1XMOM

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 26
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1xmoM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1xmoM02
2VQFM 3J7AS 3T1HM 4NXMM 4JI4M 5IWAM 4LF6M 4DR6M 4PCZA 4DV2M 3U6CA 2F5PA 1Z5BA 4DV6M 4DV3M 3VK8A 3A46A 4X64M 4G4RA 4JV5M 5LMUM 4JI5M 3U6SA 4LF9M 2UUBM 3U6PA 1Z5AA 5BR8M 1HNXM 4OX9M 3GO8A 3U6LA 4DR3M 4X66M 2F4VM 4PDGA 3GPPA 1MX0A 1HR0M 2UU9M 4GKKM 4B3SM 1L2CA 4MB7A 2OPFA 4G4NA 1R2ZA 3GQ5A 4PD2A 1PM5A 3SAWA 5ITXA 4G4QA 3U6EA 2UUAM 3JR4A 3U6DA 2F5OA 3VK7A 3T1YM 3SASA 4AQYM 3GPUA 3SATA 1XC8A 4DR7M 4LF5M 4LFBM 4JI2M 2E5LM 1K3XA 4PDIA 1Z5CA 3DOAA 2F5QA 1TDHA 2ZM6M 3SAUA 2HKJA 4JI3M 3GP1A 3TWKA 3GQ4A 5LMNM 1K82A 3SARA 4DV0M 3U6OA 4JYAM 4JI6M 5A2QS 5ITYA 1XNRM 3U6MA 3TWMA 3GQ3A 4X62M 1N34M 4DR1M 1Q39A 4DUZM 4B3RM 4DR4M 1Z59A 1N36M 4ITQA 2EA0A 1R2YA 1IBLM 3C58A 2OQ4A 4JI1M 4LFCM 4DV4M 1XNQM 3GPXA 1XMOM 4NXNM 2F5NA 3JAMS 1EE8A 5ITTA 1IBKM 1N33M 5ITRA 4DV1M 1L2BA 4YHHM 4X65M 4DR2M 5IT9S 1MU5A 5ITQA 1L1TA 1TDZA 3SAVA 3J81S 4KHPM 4NRVA 4LF8M 2HHHM 1KFVA 3J80S 1XMQM 2ZBKB 2UXCM 4LFAM 4CISA 1IBMM 4JI0M 1NNJA 4JI7M 4NRWA 3JR5A 4JI8M 1Q3CA 4LF7M 2UXBM 3A42A 2XZFA 1PJIA 1J5EM 2F5SA 5FLXS 5ITXE 4GKJM 4B3MM 1L2DA 5ITUA 3W0FA 2VQEM 1L1ZA 1Q3BA 1K3WA 4K0KM 3A45A 2UUCM 4DR5M 4LF4M 3TWLA 1PJJA 1N32M 4YY3M 4B3TM 4DV5M 2XZUA 3U6QA 1I94M 1HNWM 4G4OA 1HNZM 3OTOM 3SBJA 1FJGM 3GPYA 2UXDM 2Q2EB 4DV7M 4DUYM
chains in the Genus database with same CATH superfamily
2VQFM 1IY0A 5EP2A 1HT2E 3PXGA 5IWAM 4LF6M 1P3QQ 3I01M 4DR6M 5FTMA 4NSRA 2CV1A 4PCZA 8CATA 4BLCA 3U6CA 1PRBA 4MGHA 2H5XA 4I81A 2R4EA 2RRUA 4L6V6 1LTMA 2DKLA 4KODA 3A46A 4X64M 4JV5M 2Y0QA 4LF9M 5KPZA 2UUBM 3IG8A 1GL7A 1WJ7A 5BR8M 1HNXM 2KEBA 2LHCA 3TL4X 4LJ4A 1DO0A 2Z4RA 3PNYA 3T15A 3K9OA 4FWDA 4M9XA 4MM3B 1KSFX 4B08A 5EXTA 4G4NA 1R2ZA 4IJFA 1G59A 2VDBB 1QAMA 1OAOC 3SAWA 3T38A 3AJIB 1C1KA 3QWLA 4GC9A 4IIWA 3SHFA 2LTUA 5EJCA 2O01F 3GRYA 4BBAA 1TH4A 3SATA 3BOSA 2KDLA 3E9SA 1C7YA 4LF5M 1XB2B 2KRUA 1YSYA 1K3XA 1E32A 4PDIA 1VEJA 1XWIA 3KW6A 4II7A 3TE6A 2LBCA 2F5QA 1QDTA 1IN5A 2JY8A 3C9PA 3HHXA 1PJQA 2Y21A 2ZM6M 3NBXX 3GP1A 3MK6A 3SMPA 2WSFF 3L2AA 3TWKA 5LMNM 4RF0A 1OIZA 1ZMVA 1AUAA 1WGLA 5DYIA 1N78A 5BPVA 5ITYA 2LXEA 3BBZA 4FVMA 1NJGA 1G8PA 1DGFA 2MGWA 3C3EA 1QVRA 2NQ8C 2K0BX 4HEOA 4AG5A 1R5LA 2M5ZA 2R62A 3B74A 3FE3A 1VQ1A 1W5TA 1IFYA 2LNHC 3IG5A 1F4IA 3U61A 1NY6A 2HCBA 4Z6YA 2Z4SA 2Z8YM 2F5NA 4AW4A 1VG5A 5ITTA 5ITRA 2DI0A 3SFZA 5FTKA 4AG6A 4LJAA 2CHQA 4DR2M 3HKPA 3DFZA 3UJNA 1V33A 5ITQA 2CUZA 2LH0A 2LVPC 1D2NA 2KNAA 1QDRA 3EIHA 2CFOA 3CF0A 3KOWE 3K92A 3QYBA 2K47A 3FD9A 3ZC7B 4P16A 3ZH9B 2CP8A 3F92A 4LJ6A 1DO2A 5EP3A 3JR5A 4KLNA 2UXBM 1SXJC 3FTFA 1E9RA 1L8QA 1SG9A 2EO2A 3A42A 1J5EM 2QBYA 3LCUA 1DGBA 3HU2A 4LJ7A 4FWGA 1G71A 3FUWA 2DENA 2QENA 2C99A 3M7GA 1N75A 4DR5M 2JP7A 4YY3M 3J2PB 1DGHA 3HJ8A 2FE8A 3U6QA 4L78A 2YQZA 4FWHA 3KP0E 3HJSA 4B7GA 3OTOM 2L7HA 2KHHA 2Q2EB 4DV7M 4DUYM 2ZTDA 4NXMM 1HQCA 1NVMA 4JI4M 3FYCA 4Z8XA 3GLGA 2DXIA 4RKUF 1IXSB 2D7GA 3ZQJA 3UZUA 3ILKA 3PNVA 3GRUA 2OOAA 4R7GA 5JI3E 5EP1A 2J5YA 3B89A 4XBOA 3HHYA 4DV3M 3VK8A 1QZMA 4L15A 3D8BA 3GRRA 3LQQA 2LVNC 2EKKA 4WURA 2KZSA 5C18A 5LMUM 1T6OA 1VDDA 2QCUA 3ZCBB 4GHAA 3R8FA 2DZNB 2ERCA 4NL4H 2QNJA 3KVWA 2R44A 4LRTA 3J7BA 2ZTCA 1V34A 3SYLA 3LVVA 4WW0A 4DR3M 3U6LA 2F4VM 4GHLA 3DA1A 3FYDA 4JN6A 1GJSA 1TTEA 1MX0A 1G3IA 4NSOB 4DBGB 4OW0A 1IXRC 2UU9M 2X49A 3V76A 4MB7A 1NV9A 2JUJA 2CHVA 1VEKA 3CF6E 4TUWA 3I4YA 1PM5A 1YUBA 1IN4A 5FTLA 2N35A 3T1YM 2CEAA 5DYGA 4M0WA 1NJFA 3FRIA 2LHGA 1ZQ9A 5EXXA 1X37A 2E5LM 1GVNA 1IY2A 3NWLA 3GLHE 4D80A 1Z5CA 4AKGA 1SXJA 1EFUB 1NHGC 1J7KA 3SMSA 3SAUA 3SAVA 3KS8A 4XGIA 2BWEA 5JI2E 1GABA 1TF0B 3SARA 3VKGA 4DV0M 4F1IA 1XHBA 3U6OA 4JYAM 2FH0A 4QOSA 3T6PA 3FUUA 2BWBA 1AIPC 2JNHA 2VIIA 5A2QS 4CJ6A 1ZMUA 1WIVA 3KS4A 4IBDA 3GQ3A 1XXHA 3W0LB 3VDUA 2KW0A 4X62M 4DR1M 3TWMA 1N34M 3MJ5A 3HY5A 4OVZA 1SXJD 3KOYE 3KXEC 3PVSA 1VEGA 3QAUA 4LY6A 3AOEC 3CTWB 2ZAOA 4MGKE 1IN8A 2EA0A 1R2YA 2QZ4A 4JI1M 1XNQM 4DV4M 3K8ZA 3RGPA 3Q8XA 4B7FA 2QSFX 1DGHB 2XEPA 4NXNM 1OFIA 1EE8A 2WSCF 3AOEA 1IBKM 2R46A 4YHHM 2QP9X 4G6ZA 3U61B 5E6JA 2JWSA 3GLHB 3H4MA 1RU3A 2I7NA 4IBFA 1TDZA 3AOGA 4IBKA 4B7HA 1Y8GA 3J81S 4LF8M 2L2DA 2RGHA 3L26A 1KFVA 4GRIA 3FKEA 3AL0C 2UXCM 3HU3A 1IBMM 2P5TA 4JI0M 2EUCA 4FD2A 2GQFA 1NNJA 3UMMA 4AI6A 1D0MA 2VF8A 4I5SA 4IJEA 4QHSA 1HT1E 4JI8M 1JB0F 3LMMA 3W68A 1W5SA 3GLIA 4QOZC 3K9PA 4OU7A 3PFIA 4EIWA 1PJIA 5ITXE 4GKJM 1QANA 1L2DA 5ITUA 4UN2B 4WP2A 1GJTA 1NO1A 4D82A 5KO3A 1CUKA 1Q3BA 3FUVA 3MHVC 1OQYA 1PJSA 1NY5A 2VF7A 3A45A 3K1JA 2FNAA 3TWLA 1PJJA 2UUCM 4LF4M 4HL4A 1N32M 2KA6B 4NOOB 4LCBA 5EXSA 1I94M 5DFLA 2DAGA 1HJPA 4R3DA 4ZPXA 3VLFB 4AKIA 2OOBA 5F3WA 2O5RA 3SBJA 3GPYA 4MH0E 1R7RA 4Q7JA 4GIPA 2JY6B 3U5ZA 1D0KA 3J7AS 2Z7JA 4QNMA 1JR3A 1NSFA 2MROB 1MN3A 2F5PA 1A5TA 1Z5BA 2DHRA 2BJVA 3W67A 1UFZA 1WXQA 2HL7A 3AV0A 1GKIA 2X8AA 1IXSA 3C3DA 2XGNA 2WSEF 3U6SA 2D7EA 1OAIA 2B3TA 2KNVA 3IECA 2DZLA 3L29A 4KT0F 2DVWB 3KFUG 2FFJA 1JR3D 1OIPA 2HWJA 2DNAA 4OX9M 1DGGA 2G5GX 1IN7A 2KNZA 3GPPA 1H6UA 2K6BA 4IBJA 4GKKM 4B3SM 3VDPA 4AKHA 2V1CA 1OTRA 3UGJA 3GQ5A 2ZAMA 2XFSA 4R71A 5ITXA 4G4QA 3U6EA 2UUAM 3JR4A 3U6DA 4LRSA 2CWBA 3VK7A 2F5OA 3FRHA 3SYKA 4L16A 3A98B 4IBBA 3SASA 3U5ZB 1WR1B 4IBGA 1D0LA 1XC8A 2D7HA 4IBEA 3K2LA 3GLFE 2JY5A 1V92A 5KPTA 2JA2A 4FCWA 3DOAA 1IQPA 2XF3A 4D81A 1TDHA 3Q8GA 3J27B 2RKOA 1PGYA 2QHOB 2HKJA 3UK6A 4G4RA 4GMQA 1K82A 4JI6M 3CF2A 5IZ7D 2KZUA 2JZ1A 4B3RM 2LVQD 1Z59A 1R4GA 4W5WA 3I4VA 3NBIA 1N36M 2HAKA 4F2LA 3B7QA 2CRUA 4LZZA 4LFCM 1G41A 4MGIE 4G3OA 3AFHA 3TPZA 3CGWA 5KQDA 3C58A 2OQ4A 5EXPA 3GPXA 3HGIA 2X4AA 2BNKA 1BVSA 3L28A 1XXHE 1IM2A 4A3VB 4M0DA 1N77A 1OKSA 4DV1M 1L2BA 5EQTA 3TQSA 4GITA 3KSXA 4X65M 1TR8A 1MU5A 3HHWA 1SXJB 1QZEA 2C96A 1ZMWA 2KXEA 2EKFA 5L8RF 3J80S 2MJ5B 1XMQM 2ZBKB 3GLHA 1GO5A 3HX3A 2QPAA 2O25A 2G3QA 1ORYB 5H37D 2YNMD 3HJQA 3LQRA 4Y28F 1DV0A 1IXZA 1Q3CA 3R9XB 3H4JA 1JQJC 3I51A 2W82A 2F5SA 2CV2A 2H1RA 2XH9A 4B3MM 1MJGM 3B7ZA 1QUTA 4LGMA 4M9SA 3W0FA 2LVAA 2VQEM 1L1ZA 3LCVB 5EP4A 1HQYE 2YR0A 1K3WA 3FTDA 2JY7A 4K0KM 2FS1A 1IY1A 3GLIE 3EIEA 1E9SA 2L7IA 3GRVA 2R6FA 2L6OA 5FSWA 4RF1A 2JXNA 4I8OA 1SXJE 1HNZM 1T3TA 2DAKA 2K9DA 1JR3E 4QNRA 4GH9A 5FTJA 2FOIC 7CATA 3T1HM 3KDSE 1EIJA 3VFDA 2AHMA 3M6AA 3WHLA 4BB9A 2CV0A 1OJLA 4DV2M 1NHWC 2GNOA 2LWXA 3THGA 4DV6M 3U60A 2CE7A 3RE8A 1PJTA 4P17A 3VKHA 1LV7A 1WGNA 2Y20A 3RGSA 3U60B 4JI5M 1S3SA 3QYEA 1J09A 1NV8A 3U6PA 2OO9A 3WHKA 1Z5AA 4MGYE 3GO8A 1Q02A 4X66M 1XXHB 4PDGA 3AKZA 2MR9A 4GC5A 1E94E 1HR0M 3LW5F 4LJ9A 3GLFB 1QAQA 2XSZA 4FCVA 3MMPA 2C9OA 3BXWA 4S12A 3E21A 4KO8A 3HWSA 2RGOA 1L2CA 2OPFA 4CHTB 2Z3XA 1T43A 1ZAEA 4PD2A 1QUSA 2YFQA 3GLFA 4FW9A 4L8RC 3E4RA 3L27A 3LVWA 3FUTA 4HLQA 2R18A 4AQYM 3GPUA 1QAOA 3M0EA 3HHZA 4LJ8A 4DR7M 3GLGB 4LFBM 1G4AE 2DWLA 4JI2M 2ZANA 4LGYA 1ZV1A 2J7NA 4CIZA 4RNAA 2MH8A 5C1BA 2CHGA 3SC3A 1R6BX 5GKNA 4JI3M 3KSJA 5IREB 2JZ0A 2DAMA 3GQ4A 2G8LA 1YE9A 3FUXA 1I4WA 4OVZB 4LJ5A 4NC6A 2R65A 1KYIA 3KP1E 1XNRM 3GLIB 3U6MA 4PT5A 3HZJA 1Q39A 4LZJA 3SHGB 4DUZM 4DR4M 3RFWA 3B9PA 2XLJA 1QQWA 3I04M 2LVOC 1VDLA 2EJSA 5DNYA 3E46A 1YLAA 5KPRA 2DHYA 4ITQA 1IBLM 4L4UA 1WHCA 4JXJA 2R4JA 3D8LA 2C98A 4MGZE 1XMOM 3L25A 1FNNA 3GLGE 2DWNA 4LG2A 4ANRA 3JAMS 1N33M 2C5RA 2DAEA 3KOZE 1OFHA 1Z6TA 2J7OA 5IT9S 1L1TA 4GEWA 2DWZB 2DWMA 4XK8F 4KHPM 4NRVA 2L09A 2HHHM 2V1UA 2L4FA 2I7PA 4LFAM 4CISA 2KRKA 4I4LA 4JI7M 4CGYB 4NRWA 1UM8A 4REZA 4AZFA 3IHPA 4LF7M 1IN6A 1QYRA 1TH3A 3FTCA 5E26A 2A5YB 5FTNA 3KOXE 2XZFA 2WZJA 2DAIA 5FLXS 1NNUC 5KQ8A 2DZOB 4IBIA 3HU1A 2Y0TA 4M9ZA 2R0IA 3DZDA 4IBCA 4QHTA 2R45A 1TH2A 3B7NA 2QBYB 1TGUA 2APLA 2XFTA 2L4EA 4B3TM 2QQ8A 4FCTA 2BJWA 4DV5M 2XZUA 1GL6A 3FTEA 1HNWM 4G4OA 1GLNA 2C9CA 2M60A 1FJGM 2XSZD 2UXDM 2V6ZM
chains in the Genus database with same CATH topology
2VQFM 1IY0A 5EP2A 1HT2E 3PXGA 5IWAM 4LF6M 4DR6M 5FTMA 4NSRA 2CV1A 4PCZA 8CATA 4BLCA 3U6CA 4MGHA 4I81A 2R4EA 4KODA 3A46A 4X64M 4JV5M 2Y0QA 4LF9M 5KPZA 2UUBM 3IG8A 1GL7A 5BR8M 1HNXM 2KEBA 3TL4X 4LJ4A 1DO0A 2Z4RA 3PNYA 3T15A 4FWDA 4M9XA 4MM3B 1KSFX 4B08A 5EXTA 4G4NA 1R2ZA 4IJFA 1G59A 1QAMA 3SAWA 3T38A 3AJIB 1C1KA 3QWLA 4GC9A 4IIWA 3SHFA 5EJCA 4BBAA 3GRYA 1TH4A 3SATA 3BOSA 3E9SA 4LF5M 2KRUA 1YSYA 1K3XA 1E32A 4PDIA 1XWIA 3KW6A 4II7A 3TE6A 2F5QA 1IN5A 3HHXA 2Y21A 2ZM6M 3GP1A 3MK6A 3SMPA 3L2AA 3TWKA 5LMNM 4RF0A 5DYIA 1N78A 5BPVA 5ITYA 2LXEA 4FVMA 1NJGA 1G8PA 1DGFA 1QVRA 2NQ8C 4AG5A 2M5ZA 2R62A 1W5TA 2LNHC 3IG5A 3U61A 1NY6A 2HCBA 4Z6YA 2Z4SA 2F5NA 4AW4A 5ITTA 5ITRA 3SFZA 5FTKA 4AG6A 4LJAA 2CHQA 4DR2M 3HKPA 3DFZA 3UJNA 5ITQA 2CUZA 2LH0A 1D2NA 3SAVA 3EIHA 2CFOA 3CF0A 3KOWE 3K92A 3ZC7B 2K47A 3FD9A 4P16A 3ZH9B 4LJ6A 1DO2A 5EP3A 3JR5A 4KLNA 2UXBM 1SXJC 3FTFA 1E9RA 1L8QA 2EO2A 3A42A 1J5EM 2QBYA 1DGBA 3HU2A 4LJ7A 4FWGA 3FUWA 2QENA 2C99A 3M7GA 1N75A 4DR5M 4YY3M 3J2PB 1DGHA 3HJ8A 2FE8A 3U6QA 4L78A 2YQZA 4FWHA 3KP0E 3HJSA 4B7GA 3OTOM 2L7HA 2Q2EB 4DV7M 4DUYM 4NXMM 1HQCA 1NVMA 4JI4M 3FYCA 4Z8XA 3GLGA 2DXIA 1IXSB 2D7GA 3UZUA 3ILKA 3PNVA 3GRUA 4R7GA 5JI3E 5EP1A 3HHYA 4XBOA 4DV3M 3VK8A 1QZMA 4L15A 3D8BA 3GRRA 3LQQA 4WURA 5C18A 4G4RA 2KZSA 5LMUM 1VDDA 2QCUA 4GHAA 3ZCBB 3R8FA 2DZNB 2ERCA 4NL4H 3KVWA 4LRTA 3J7BA 3SYLA 3LVVA 4WW0A 4DR3M 3U6LA 2F4VM 4GHLA 3DA1A 3FYDA 4JN6A 1MX0A 1G3IA 4NSOB 4OW0A 1IXRC 2UU9M 2X49A 4MB7A 2CHVA 3CF6E 4TUWA 3I4YA 1PM5A 1YUBA 1IN4A 5FTLA 3T1YM 2CEAA 5DYGA 4M0WA 1NJFA 1ZQ9A 5EXXA 1X37A 2E5LM 1GVNA 1IY2A 3NWLA 4D80A 1Z5CA 4AKGA 1SXJA 1NHGC 1J7KA 3SMSA 3SAUA 3KS8A 4XGIA 5JI2E 3SARA 3VKGA 4DV0M 3U6OA 1XHBA 4JYAM 4QOSA 3FUUA 5A2QS 2VIIA 3KS4A 4IBDA 3GQ3A 1XXHA 3W0LB 3VDUA 2KW0A 4X62M 4DR1M 3TWMA 1N34M 3MJ5A 4OVZA 3QAUA 3PVSA 1SXJD 3KOYE 3KXEC 4LY6A 3AOEC 3CTWB 2ZAOA 4MGKE 1IN8A 2EA0A 1R2YA 2QZ4A 4JI1M 1XNQM 4DV4M 3K8ZA 3RGPA 3Q8XA 4B7FA 1DGHB 2XEPA 4NXNM 1OFIA 1EE8A 3AOEA 1IBKM 2R46A 4YHHM 2QP9X 4G6ZA 3U61B 5E6JA 3GLHB 3H4MA 2I7NA 4IBFA 1TDZA 3AOGA 4IBKA 4B7HA 3J81S 4LF8M 2RGHA 3L26A 1KFVA 4GRIA 3FKEA 3AL0C 2UXCM 3HU3A 1IBMM 2P5TA 4JI0M 2EUCA 4FD2A 1NNJA 3UMMA 4AI6A 4I5SA 4IJEA 4QHSA 1HT1E 4JI8M 3LMMA 3GLIA 1W5SA 4QOZC 4OU7A 3PFIA 4EIWA 1PJIA 5ITXE 4GKJM 1QANA 1L2DA 5ITUA 4D82A 5KO3A 3FUVA 1Q3BA 3MHVC 3A45A 3K1JA 1NY5A 2UUCM 4LF4M 2FNAA 3TWLA 1PJJA 1N32M 4HL4A 2KA6B 4NOOB 4LCBA 5EXSA 1I94M 4ZPXA 4R3DA 3VLFB 4AKIA 5F3WA 2O5RA 3SBJA 3GPYA 4MH0E 1R7RA 4GIPA 3U5ZA 3J7AS 2Z7JA 4QNMA 1JR3A 1NSFA 2F5PA 1Z5BA 2DHRA 2BJVA 1WXQA 2HL7A 3AV0A 1GKIA 2X8AA 2XGNA 3U6SA 2D7EA 3L29A 2DVWB 3KFUG 2FFJA 1JR3D 4OX9M 1DGGA 2G5GX 1IN7A 3GPPA 1H6UA 4IBJA 4GKKM 4B3SM 3VDPA 4AKHA 2V1CA 3UGJA 3GQ5A 2ZAMA 2XFSA 5ITXA 4G4QA 3U6EA 2UUAM 3JR4A 3U6DA 4LRSA 3VK7A 2F5OA 3SYKA 3SASA 4L16A 3A98B 4IBBA 3U5ZB 4IBGA 1XC8A 2D7HA 4IBEA 3K2LA 5KPTA 2JA2A 4FCWA 3DOAA 1IQPA 2XF3A 4D81A 1TDHA 3J27B 2RKOA 2HKJA 3UK6A 1K82A 4GMQA 4JI6M 3CF2A 5IZ7D 2KZUA 4B3RM 1Z59A 4W5WA 3I4VA 3NBIA 1N36M 4LZZA 4LFCM 1G41A 4MGIE 5KQDA 3AFHA 3TPZA 3C58A 2OQ4A 5EXPA 3GPXA 3HGIA 2X4AA 2BNKA 3L28A 4A3VB 1IM2A 4M0DA 1N77A 4DV1M 1L2BA 5EQTA 3TQSA 4GITA 3KSXA 4X65M 1MU5A 3HHWA 1SXJB 2C96A 2KXEA 3J80S 1XMQM 2ZBKB 3GLHA 2QPAA 1ORYB 5H37D 2YNMD 3HJQA 3LQRA 1IXZA 1Q3CA 3R9XB 1JQJC 3I51A 2W82A 2F5SA 2CV2A 2H1RA 2XH9A 4B3MM 4M9SA 4LGMA 3W0FA 2VQEM 1L1ZA 5EP4A 1HQYE 2YR0A 1K3WA 3FTDA 4K0KM 1IY1A 3EIEA 1E9SA 2L7IA 3GRVA 2L6OA 5FSWA 4RF1A 4I8OA 1HNZM 1SXJE 1T3TA 4QNRA 4GH9A 5FTJA 2FOIC 7CATA 3T1HM 3KDSE 3VFDA 2AHMA 3M6AA 3WHLA 4BB9A 2CV0A 1OJLA 4DV2M 1NHWC 2LWXA 3THGA 4DV6M 3U60A 2CE7A 3RE8A 3VKHA 1LV7A 2Y20A 3U60B 3RGSA 4JI5M 1S3SA 1J09A 3U6PA 3WHKA 1Z5AA 4MGYE 3GO8A 4X66M 1XXHB 4PDGA 3AKZA 4GC5A 1E94E 1HR0M 3GLFB 4LJ9A 1QAQA 2XSZA 4FCVA 2C9OA 4S12A 4KO8A 3HWSA 2RGOA 1L2CA 2OPFA 4CHTB 2Z3XA 4PD2A 1ZAEA 2YFQA 3GLFA 4FW9A 4L8RC 3E4RA 3L27A 3LVWA 3FUTA 4HLQA 2R18A 4AQYM 3GPUA 1QAOA 3M0EA 3HHZA 4LJ8A 4DR7M 3GLGB 4LFBM 1G4AE 2DWLA 4JI2M 2ZANA 4LGYA 2J7NA 4RNAA 5C1BA 2CHGA 3SC3A 1R6BX 5GKNA 4JI3M 3KSJA 5IREB 3GQ4A 2G8LA 1YE9A 3FUXA 1I4WA 4OVZB 4LJ5A 2R65A 1KYIA 3KP1E 1XNRM 3GLIB 3U6MA 4PT5A 4LZJA 1Q39A 4DUZM 3SHGB 4DR4M 3RFWA 3B9PA 2XLJA 1QQWA 5DNYA 5KPRA 4ITQA 1IBLM 4L4UA 4JXJA 2R4JA 3D8LA 2C98A 4MGZE 1XMOM 3L25A 1FNNA 2DWNA 4LG2A 3JAMS 1N33M 2C5RA 3KOZE 1OFHA 1Z6TA 2J7OA 5IT9S 1L1TA 2DWZB 2DWMA 4KHPM 4NRVA 2L09A 2HHHM 2V1UA 2I7PA 4LFAM 4CISA 2KRKA 4I4LA 4JI7M 4CGYB 4NRWA 1UM8A 4REZA 4AZFA 4LF7M 1IN6A 3FTCA 1QYRA 1TH3A 5E26A 2A5YB 5FTNA 3KOXE 2XZFA 5FLXS 1NNUC 5KQ8A 2DZOB 4IBIA 3HU1A 2Y0TA 4M9ZA 3DZDA 4IBCA 4QHTA 2R45A 1TH2A 2QBYB 1TGUA 2XFTA 4B3TM 4DV5M 4FCTA 2BJWA 2XZUA 1GL6A 3FTEA 1HNWM 4G4OA 1GLNA 2C9CA 2M60A 1FJGM 2XSZD 2UXDM 2V6ZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF M;  3J7A S;  3T1H M;  4NXM M;  4JI4 M;  5IWA M;  4LF6 M;  4DR6 M;  4PCZ A;  4DV2 M;  3U6C A;  2F5P A;  1Z5B A;  4DV6 M;  4DV3 M;  3VK8 A;  3A46 A;  4X64 M;  4G4R A;  4JV5 M;  5LMU M;  4JI5 M;  3U6S A;  4LF9 M;  2UUB M;  3U6P A;  1Z5A A;  5BR8 M;  1HNX M;  4OX9 M;  3GO8 A;  3U6L A;  4DR3 M;  4X66 M;  2F4V M;  4PDG A;  3GPP A;  1MX0 A;  1HR0 M;  2UU9 M;  4GKK M;  4B3S M;  1L2C A;  4MB7 A;  2OPF A;  4G4N A;  1R2Z A;  3GQ5 A;  4PD2 A;  1PM5 A;  3SAW A;  5ITX A;  4G4Q A;  3U6E A;  2UUA M;  3JR4 A;  3U6D A;  2F5O A;  3VK7 A;  3T1Y M;  3SAS A;  4AQY M;  3GPU A;  3SAT A;  1XC8 A;  4DR7 M;  4LF5 M;  4LFB M;  4JI2 M;  2E5L M;  1K3X A;  4PDI A;  1Z5C A;  3DOA A;  2F5Q A;  1TDH A;  2ZM6 M;  3SAU A;  2HKJ A;  4JI3 M;  3GP1 A;  3TWK A;  3GQ4 A;  5LMN M;  1K82 A;  3SAR A;  4DV0 M;  3U6O A;  4JYA M;  4JI6 M;  5A2Q S;  5ITY A;  1XNR M;  3U6M A;  3TWM A;  3GQ3 A;  4X62 M;  1N34 M;  4DR1 M;  1Q39 A;  4DUZ M;  4B3R M;  4DR4 M;  1Z59 A;  1N36 M;  4ITQ A;  2EA0 A;  1R2Y A;  1IBL M;  3C58 A;  2OQ4 A;  4JI1 M;  4LFC M;  4DV4 M;  1XNQ M;  3GPX A;  1XMO M;  4NXN M;  2F5N A;  3JAM S;  1EE8 A;  5ITT A;  1IBK M;  1N33 M;  5ITR A;  4DV1 M;  1L2B A;  4YHH M;  4X65 M;  4DR2 M;  5IT9 S;  1MU5 A;  5ITQ A;  1L1T A;  1TDZ A;  3SAV A;  3J81 S;  4KHP M;  4NRV A;  4LF8 M;  2HHH M;  1KFV A;  3J80 S;  1XMQ M;  2ZBK B;  2UXC M;  4LFA M;  4CIS A;  1IBM M;  4JI0 M;  1NNJ A;  4JI7 M;  4NRW A;  3JR5 A;  4JI8 M;  1Q3C A;  4LF7 M;  2UXB M;  3A42 A;  2XZF A;  1PJI A;  1J5E M;  2F5S A;  5FLX S;  5ITX E;  4GKJ M;  4B3M M;  1L2D A;  5ITU A;  3W0F A;  2VQE M;  1L1Z A;  1Q3B A;  1K3W A;  4K0K M;  3A45 A;  2UUC M;  4DR5 M;  4LF4 M;  3TWL A;  1PJJ A;  1N32 M;  4YY3 M;  4B3T M;  4DV5 M;  2XZU A;  3U6Q A;  1I94 M;  1HNW M;  4G4O A;  1HNZ M;  3OTO M;  3SBJ A;  1FJG M;  3GPY A;  2UXD M;  2Q2E B;  4DV7 M;  4DUY M; 
#chains in the Genus database with same CATH topology
 2VQF M;  1IY0 A;  5EP2 A;  1HT2 E;  3PXG A;  5IWA M;  4LF6 M;  1P3Q Q;  3I01 M;  4DR6 M;  5FTM A;  4NSR A;  2CV1 A;  4PCZ A;  8CAT A;  4BLC A;  3U6C A;  1PRB A;  4MGH A;  2H5X A;  4I81 A;  2R4E A;  2RRU A;  4L6V 6;  1LTM A;  2DKL A;  4KOD A;  3A46 A;  4X64 M;  4JV5 M;  2Y0Q A;  4LF9 M;  5KPZ A;  2UUB M;  3IG8 A;  1GL7 A;  1WJ7 A;  5BR8 M;  1HNX M;  2KEB A;  2LHC A;  3TL4 X;  4LJ4 A;  1DO0 A;  2Z4R A;  3PNY A;  3T15 A;  3K9O A;  4FWD A;  4M9X A;  4MM3 B;  1KSF X;  4B08 A;  5EXT A;  4G4N A;  1R2Z A;  4IJF A;  1G59 A;  2VDB B;  1QAM A;  1OAO C;  3SAW A;  3T38 A;  3AJI B;  1C1K A;  3QWL A;  4GC9 A;  4IIW A;  3SHF A;  2LTU A;  5EJC A;  2O01 F;  3GRY A;  4BBA A;  1TH4 A;  3SAT A;  3BOS A;  2KDL A;  3E9S A;  1C7Y A;  4LF5 M;  1XB2 B;  2KRU A;  1YSY A;  1K3X A;  1E32 A;  4PDI A;  1VEJ A;  1XWI A;  3KW6 A;  4II7 A;  3TE6 A;  2LBC A;  2F5Q A;  1QDT A;  1IN5 A;  2JY8 A;  3C9P A;  3HHX A;  1PJQ A;  2Y21 A;  2ZM6 M;  3NBX X;  3GP1 A;  3MK6 A;  3SMP A;  2WSF F;  3L2A A;  3TWK A;  5LMN M;  4RF0 A;  1OIZ A;  1ZMV A;  1AUA A;  1WGL A;  5DYI A;  1N78 A;  5BPV A;  5ITY A;  2LXE A;  3BBZ A;  4FVM A;  1NJG A;  1G8P A;  1DGF A;  2MGW A;  3C3E A;  1QVR A;  2NQ8 C;  2K0B X;  4HEO A;  4AG5 A;  1R5L A;  2M5Z A;  2R62 A;  3B74 A;  3FE3 A;  1VQ1 A;  1W5T A;  1IFY A;  2LNH C;  3IG5 A;  1F4I A;  3U61 A;  1NY6 A;  2HCB A;  4Z6Y A;  2Z4S A;  2Z8Y M;  2F5N A;  4AW4 A;  1VG5 A;  5ITT A;  5ITR A;  2DI0 A;  3SFZ A;  5FTK A;  4AG6 A;  4LJA A;  2CHQ A;  4DR2 M;  3HKP A;  3DFZ A;  3UJN A;  1V33 A;  5ITQ A;  2CUZ A;  2LH0 A;  2LVP C;  1D2N A;  2KNA A;  1QDR A;  3EIH A;  2CFO A;  3CF0 A;  3KOW E;  3K92 A;  3QYB A;  2K47 A;  3FD9 A;  3ZC7 B;  4P16 A;  3ZH9 B;  2CP8 A;  3F92 A;  4LJ6 A;  1DO2 A;  5EP3 A;  3JR5 A;  4KLN A;  2UXB M;  1SXJ C;  3FTF A;  1E9R A;  1L8Q A;  1SG9 A;  2EO2 A;  3A42 A;  1J5E M;  2QBY A;  3LCU A;  1DGB A;  3HU2 A;  4LJ7 A;  4FWG A;  1G71 A;  3FUW A;  2DEN A;  2QEN A;  2C99 A;  3M7G A;  1N75 A;  4DR5 M;  2JP7 A;  4YY3 M;  3J2P B;  1DGH A;  3HJ8 A;  2FE8 A;  3U6Q A;  4L78 A;  2YQZ A;  4FWH A;  3KP0 E;  3HJS A;  4B7G A;  3OTO M;  2L7H A;  2KHH A;  2Q2E B;  4DV7 M;  4DUY M;  2ZTD A;  4NXM M;  1HQC A;  1NVM A;  4JI4 M;  3FYC A;  4Z8X A;  3GLG A;  2DXI A;  4RKU F;  1IXS B;  2D7G A;  3ZQJ A;  3UZU A;  3ILK A;  3PNV A;  3GRU A;  2OOA A;  4R7G A;  5JI3 E;  5EP1 A;  2J5Y A;  3B89 A;  4XBO A;  3HHY A;  4DV3 M;  3VK8 A;  1QZM A;  4L15 A;  3D8B A;  3GRR A;  3LQQ A;  2LVN C;  2EKK A;  4WUR A;  2KZS A;  5C18 A;  5LMU M;  1T6O A;  1VDD A;  2QCU A;  3ZCB B;  4GHA A;  3R8F A;  2DZN B;  2ERC A;  4NL4 H;  2QNJ A;  3KVW A;  2R44 A;  4LRT A;  3J7B A;  2ZTC A;  1V34 A;  3SYL A;  3LVV A;  4WW0 A;  4DR3 M;  3U6L A;  2F4V M;  4GHL A;  3DA1 A;  3FYD A;  4JN6 A;  1GJS A;  1TTE A;  1MX0 A;  1G3I A;  4NSO B;  4DBG B;  4OW0 A;  1IXR C;  2UU9 M;  2X49 A;  3V76 A;  4MB7 A;  1NV9 A;  2JUJ A;  2CHV A;  1VEK A;  3CF6 E;  4TUW A;  3I4Y A;  1PM5 A;  1YUB A;  1IN4 A;  5FTL A;  2N35 A;  3T1Y M;  2CEA A;  5DYG A;  4M0W A;  1NJF A;  3FRI A;  2LHG A;  1ZQ9 A;  5EXX A;  1X37 A;  2E5L M;  1GVN A;  1IY2 A;  3NWL A;  3GLH E;  4D80 A;  1Z5C A;  4AKG A;  1SXJ A;  1EFU B;  1NHG C;  1J7K A;  3SMS A;  3SAU A;  3SAV A;  3KS8 A;  4XGI A;  2BWE A;  5JI2 E;  1GAB A;  1TF0 B;  3SAR A;  3VKG A;  4DV0 M;  4F1I A;  1XHB A;  3U6O A;  4JYA M;  2FH0 A;  4QOS A;  3T6P A;  3FUU A;  2BWB A;  1AIP C;  2JNH A;  2VII A;  5A2Q S;  4CJ6 A;  1ZMU A;  1WIV A;  3KS4 A;  4IBD A;  3GQ3 A;  1XXH A;  3W0L B;  3VDU A;  2KW0 A;  4X62 M;  4DR1 M;  3TWM A;  1N34 M;  3MJ5 A;  3HY5 A;  4OVZ A;  1SXJ D;  3KOY E;  3KXE C;  3PVS A;  1VEG A;  3QAU A;  4LY6 A;  3AOE C;  3CTW B;  2ZAO A;  4MGK E;  1IN8 A;  2EA0 A;  1R2Y A;  2QZ4 A;  4JI1 M;  1XNQ M;  4DV4 M;  3K8Z A;  3RGP A;  3Q8X A;  4B7F A;  2QSF X;  1DGH B;  2XEP A;  4NXN M;  1OFI A;  1EE8 A;  2WSC F;  3AOE A;  1IBK M;  2R46 A;  4YHH M;  2QP9 X;  4G6Z A;  3U61 B;  5E6J A;  2JWS A;  3GLH B;  3H4M A;  1RU3 A;  2I7N A;  4IBF A;  1TDZ A;  3AOG A;  4IBK A;  4B7H A;  1Y8G A;  3J81 S;  4LF8 M;  2L2D A;  2RGH A;  3L26 A;  1KFV A;  4GRI A;  3FKE A;  3AL0 C;  2UXC M;  3HU3 A;  1IBM M;  2P5T A;  4JI0 M;  2EUC A;  4FD2 A;  2GQF A;  1NNJ A;  3UMM A;  4AI6 A;  1D0M A;  2VF8 A;  4I5S A;  4IJE A;  4QHS A;  1HT1 E;  4JI8 M;  1JB0 F;  3LMM A;  3W68 A;  1W5S A;  3GLI A;  4QOZ C;  3K9P A;  4OU7 A;  3PFI A;  4EIW A;  1PJI A;  5ITX E;  4GKJ M;  1QAN A;  1L2D A;  5ITU A;  4UN2 B;  4WP2 A;  1GJT A;  1NO1 A;  4D82 A;  5KO3 A;  1CUK A;  1Q3B A;  3FUV A;  3MHV C;  1OQY A;  1PJS A;  1NY5 A;  2VF7 A;  3A45 A;  3K1J A;  2FNA A;  3TWL A;  1PJJ A;  2UUC M;  4LF4 M;  4HL4 A;  1N32 M;  2KA6 B;  4NOO B;  4LCB A;  5EXS A;  1I94 M;  5DFL A;  2DAG A;  1HJP A;  4R3D A;  4ZPX A;  3VLF B;  4AKI A;  2OOB A;  5F3W A;  2O5R A;  3SBJ A;  3GPY A;  4MH0 E;  1R7R A;  4Q7J A;  4GIP A;  2JY6 B;  3U5Z A;  1D0K A;  3J7A S;  2Z7J A;  4QNM A;  1JR3 A;  1NSF A;  2MRO B;  1MN3 A;  2F5P A;  1A5T A;  1Z5B A;  2DHR A;  2BJV A;  3W67 A;  1UFZ A;  1WXQ A;  2HL7 A;  3AV0 A;  1GKI A;  2X8A A;  1IXS A;  3C3D A;  2XGN A;  2WSE F;  3U6S A;  2D7E A;  1OAI A;  2B3T A;  2KNV A;  3IEC A;  2DZL A;  3L29 A;  4KT0 F;  2DVW B;  3KFU G;  2FFJ A;  1JR3 D;  1OIP A;  2HWJ A;  2DNA A;  4OX9 M;  1DGG A;  2G5G X;  1IN7 A;  2KNZ A;  3GPP A;  1H6U A;  2K6B A;  4IBJ A;  4GKK M;  4B3S M;  3VDP A;  4AKH A;  2V1C A;  1OTR A;  3UGJ A;  3GQ5 A;  2ZAM A;  2XFS A;  4R71 A;  5ITX A;  4G4Q A;  3U6E A;  2UUA M;  3JR4 A;  3U6D A;  4LRS A;  2CWB A;  3VK7 A;  2F5O A;  3FRH A;  3SYK A;  4L16 A;  3A98 B;  4IBB A;  3SAS A;  3U5Z B;  1WR1 B;  4IBG A;  1D0L A;  1XC8 A;  2D7H A;  4IBE A;  3K2L A;  3GLF E;  2JY5 A;  1V92 A;  5KPT A;  2JA2 A;  4FCW A;  3DOA A;  1IQP A;  2XF3 A;  4D81 A;  1TDH A;  3Q8G A;  3J27 B;  2RKO A;  1PGY A;  2QHO B;  2HKJ A;  3UK6 A;  4G4R A;  4GMQ A;  1K82 A;  4JI6 M;  3CF2 A;  5IZ7 D;  2KZU A;  2JZ1 A;  4B3R M;  2LVQ D;  1Z59 A;  1R4G A;  4W5W A;  3I4V A;  3NBI A;  1N36 M;  2HAK A;  4F2L A;  3B7Q A;  2CRU A;  4LZZ A;  4LFC M;  1G41 A;  4MGI E;  4G3O A;  3AFH A;  3TPZ A;  3CGW A;  5KQD A;  3C58 A;  2OQ4 A;  5EXP A;  3GPX A;  3HGI A;  2X4A A;  2BNK A;  1BVS A;  3L28 A;  1XXH E;  1IM2 A;  4A3V B;  4M0D A;  1N77 A;  1OKS A;  4DV1 M;  1L2B A;  5EQT A;  3TQS A;  4GIT A;  3KSX A;  4X65 M;  1TR8 A;  1MU5 A;  3HHW A;  1SXJ B;  1QZE A;  2C96 A;  1ZMW A;  2KXE A;  2EKF A;  5L8R F;  3J80 S;  2MJ5 B;  1XMQ M;  2ZBK B;  3GLH A;  1GO5 A;  3HX3 A;  2QPA A;  2O25 A;  2G3Q A;  1ORY B;  5H37 D;  2YNM D;  3HJQ A;  3LQR A;  4Y28 F;  1DV0 A;  1IXZ A;  1Q3C A;  3R9X B;  3H4J A;  1JQJ C;  3I51 A;  2W82 A;  2F5S A;  2CV2 A;  2H1R A;  2XH9 A;  4B3M M;  1MJG M;  3B7Z A;  1QUT A;  4LGM A;  4M9S A;  3W0F A;  2LVA A;  2VQE M;  1L1Z A;  3LCV B;  5EP4 A;  1HQY E;  2YR0 A;  1K3W A;  3FTD A;  2JY7 A;  4K0K M;  2FS1 A;  1IY1 A;  3GLI E;  3EIE A;  1E9S A;  2L7I A;  3GRV A;  2R6F A;  2L6O A;  5FSW A;  4RF1 A;  2JXN A;  4I8O A;  1SXJ E;  1HNZ M;  1T3T A;  2DAK A;  2K9D A;  1JR3 E;  4QNR A;  4GH9 A;  5FTJ A;  2FOI C;  7CAT A;  3T1H M;  3KDS E;  1EIJ A;  3VFD A;  2AHM A;  3M6A A;  3WHL A;  4BB9 A;  2CV0 A;  1OJL A;  4DV2 M;  1NHW C;  2GNO A;  2LWX A;  3THG A;  4DV6 M;  3U60 A;  2CE7 A;  3RE8 A;  1PJT A;  4P17 A;  3VKH A;  1LV7 A;  1WGN A;  2Y20 A;  3RGS A;  3U60 B;  4JI5 M;  1S3S A;  3QYE A;  1J09 A;  1NV8 A;  3U6P A;  2OO9 A;  3WHK A;  1Z5A A;  4MGY E;  3GO8 A;  1Q02 A;  4X66 M;  1XXH B;  4PDG A;  3AKZ A;  2MR9 A;  4GC5 A;  1E94 E;  1HR0 M;  3LW5 F;  4LJ9 A;  3GLF B;  1QAQ A;  2XSZ A;  4FCV A;  3MMP A;  2C9O A;  3BXW A;  4S12 A;  3E21 A;  4KO8 A;  3HWS A;  2RGO A;  1L2C A;  2OPF A;  4CHT B;  2Z3X A;  1T43 A;  1ZAE A;  4PD2 A;  1QUS A;  2YFQ A;  3GLF A;  4FW9 A;  4L8R C;  3E4R A;  3L27 A;  3LVW A;  3FUT A;  4HLQ A;  2R18 A;  4AQY M;  3GPU A;  1QAO A;  3M0E A;  3HHZ A;  4LJ8 A;  4DR7 M;  3GLG B;  4LFB M;  1G4A E;  2DWL A;  4JI2 M;  2ZAN A;  4LGY A;  1ZV1 A;  2J7N A;  4CIZ A;  4RNA A;  2MH8 A;  5C1B A;  2CHG A;  3SC3 A;  1R6B X;  5GKN A;  4JI3 M;  3KSJ A;  5IRE B;  2JZ0 A;  2DAM A;  3GQ4 A;  2G8L A;  1YE9 A;  3FUX A;  1I4W A;  4OVZ B;  4LJ5 A;  4NC6 A;  2R65 A;  1KYI A;  3KP1 E;  1XNR M;  3GLI B;  3U6M A;  4PT5 A;  3HZJ A;  1Q39 A;  4LZJ A;  3SHG B;  4DUZ M;  4DR4 M;  3RFW A;  3B9P A;  2XLJ A;  1QQW A;  3I04 M;  2LVO C;  1VDL A;  2EJS A;  5DNY A;  3E46 A;  1YLA A;  5KPR A;  2DHY A;  4ITQ A;  1IBL M;  4L4U A;  1WHC A;  4JXJ A;  2R4J A;  3D8L A;  2C98 A;  4MGZ E;  1XMO M;  3L25 A;  1FNN A;  3GLG E;  2DWN A;  4LG2 A;  4ANR A;  3JAM S;  1N33 M;  2C5R A;  2DAE A;  3KOZ E;  1OFH A;  1Z6T A;  2J7O A;  5IT9 S;  1L1T A;  4GEW A;  2DWZ B;  2DWM A;  4XK8 F;  4KHP M;  4NRV A;  2L09 A;  2HHH M;  2V1U A;  2L4F A;  2I7P A;  4LFA M;  4CIS A;  2KRK A;  4I4L A;  4JI7 M;  4CGY B;  4NRW A;  1UM8 A;  4REZ A;  4AZF A;  3IHP A;  4LF7 M;  1IN6 A;  1QYR A;  1TH3 A;  3FTC A;  5E26 A;  2A5Y B;  5FTN A;  3KOX E;  2XZF A;  2WZJ A;  2DAI A;  5FLX S;  1NNU C;  5KQ8 A;  2DZO B;  4IBI A;  3HU1 A;  2Y0T A;  4M9Z A;  2R0I A;  3DZD A;  4IBC A;  4QHT A;  2R45 A;  1TH2 A;  3B7N A;  2QBY B;  1TGU A;  2APL A;  2XFT A;  2L4E A;  4B3T M;  2QQ8 A;  4FCT A;  2BJW A;  4DV5 M;  2XZU A;  1GL6 A;  3FTE A;  1HNW M;  4G4O A;  1GLN A;  2C9C A;  2M60 A;  1FJG M;  2XSZ D;  2UXD M;  2V6Z M; 
#chains in the Genus database with same CATH homology
 2VQF M;  1IY0 A;  5EP2 A;  1HT2 E;  3PXG A;  5IWA M;  4LF6 M;  4DR6 M;  5FTM A;  4NSR A;  2CV1 A;  4PCZ A;  8CAT A;  4BLC A;  3U6C A;  4MGH A;  4I81 A;  2R4E A;  4KOD A;  3A46 A;  4X64 M;  4JV5 M;  2Y0Q A;  4LF9 M;  5KPZ A;  2UUB M;  3IG8 A;  1GL7 A;  5BR8 M;  1HNX M;  2KEB A;  3TL4 X;  4LJ4 A;  1DO0 A;  2Z4R A;  3PNY A;  3T15 A;  4FWD A;  4M9X A;  4MM3 B;  1KSF X;  4B08 A;  5EXT A;  4G4N A;  1R2Z A;  4IJF A;  1G59 A;  1QAM A;  3SAW A;  3T38 A;  3AJI B;  1C1K A;  3QWL A;  4GC9 A;  4IIW A;  3SHF A;  5EJC A;  4BBA A;  3GRY A;  1TH4 A;  3SAT A;  3BOS A;  3E9S A;  4LF5 M;  2KRU A;  1YSY A;  1K3X A;  1E32 A;  4PDI A;  1XWI A;  3KW6 A;  4II7 A;  3TE6 A;  2F5Q A;  1IN5 A;  3HHX A;  2Y21 A;  2ZM6 M;  3GP1 A;  3MK6 A;  3SMP A;  3L2A A;  3TWK A;  5LMN M;  4RF0 A;  5DYI A;  1N78 A;  5BPV A;  5ITY A;  2LXE A;  4FVM A;  1NJG A;  1G8P A;  1DGF A;  1QVR A;  2NQ8 C;  4AG5 A;  2M5Z A;  2R62 A;  1W5T A;  2LNH C;  3IG5 A;  3U61 A;  1NY6 A;  2HCB A;  4Z6Y A;  2Z4S A;  2F5N A;  4AW4 A;  5ITT A;  5ITR A;  3SFZ A;  5FTK A;  4AG6 A;  4LJA A;  2CHQ A;  4DR2 M;  3HKP A;  3DFZ A;  3UJN A;  5ITQ A;  2CUZ A;  2LH0 A;  1D2N A;  3SAV A;  3EIH A;  2CFO A;  3CF0 A;  3KOW E;  3K92 A;  3ZC7 B;  2K47 A;  3FD9 A;  4P16 A;  3ZH9 B;  4LJ6 A;  1DO2 A;  5EP3 A;  3JR5 A;  4KLN A;  2UXB M;  1SXJ C;  3FTF A;  1E9R A;  1L8Q A;  2EO2 A;  3A42 A;  1J5E M;  2QBY A;  1DGB A;  3HU2 A;  4LJ7 A;  4FWG A;  3FUW A;  2QEN A;  2C99 A;  3M7G A;  1N75 A;  4DR5 M;  4YY3 M;  3J2P B;  1DGH A;  3HJ8 A;  2FE8 A;  3U6Q A;  4L78 A;  2YQZ A;  4FWH A;  3KP0 E;  3HJS A;  4B7G A;  3OTO M;  2L7H A;  2Q2E B;  4DV7 M;  4DUY M;  4NXM M;  1HQC A;  1NVM A;  4JI4 M;  3FYC A;  4Z8X A;  3GLG A;  2DXI A;  1IXS B;  2D7G A;  3UZU A;  3ILK A;  3PNV A;  3GRU A;  4R7G A;  5JI3 E;  5EP1 A;  3HHY A;  4XBO A;  4DV3 M;  3VK8 A;  1QZM A;  4L15 A;  3D8B A;  3GRR A;  3LQQ A;  4WUR A;  5C18 A;  4G4R A;  2KZS A;  5LMU M;  1VDD A;  2QCU A;  4GHA A;  3ZCB B;  3R8F A;  2DZN B;  2ERC A;  4NL4 H;  3KVW A;  4LRT A;  3J7B A;  3SYL A;  3LVV A;  4WW0 A;  4DR3 M;  3U6L A;  2F4V M;  4GHL A;  3DA1 A;  3FYD A;  4JN6 A;  1MX0 A;  1G3I A;  4NSO B;  4OW0 A;  1IXR C;  2UU9 M;  2X49 A;  4MB7 A;  2CHV A;  3CF6 E;  4TUW A;  3I4Y A;  1PM5 A;  1YUB A;  1IN4 A;  5FTL A;  3T1Y M;  2CEA A;  5DYG A;  4M0W A;  1NJF A;  1ZQ9 A;  5EXX A;  1X37 A;  2E5L M;  1GVN A;  1IY2 A;  3NWL A;  4D80 A;  1Z5C A;  4AKG A;  1SXJ A;  1NHG C;  1J7K A;  3SMS A;  3SAU A;  3KS8 A;  4XGI A;  5JI2 E;  3SAR A;  3VKG A;  4DV0 M;  3U6O A;  1XHB A;  4JYA M;  4QOS A;  3FUU A;  5A2Q S;  2VII A;  3KS4 A;  4IBD A;  3GQ3 A;  1XXH A;  3W0L B;  3VDU A;  2KW0 A;  4X62 M;  4DR1 M;  3TWM A;  1N34 M;  3MJ5 A;  4OVZ A;  3QAU A;  3PVS A;  1SXJ D;  3KOY E;  3KXE C;  4LY6 A;  3AOE C;  3CTW B;  2ZAO A;  4MGK E;  1IN8 A;  2EA0 A;  1R2Y A;  2QZ4 A;  4JI1 M;  1XNQ M;  4DV4 M;  3K8Z A;  3RGP A;  3Q8X A;  4B7F A;  1DGH B;  2XEP A;  4NXN M;  1OFI A;  1EE8 A;  3AOE A;  1IBK M;  2R46 A;  4YHH M;  2QP9 X;  4G6Z A;  3U61 B;  5E6J A;  3GLH B;  3H4M A;  2I7N A;  4IBF A;  1TDZ A;  3AOG A;  4IBK A;  4B7H A;  3J81 S;  4LF8 M;  2RGH A;  3L26 A;  1KFV A;  4GRI A;  3FKE A;  3AL0 C;  2UXC M;  3HU3 A;  1IBM M;  2P5T A;  4JI0 M;  2EUC A;  4FD2 A;  1NNJ A;  3UMM A;  4AI6 A;  4I5S A;  4IJE A;  4QHS A;  1HT1 E;  4JI8 M;  3LMM A;  3GLI A;  1W5S A;  4QOZ C;  4OU7 A;  3PFI A;  4EIW A;  1PJI A;  5ITX E;  4GKJ M;  1QAN A;  1L2D A;  5ITU A;  4D82 A;  5KO3 A;  3FUV A;  1Q3B A;  3MHV C;  3A45 A;  3K1J A;  1NY5 A;  2UUC M;  4LF4 M;  2FNA A;  3TWL A;  1PJJ A;  1N32 M;  4HL4 A;  2KA6 B;  4NOO B;  4LCB A;  5EXS A;  1I94 M;  4ZPX A;  4R3D A;  3VLF B;  4AKI A;  5F3W A;  2O5R A;  3SBJ A;  3GPY A;  4MH0 E;  1R7R A;  4GIP A;  3U5Z A;  3J7A S;  2Z7J A;  4QNM A;  1JR3 A;  1NSF A;  2F5P A;  1Z5B A;  2DHR A;  2BJV A;  1WXQ A;  2HL7 A;  3AV0 A;  1GKI A;  2X8A A;  2XGN A;  3U6S A;  2D7E A;  3L29 A;  2DVW B;  3KFU G;  2FFJ A;  1JR3 D;  4OX9 M;  1DGG A;  2G5G X;  1IN7 A;  3GPP A;  1H6U A;  4IBJ A;  4GKK M;  4B3S M;  3VDP A;  4AKH A;  2V1C A;  3UGJ A;  3GQ5 A;  2ZAM A;  2XFS A;  5ITX A;  4G4Q A;  3U6E A;  2UUA M;  3JR4 A;  3U6D A;  4LRS A;  3VK7 A;  2F5O A;  3SYK A;  3SAS A;  4L16 A;  3A98 B;  4IBB A;  3U5Z B;  4IBG A;  1XC8 A;  2D7H A;  4IBE A;  3K2L A;  5KPT A;  2JA2 A;  4FCW A;  3DOA A;  1IQP A;  2XF3 A;  4D81 A;  1TDH A;  3J27 B;  2RKO A;  2HKJ A;  3UK6 A;  1K82 A;  4GMQ A;  4JI6 M;  3CF2 A;  5IZ7 D;  2KZU A;  4B3R M;  1Z59 A;  4W5W A;  3I4V A;  3NBI A;  1N36 M;  4LZZ A;  4LFC M;  1G41 A;  4MGI E;  5KQD A;  3AFH A;  3TPZ A;  3C58 A;  2OQ4 A;  5EXP A;  3GPX A;  3HGI A;  2X4A A;  2BNK A;  3L28 A;  4A3V B;  1IM2 A;  4M0D A;  1N77 A;  4DV1 M;  1L2B A;  5EQT A;  3TQS A;  4GIT A;  3KSX A;  4X65 M;  1MU5 A;  3HHW A;  1SXJ B;  2C96 A;  2KXE A;  3J80 S;  1XMQ M;  2ZBK B;  3GLH A;  2QPA A;  1ORY B;  5H37 D;  2YNM D;  3HJQ A;  3LQR A;  1IXZ A;  1Q3C A;  3R9X B;  1JQJ C;  3I51 A;  2W82 A;  2F5S A;  2CV2 A;  2H1R A;  2XH9 A;  4B3M M;  4M9S A;  4LGM A;  3W0F A;  2VQE M;  1L1Z A;  5EP4 A;  1HQY E;  2YR0 A;  1K3W A;  3FTD A;  4K0K M;  1IY1 A;  3EIE A;  1E9S A;  2L7I A;  3GRV A;  2L6O A;  5FSW A;  4RF1 A;  4I8O A;  1HNZ M;  1SXJ E;  1T3T A;  4QNR A;  4GH9 A;  5FTJ A;  2FOI C;  7CAT A;  3T1H M;  3KDS E;  3VFD A;  2AHM A;  3M6A A;  3WHL A;  4BB9 A;  2CV0 A;  1OJL A;  4DV2 M;  1NHW C;  2LWX A;  3THG A;  4DV6 M;  3U60 A;  2CE7 A;  3RE8 A;  3VKH A;  1LV7 A;  2Y20 A;  3U60 B;  3RGS A;  4JI5 M;  1S3S A;  1J09 A;  3U6P A;  3WHK A;  1Z5A A;  4MGY E;  3GO8 A;  4X66 M;  1XXH B;  4PDG A;  3AKZ A;  4GC5 A;  1E94 E;  1HR0 M;  3GLF B;  4LJ9 A;  1QAQ A;  2XSZ A;  4FCV A;  2C9O A;  4S12 A;  4KO8 A;  3HWS A;  2RGO A;  1L2C A;  2OPF A;  4CHT B;  2Z3X A;  4PD2 A;  1ZAE A;  2YFQ A;  3GLF A;  4FW9 A;  4L8R C;  3E4R A;  3L27 A;  3LVW A;  3FUT A;  4HLQ A;  2R18 A;  4AQY M;  3GPU A;  1QAO A;  3M0E A;  3HHZ A;  4LJ8 A;  4DR7 M;  3GLG B;  4LFB M;  1G4A E;  2DWL A;  4JI2 M;  2ZAN A;  4LGY A;  2J7N A;  4RNA A;  5C1B A;  2CHG A;  3SC3 A;  1R6B X;  5GKN A;  4JI3 M;  3KSJ A;  5IRE B;  3GQ4 A;  2G8L A;  1YE9 A;  3FUX A;  1I4W A;  4OVZ B;  4LJ5 A;  2R65 A;  1KYI A;  3KP1 E;  1XNR M;  3GLI B;  3U6M A;  4PT5 A;  4LZJ A;  1Q39 A;  4DUZ M;  3SHG B;  4DR4 M;  3RFW A;  3B9P A;  2XLJ A;  1QQW A;  5DNY A;  5KPR A;  4ITQ A;  1IBL M;  4L4U A;  4JXJ A;  2R4J A;  3D8L A;  2C98 A;  4MGZ E;  1XMO M;  3L25 A;  1FNN A;  2DWN A;  4LG2 A;  3JAM S;  1N33 M;  2C5R A;  3KOZ E;  1OFH A;  1Z6T A;  2J7O A;  5IT9 S;  1L1T A;  2DWZ B;  2DWM A;  4KHP M;  4NRV A;  2L09 A;  2HHH M;  2V1U A;  2I7P A;  4LFA M;  4CIS A;  2KRK A;  4I4L A;  4JI7 M;  4CGY B;  4NRW A;  1UM8 A;  4REZ A;  4AZF A;  4LF7 M;  1IN6 A;  3FTC A;  1QYR A;  1TH3 A;  5E26 A;  2A5Y B;  5FTN A;  3KOX E;  2XZF A;  5FLX S;  1NNU C;  5KQ8 A;  2DZO B;  4IBI A;  3HU1 A;  2Y0T A;  4M9Z A;  3DZD A;  4IBC A;  4QHT A;  2R45 A;  1TH2 A;  2QBY B;  1TGU A;  2XFT A;  4B3T M;  4DV5 M;  4FCT A;  2BJW A;  2XZU A;  1GL6 A;  3FTE A;  1HNW M;  4G4O A;  1GLN A;  2C9C A;  2M60 A;  1FJG M;  2XSZ D;  2UXD M;  2V6Z M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...