XF3 A;  4NRW A;  2OQ4 A;  2CHG A;  1OFH A;  3OTO M;  3L26 A;  4DV7 M;  3E4R A;  4G4O A;  4AKH A;  1Z6T A;  4CGY B;  2G5G X;  2O5R A;  3W0L B;  3FTE A;  3DA1 A;  3A98 B;  3E9S A;  2HL7 A;  2OPF A;  4EIW A;  4QNM A;  4FW9 A;  1G41 A;  4DR3 M;  4PCZ A;  1HR0 M;  1SXJ C;  4PDI A;  3TWL A;  1IBL M;  2UUB M;  1XMO M;  3HJQ A;  3U6E A;  4XGI A;  5EXP A;  2CUZ A;  3KVW A;  4B7G A;  1Z5A A;  5BR8 M;  5IRE B;  2D7E A;  3JR4 A;  2CHV A;  3HU2 A;  3AOG A;  3TQS A;  3A42 A;  4GRI A;  3KOZ E;  2ZAN A;  5IT9 S;  2DWZ B;  5EXS A;  3B9P A;  3UK6 A;  2V6Z M;  3U6Q A;  2YNM D;  1NHG C;  3M6A A;  2C9C A;  1I4W A;  4IBG A;  1SXJ B;  4DUY M;  4OVZ B;  4ZPX A;  1Q3B A;  3QAU A;  3R9X B;  3DOA A;  4JI4 M;  4P16 A;  1JQJ C;  4IBB A;  4WUR A;  3DFZ A;  4IJF A;  7CAT A;  4LF8 M;  5EP4 A;  3IG5 A;  4REZ A;  2KRK A;  2C9O A;  5KQD A;  3PVS A;  5E26 A;  1XMQ M;  3A45 A;  1OFI A;  1NY6 A;  5LMN M;  3IG8 A;  4LJ6 A;  5FTN A;  3SAW A;  4LRS A;  1IBM M;  1IN8 A;  3M7G A;  1IN5 A;  1JR3 A;  4IBJ A;  3SBJ A;  3C58 A;  2L7I A;  3R8F A;  1ZQ9 A;  3KP1 E;  4AKG A;  4YY3 M;  4II7 A;  3ILK A;  2CHQ A;  3NWL A;  2LNH C;  2XGN A;  4GHA A;  4QHT A;  1HNW M;  3AFH A;  3T1Y M;  4JI5 M;  1R6B X;  2BJV A;  3FUT A;  3GLG B;  1QAQ A;  4GHL A;  2HCB A;  3TPZ A;  4OX9 M;  4LGY A;  4L8R C;  3HKP A;  3HU1 A;  4MM3 B;  3WHL A;  2AHM A;  1L2D A;  2M5Z A;  1IXS B;  1GL6 A;  1HNZ M;  4XBO A;  1HQC A;  1N34 M;  2DHR A;  3U6O A;  1YE9 A;  3PFI A;  1TDH A;  4MGI E;  5ITX A;  4AG5 A;  2KXE A;  4LJ8 A;  1Q3C A;  2BNK A;  2KZU A;  2F5Q A;  4LZZ A;  4R7G A;  2K47 A;  1NNU C;  3LMM A;  4QNR A;  2DXI A;  3VK7 A;  3KSJ A;  4Z8X A;  3FKE A;  2Y0T A;  4B3T M;  4I8O A;  2QBY B;  1XXH A;  2YQZ A;  2KZS A;  3QWL A;  5FTK A;  4L16 A;  2J7O A;  1PJJ A;  4JI2 M;  4LRT A;  4GC9 A;  2L09 A;  1DO0 A;  4LJ5 A;  4IJE A;  5ITU A;  2F5S A;  4DR6 M;  2QP9 X;  4GC5 A;  4LGM A;  3I4V A;  4LY6 A;  5DYG A;  2QCU A;  5GKN A;  3TWK A;  1PJI A;  4DR5 M;  1S3S A;  3DZD A;  1YSY A;  2XFS A;  5ITQ A;  4IBI A;  4AI6 A;  1FNN A;  3HHW A;  1N75 A;  3H4M A;  1N36 M;  2QPA A;  1IXR C;  2XZF A;  3J80 S;  4LF5 M;  4JXJ A;  4FWH A;  4R3D A;  3NBI A;  1DGG A;  2KRU A;  2EA0 A;  2ZM6 M;  4LG2 A;  2ZAM A;  1H6U A;  4OVZ A;  1NSF A;  1TDZ A;  2A5Y B;  3UGJ A;  2F5N A;  1R2Y A;  1E9S A;  2KW0 A;  3GRU A;  4LJ7 A;  5BPV A;  1KFV A;  4A3V B;  1NJG A;  8CAT A;  3U5Z A;  4MGK E;  4OW0 A;  4AZF A;  1VDD A;  2C98 A;  2C99 A;  3EIE A;  4B3S M;  3FTD A;  3WHK A;  2EO2 A;  3ZH9 B;  4BBA A;  2VQF M;  3ZC7 B;  2XH9 A;  4M0W A;  2ERC A;  3FYD A;  4JI7 M;  2RGO A;  4KO8 A;  2KA6 B;  3L2A A;  4JI8 M;  3FUU A;  4HL4 A;  3RGS A;  3GLG A;  4G6Z A;  2CV1 A;  3VFD A;  2UU9 M;  3AKZ A;  3VDP A;  3CF6 E;  2FNA A;  3KW6 A;  4FD2 A;  3I51 A;  2V1C A;  4DR7 M;  3GP1 A;  3AV0 A;  3JAM S;  2Z3X A;  4LF6 M;  2V1U A;  4LF7 M;  4JV5 M;  4X65 M;  4BLC A;  3KP0 E;  3U6C A;  3SAV A;  2X4A A;  3D8B A;  4IBK A;  2UXB M;  1K3X A;  2LH0 A;  1GKI A;  4M9X A;  4L15 A;  5KO3 A;  3U5Z B;  4YHH M;  3L29 A;  3SFZ A;  3LVV A;  4GH9 A;  5EXX A;  4M0D A;  3K2L A;  4DV2 M;  2QBY A;  4KLN A;  1OJL A;  3HHY A;  1E9R A;  3FUV A;  3HJS A;  4RF1 A;  4LF4 M;  2Y20 A;  3HU3 A;  1TH4 A;  4I5S A;  1L1T A;  4D81 A;  5FSW A;  5FTL A;  5JI3 E;  2J7N A;  2ZBK B;  4DUZ M;  3AL0 C;  3KS8 A;  1L8Q A;  4Z6Y A;  1ORY B;  3SAS A;  4S12 A;  5FTJ A;  3SMP A;  2XLJ A;  2XSZ D;  1HQY E;  4GKJ M;  2FE8 A;  2QZ4 A;  2DZO B;  5IWA M;  2CFO A;  1PM5 A;  3K92 A;  4B7F A;  1TGU A;  3TL4 X;  4DV5 M;  4DV0 M;  2R18 A;  1D2N A;  1QQW A;  2D7H A;  3FTF A;  2HHH M;  3UMM A;  1G8P A;  1L1Z A;  4B08 A;  2DWL A;  2UXC M;  4CIS A;  4TUW A;  4GIT A;  1J09 A;  4I81 A;  5EQT A;  1K82 A;  3LVW A;  1G3I A;  1MX0 A;  2R4J A;  3U6P A;  3FYC A;  3U61 B;  4LZJ A;  1HNX M;  1L2B A;  4PDG A;  2RGH A;  5A2Q S;  1E32 A;  3CF2 A;  4MGZ E;  1QAM A;  3FUW A;  4NXM M;  4M9Z A;  1N78 A;  4G4Q A;  2VII A;  2W82 A;  3VDU A;  3HGI A;  3GPX A;  5ITR A;  2JA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...