1XMOM

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xmoM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xmoM02
3U6QA 3GO8A 4JYAM 2HHHM 2UXDM 4PDIA 4DUZM 1L1ZA 4YY3M 1K3WA 1L2DA 5IWAM 2ZM6M 4DV5M 1L1TA 1TDZA 1Z5BA 4JI3M 1Z5CA 4G4OA 4DR5M 3SASA 5ITYA 4LFBM 2F5PA 4CISA 4KHPM 2F5QA 3GQ5A 1HNWM 4GKJM 4MB7A 4X65M 4YHHM 3VK8A 4DV3M 3T1HM 4JI5M 4GKKM 1Z59A 5ITTA 2E5LM 4JI1M 3GQ3A 3SAWA 4B3MM 4LF8M 1PJIA 1XNQM 3GQ4A 1XC8A 4B3RM 3OTOM 3SARA 3GPPA 4JI2M 5LMNM 4X64M 3U6PA 3SATA 1R2YA 4ITQA 4DR4M 1NNJA 4G4QA 1TDHA 4B3SM 3GPYA 4X62M 4DUYM 1FJGM 3U6EA 4DV1M 1IBMM 4LF6M 4NRVA 3U6CA 3JR4A 5BR8M 1R2ZA 5ITUA 1K82A 3J7AS 2XZUA 4DV7M 3TWMA 1Z5AA 2XZFA 3J80S 1XNRM 1KFVA 3U6LA 1L2CA 2VQFM 4G4NA 4B3TM 1N34M 4DR2M 3SBJA 3C58A 2OPFA 1I94M 4DR1M 2UUAM 4NXNM 1MX0A 1N32M 5A2QS 4JV5M 3GP1A 3A45A 2F5SA 2UU9M 1L2BA 1PJJA 4DR6M 3T1YM 3U6MA 3SAVA 3W0FA 5ITQA 3GPUA 2UUBM 2F4VM 4PDGA 2OQ4A 2UXCM 2EA0A 4DV0M 3TWLA 4DV4M 1K3XA 4X66M 4NRWA 2VQEM 2Q2EB 4DR7M 4LF4M 1IBLM 3JAMS 5FLXS 3GPXA 4PD2A 4LFAM 5ITXA 3A42A 3U6OA 4JI0M 3JR5A 3SAUA 1HNXM 4OX9M 1N33M 4PCZA 4LF5M 4DV6M 4JI7M 4JI4M 1Q39A 1HR0M 2F5NA 3A46A 2UUCM 1EE8A 4K0KM 4JI8M 2UXBM 4LFCM 1Q3CA 3DOAA 4NXMM 5LMUM 4DV2M 4JI6M 5ITRA 1N36M 1J5EM 3TWKA 4LF7M 2ZBKB 4LF9M 4DR3M 1XMQM 2F5OA 5IT9S 1MU5A 1Q3BA 3J81S 4AQYM 1PM5A 2HKJA 3U6SA 1XMOM 5ITXE 1IBKM 4G4RA 3VK7A 1HNZM 3U6DA
chains in the Genus database with same CATH superfamily
2DWZB 3D8LA 3U6QA 1GJSA 1PGYA 4LJ6A 4JYAM 3AOEC 3UZUA 2XFTA 3LVWA 1SXJA 4PDIA 4DUZM 4YY3M 3TL4X 1OTRA 5IWAM 2ZM6M 1L2DA 2HWJA 3I04M 3AV0A 1Z5CA 4GIPA 4G4OA 2CWBA 3KW6A 4DR5M 2DWMA 5ITYA 1JQJC 1XHBA 2CV0A 4LFBM 5E26A 3VLFB 3KOXE 2DAGA 3UJNA 3KOZE 2F5QA 3B9PA 3GQ5A 2CHVA 1R5LA 2G8LA 3QYBA 1F4IA 2VF7A 3AKZA 2JA2A 2L4EA 3VK8A 1WHCA 3MK6A 2C99A 4QNRA 3FUVA 1P3QQ 1JB0F 1G3IA 2FS1A 3FTEA 2XH9A 2J7NA 5IREB 4JI1M 1BVSA 4BBAA 4D82A 3SAWA 1PJIA 1XNQM 3AFHA 1DGHB 4DBGB 1XC8A 2VDBB 2LBCA 2LTUA 3OTOM 3GRYA 1DO0A 1WGLA 2EKKA 3K1JA 4IIWA 3SARA 4X64M 2C98A 2JNHA 3SYKA 3U60A 4AKIA 1H6UA 4MGKE 4ITQA 4DR4M 3LW5F 3NBXX 3GRVA 3SFZA 4B3SM 3CF0A 1CUKA 4FCWA 4LY6A 2KZSA 4X62M 4DUYM 1FJGM 3ZCBB 4NRVA 3KDSE 3PNVA 2R45A 3GPXA 3GLIA 2VF8A 2CHGA 2O25A 2Y0QA 2CE7A 4FCTA 3PXGA 1OIPA 2J7OA 1HQCA 4DV7M 4KODA 3PNYA 3R8FA 1QVRA 1TH2A 4WURA 1Z5AA 1G41A 3B7NA 2Z7JA 1NSFA 2QPAA 1PRBA 2AHMA 2B3TA 4GH9A 5GKNA 1N78A 4EIWA 1OFIA 4IBBA 4B3TM 5JI3E 3FUUA 3SBJA 4QOSA 4LGYA 2ZAMA 2H5XA 3U5ZA 4NXNM 5A2QS 3GP1A 1XXHE 3L28A 4A3VB 2LHCA 2F5SA 2APLA 1L2BA 2M60A 2R0IA 1QUTA 4L16A 3IECA 2KDLA 4M9ZA 2JZ0A 3GLFE 2N35A 2R46A 3W67A 4X66M 2Y21A 2XSZA 3SHFA 5KQ8A 3K9PA 3I4VA 3KXEC 3HGIA 1N77A 2Q2EB 1VEJA 2FNAA 3I4YA 1TTEA 1I4WA 3KS8A 2WSCF 4LF4M 1HT2E 1G8PA 2KNAA 5FLXS 2NQ8C 4NOOB 2EUCA 2RGHA 5ITXA 2DNAA 2OOAA 1PJTA 4OX9M 1HNXM 4KLNA 1E9RA 1OAIA 3D8BA 1IN7A 2LXEA 4HL4A 1MJGM 4JI4M 4L8RC 1G71A 3E4RA 1EE8A 3KS4A 4S12A 2L7HA 1NJGA 4DV2M 4L78A 4KO8A 2KNVA 1IXSB 2R44A 2O5RA 4OW0A 4II7A 3WHKA 1QDRA 2MR9A 4AZFA 3L26A 1S3SA 1OKSA 1Q3BA 4LJ5A 1NY5A 5EP3A 2FH0A 3RFWA 4AQYM 3M6AA 1PM5A 2HKJA 1XMOM 1DV0A 1YUBA 5KPZA 3HJSA 5ITXE 4GHLA 1GVNA 2QQ8A 2G5GX 2D7EA 2DHRA 4GHAA 3HHYA 2HHHM 1ZV1A 4AG6A 1IXRC 3FYDA 3UK6A 1L1TA 1E94E 1TDZA 3CTWB 4B7HA 3K9OA 1X37A 3LVVA 3SASA 1VDDA 1XXHA 2YFQA 3VDUA 4CISA 5DFLA 4KHPM 4R7GA 1ZAEA 4FWDA 1QAOA 4JN6A 3EIEA 4MB7A 2XGNA 3FUWA 4YHHM 2YR0A 3HJ8A 1IM2A 2JY6B 1C1KA 4GC5A 2L7IA 4MH0E 5IZ7D 1EFUB 2BWBA 1L8QA 4RNAA 3C3EA 5EP4A 1ZQ9A 3GQ3A 3GLIE 4LF8M 5DNYA 4B3RM 4D81A 1GL7A 3J7BA 8CATA 3SYLA 3L2AA 3HJQA 5LMNM 1Z6TA 2DI0A 3SATA 3M0EA 1NNJA 3W0LB 1DGGA 4HEOA 3GPYA 2C9CA 1GABA 3UGJA 3U60B 3KVWA 4Y28F 4LF6M 4AKHA 2C96A 4IBKA 2KA6B 2G3QA 3W68A 3FTCA 5EP2A 3PVSA 1K82A 3J7AS 3TPZA 2XZUA 3FTDA 2VIIA 2DWLA 3FUXA 1J09A 1UM8A 1IFYA 4GMQA 2Z3XA 1XB2B 1SXJD 1L2CA 2O01F 3C3DA 3B7ZA 2JY8A 2MJ5B 4FD2A 3C58A 2QENA 2OPFA 2KNZA 1QAQA 4LZZA 1WJ7A 2K9DA 4W5WA 5DYGA 2UUAM 1N32M 4RF1A 4LG2A 3HU2A 4JV5M 2X8AA 3T6PA 2UU9M 4I5SA 2Y20A 3VKGA 1PJJA 2KRUA 1R6BX 3E9SA 1ZMUA 2F4VM 2UUBM 4UN2B 1IQPA 3GLHB 4LCBA 4IBDA 3KOWE 5FTJA 3U6DA 3KP1E 2WSEF 1HQYE 1PJSA 2DKLA 1WIVA 2A5YB 3FKEA 4P17A 4RKUF 1DO2A 4OVZA 1NHGC 2BJVA 4QHSA 3CF2A 5EP1A 4B7GA 4L4UA 5KPTA 4MGZE 4LFAM 4Q7JA 2K6BA 2CFOA 2C9OA 1HJPA 2FFJA 1TH3A 2LVNC 5EQTA 2QBYA 4PCZA 4LF5M 3AOEA 1JR3E 1SXJC 2QBYB 2JWSA 1OQYA 3EIHA 3A98B 3F92A 1MN3A 4FWHA 4R3DA 5L8RF 1NJFA 1QAMA 2XFSA 4JI8M 1D2NA 1LV7A 2DZLA 4FCVA 1Q3CA 4M0WA 3RE8A 4JI6M 2R65A 2QSFX 3TWKA 5JI2E 4I81A 4F2LA 2L4FA 2QNJA 1GJTA 2ZBKB 4LF9M 1ZMWA 1Q02A 4QHTA 1V92A 1QZEA 4GITA 7CATA 3J81S 2HCBA 3U6SA 3KSJA 1VG5A 1IXZA 3RGPA 4AW4A 1IBKM 2YNMD 4M9XA 2R4JA 4KT0F 1SXJB 5C18A 2EJSA 2LWXA 1VQ1A 3GO8A 3Q8GA 4OVZB 2R4EA 5FTLA 2UXDM 3PFIA 2LNHC 3FRHA 3GRUA 2DZOB 3ILKA 3AOGA 1Z5BA 1HT1E 1IY1A 2LH0A 2LVAA 4LRTA 2QCUA 1JR3D 1NY6A 3TE6A 3GLHA 1G4AE 1R4GA 4B08A 2V1CA 1HNWM 4GKJM 1QDTA 2YQZA 4X65M 3U5ZB 3T38A 4DV3M 4LZJA 1ZMVA 4GC9A 3HU1A 4LGMA 2DAMA 4GKKM 5C1BA 1Z59A 1T43A 1XXHB 1KSFX 1D0MA 2ZAOA 1E9SA 2BNKA 2DWNA 2E5LM 1XWIA 3IG5A 3GQ4A 4I8OA 3R9XB 3BXWA 2X49A 1D0LA 5E6JA 2QP9X 4QNMA 3GPPA 4JI2M 4GEWA 2L2DA 3M7GA 1QUSA 4IBIA 4GRIA 1R2YA 4HLQA 2DAKA 4LJAA 2LHGA 1C7YA 4FVMA 1YE9A 4MGHA 2Z4SA 3U6EA 4DV1M 1IBMM 5KO3A 3U6CA 1GO5A 1SXJE 3CGWA 4L6V6 3VDPA 3FD9A 1R2ZA 3KFUG 1W5SA 4MM3B 5F3WA 5ITUA 1WGNA 1T3TA 3QWLA 5BPVA 4P16A 2LVOC 3FRIA 3SMPA 3GRRA 1QANA 2JY7A 1KFVA 2DXIA 1IN8A 5EXXA 2VQFM 2QZ4A 2D7HA 3BBZA 4DR2M 1N34M 2GQFA 1RU3A 1NVMA 1VEKA 1OIZA 2ZANA 2I7NA 1I94M 2Z4RA 3BOSA 3GLFB 3VFDA 3U61A 2DAIA 3U6MA 2MGWA 3SAVA 3KOYE 3LQRA 3W0FA 4PDGA 2EA0A 4CGYB 3TWLA 3LCVB 4DV4M 1DGFA 2DAEA 4WW0A 2DVWB 2R62A 2XLJA 4NRWA 2JZ1A 3HZJA 1QYRA 2KHHA 2EO2A 1T6OA 3LMMA 2I7PA 1IBLM 3ZC7B 3JAMS 1IN5A 2FOIC 2RKOA 5EXTA 5FTKA 2FE8A 4RF0A 1IN6A 3MJ5A 4FW9A 2K0BX 1OJLA 1V33A 3A42A 2ERCA 3L29A 4AG5A 3UMMA 3JR5A 2CV2A 2KXEA 1IY0A 4CIZA 4MGIE 4DV6M 2L09A 4JI7M 1NHWC 1Q39A 1HR0M 1ORYB 3IG8A 3GLGB 4K0KM 4LJ4A 1IXSA 2H1RA 2W82A 4LFCM 2UXBM 1OFHA 3GLGA 2HL7A 2M5ZA 4TUWA 5ITRA 1N36M 4B7FA 4AKGA 3B89A 4XK8F 2BWEA 2BJWA 2CUZA 2RRUA 4DR3M 2F5OA 4OU7A 1MU5A 3NWLA 2MROB 1NNUC 2JP7A 3HHZA 2DZNB 2LVQD 5FTNA 1GKIA 4G4RA 4LJ7A 2D7GA 1D0KA 3ZH9B 1TGUA 2RGOA 4FWGA 4IBFA 2P5TA 2DENA 1OAOC 1L1ZA 1K3WA 4DV5M 1DGHA 4JI3M 4AI6A 3I51A 4QOZC 2KRKA 1VDLA 5KPRA 2KEBA 1WR1B 3L27A 3AL0C 3IHPA 5FTMA 2F5PA 3MHVC 1NV9A 4PT5A 5DYIA 4BLCA 1LTMA 3NBIA 2CHQA 4F1IA 3SHGB 4MGYE 1TF0B 1IY2A 3DA1A 1NV8A 1NO1A 3CF6E 5KQDA 3V76A 3T1HM 2V1UA 4BB9A 4JI5M 2XSZD 1FNNA 1VEGA 2MH8A 3DFZA 5ITTA 2OO9A 3K92A 4B3MM 1J7KA 4NC6A 2WZJA 4XGIA 3HU3A 3T15A 3FUTA 4ANRA 3AJIB 3U6PA 2QHOB 2R6FA 1YSYA 3KP0E 3H4MA 3Q8XA 2KW0A 3HHXA 5EXSA 4G4QA 1TDHA 3MMPA 5EJCA 3VK7A 2ZTDA 4R71A 4M0DA 2JXNA 1V34A 4IBGA 3K8ZA 1GLNA 3FTFA 4G3OA 1PJQA 3TQSA 5BR8M 3JR4A 1IN4A 3WHLA 1JR3A 3HKPA 1DGBA 1A5TA 3HWSA 1WXQA 3TWMA 1E32A 3QYEA 5EXPA 2XZFA 3J80S 3FYCA 1XNRM 4WP2A 2X4AA 3U61B 3U6LA 3E21A 4G4NA 2Y0TA 1Y8GA 2KZUA 4DR1M 5H37D 1MX0A 3LCUA 3DZDA 4L15A 2CEAA 3GLHE 4G6ZA 4M9SA 3A45A 3SMSA 3L25A 3I01M 4DR6M 2EKFA 2JUJA 3KSXA 3T1YM 5ITQA 4Z6YA 3GPUA 3GLGE 1TR8A 3K2LA 2OQ4A 2UXCM 4NSRA 4DV0M 2V6ZM 1K3XA 1AUAA 4IBCA 3QAUA 2VQEM 4IJFA 3J2PB 4DR7M 4IJEA 3FE3A 4PD2A 4Z8XA 3J27B 3RGSA 3SC3A 4CJ6A 2K47A 3U6OA 4IBEA 2ZTCA 2XF3A 4JXJA 4ZPXA 4JI0M 3SAUA 3B74A 1N33M 1AIPC 1KYIA 1YLAA 4LJ9A 2OOBA 2DHYA 2C5RA 2Z8YM 2LVPC 1EIJA 2F5NA 1QZMA 1W5TA 2GNOA 1GL6A 3C9PA 4LJ8A 4LRSA 3THGA 2CRUA 3A46A 3ZQJA 2CV1A 2UUCM 4CHTB 4REZA 4NXMM 3DOAA 3VKHA 5LMUM 1QQWA 2XEPA 3B7QA 3GLFA 1G59A 1J5EM 1R7RA 3HY5A 4I4LA 4LF7M 3HHWA 4IBJA 3H4JA 3GLIB 1XMQM 5IT9S 2JY5A 4NSOB 2HAKA 2L6OA 3LQQA 2J5YA 4NL4H 5FSWA 2R18A 1TH4A 2WSFF 1N75A 1UFZA 4XBOA 1SG9A 4D80A 2CP8A 3E46A 1HNZM 3HX3A
chains in the Genus database with same CATH topology
2DWZB 3D8LA 3U6QA 4LJ6A 4JYAM 3AOEC 3UZUA 2XFTA 3LVWA 1SXJA 4PDIA 4DUZM 4YY3M 3TL4X 1L2DA 5IWAM 2ZM6M 3AV0A 1Z5CA 4GIPA 4G4OA 3KW6A 4DR5M 2DWMA 5ITYA 1JQJC 1XHBA 2CV0A 4LFBM 5E26A 3VLFB 3KOXE 3UJNA 3KOZE 2F5QA 3B9PA 3GQ5A 2CHVA 2G8LA 3AKZA 2JA2A 3VK8A 3MK6A 2C99A 4QNRA 3FUVA 1G3IA 3FTEA 2XH9A 2J7NA 5IREB 4JI1M 3SAWA 4BBAA 4D82A 1PJIA 1XNQM 3AFHA 1DGHB 1XC8A 3OTOM 3GRYA 1DO0A 3K1JA 4IIWA 3SARA 4X64M 2C98A 3SYKA 3U60A 4AKIA 1H6UA 4MGKE 4ITQA 4DR4M 3GRVA 3SFZA 4B3SM 3CF0A 4LY6A 4FCWA 2KZSA 4X62M 4DUYM 1FJGM 3ZCBB 4NRVA 3KDSE 3PNVA 2R45A 3GPXA 3GLIA 2CHGA 2Y0QA 2CE7A 4FCTA 3PXGA 2J7OA 1HQCA 4DV7M 4KODA 3PNYA 3R8FA 1QVRA 1TH2A 4WURA 1Z5AA 1G41A 2Z7JA 1NSFA 2QPAA 4GH9A 2AHMA 5GKNA 1N78A 4EIWA 1OFIA 4IBBA 4B3TM 5JI3E 3FUUA 3SBJA 4QOSA 4LGYA 2ZAMA 3U5ZA 4NXNM 5A2QS 3GP1A 3L28A 4A3VB 2F5SA 1L2BA 2M60A 4L16A 4M9ZA 2R46A 4X66M 2Y21A 2XSZA 3SHFA 5KQ8A 3I4VA 3KXEC 3HGIA 1N77A 2Q2EB 2FNAA 3I4YA 3KS8A 1I4WA 4LF4M 1HT2E 1G8PA 5FLXS 2NQ8C 4NOOB 2EUCA 2RGHA 5ITXA 4OX9M 1HNXM 4KLNA 1E9RA 3D8BA 1IN7A 2LXEA 4HL4A 4JI4M 4L8RC 3E4RA 1EE8A 3KS4A 4S12A 2L7HA 1NJGA 4DV2M 4L78A 4KO8A 1IXSB 2O5RA 4OW0A 4II7A 3WHKA 4AZFA 3L26A 1S3SA 1Q3BA 4LJ5A 1NY5A 5EP3A 3RFWA 4AQYM 3M6AA 1PM5A 2HKJA 1XMOM 1YUBA 5KPZA 3HJSA 5ITXE 4GHLA 1GVNA 2G5GX 2D7EA 2DHRA 4GHAA 3HHYA 2HHHM 4AG6A 1IXRC 3FYDA 3UK6A 1L1TA 1E94E 1TDZA 3CTWB 4B7HA 1X37A 3LVVA 3SASA 1VDDA 1XXHA 2YFQA 3VDUA 4CISA 4KHPM 4R7GA 1ZAEA 4FWDA 1QAOA 4JN6A 3EIEA 4MB7A 2XGNA 3FUWA 4YHHM 2YR0A 3HJ8A 1IM2A 4GC5A 1C1KA 2L7IA 4MH0E 5IZ7D 4RNAA 1L8QA 5EP4A 1ZQ9A 3GQ3A 4LF8M 5DNYA 4B3RM 4D81A 1GL7A 3J7BA 8CATA 3SYLA 3L2AA 3HJQA 5LMNM 1Z6TA 3SATA 3M0EA 1NNJA 3W0LB 1DGGA 3GPYA 2C9CA 3UGJA 3U60B 3KVWA 4LF6M 4AKHA 2C96A 4IBKA 2KA6B 3FTCA 5EP2A 3PVSA 1K82A 3J7AS 3TPZA 2XZUA 3FTDA 2VIIA 2DWLA 3FUXA 1J09A 1UM8A 4GMQA 2Z3XA 1SXJD 1L2CA 4FD2A 3C58A 2QENA 2OPFA 4LZZA 1QAQA 4W5WA 2UUAM 5DYGA 4RF1A 4LG2A 3HU2A 4JV5M 2X8AA 2UU9M 4I5SA 2Y20A 3VKGA 1PJJA 2KRUA 1R6BX 3E9SA 2F4VM 2UUBM 1IQPA 3GLHB 4LCBA 4IBDA 3KOWE 5FTJA 3KP1E 1HQYE 2A5YB 3FKEA 1DO2A 4OVZA 1NHGC 2BJVA 4QHSA 3CF2A 5EP1A 4B7GA 4L4UA 5KPTA 4MGZE 4LFAM 2CFOA 2C9OA 2FFJA 1TH3A 5EQTA 2QBYA 4PCZA 4LF5M 3AOEA 1SXJC 2QBYB 3EIHA 3A98B 4R3DA 4FWHA 4JI8M 1NJFA 1QAMA 2XFSA 1D2NA 1LV7A 4FCVA 1Q3CA 4M0WA 3RE8A 4JI6M 2R65A 3TWKA 5JI2E 4I81A 2ZBKB 4LF9M 4QHTA 4GITA 7CATA 3J81S 2HCBA 3U6SA 3KSJA 1IXZA 3RGPA 4AW4A 1IBKM 2YNMD 4M9XA 2R4JA 1SXJB 5C18A 2LWXA 3GO8A 4OVZB 2R4EA 5FTLA 2UXDM 3PFIA 2LNHC 3GRUA 2DZOB 3ILKA 3AOGA 1Z5BA 1HT1E 1IY1A 2LH0A 4LRTA 2QCUA 1JR3D 1NY6A 3TE6A 3GLHA 1G4AE 4B08A 2V1CA 1HNWM 4GKJM 2YQZA 4X65M 3U5ZB 3T38A 4DV3M 4LZJA 4GC9A 3HU1A 4GKKM 5C1BA 1Z59A 1XXHB 2ZAOA 1KSFX 2E5LM 1E9SA 2BNKA 2DWNA 1XWIA 3IG5A 3GQ4A 4I8OA 3R9XB 2X49A 5E6JA 2QP9X 4QNMA 3GPPA 4JI2M 3M7GA 4IBIA 4GRIA 1R2YA 4HLQA 4LJAA 4FVMA 1YE9A 4MGHA 2Z4SA 3U6EA 4DV1M 1IBMM 5KO3A 3U6CA 1SXJE 3VDPA 3FD9A 1R2ZA 3KFUG 1W5SA 4MM3B 5F3WA 5ITUA 1T3TA 3QWLA 5BPVA 4P16A 3SMPA 3GRRA 1QANA 1KFVA 2DXIA 1IN8A 5EXXA 2VQFM 2QZ4A 2D7HA 1N34M 4DR2M 1I94M 1NVMA 2ZANA 2I7NA 2Z4RA 3BOSA 3GLFB 3VFDA 3U61A 3U6MA 3SAVA 3KOYE 3LQRA 3W0FA 4PDGA 2EA0A 4CGYB 3TWLA 4DV4M 1DGFA 4WW0A 2DVWB 2R62A 2XLJA 4NRWA 1QYRA 2EO2A 3LMMA 2I7PA 1IBLM 3ZC7B 3JAMS 1IN5A 2FOIC 2RKOA 5EXTA 5FTKA 2FE8A 4RF0A 1IN6A 4FW9A 3MJ5A 3L29A 1OJLA 3A42A 2ERCA 4AG5A 3UMMA 3JR5A 2CV2A 2KXEA 1IY0A 4MGIE 4DV6M 2L09A 4JI7M 1NHWC 1Q39A 1HR0M 1ORYB 3IG8A 3GLGB 4K0KM 4LJ4A 2H1RA 2W82A 4LFCM 2UXBM 1OFHA 3GLGA 2HL7A 2M5ZA 4TUWA 5ITRA 1N36M 4B7FA 4AKGA 2BJWA 2CUZA 4DR3M 2F5OA 4OU7A 1MU5A 3NWLA 1NNUC 3HHZA 2DZNB 5FTNA 1GKIA 4G4RA 4LJ7A 2D7GA 3ZH9B 1TGUA 2RGOA 4FWGA 4IBFA 2P5TA 1L1ZA 1K3WA 4DV5M 1DGHA 4JI3M 4AI6A 3I51A 4QOZC 2KRKA 5KPRA 2KEBA 3L27A 3AL0C 5FTMA 2F5PA 3MHVC 4PT5A 5DYIA 4BLCA 3NBIA 2CHQA 3SHGB 4MGYE 1IY2A 3DA1A 5KQDA 3CF6E 2V1UA 3T1HM 4BB9A 4JI5M 2XSZD 1FNNA 3DFZA 5ITTA 3K92A 4B3MM 1J7KA 4XGIA 3HU3A 3T15A 3FUTA 3AJIB 3U6PA 1YSYA 3KP0E 3H4MA 3Q8XA 2KW0A 3HHXA 5EXSA 4G4QA 1TDHA 5EJCA 3VK7A 4M0DA 4IBGA 3K8ZA 1GLNA 3FTFA 3TQSA 5BR8M 3JR4A 1IN4A 3WHLA 1JR3A 3HKPA 1DGBA 3HWSA 3TWMA 1WXQA 1E32A 5EXPA 2XZFA 3J80S 3FYCA 1XNRM 2X4AA 3U61B 3U6LA 4G4NA 2Y0TA 2KZUA 4DR1M 5H37D 1MX0A 1N32M 3DZDA 4L15A 2CEAA 4G6ZA 4M9SA 3SMSA 3A45A 3L25A 4DR6M 3T1YM 3KSXA 5ITQA 4Z6YA 3GPUA 3K2LA 2OQ4A 2UXCM 4NSRA 4DV0M 2V6ZM 1K3XA 4IBCA 3QAUA 2VQEM 4IJFA 3J2PB 4DR7M 4IJEA 4PD2A 4Z8XA 3J27B 3RGSA 3SC3A 2K47A 3U6OA 4IBEA 4JXJA 2XF3A 4ZPXA 4JI0M 3SAUA 1N33M 4LJ9A 1KYIA 2C5RA 2F5NA 1QZMA 1W5TA 3A46A 1GL6A 4LRSA 4LJ8A 3THGA 2UUCM 2CV1A 4CHTB 4REZA 4NXMM 3DOAA 3VKHA 5LMUM 1QQWA 2XEPA 1G59A 3GLFA 1J5EM 1R7RA 4I4LA 4LF7M 3HHWA 4IBJA 3GLIB 1XMQM 5IT9S 4NSOB 2L6OA 3LQQA 4NL4H 5FSWA 2R18A 1TH4A 1N75A 4XBOA 4D80A 4LGMA 1HNZM 3U6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6Q A;  3GO8 A;  4JYA M;  2HHH M;  2UXD M;  4PDI A;  4DUZ M;  1L1Z A;  4YY3 M;  1K3W A;  1L2D A;  5IWA M;  2ZM6 M;  4DV5 M;  1L1T A;  1TDZ A;  1Z5B A;  4JI3 M;  1Z5C A;  4G4O A;  4DR5 M;  3SAS A;  5ITY A;  4LFB M;  2F5P A;  4CIS A;  4KHP M;  2F5Q A;  3GQ5 A;  1HNW M;  4GKJ M;  4MB7 A;  4X65 M;  4YHH M;  3VK8 A;  4DV3 M;  3T1H M;  4JI5 M;  4GKK M;  1Z59 A;  5ITT A;  2E5L M;  4JI1 M;  3GQ3 A;  3SAW A;  4B3M M;  4LF8 M;  1PJI A;  1XNQ M;  3GQ4 A;  1XC8 A;  4B3R M;  3OTO M;  3SAR A;  3GPP A;  4JI2 M;  5LMN M;  4X64 M;  3U6P A;  3SAT A;  1R2Y A;  4ITQ A;  4DR4 M;  1NNJ A;  4G4Q A;  1TDH A;  4B3S M;  3GPY A;  4X62 M;  4DUY M;  1FJG M;  3U6E A;  4DV1 M;  1IBM M;  4LF6 M;  4NRV A;  3U6C A;  3JR4 A;  5BR8 M;  1R2Z A;  5ITU A;  1K82 A;  3J7A S;  2XZU A;  4DV7 M;  3TWM A;  1Z5A A;  2XZF A;  3J80 S;  1XNR M;  1KFV A;  3U6L A;  1L2C A;  2VQF M;  4G4N A;  4B3T M;  1N34 M;  4DR2 M;  3SBJ A;  3C58 A;  2OPF A;  1I94 M;  4DR1 M;  2UUA M;  4NXN M;  1MX0 A;  1N32 M;  5A2Q S;  4JV5 M;  3GP1 A;  3A45 A;  2F5S A;  2UU9 M;  1L2B A;  1PJJ A;  4DR6 M;  3T1Y M;  3U6M A;  3SAV A;  3W0F A;  5ITQ A;  3GPU A;  2UUB M;  2F4V M;  4PDG A;  2OQ4 A;  2UXC M;  2EA0 A;  4DV0 M;  3TWL A;  4DV4 M;  1K3X A;  4X66 M;  4NRW A;  2VQE M;  2Q2E B;  4DR7 M;  4LF4 M;  1IBL M;  3JAM S;  5FLX S;  3GPX A;  4PD2 A;  4LFA M;  5ITX A;  3A42 A;  3U6O A;  4JI0 M;  3JR5 A;  3SAU A;  1HNX M;  4OX9 M;  1N33 M;  4PCZ A;  4LF5 M;  4DV6 M;  4JI7 M;  4JI4 M;  1Q39 A;  1HR0 M;  2F5N A;  3A46 A;  2UUC M;  1EE8 A;  4K0K M;  4JI8 M;  2UXB M;  4LFC M;  1Q3C A;  3DOA A;  4NXM M;  5LMU M;  4DV2 M;  4JI6 M;  5ITR A;  1N36 M;  1J5E M;  3TWK A;  4LF7 M;  2ZBK B;  4LF9 M;  4DR3 M;  1XMQ M;  2F5O A;  5IT9 S;  1MU5 A;  1Q3B A;  3J81 S;  4AQY M;  1PM5 A;  2HKJ A;  3U6S A;  1XMO M;  5ITX E;  1IBK M;  4G4R A;  3VK7 A;  1HNZ M;  3U6D A; 
#chains in the Genus database with same CATH topology
 2DWZ B;  3D8L A;  3U6Q A;  1GJS A;  1PGY A;  4LJ6 A;  4JYA M;  3AOE C;  3UZU A;  2XFT A;  3LVW A;  1SXJ A;  4PDI A;  4DUZ M;  4YY3 M;  3TL4 X;  1OTR A;  5IWA M;  2ZM6 M;  1L2D A;  2HWJ A;  3I04 M;  3AV0 A;  1Z5C A;  4GIP A;  4G4O A;  2CWB A;  3KW6 A;  4DR5 M;  2DWM A;  5ITY A;  1JQJ C;  1XHB A;  2CV0 A;  4LFB M;  5E26 A;  3VLF B;  3KOX E;  2DAG A;  3UJN A;  3KOZ E;  2F5Q A;  3B9P A;  3GQ5 A;  2CHV A;  1R5L A;  2G8L A;  3QYB A;  1F4I A;  2VF7 A;  3AKZ A;  2JA2 A;  2L4E A;  3VK8 A;  1WHC A;  3MK6 A;  2C99 A;  4QNR A;  3FUV A;  1P3Q Q;  1JB0 F;  1G3I A;  2FS1 A;  3FTE A;  2XH9 A;  2J7N A;  5IRE B;  4JI1 M;  1BVS A;  4BBA A;  4D82 A;  3SAW A;  1PJI A;  1XNQ M;  3AFH A;  1DGH B;  4DBG B;  1XC8 A;  2VDB B;  2LBC A;  2LTU A;  3OTO M;  3GRY A;  1DO0 A;  1WGL A;  2EKK A;  3K1J A;  4IIW A;  3SAR A;  4X64 M;  2C98 A;  2JNH A;  3SYK A;  3U60 A;  4AKI A;  1H6U A;  4MGK E;  4ITQ A;  4DR4 M;  3LW5 F;  3NBX X;  3GRV A;  3SFZ A;  4B3S M;  3CF0 A;  1CUK A;  4FCW A;  4LY6 A;  2KZS A;  4X62 M;  4DUY M;  1FJG M;  3ZCB B;  4NRV A;  3KDS E;  3PNV A;  2R45 A;  3GPX A;  3GLI A;  2VF8 A;  2CHG A;  2O25 A;  2Y0Q A;  2CE7 A;  4FCT A;  3PXG A;  1OIP A;  2J7O A;  1HQC A;  4DV7 M;  4KOD A;  3PNY A;  3R8F A;  1QVR A;  1TH2 A;  4WUR A;  1Z5A A;  1G41 A;  3B7N A;  2Z7J A;  1NSF A;  2QPA A;  1PRB A;  2AHM A;  2B3T A;  4GH9 A;  5GKN A;  1N78 A;  4EIW A;  1OFI A;  4IBB A;  4B3T M;  5JI3 E;  3FUU A;  3SBJ A;  4QOS A;  4LGY A;  2ZAM A;  2H5X A;  3U5Z A;  4NXN M;  5A2Q S;  3GP1 A;  1XXH E;  3L28 A;  4A3V B;  2LHC A;  2F5S A;  2APL A;  1L2B A;  2M60 A;  2R0I A;  1QUT A;  4L16 A;  3IEC A;  2KDL A;  4M9Z A;  2JZ0 A;  3GLF E;  2N35 A;  2R46 A;  3W67 A;  4X66 M;  2Y21 A;  2XSZ A;  3SHF A;  5KQ8 A;  3K9P A;  3I4V A;  3KXE C;  3HGI A;  1N77 A;  2Q2E B;  1VEJ A;  2FNA A;  3I4Y A;  1TTE A;  1I4W A;  3KS8 A;  2WSC F;  4LF4 M;  1HT2 E;  1G8P A;  2KNA A;  5FLX S;  2NQ8 C;  4NOO B;  2EUC A;  2RGH A;  5ITX A;  2DNA A;  2OOA A;  1PJT A;  4OX9 M;  1HNX M;  4KLN A;  1E9R A;  1OAI A;  3D8B A;  1IN7 A;  2LXE A;  4HL4 A;  1MJG M;  4JI4 M;  4L8R C;  1G71 A;  3E4R A;  1EE8 A;  3KS4 A;  4S12 A;  2L7H A;  1NJG A;  4DV2 M;  4L78 A;  4KO8 A;  2KNV A;  1IXS B;  2R44 A;  2O5R A;  4OW0 A;  4II7 A;  3WHK A;  1QDR A;  2MR9 A;  4AZF A;  3L26 A;  1S3S A;  1OKS A;  1Q3B A;  4LJ5 A;  1NY5 A;  5EP3 A;  2FH0 A;  3RFW A;  4AQY M;  3M6A A;  1PM5 A;  2HKJ A;  1XMO M;  1DV0 A;  1YUB A;  5KPZ A;  3HJS A;  5ITX E;  4GHL A;  1GVN A;  2QQ8 A;  2G5G X;  2D7E A;  2DHR A;  4GHA A;  3HHY A;  2HHH M;  1ZV1 A;  4AG6 A;  1IXR C;  3FYD A;  3UK6 A;  1L1T A;  1E94 E;  1TDZ A;  3CTW B;  4B7H A;  3K9O A;  1X37 A;  3LVV A;  3SAS A;  1VDD A;  1XXH A;  2YFQ A;  3VDU A;  4CIS A;  5DFL A;  4KHP M;  4R7G A;  1ZAE A;  4FWD A;  1QAO A;  4JN6 A;  3EIE A;  4MB7 A;  2XGN A;  3FUW A;  4YHH M;  2YR0 A;  3HJ8 A;  1IM2 A;  2JY6 B;  1C1K A;  4GC5 A;  2L7I A;  4MH0 E;  5IZ7 D;  1EFU B;  2BWB A;  1L8Q A;  4RNA A;  3C3E A;  5EP4 A;  1ZQ9 A;  3GQ3 A;  3GLI E;  4LF8 M;  5DNY A;  4B3R M;  4D81 A;  1GL7 A;  3J7B A;  8CAT A;  3SYL A;  3L2A A;  3HJQ A;  5LMN M;  1Z6T A;  2DI0 A;  3SAT A;  3M0E A;  1NNJ A;  3W0L B;  1DGG A;  4HEO A;  3GPY A;  2C9C A;  1GAB A;  3UGJ A;  3U60 B;  3KVW A;  4Y28 F;  4LF6 M;  4AKH A;  2C96 A;  4IBK A;  2KA6 B;  2G3Q A;  3W68 A;  3FTC A;  5EP2 A;  3PVS A;  1K82 A;  3J7A S;  3TPZ A;  2XZU A;  3FTD A;  2VII A;  2DWL A;  3FUX A;  1J09 A;  1UM8 A;  1IFY A;  4GMQ A;  2Z3X A;  1XB2 B;  1SXJ D;  1L2C A;  2O01 F;  3C3D A;  3B7Z A;  2JY8 A;  2MJ5 B;  4FD2 A;  3C58 A;  2QEN A;  2OPF A;  2KNZ A;  1QAQ A;  4LZZ A;  1WJ7 A;  2K9D A;  4W5W A;  5DYG A;  2UUA M;  1N32 M;  4RF1 A;  4LG2 A;  3HU2 A;  4JV5 M;  2X8A A;  3T6P A;  2UU9 M;  4I5S A;  2Y20 A;  3VKG A;  1PJJ A;  2KRU A;  1R6B X;  3E9S A;  1ZMU A;  2F4V M;  2UUB M;  4UN2 B;  1IQP A;  3GLH B;  4LCB A;  4IBD A;  3KOW E;  5FTJ A;  3U6D A;  3KP1 E;  2WSE F;  1HQY E;  1PJS A;  2DKL A;  1WIV A;  2A5Y B;  3FKE A;  4P17 A;  4RKU F;  1DO2 A;  4OVZ A;  1NHG C;  2BJV A;  4QHS A;  3CF2 A;  5EP1 A;  4B7G A;  4L4U A;  5KPT A;  4MGZ E;  4LFA M;  4Q7J A;  2K6B A;  2CFO A;  2C9O A;  1HJP A;  2FFJ A;  1TH3 A;  2LVN C;  5EQT A;  2QBY A;  4PCZ A;  4LF5 M;  3AOE A;  1JR3 E;  1SXJ C;  2QBY B;  2JWS A;  1OQY A;  3EIH A;  3A98 B;  3F92 A;  1MN3 A;  4FWH A;  4R3D A;  5L8R F;  1NJF A;  1QAM A;  2XFS A;  4JI8 M;  1D2N A;  1LV7 A;  2DZL A;  4FCV A;  1Q3C A;  4M0W A;  3RE8 A;  4JI6 M;  2R65 A;  2QSF X;  3TWK A;  5JI2 E;  4I81 A;  4F2L A;  2L4F A;  2QNJ A;  1GJT A;  2ZBK B;  4LF9 M;  1ZMW A;  1Q02 A;  4QHT A;  1V92 A;  1QZE A;  4GIT A;  7CAT A;  3J81 S;  2HCB A;  3U6S A;  3KSJ A;  1VG5 A;  1IXZ A;  3RGP A;  4AW4 A;  1IBK M;  2YNM D;  4M9X A;  2R4J A;  4KT0 F;  1SXJ B;  5C18 A;  2EJS A;  2LWX A;  1VQ1 A;  3GO8 A;  3Q8G A;  4OVZ B;  2R4E A;  5FTL A;  2UXD M;  3PFI A;  2LNH C;  3FRH A;  3GRU A;  2DZO B;  3ILK A;  3AOG A;  1Z5B A;  1HT1 E;  1IY1 A;  2LH0 A;  2LVA A;  4LRT A;  2QCU A;  1JR3 D;  1NY6 A;  3TE6 A;  3GLH A;  1G4A E;  1R4G A;  4B08 A;  2V1C A;  1HNW M;  4GKJ M;  1QDT A;  2YQZ A;  4X65 M;  3U5Z B;  3T38 A;  4DV3 M;  4LZJ A;  1ZMV A;  4GC9 A;  3HU1 A;  4LGM A;  2DAM A;  4GKK M;  5C1B A;  1Z59 A;  1T43 A;  1XXH B;  1KSF X;  1D0M A;  2ZAO A;  1E9S A;  2BNK A;  2DWN A;  2E5L M;  1XWI A;  3IG5 A;  3GQ4 A;  4I8O A;  3R9X B;  3BXW A;  2X49 A;  1D0L A;  5E6J A;  2QP9 X;  4QNM A;  3GPP A;  4JI2 M;  4GEW A;  2L2D A;  3M7G A;  1QUS A;  4IBI A;  4GRI A;  1R2Y A;  4HLQ A;  2DAK A;  4LJA A;  2LHG A;  1C7Y A;  4FVM A;  1YE9 A;  4MGH A;  2Z4S A;  3U6E A;  4DV1 M;  1IBM M;  5KO3 A;  3U6C A;  1GO5 A;  1SXJ E;  3CGW A;  4L6V 6;  3VDP A;  3FD9 A;  1R2Z A;  3KFU G;  1W5S A;  4MM3 B;  5F3W A;  5ITU A;  1WGN A;  1T3T A;  3QWL A;  5BPV A;  4P16 A;  2LVO C;  3FRI A;  3SMP A;  3GRR A;  1QAN A;  2JY7 A;  1KFV A;  2DXI A;  1IN8 A;  5EXX A;  2VQF M;  2QZ4 A;  2D7H A;  3BBZ A;  4DR2 M;  1N34 M;  2GQF A;  1RU3 A;  1NVM A;  1VEK A;  1OIZ A;  2ZAN A;  2I7N A;  1I94 M;  2Z4R A;  3BOS A;  3GLF B;  3VFD A;  3U61 A;  2DAI A;  3U6M A;  2MGW A;  3SAV A;  3KOY E;  3LQR A;  3W0F A;  4PDG A;  2EA0 A;  4CGY B;  3TWL A;  3LCV B;  4DV4 M;  1DGF A;  2DAE A;  4WW0 A;  2DVW B;  2R62 A;  2XLJ A;  4NRW A;  2JZ1 A;  3HZJ A;  1QYR A;  2KHH A;  2EO2 A;  1T6O A;  3LMM A;  2I7P A;  1IBL M;  3ZC7 B;  3JAM S;  1IN5 A;  2FOI C;  2RKO A;  5EXT A;  5FTK A;  2FE8 A;  4RF0 A;  1IN6 A;  3MJ5 A;  4FW9 A;  2K0B X;  1OJL A;  1V33 A;  3A42 A;  2ERC A;  3L29 A;  4AG5 A;  3UMM A;  3JR5 A;  2CV2 A;  2KXE A;  1IY0 A;  4CIZ A;  4MGI E;  4DV6 M;  2L09 A;  4JI7 M;  1NHW C;  1Q39 A;  1HR0 M;  1ORY B;  3IG8 A;  3GLG B;  4K0K M;  4LJ4 A;  1IXS A;  2H1R A;  2W82 A;  4LFC M;  2UXB M;  1OFH A;  3GLG A;  2HL7 A;  2M5Z A;  4TUW A;  5ITR A;  1N36 M;  4B7F A;  4AKG A;  3B89 A;  4XK8 F;  2BWE A;  2BJW A;  2CUZ A;  2RRU A;  4DR3 M;  2F5O A;  4OU7 A;  1MU5 A;  3NWL A;  2MRO B;  1NNU C;  2JP7 A;  3HHZ A;  2DZN B;  2LVQ D;  5FTN A;  1GKI A;  4G4R A;  4LJ7 A;  2D7G A;  1D0K A;  3ZH9 B;  1TGU A;  2RGO A;  4FWG A;  4IBF A;  2P5T A;  2DEN A;  1OAO C;  1L1Z A;  1K3W A;  4DV5 M;  1DGH A;  4JI3 M;  4AI6 A;  3I51 A;  4QOZ C;  2KRK A;  1VDL A;  5KPR A;  2KEB A;  1WR1 B;  3L27 A;  3AL0 C;  3IHP A;  5FTM A;  2F5P A;  3MHV C;  1NV9 A;  4PT5 A;  5DYI A;  4BLC A;  1LTM A;  3NBI A;  2CHQ A;  4F1I A;  3SHG B;  4MGY E;  1TF0 B;  1IY2 A;  3DA1 A;  1NV8 A;  1NO1 A;  3CF6 E;  5KQD A;  3V76 A;  3T1H M;  2V1U A;  4BB9 A;  4JI5 M;  2XSZ D;  1FNN A;  1VEG A;  2MH8 A;  3DFZ A;  5ITT A;  2OO9 A;  3K92 A;  4B3M M;  1J7K A;  4NC6 A;  2WZJ A;  4XGI A;  3HU3 A;  3T15 A;  3FUT A;  4ANR A;  3AJI B;  3U6P A;  2QHO B;  2R6F A;  1YSY A;  3KP0 E;  3H4M A;  3Q8X A;  2KW0 A;  3HHX A;  5EXS A;  4G4Q A;  1TDH A;  3MMP A;  5EJC A;  3VK7 A;  2ZTD A;  4R71 A;  4M0D A;  2JXN A;  1V34 A;  4IBG A;  3K8Z A;  1GLN A;  3FTF A;  4G3O A;  1PJQ A;  3TQS A;  5BR8 M;  3JR4 A;  1IN4 A;  3WHL A;  1JR3 A;  3HKP A;  1DGB A;  1A5T A;  3HWS A;  1WXQ A;  3TWM A;  1E32 A;  3QYE A;  5EXP A;  2XZF A;  3J80 S;  3FYC A;  1XNR M;  4WP2 A;  2X4A A;  3U61 B;  3U6L A;  3E21 A;  4G4N A;  2Y0T A;  1Y8G A;  2KZU A;  4DR1 M;  5H37 D;  1MX0 A;  3LCU A;  3DZD A;  4L15 A;  2CEA A;  3GLH E;  4G6Z A;  4M9S A;  3A45 A;  3SMS A;  3L25 A;  3I01 M;  4DR6 M;  2EKF A;  2JUJ A;  3KSX A;  3T1Y M;  5ITQ A;  4Z6Y A;  3GPU A;  3GLG E;  1TR8 A;  3K2L A;  2OQ4 A;  2UXC M;  4NSR A;  4DV0 M;  2V6Z M;  1K3X A;  1AUA A;  4IBC A;  3QAU A;  2VQE M;  4IJF A;  3J2P B;  4DR7 M;  4IJE A;  3FE3 A;  4PD2 A;  4Z8X A;  3J27 B;  3RGS A;  3SC3 A;  4CJ6 A;  2K47 A;  3U6O A;  4IBE A;  2ZTC A;  2XF3 A;  4JXJ A;  4ZPX A;  4JI0 M;  3SAU A;  3B74 A;  1N33 M;  1AIP C;  1KYI A;  1YLA A;  4LJ9 A;  2OOB A;  2DHY A;  2C5R A;  2Z8Y M;  2LVP C;  1EIJ A;  2F5N A;  1QZM A;  1W5T A;  2GNO A;  1GL6 A;  3C9P A;  4LJ8 A;  4LRS A;  3THG A;  2CRU A;  3A46 A;  3ZQJ A;  2CV1 A;  2UUC M;  4CHT B;  4REZ A;  4NXM M;  3DOA A;  3VKH A;  5LMU M;  1QQW A;  2XEP A;  3B7Q A;  3GLF A;  1G59 A;  1J5E M;  1R7R A;  3HY5 A;  4I4L A;  4LF7 M;  3HHW A;  4IBJ A;  3H4J A;  3GLI B;  1XMQ M;  5IT9 S;  2JY5 A;  4NSO B;  2HAK A;  2L6O A;  3LQQ A;  2J5Y A;  4NL4 H;  5FSW A;  2R18 A;  1TH4 A;  2WSF F;  1N75 A;  1UFZ A;  4XBO A;  1SG9 A;  4D80 A;  2CP8 A;  3E46 A;  1HNZ M;  3HX3 A; 
#chains in the Genus database with same CATH homology
 2DWZ B;  3D8L A;  3U6Q A;  4LJ6 A;  4JYA M;  3AOE C;  3UZU A;  2XFT A;  3LVW A;  1SXJ A;  4PDI A;  4DUZ M;  4YY3 M;  3TL4 X;  1L2D A;  5IWA M;  2ZM6 M;  3AV0 A;  1Z5C A;  4GIP A;  4G4O A;  3KW6 A;  4DR5 M;  2DWM A;  5ITY A;  1JQJ C;  1XHB A;  2CV0 A;  4LFB M;  5E26 A;  3VLF B;  3KOX E;  3UJN A;  3KOZ E;  2F5Q A;  3B9P A;  3GQ5 A;  2CHV A;  2G8L A;  3AKZ A;  2JA2 A;  3VK8 A;  3MK6 A;  2C99 A;  4QNR A;  3FUV A;  1G3I A;  3FTE A;  2XH9 A;  2J7N A;  5IRE B;  4JI1 M;  3SAW A;  4BBA A;  4D82 A;  1PJI A;  1XNQ M;  3AFH A;  1DGH B;  1XC8 A;  3OTO M;  3GRY A;  1DO0 A;  3K1J A;  4IIW A;  3SAR A;  4X64 M;  2C98 A;  3SYK A;  3U60 A;  4AKI A;  1H6U A;  4MGK E;  4ITQ A;  4DR4 M;  3GRV A;  3SFZ A;  4B3S M;  3CF0 A;  4LY6 A;  4FCW A;  2KZS A;  4X62 M;  4DUY M;  1FJG M;  3ZCB B;  4NRV A;  3KDS E;  3PNV A;  2R45 A;  3GPX A;  3GLI A;  2CHG A;  2Y0Q A;  2CE7 A;  4FCT A;  3PXG A;  2J7O A;  1HQC A;  4DV7 M;  4KOD A;  3PNY A;  3R8F A;  1QVR A;  1TH2 A;  4WUR A;  1Z5A A;  1G41 A;  2Z7J A;  1NSF A;  2QPA A;  4GH9 A;  2AHM A;  5GKN A;  1N78 A;  4EIW A;  1OFI A;  4IBB A;  4B3T M;  5JI3 E;  3FUU A;  3SBJ A;  4QOS A;  4LGY A;  2ZAM A;  3U5Z A;  4NXN M;  5A2Q S;  3GP1 A;  3L28 A;  4A3V B;  2F5S A;  1L2B A;  2M60 A;  4L16 A;  4M9Z A;  2R46 A;  4X66 M;  2Y21 A;  2XSZ A;  3SHF A;  5KQ8 A;  3I4V A;  3KXE C;  3HGI A;  1N77 A;  2Q2E B;  2FNA A;  3I4Y A;  3KS8 A;  1I4W A;  4LF4 M;  1HT2 E;  1G8P A;  5FLX S;  2NQ8 C;  4NOO B;  2EUC A;  2RGH A;  5ITX A;  4OX9 M;  1HNX M;  4KLN A;  1E9R A;  3D8B A;  1IN7 A;  2LXE A;  4HL4 A;  4JI4 M;  4L8R C;  3E4R A;  1EE8 A;  3KS4 A;  4S12 A;  2L7H A;  1NJG A;  4DV2 M;  4L78 A;  4KO8 A;  1IXS B;  2O5R A;  4OW0 A;  4II7 A;  3WHK A;  4AZF A;  3L26 A;  1S3S A;  1Q3B A;  4LJ5 A;  1NY5 A;  5EP3 A;  3RFW A;  4AQY M;  3M6A A;  1PM5 A;  2HKJ A;  1XMO M;  1YUB A;  5KPZ A;  3HJS A;  5ITX E;  4GHL A;  1GVN A;  2G5G X;  2D7E A;  2DHR A;  4GHA A;  3HHY A;  2HHH M;  4AG6 A;  1IXR C;  3FYD A;  3UK6 A;  1L1T A;  1E94 E;  1TDZ A;  3CTW B;  4B7H A;  1X37 A;  3LVV A;  3SAS A;  1VDD A;  1XXH A;  2YFQ A;  3VDU A;  4CIS A;  4KHP M;  4R7G A;  1ZAE A;  4FWD A;  1QAO A;  4JN6 A;  3EIE A;  4MB7 A;  2XGN A;  3FUW A;  4YHH M;  2YR0 A;  3HJ8 A;  1IM2 A;  4GC5 A;  1C1K A;  2L7I A;  4MH0 E;  5IZ7 D;  4RNA A;  1L8Q A;  5EP4 A;  1ZQ9 A;  3GQ3 A;  4LF8 M;  5DNY A;  4B3R M;  4D81 A;  1GL7 A;  3J7B A;  8CAT A;  3SYL A;  3L2A A;  3HJQ A;  5LMN M;  1Z6T A;  3SAT A;  3M0E A;  1NNJ A;  3W0L B;  1DGG A;  3GPY A;  2C9C A;  3UGJ A;  3U60 B;  3KVW A;  4LF6 M;  4AKH A;  2C96 A;  4IBK A;  2KA6 B;  3FTC A;  5EP2 A;  3PVS A;  1K82 A;  3J7A S;  3TPZ A;  2XZU A;  3FTD A;  2VII A;  2DWL A;  3FUX A;  1J09 A;  1UM8 A;  4GMQ A;  2Z3X A;  1SXJ D;  1L2C A;  4FD2 A;  3C58 A;  2QEN A;  2OPF A;  4LZZ A;  1QAQ A;  4W5W A;  2UUA M;  5DYG A;  4RF1 A;  4LG2 A;  3HU2 A;  4JV5 M;  2X8A A;  2UU9 M;  4I5S A;  2Y20 A;  3VKG A;  1PJJ A;  2KRU A;  1R6B X;  3E9S A;  2F4V M;  2UUB M;  1IQP A;  3GLH B;  4LCB A;  4IBD A;  3KOW E;  5FTJ A;  3KP1 E;  1HQY E;  2A5Y B;  3FKE A;  1DO2 A;  4OVZ A;  1NHG C;  2BJV A;  4QHS A;  3CF2 A;  5EP1 A;  4B7G A;  4L4U A;  5KPT A;  4MGZ E;  4LFA M;  2CFO A;  2C9O A;  2FFJ A;  1TH3 A;  5EQT A;  2QBY A;  4PCZ A;  4LF5 M;  3AOE A;  1SXJ C;  2QBY B;  3EIH A;  3A98 B;  4R3D A;  4FWH A;  4JI8 M;  1NJF A;  1QAM A;  2XFS A;  1D2N A;  1LV7 A;  4FCV A;  1Q3C A;  4M0W A;  3RE8 A;  4JI6 M;  2R65 A;  3TWK A;  5JI2 E;  4I81 A;  2ZBK B;  4LF9 M;  4QHT A;  4GIT A;  7CAT A;  3J81 S;  2HCB A;  3U6S A;  3KSJ A;  1IXZ A;  3RGP A;  4AW4 A;  1IBK M;  2YNM D;  4M9X A;  2R4J A;  1SXJ B;  5C18 A;  2LWX A;  3GO8 A;  4OVZ B;  2R4E A;  5FTL A;  2UXD M;  3PFI A;  2LNH C;  3GRU A;  2DZO B;  3ILK A;  3AOG A;  1Z5B A;  1HT1 E;  1IY1 A;  2LH0 A;  4LRT A;  2QCU A;  1JR3 D;  1NY6 A;  3TE6 A;  3GLH A;  1G4A E;  4B08 A;  2V1C A;  1HNW M;  4GKJ M;  2YQZ A;  4X65 M;  3U5Z B;  3T38 A;  4DV3 M;  4LZJ A;  4GC9 A;  3HU1 A;  4GKK M;  5C1B A;  1Z59 A;  1XXH B;  2ZAO A;  1KSF X;  2E5L M;  1E9S A;  2BNK A;  2DWN A;  1XWI A;  3IG5 A;  3GQ4 A;  4I8O A;  3R9X B;  2X49 A;  5E6J A;  2QP9 X;  4QNM A;  3GPP A;  4JI2 M;  3M7G A;  4IBI A;  4GRI A;  1R2Y A;  4HLQ A;  4LJA A;  4FVM A;  1YE9 A;  4MGH A;  2Z4S A;  3U6E A;  4DV1 M;  1IBM M;  5KO3 A;  3U6C A;  1SXJ E;  3VDP A;  3FD9 A;  1R2Z A;  3KFU G;  1W5S A;  4MM3 B;  5F3W A;  5ITU A;  1T3T A;  3QWL A;  5BPV A;  4P16 A;  3SMP A;  3GRR A;  1QAN A;  1KFV A;  2DXI A;  1IN8 A;  5EXX A;  2VQF M;  2QZ4 A;  2D7H A;  1N34 M;  4DR2 M;  1I94 M;  1NVM A;  2ZAN A;  2I7N A;  2Z4R A;  3BOS A;  3GLF B;  3VFD A;  3U61 A;  3U6M A;  3SAV A;  3KOY E;  3LQR A;  3W0F A;  4PDG A;  2EA0 A;  4CGY B;  3TWL A;  4DV4 M;  1DGF A;  4WW0 A;  2DVW B;  2R62 A;  2XLJ A;  4NRW A;  1QYR A;  2EO2 A;  3LMM A;  2I7P A;  1IBL M;  3ZC7 B;  3JAM S;  1IN5 A;  2FOI C;  2RKO A;  5EXT A;  5FTK A;  2FE8 A;  4RF0 A;  1IN6 A;  4FW9 A;  3MJ5 A;  3L29 A;  1OJL A;  3A42 A;  2ERC A;  4AG5 A;  3UMM A;  3JR5 A;  2CV2 A;  2KXE A;  1IY0 A;  4MGI E;  4DV6 M;  2L09 A;  4JI7 M;  1NHW C;  1Q39 A;  1HR0 M;  1ORY B;  3IG8 A;  3GLG B;  4K0K M;  4LJ4 A;  2H1R A;  2W82 A;  4LFC M;  2UXB M;  1OFH A;  3GLG A;  2HL7 A;  2M5Z A;  4TUW A;  5ITR A;  1N36 M;  4B7F A;  4AKG A;  2BJW A;  2CUZ A;  4DR3 M;  2F5O A;  4OU7 A;  1MU5 A;  3NWL A;  1NNU C;  3HHZ A;  2DZN B;  5FTN A;  1GKI A;  4G4R A;  4LJ7 A;  2D7G A;  3ZH9 B;  1TGU A;  2RGO A;  4FWG A;  4IBF A;  2P5T A;  1L1Z A;  1K3W A;  4DV5 M;  1DGH A;  4JI3 M;  4AI6 A;  3I51 A;  4QOZ C;  2KRK A;  5KPR A;  2KEB A;  3L27 A;  3AL0 C;  5FTM A;  2F5P A;  3MHV C;  4PT5 A;  5DYI A;  4BLC A;  3NBI A;  2CHQ A;  3SHG B;  4MGY E;  1IY2 A;  3DA1 A;  5KQD A;  3CF6 E;  2V1U A;  3T1H M;  4BB9 A;  4JI5 M;  2XSZ D;  1FNN A;  3DFZ A;  5ITT A;  3K92 A;  4B3M M;  1J7K A;  4XGI A;  3HU3 A;  3T15 A;  3FUT A;  3AJI B;  3U6P A;  1YSY A;  3KP0 E;  3H4M A;  3Q8X A;  2KW0 A;  3HHX A;  5EXS A;  4G4Q A;  1TDH A;  5EJC A;  3VK7 A;  4M0D A;  4IBG A;  3K8Z A;  1GLN A;  3FTF A;  3TQS A;  5BR8 M;  3JR4 A;  1IN4 A;  3WHL A;  1JR3 A;  3HKP A;  1DGB A;  3HWS A;  3TWM A;  1WXQ A;  1E32 A;  5EXP A;  2XZF A;  3J80 S;  3FYC A;  1XNR M;  2X4A A;  3U61 B;  3U6L A;  4G4N A;  2Y0T A;  2KZU A;  4DR1 M;  5H37 D;  1MX0 A;  1N32 M;  3DZD A;  4L15 A;  2CEA A;  4G6Z A;  4M9S A;  3SMS A;  3A45 A;  3L25 A;  4DR6 M;  3T1Y M;  3KSX A;  5ITQ A;  4Z6Y A;  3GPU A;  3K2L A;  2OQ4 A;  2UXC M;  4NSR A;  4DV0 M;  2V6Z M;  1K3X A;  4IBC A;  3QAU A;  2VQE M;  4IJF A;  3J2P B;  4DR7 M;  4IJE A;  4PD2 A;  4Z8X A;  3J27 B;  3RGS A;  3SC3 A;  2K47 A;  3U6O A;  4IBE A;  4JXJ A;  2XF3 A;  4ZPX A;  4JI0 M;  3SAU A;  1N33 M;  4LJ9 A;  1KYI A;  2C5R A;  2F5N A;  1QZM A;  1W5T A;  3A46 A;  1GL6 A;  4LRS A;  4LJ8 A;  3THG A;  2UUC M;  2CV1 A;  4CHT B;  4REZ A;  4NXM M;  3DOA A;  3VKH A;  5LMU M;  1QQW A;  2XEP A;  1G59 A;  3GLF A;  1J5E M;  1R7R A;  4I4L A;  4LF7 M;  3HHW A;  4IBJ A;  3GLI B;  1XMQ M;  5IT9 S;  4NSO B;  2L6O A;  3LQQ A;  4NL4 H;  5FSW A;  2R18 A;  1TH4 A;  1N75 A;  4XBO A;  4D80 A;  4LGM A;  1HNZ M;  3U6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...