1XMOQ

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmoQ00
2UUCL 1UE1A 3SGIA 1S40A 2HHHQ 3T1YL 1K83H 1WYDA 1Y14B 3I2ZA 3HOWH 2VNUD 3KOJA 3IRBA 2NVYH 1TWFH 4AIMA 1G6PA 1U0LA 4YCUA 1IBML 2UUAQ 2JA8H 2IHEA 1VQKA 5J3BA 2RCNA 3HOYH 4QGUA 1WCMG 1PFSA 4GOPB 1U5KA 3W5OA 1NJIC 4A3LG 4O0AA 2ZM6Q 5C0XG 3GTKH 4JG2A 2N49A 4YWMA 5JEAJ 4LFBL 2VY3A 1EQRA 3NENA 4A3KG 3KJPA 4DR5L 3GTOH 1KD1C 3GO5A 1XJVA 3RNUA 1NMFA 4JBWA 1ASYA 5IYDH 3KYHC 2A8VA 4B3TQ 4APVA 1TWHH 2K75A 1YHBA 4JI3Q 2UXCQ 4UPAA 3S24A 4DV5Q 4DV1Q 4OWWB 1XNQL 4BBRG 1VQNA 2B29A 1Q81C 4X6AH 3F2BA 1IXRA 3LGJA 1VS0A 4XTCS 2Y0SE 4OX9Q 3H3VH 4P75A 5IYBH 4DR1L 3J80c 3PCOB 5AJ3L 3BZCA 4JBJA 1IBLQ 3CXCA 1VQFA 1VCIA 3DLLA 2NVXH 3J81c 1TWGH 3CCSA 2OQKA 5IYCH 4QY7A 3HKZE 2R93H 3I56A 4HJ5A 4IJLA 4IJHA 4YCWA 4X64L 4L5RC 4GOPA 3EIVA 1X56A 1Q82C 3PUXA 2EIFA 1IYJB 3M7NA 1I94L 1PH3A 1PH2A 5DLQE 3KFUA 1N36Q 2F52A 1A0IA 3TS2A 5GQOA 5FLXc 5LMNQ 4B3SQ 4JV5L 3WWVA 4DV6Q 3M3YH 4HJ8A 1TWAH 3HOVG 4DV3Q 1QUQB 2WP8J 3UDFA 5IWAQ 1KIXA 1PVOA 2F4VL 3TREA 4HIKA 1JB7A 1VQ5A 4YWLA 2K14A 5FLMG 4LF7Q 1VQ4A 3ULJA 1CKNA 2WFWA 3NEMA 3PSIA 4DAMA 3CCVA 2CCZA 1NMGA 4GLVB 4GKKL 3HOWG 1Q1EA 2KBNA 1Z47A 4LF6Q 2R6GA 2QEXA 4IPDA 1HNZQ 1K8GA 4GKJL 2JA8G 3OTOL 4XIGS 3HOZH 4IFDJ 1BBWA 3GD7A 1X54A 4A3IH 4PZ8A 2CWPA 2R7ZG 5GAGC 4IFDI 2E2IH 4R4CA 1T9HA 1QZHA 1PYBA 4DR7Q 1BBUA 3HFZB 1SN8A 1A62A 4OO1G 5ELOA 2HHHL 3T1YQ 3K7AH 4KHPL 2B63H 4JI0Q 3B6YA 4LWCA 3A5ZB 1HJPA 4KHZA 4X65L 2AHOB 1K73C 5EAYA 1VQLA 2R92G 4K0KL 4DR2L 4PZ6A 1GO3E 1VQ6A 3I4OA 3CCQA 1LYLA 1KL9A 2JA7G 4YWKA 1YHQA 4LFAQ 2ZJPA 4P71A 1YJNA 1N34Q 4JI5Q 5K36G 4LFBQ 3FHWA 5JJKA 2DUDA 4NXNL 2V1CC 4C2MH 2C35B 3EN2A 5GAEC 2VUMG 1N32Q 3U50C 1BVSA 4GN5A 2NZHA 4A3FH 1YNXA 3GTMH 1X3GA 1SROA 5GAHC 4OO1I 4J15A 4QL5A 2YTXA 3BJUA 3PIPA 2Q2TA 4B3TL 1P16A 2BA0A 4JI2Q 1OXUA 1CKOA 4X62Q 1VQ9A 3U4ZA 4DKAC 1FJGL 4LFCL 5BR8Q 1XMQQ 4DUYL 3NELA 4DAYB 1MIUA 4A93G 4Y52H 4BXXH 4DR3L 1S3OA 5M5YH 2WB1G 4LF9L 2LXKA 1VQCA 3JAMc 3PF4A 4P73A 1HZ9A 2Q2IA 1WI5A 1IZ6A 5IP7G 3PO3H 2CQOA 2Q2UA 3CCJA 1NBWA 2YV5A 3HKSA 2K5HA 4UP8A 4AH6A 2UXBL 2EQSA 2R93G 4OWXB 1LUZA 2ZJRA 3AFQA 4GLAC 1YIJA 1YJ9A 4LF8Q 1PH4A 5H1SE 4L5SA 2Y0SG 2I5MX 3J81i 3BZKA 1C9OA 4DV7L 1AH9A 1SLJA 2UU9Q 1QUQA 4A4IA 1J5EQ 4BBSH 1PH1A 1XNRL 3HOXG 3K80C 2DGYA 4C3HH 2HQLA 1N36L 1Q46A 4DR6Q 4HJ7A 1HNWL 4A3MH 1NY4A 3CF5A 2R92H 4JV5Q 3GDEA 5LMUQ 1VQOA 1Q12A 2Z0SA 3ER0A 4LUOA 3HKZG 4Y7NH 3PIOA 4IPHA 3CCRA 1PA6A 3HOYG 2CKZB 2OQ0A 3G6EA 2B3GA 1N33Q 5M3FH 3U4VA 1VQIA 1VQPA 2JA5H 1X55A 3PUYA 4BY7G 5IYBG 1K3RA 2YTYA 1L0WA 3CPFA 3J81j 1YZ6A 1JJCB 4WJ3M 4P72A 4DV0L 3GTQH 1N9WA 3G48A 1HNZL 4P74A 3K8AA 2XGTA 1QZGA 3OTOQ 1AE3A 2CWAA 2VQEQ 3CPWA 1HH2P 1IL2A 5C44G 1XMOQ 2LXJA 1K0RA 3UDXA 4A93H 1GKHA 1VQGA 4PMWA 4DPGA 3CC7A 2YU9H 2UXDL 1WJJA 4JI1Q 4IO9A 3AQQA 4HJAA 2UUAL 2VUMH 4TQUS 4A3JH 4B3MQ 3L0OA 2YTVA 3PF5A 1QVFA 2VZAA 1A8VA 1YVCA 3ULPA 4A3GG 1G291 5C3EG 3RN2A 4JYAL 3M9BA 3L2PA 4AQYQ 1Y1WH 3A74A 1ASZA 2OTLA 1B70B 2HIVA 4NXMQ 2JA7H 2K4KA 2GVBA 4GLXA 1PYSB 4AYBE 2H5XA 3RLOA 3S16H 1SFOH 1VQAA 2ID0A 1PH5A 1QVGA 2I0QA 4JI6Q 4LUVA 1D7QA 3M4PA 4NXNQ 1AE2A 1R9TH 3A5UA 1XNQQ 5C4XG 2KENA 2F3IA 3PO2G 1EQQA 3RZOH 4BA2I 2VW9A 2NVQH 5M3FG 1D8LA 2KCMA 4OX9L 4DR1Q 4LF5L 3OYYA 2VQFQ 4A3CH 5AJ3Q 4QJFA 4X62L 4DR4Q 1UE5A 4DK6C 1FJGQ 1L2FA 1JE5A 3PUVA 2AMCB 1A63A 2D0OA 2IX0A 4X66L 2XTIA 5M5WH 5M5XH 4RMFA 3K81C 3I4MG 4JCVE 5IP7H 1OXXK 4LUZA 4LW1A 4R4IA 4YCVA 4GNXB 1LTLA 1MJEA 3CCLA 3MXNB 4A76A 4A3IG 1PV4A 3CP0A 1KC8C 4LF4Q 3HOVH 2K52A 1BKBA 2UXBQ 1C0AA 2ZTCA 3FKIH 1PH9A 1L1OA 2UUBL 4BXXG 4DUZQ 1YI2A 4LF8L 1K9MC 5FLMH 4JI4Q 1VQ8A 2BA1A 3AEVA 1Y1VH 4L5QA 1EYGA 3AFPA 5IP9G 4GNXC 4R4QA 5IWAL 4A3GH 4A3BH 1J5EL 1YEZA 4A3FG 3F2CA 1XNRQ 1H95A 1CSQA 3PGZA 1JMCA 2KHIA 3HOUG 4DR6L 3T1HQ 1EOVA 1IBKL 1YHAA 3MEFA 4BY1H 5LMUL 3FP9A 3HOZG 2JEAI 4JI8Q 1OXTA 3F2DA 1V1QA 4A75A 1XTDA 1YJWA 1I3QH 4IOAA 3UE1A 1N33L 4HJ9A 3CW2C 3HOXH 3CCUA 3KDFB 4A3EH 1HR0L 1Q86C 3H3VI 2AWNA 5FJ8G 3CQZH 4IPGA 4MNOA 3ULLA 2NVTH 3GTPH 3RN5A 2UUCQ 5JJLA 3TEHB 1M1KC 3A0JA 3CC2A 1Q8KA 2RF4A 2MO1A 1Y1WG 1VQMA 3STBC 3W1BA 2MNAA 2KCTA 3J7ZC 4C3IH 4O2DA 4A3CG 2VQEL 1Z9FA 1M90C 1IBMQ 3GTGH 4PZ7A 3BU2A 1YBYA 4DK3C 1V9PA 4JI0L 3G71A 2JA6H 2D62A 1FVIA 2UXDQ 4BA1I 3CMEA 4JI1L 3EBEA 3PUWA 1CSPA 4K0KQ 1GVPA 2VL6A 1VQJA 3AYHB 1VQEA 4R4TA 1HNXQ 1FGUA 2K5NA 1E7ZA 2JEBI 5C3EH 3PO3G 4LFAL 3H0GH 1CUKA 1N34L 3PV0A 3RR5A 4DV4Q 4AQYL 1EWIA 2IX1A 1EIYB 4NXML 4JI3L 3TRZA 5IP9H 4YHHQ 2I5LX 1VQHA 4DV1L 4IOCA 4UP9A 1NE3A 4TVAB 2R7DA 3UDIA 2L15A 2JJQA 2RHSB 1W3SA 2A19A 3S17H 2JE6I 1N8RC 5BR8L 5E7NA 4R1JA 2HT1A 1VQ7A 4NPSA 2AWOA 1EIFA 3S14H 4DR3Q 1QVCA 5C44H 5C4JH 1IBLL 2LSSA 1B7YB 1I5FA 4LF9Q 1PH8A 2R7FA 5IT9c 4JC0A 4QQBX 4YY3Q 4LF5Q 3E9HA 1XPUA 2VQFL 1GM5A 1UE7A 2N3SA 1PH7A 4DR4L 4AYBG 1JJ2A 4UP7A 4EX5A 1KHIA 1Q7YC 3G4SA 1OXVA 4X64Q 1VQDA 5IY0A 5IYDG 3HOUH 3I7FA 4FDBA 3RLNA 1L1OB 2VS1A 2NZOA 4HIOA 2A1AA 4B3RL 1O7IA 2CFMA 2MO0A 4R4OA 5LMNL 4DV7Q 4B3SL 2UU9L 2OWOA 1LM0A 4JI7L 3I4NG 2FXQA 4LF4L 2E5LL 4LNQA 2D0PA 4DV3L 1HNWQ 3S1MH 4DUZL 2F4VQ 4A3KH 4JI4L 1GD7A 1K8AC 4L5TA 2IY5B 4GN4B 4EQ5A 3CCEA 3CAMA 4A3JG 4LF7L 2JK8A 3STBD 3I4MH 3JAMi 5JJIA 1SE8A 2WAQG 4RG1A 5C4XH 1WCMH 3I55A 3DM3A 4GNXA 4A3LH 2N78A 1OXSC 2ZTEA 4IPCA 1VQBA 4KLKA 1Q1BA 1KRSA 3M85A 4DV2Q 3FKIG 4OONA 1HZAA 2E2HH 1RL2A 1NTGA 2NN6I 5M3MG 4GKJQ 1X9NA 3D31A 1P8LA 1SR3A 4POFA 3CMAA 1E22A 2AKWB 3J7A5 5C0XI 1Y1VG 1X6OA 5LMNW 1JT8A 3NBHB 4ALPA 3TS0A 1PHJA 4JBKA 5FJ8H 2PI2E 1UWVA 3K0XA 5HGQA 3RLFA 1XMOL 3CD6A 1S72A 2QA4A 2PMZE 3CC4A 3PO2H 4GOPC 4ME3A 3D0FA 3KF6B 4BBRH 5IYCG 2ZM6L 2JQOA 5ELNA 4KHPQ 4BY1G 2K5VA 1CKNB 2GVAA 2WB1E 1UE6A 4B3ML 4X65Q 4A3DH 4POGA 1KXLA 3KJOA 3CCMA 5GADC 4DR5Q 2ZJQA 3KDFA 4DR2Q 2ASBA 4JYAQ 3OW2A 4GS3A 2B63G 3S2DH 4A3BG 2Z6KA 3F1ZA 1DGSA 1OTCA 1JJGA 5JEAG 1SMXA 4JI5L 1HR0W 2OCEA 3U58A 2UXCL 3F8TA 3ERSX 2PNHA 5C0XJ 1HNXL 2KHJA 2E8GA 4DV5L 3ICEA 1CKMA 1N32L 4JOIA 3GTJH 1EFWA 4JI6L 2PQAB 2PQAA 4DV4L 1X3FA 4MTNA 1I6HH 1L1OC 3S15H 3KF8B 1TWCH 1C7YA 4JBMA 4JI2L 2K50A 4DNIA 4H02A 4YHHL 3JC66 2ES2A 4LFCQ 2ATWA 1XMQL 4DUYQ 3VDYA 2JA6G 4NB3A 3Q8DA 1X3EA 4JOIC 2OTJA 1RIPA 1V43A 3H0GG 2WAQE 4KI0A 1PH6A 1SRUA 1I50H 1YITA 2QGQA 2IHFA 4PG3A 1W2BA 3S1QH 4UY8C 2ZTDA 1KQSA 2MQHA 2Z6KC 2HIXA 2JA9A 1EUJA 1MKHA 1UEBA 3PUZA 4HIMA 3KF6A 4X66Q 1G51A 1MJCA 3S1NH 3M4OH 4YY3L 1I94Q 3E9IA 2GN5A 3S1RH 1HZBA 2IT1A 1E24A 2EXDA 4A3EG 2ALYB 3TQYA 3E0EA 2YYZA 4DV6L 1J6QA 2E2JH 3UE0A 1B8AA 4GN3B 4OWTB 2UUBQ 1E1TA 1E3PA 2I5HA 2R7ZH 3GTLH 2N8NA 4B3RQ 3KLWA 4HIDA 1FL0A 1XPOA 3ZJYC 2BH8A 1XPRA 5HY6A 1KRTA 4JI7Q 1X65A 4MZ9A 3H15A 4BBSG 2E5LQ 4GKKQ 3M4QA 3T1HL 2RHQB 1IBKQ 1E1OA 4LF6L 4A3MG 1TXYA 3K7UC 1HZCA 1KAWA 1WFQA 5GROA 4OXPA 2BH2A 4JI8L 3J80i 4WJ4A 2PI2A 3RZDH 1WOCA 3W1GA 3UDGA 4C3JH 2Q2HA 2MFIA 5IE8A 2JA5G 1HR0Q 3S2HH 4DV2L 2NN6G 4DV0Q 4A3DG 5M3MH 4BY7H 4QIWE 4IFDG 3I4NH 4DR7L 3L7ZC
chains in the Genus database with same CATH superfamily
2F1MA 1EZ8A 3TZUA 3NUCA 1PTOC 1EEID 5CMDA 3IRBA 5I4DA 3CHBD 1T5EA 4QGUA 1QOHA 2M9VA 4A3LG 2B8GA 4O0AA 4M1UB 4F8MA 4ZRZA 3V96A 5JEAJ 1B50A 4H7BA 2B2YC 4KD4A 1SFOB 3SK6A 5I6WA 4ZUIA 3K5NA 3RNUA 5E1FA 4RWSC 3MTSA 5A2QE 1D5ZC 1C8CA 1TWHH 2K75A 3EROA 4JI3Q 4N9TA 1I4QA 3S24A 4OWWB 1XNQL 1TWCB 1IXRA 1EY5A 3TP6A 3H3VH 4OGQC 5IYBH 5AJ3L 3BZCA 4JBJA 1VQFA 1PRTB 2NBFA 2OQKA 5LHY1 5IYCH 3MFYA 3R93A 4IJHA 4X64L 4L5RC 4R9WA 4M8AA 3EIVA 5IT9L 2FMMA 1IYJB 3NXWA 3J7AV 1N36Q 1ZYRD 5EKLA 3TS2A 3I90A 5M3FB 4B3SQ 2A6ED 3HOVG 4G7HC 1KDBA 3UDFA 2K05A 4PQXA 3TREA 1KLUD 2JA7B 1ENAA 1S5BD 3NQTA 1VQ5A 5CV6A 4DAMA 4GKKL 3HOWG 4CJ0B 1Q1EA 3UI2A 4HN7A 1GUWA 5C5LA 1HUNA 3H09A 1X54A 4A3IH 3BYYB 2XVSA 2E2IH 1A3UA 3MFGA 5JPMC 1K8OA 1BBUA 3W2DA 1SN8A 1JOOA 4OO1G 3D6CA 5ELOA 4J1MA 3T1YQ 4JI0Q 4LWCA 3A5ZB 4DGZA 1VF7A 2CQAA 1F77A 4K0KL 5EKKA 2Z8LA 3DEPA 3OWEB 4XQJA 3CRKC 1ET6A 4HCSA 5EBCA 3GQBA 4UHVA 2IL8A 1CT1D 1BR9A 3EN2A 2K01A 1BVSA 2NZHA 1A2TA 3CKIB 3GTGB 5JJZA 1X3GA 4ZLTF 1FNUA 5GAHC 2Q2TA 3BJUA 3PIPA 1P16A 3QOJA 1NR2A 1OXUA 5BR8Q 1S4ZA 3NBIA 3NELA 4A3GB 4DAVA 4HR7B 1MIUA 4A93G 4X3TA 2LXKA 3FDTA 1VQCA 1MD2D 2Q8IB 1JQYD 1HZ9A 5IP7G 2B2VC 2Q2UA 4RGOS 1U4LA 1RTOA 3SDZA 4EQOA 3WDNA 1LUZA 3C1FA 2ZJRA 3S17B 4QUFA 4LF8Q 1AFPA 2A6HC 2P5ZX 4L5SA 2R92B 2SDFA 2Y0SG 2I5MX 2Z4IA 3BZKA 4RKBA 4A4IA 1XNRL 2DGYA 4C3HH 1IL8A 3GTMB 2PZUA 4BY7B 1HNWL 3CF5A 2OXPA 3ER0A 3LNNA 2Z6BA 1TS2A 3HOYG 3G6EA 2RSNA 5L37A 5M3FH 4XQNA 4C3IG 1VQPA 1F2MA 5IGBA 1X55A 4KY7A 4G7ZC 1ET9A 4BY7G 5CV8A 1RHPA 2L0CA 1L0WA 4DF7A 1EY8A 1JJCB 4DV0L 4XYQA 2XGTA 2VQEQ 3CPWA 3T16A 3RZOB 1HH2P 1Q90A 1STGA 2LXJA 1VQGA 4PMWA 1KTKA 4RGMA 3AQQA 2VUMH 2UUAL 4A3JH 4PMBA 3J80L 2VZAA 2K5QA 3A56A 4JYAL 4LJZC 2EOTA 3OMGA 3BVGA 2RSOA 1Y1WH 1ASZA 3RMHA 3QR8A 4GLXA 5C3WA 2H5XA 1SFOH 2ID0A 2I0QA 1AE2A 4U68A 1DZ1A 1R9TH 3A5UA 5C4XG 2KENA 3PO2G 1LV9A 4BA2I 3BVZA 4ZKCB 3EA6A 2EXZA 1D8LA 4OX9L 3VYUA 1O7ZA 1FJGQ 1HA6A 1PZJD 2IX0A 4X66L 2XTIA 5C5MA 3K57A 1HTLD 2CVRA 2EY2A 4LW1A 4R4IA 4B9WA 4A76A 2DNCA 4A3IG 3CP0A 3HOVH 4LF4Q 2UXBQ 4ZCKA 4BXXG 2UUBL 1SYBA 1YI2A 5FLMH 1A3TA 5E4XA 2J7ZA 3AFPA 4A3GH 4DA2A 4A3BH 1AEXA 2LS01 2KQ3A 4A3BB 2CH4W 1HXYD 1YHAA 5LMUL 2G5DA 4IZ8A 2BE5C 1N33L 4J6HA 4HJ9A 4A3KB 5M5YB 1STYA 1HFNA 2DJGC 2JA8B 1EL0A 5FJ8G 4IPGA 1TU2B 3SXHA 2L55A 2NVTH 4CGYB 1PZID 3TEHB 2RF4A 2J0TD 2MO1A 1VQMA 4A3CG 3J7ZC 3A7AB 1RCVD 2WINB 4KN4C 4XYOA 5K5PA 1Z9FA 4ME5A 1H9MA 3FKIB 1YBYA 1PRTC 1V9PA 5FK9C 3G71A 4WORA 1FVIA 4JI1L 2X6LA 4OIKA 1GVPA 3AYHB 4R4TA 1K3BC 5C3EH 3C46A 3PO3G 4FYDA 3E6ZX 1LO5D 2F0VA 4XXEA 3PV0A 4IUTA 3RR5A 3TSSA 3A55A 1EWIA 1FGBD 3DHQA 3G6JB 3OSOA 4JI3L 4BBSB 4H13C 4YHHQ 3GTLB 2R7ZB 2F0IA 3R3OA 3MXUA 2BDNA 4UP9A 3QWNA 2R7DA 4RCNA 2L15A 2JJQA 2G9DA 1W3SA 4K2KA 2Q8TA 5KNBA 5C44B 1K8MA 5EQ0A 2IX3A 2AWOA 3P7JA 4DR3Q 1QVCA 5C44H 4MN3A 2HCIA 4IUNA 4FXGC 4LF9Q 4UAIA 4YY3Q 4LF5Q 1XPUA 2N3SA 2PPBC 3MZ5A 4EX5A 2NVYB 1TR5A 1OXVA 4X64Q 5IY0A 5IYDG 5FO7B 3QIAA 3RLNA 1L1OB 2WKCA 3P20A 1A2UA 3H0GB 4N9PA 4B3SL 3I4NG 2FXQA 1EYCA 2NN6H 1IW7C 3S1MH 4G7OC 4DUZL 1LACA 4GN4B 5JJIA 3JAMi 1SE8A 1RTNA 4HSVA 3A8JE 3SHLA 1OXSC 3M85A 4FP5D 3OW7A 4OONA 1TWGB 2B2UC 2A68D 1P8LA 4POFA 4CHTB 3S1QB 2AKWB 3KBXA 1GHJA 2F4IA 1SYGA 3AB9A 2RQXA 3TS0A 2PI2E 1UWVA 1XYIA 1XMOL 3CD6A 1J9OA 1K28A 3PO2H 3HG9A 4KJOA 4ME3A 3KF6B 4C1NI 1ESRA 1TWFB 4BY1G 4IUQA 3HOWB 3KJOA 2F03A 4NMZA 1ZYRC 2ASBA 2O4XA 4GS3A 2B63G 3BDCA 2Z6KA 3F1ZA 2F0UA 2DN8A 3F8TA 4B08A 5C0XJ 1CZWA 4OIJA 4DV5L 1TWAB 2RCFA 5BN5A 1TVXA 5JVG3 1EFWA 4JI6L 2NYZD 1X3FA 3S15H 1LLRD 3KF8B 4TSSA 1SSOA 1C7YA 4K8IA 2N88A 4DNIA 4HMIA 3JC66 2ES2A 2JA6G 3VDYA 4JOIC 1X3EA 3KLSA 1U9RA 1V43A 5CV9A 1PH6A 1CZGA 2QGQA 1HA5A 4UY8C 1SYDA 1ONLA 2HIXA 5COYA 1UEBA 3PUZA 3Q6SA 1SEBD 1MSGA 4FO2A 3MA2B 3Q0AA 2VB2X 1I94Q 3S1RH 3S16B 2RDHA 3E0EA 1C48A 2YYZA 4OO1H 2WV6D 4DV6L 3KF8A 4GN3B 4F87A 2N8NA 3KLWA 1FL0A 4H44C 4NW2A 2BH8A 1XPRA 2M00A 2E5LQ 4EQPA 5DEHA 3T1HL 4A3JB 1IBKQ 1KNAA 5ELEA 4LF6L 1WFQA 2BH2A 1SE2A 5IGEA 3MXPA 3S1MB 2Q2HA 1WD0A 1L0XB 2MFIA 2JA5G 4DV0Q 1EU4A 5M3MH 4FF3A 1STBA 3I4NH 1CA5A 1IYVA 4KTAA 1WYDA 3I2ZA 1Y1WB 2NVYH 5AFWA 4DFAA 2UUAQ 1G6ZA 2IHEA 1I4GA 1WCMG 2E76C 2MPMA 2ZM6Q 3ND8A 4K8JA 4JG2A 4YWMA 4LFBL 1EQRA 3KJPA 3TP5A 4DR5L 3GTOH 3GO5A 1EWHA 1XJVA 5EPLA 1WD1A 1NMFA 5IYDH 4OEMB 2A8VA 3C1EA 4B3TQ 1JWMD 1YHBA 1WCMB 2RVLA 2L11A 3VYTA 3F2UA 3LGJA 1GOZA 3GTPB 4OX9Q 4P75A 1VF5C 4N8X1 1YNJD 3J80c 2CH4A 3QOLA 3CXCA 3DLLA 3D4RA 3CCSA 4XQQA 1DD2A 3HKZE 3DWPA 3J80E 4HJ5A 4IJLA 4KN7C 4BY1B 5CYUA 1Q82C 5FKAC 3PUXA 2EIFA 4R8IA 1PH2A 4FNFA 5DLQE 3NSWA 4RGTA 1TT2A 4HJ8A 1AW7A 3HZXA 2WP8J 1JB7A 4YWLA 3DMUA 5JAVA 2CCZA 2KBNA 1D2BA 2R6GA 1HNZQ 4GKJL 3OTOL 4XIGS 3HOZH 4IFDJ 1W6JA 1BBWA 1OO9B 1B4OA 4WJWA 2F0GA 3MAQA 5G3LF 4PZ8A 4KKTA 4RCOA 4A93B 3TDQA 1T9HA 3S9WA 4DR7Q 3TN2A 4NKLA 2EYHA 3P1HA 3B6YA 2F0FA 3K5LA 2R92G 4PZ6A 1VQ6A 5C4XB 3CCQA 4DN4M 1KL9A 4P71A 1WTOA 3FHWA 2DUDA 3E5SA 1JB3A 2V1CC 2C35B 2F0NA 5GAEC 1N32Q 3U50C 3HKZB 2SEBD 1YNXA 2SNSA 3NHHA 1A6XA 4J15A 4QL5A 3BVMA 2BA0A 1ILQA 2XWBB 4DKAC 4LFCL 1XMQQ 4DUYL 1TQOA 1BCPF 5IGDA 4Y52H 5E4WC 4BXXH 4DR3L 5EGTA 1S3OA 4LF9L 2QDBA 1HPCA 2Q2IA 4EQNA 1IZ6A 4IUUA 4X3KA 2CQOA 2ZXRA 2YV5A 2K5HA 4RKLA 4AH6A 1TWHB 1SNDA 2R93G 4OWXB 4L6TB 5KEEA 1GUSA 1PH4A 3J81i 1SLJA 4PNYA 1PH1A 3HOXG 4V190 1N36L 4DR6Q 3I91A 4HEDA 4LUOA 3PIOA 2K7VA 3I4LA 4K5VA 2OQ0A 4QF4A 1VQIA 2JA5H 2KHSA 4NDXA 2Y0SB 3A8IE 2Z1CA 4WJ3M 5CV7A 1I4XA 4P74A 3R8BA 1AE3A 2EY5A 5C44G 3RZDB 1XMOQ 1K0RA 3D4WA 4DPGA 3GTOB 3D6WA 1SAPA 3CC7A 1WJJA 4HJAA 1BO0A 4K5WA 4TQUS 3I4MB 3L0OA 2HDMA 5E3FA 3R2IA 3L2PA 3SVMA 3BDLA 4LMQD 4AQYQ 4UDUC 3A74A 1EY7A 2KECA 5EJWA 1UAPA 4NXMQ 2K4KA 2D2CC 4ZKBB 3S16H 1VQAA 4JI6Q 1D7QA 1QVGA 3GV3A 1GUGA 1SMYC 1PRTD 1JCKB 3PIO3 2NVQH 2A6HD 1WTVA 4DR1Q 1PLFA 2VQFQ 5FO9B 4QJFA 4DR4Q 1UE5A 2B2WA 5IGFA 1A63A 2D0OA 2NTTA 3X3MA 4K2LA 5M5WH 1PTOH 2DNEA 4ZYSA 1EYAA 4JCVE 5IP7H 1OXXK 4C3JB 3Q24A 1LTLA 3PO2B 4KKSA 4DK0A 3MXNB 3ITPA 1KC8C 1C0AA 1QE6A 2LY7A 4LF8L 4JI4Q 2BA1A 1STHA 1Y1VH 4L5QA 4R4QA 1YEZA 1XNRQ 1H95A 1CSQA 3PGZA 2KHIA 1CA6A 4G57A 3AMUA 3T1HQ 1IBKL 3KBGA 5J1ZA 5C6AA 1BOSA 2DJFC 4A75A 1I3QH 3UE1A 3CW2C 3CCUA 5J22A 2H1EA 1B9MA 4A3EH 3H3VI 3ULLA 1V1OA 1PYWD 1SE3A 3W1BA 4C3IH 3DXJC 2TSSA 4FXDA 2VQEL 1DOMA 1M90C 4PZ7A 3T4AC 3S2HB 1K0SA 3J81E 2D62A 4BA1I 3CMEA 1YNJC 5FLXL 4N8FA 2JA5B 1CSPA 1I6HB 2VL6A 1NUCA 1VQJA 1HNXQ 2WB1B 4Y7NB 4LFAL 1TS4A 3H0GH 1N34L 4DV4Q 3VA5A 3GP7A 1EIYB 3K7AB 5ELCA 4IUPA 4CJ1B 3FEWX 2F3WA 4TVAB 3MXGA 3UDIA 2RHSB 2F0MA 2JE6I 4CDEC 2WACA 4R1JA 2E2DC 3M3YB 2LSSA 1B7YB 1EQTA 1O80A 3I73A 4JC0A 3NBHA 2NTSA 3E9HA 4C2MB 3E0JA 5NUCA 1PH7A 5KYIA 1JJ2A 2FJ2A 1KHIA 1HCZA 1QCBD 2VS1A 1X32A 3HRZC 1BBXC 4B3RL 3OOCA 4R4OA 2Z4HA 4JI7L 1LM0A 1Q8IA 4LF4L 2IWHA 2XIWA 1LTRD 3T51B 1XX8A 4A3KH 1K8AC 2JK8A 3U9OA 1D5MC 2WAQG 5C4XH 3I55A 2A69D 4Z9CB 2BOSA 2ZTEA 4GNXA 4A3LH 1VQBA 2R93B 4DV2Q 1CQVA 1RL2A 5T1GA 5M3MG 4GKJQ 1X9NA 1LTTD 5ISRA 1X6OA 5I2XA 2QDLA 1MBYA 3NBHB 4ALPA 2O2LD 1PHJA 3K0XA 5HGQA 4A3MB 3CC4A 3PIP3 1F9PA 1NNXA 1FYCA 3LWUA 4C3JG 2B2VA 1UE6A 1UEAB 3DEOA 5EPJA 4IFDH 1W6KA 2I46A 1QWYA 1CHPD 1DGSA 4A3FB 3N52A 3K0YA 5JEAG 2PQEA 2UXCL 2PNHA 3HOVB 3K6OA 2E8GA 3ICEA 1N32L 4IN3A 4JOIA 5C4ZA 2FMCA 2PQAB 2PQAA 2PW7A 1L1OC 4FF4A 4OELB 1WTPA 2B8FA 2E75C 1SMYD 4JBMA 4BS9A 2K33A 4YHHL 3T53B 4ODGA 4LFCQ 1XMQL 4DUYQ 1II3A 1SBBB 4PG3A 1W2BA 2ZTDA 1IW7D 4ZQ3A 1KQSA 2Z6KC 2QEJC 4HIMA 4KK7A 1G51A 3S1NH 3M4OH 5F2DA 2K03A 2L9HA 4AYBB 4YY3L 4MIUA 1HZBA 2IT1A 5D3IB 3DWQA 2EXDA 4A3EG 2E2JH 1CI3M 2EYJA 2B63B 3DM1A 4QB4A 2AUJD 2R7ZH 3GTLH 1I50B 3A7LA 3NWSA 3GTQB 1XPOA 1ZEQX 2A73B 1GXDC 1KRTA 3M4QA 2I07B 3S1RB 1QB5D 2X69A 1HZCA 3H6MA 5GROA 1BQQT 2PI2A 2IPKD 1RODA 3H94A 4TKOB 1HR0Q 3S2HH 4CJ2C 3DWAA 4BY7H 4QIWE 3NE5B 1L0YB 3SGIA 2HHHQ 1TY2A 4RAUC 2Q8RE 1G6PA 2JN4A 1IBML 2JA8H 1U4PA 5D65A 5J3BA 3HOYH 1PFSA 4GOPB 3W5OA 4RHSA 4RA8A 3L9AX 4O1NA 5G3LD 5CC4A 3GTKH 1C4QA 2AUKA 4KV6A 5C3EB 3NENA 3K5OA 2E74C 3VYSA 2ICEC 3VA7A 3KYHC 1I6VC 1XTCD 2NVTB 3MEHA 4QMGA 3VYRA 4DV5Q 3CU7A 1CTMA 2QW7A 4BBRG 1D1IA 1V1PB 1Q81C 1HRJA 1BCPC 1KDAA 2RA4A 1HHVA 1FD7D 3R2TA 1VS0A 4XTCS 3EJIA 5K36H 4RHRA 4DR1L 1M4VA 3NTHA 3M4OB 2L5TA 1X3PA 4DAYA 1VCIA 3LX0A 5JOBA 1TS3A 1TWGH 4QY7A 5LL6X 2R93H 2R61A 4YCWA 4CKEA 4K14A 4GOPA 4ZUJA 1PFBA 5KNCA 1I94L 1PH3A 1ZKOA 3BG3A 3KFUA 2F52A 1A0IA 5GQOA 5FLXc 5LMNQ 4JV5L 5BN3A 3U9SA 3WWVA 4DV6Q 1TWAH 1QUQB 2F0SA 1D1KA 1PVOA 1ICWA 4HIKA 4HCEA 2K14A 2A5HA 2MGSA 5FLMG 1VQ4A 1CKNA 2WFWA 3NEMA 3PSIA 5C4HA 3JAME 4GLVB 3D4DA 4LF6Q 1F2YA 2QEXA 4IPDA 5CV5A 4H0LC 1LT5D 1MGSA 1PFMA 2R7ZG 4NP5A 1EZ6A 5GAGC 3HOYB 1EY0A 4R4CA 4QUCA 5FO8B 4WFN3 1QZHA 1PYBA 2LKVA 4ZK9B 5KRUA 4XT3B 5EKIA 3K7AH 4C3HG 4KHZA 4X65L 1EFID 1WTXA 1FNWA 2A6EC 5JEAH 1K73C 4DR2L 1GO3E 1LYLA 3KLRA 1Z7TA 4LFAQ 2ZJPA 1YJNA 1N34Q 4LFBQ 2E2IB 3SE0A 4NXNL 5IOCA 4C2MH 3FPPA 3KLSX 1Z6HA 4A3FH 4C3HB 3GTMH 3AU7A 3ERQA 4OO1I 4B3TL 1NCVA 2EZVA 4JK1C 4JI2Q 1EYDA 4KMUC 2F0OA 4X62Q 1VQ9A 3U4ZA 4DAPA 4DAYB 3VR5A 3OWFA 1SYFA 2DY7A 2MJ8A 2WB1G 4P73A 3PO3H 5KIXA 3LWEA 1NBWA 1F9QA 3HKSA 3L3OC 3S2DB 4PV1C 2MHVA 1YIJA 2G9HD 2ZXOA 1BF4A 1AH9A 1QUQA 1WTRA 1J5EQ 1Q46A 4A3MH 1KLGD 3GDEA 1VQOA 1DONA 3HKZG 4Y7NH 2SNMA 2FINB 1PA6A 1ENCA 2AQ2B 1EIGA 3U4VA 2F0DA 1KDCA 3PUYA 1UUPA 1K3RA 3BYTB 2YTYA 1BXTA 1EY4A 1F2ZA 2HQEA 3J81j 1YZ6A 2X6GA 4KKUA 1N9WA 2R3ZA 5I2YA 1HNZL 3K8AA 1F9SA 2LFNA 3OTOQ 2RBMA 4LK1C 1IL2A 4J8QA 1STAA 3M7GA 4A93H 3UDXA 5CBAE 1GKHA 3NTIA 4K6DA 2YU9H 2UXDL 4IO9A 1JICA 1BNZA 2JP1A 3W3AA 1QVFA 1YVCA 4A3GG 1E2ZA 3RN2A 2ICIA 1JR0D 4X3UA 2OTLA 4FF1A 1K83B 1SYCA 5CGKA 2JA7H 1TS5A 1LTID 1PYSB 3RLOA 2HCCA 1PH5A 2VUMB 2D9UA 4LUVA 3M4PA 3VR6A 1LTBD 2KEEA 2F3IA 3GTJB 4KY6A 1EQQA 3RZOH 1B44D 2WAQB 3HP3A 2NZ1D 5M3FG 3OYYA 3RD4A 2WIIB 4A3CH 5M5WB 4DK6C 1JE5A 3PUVA 2AMCB 3OHXC 3IKJA 3TP7A 2OF1A 3SR1A 3A54A 1EY6A 1STEA 4RMFA 3K81C 1JORA 3I4MG 4GNXB 3CCLA 1Y8OB 5ELFA 1JOKA 4I7ZC 1BKBA 2ZTCA 1PH9A 1EU3A 1L1OA 1DM0B 5ELDA 2NB0A 1K9MC 2KUMA 2JYOA 3AEVA 1EYGA 1I4PA 5IP9G 3C2PA 5IWAL 1JMCA 1CHQD 3HOUG 1ICFB 1R4QB 4DR6L 2L4NA 1H9SB 3MEFA 4BY1H 3FP9A 1ZXTA 4A3EB 2JEAI 1RKNA 3F2DA 2E2JB 1YJWA 1XTDA 4X3SA 1MSHA 1D6EC 1GUOA 3HOXH 3BS1A 4XDXA 1HR0L 3H3VC 3IFTA 2AWNA 4MNOA 3GTPH 3RN5A 2ZT9C 3CC2A 3A0JA 3OIQA 2KCTA 2MNAA 2EJFC 4O2DA 2EDGA 4RFBA 4HAEA 1IBMQ 4DNTB 3MXNA 3BU2A 4IUVA 2JA6H 5T1IA 1IKLA 3EBEA 2B2TA 1VQEA 2F0EA 1E7ZA 2JEBI 1Q3LA 2PMZB 4AQYL 2IX1A 1BDOA 5IODA 4NXML 1S5CD 3TRZA 2BE5D 5IP9H 2I5LX 4IOCA 3BDOA 2MP1A 4IURA 5I6YA 2A19A 2EYLA 1Y1VB 1SDFA 2ZXPA 2PNRC 5E7NA 5C4JB 2HT1A 1VQ7A 2A68C 3I3CA 2EY1A 5M3MB 5C4JH 4C56C 1I5FA 2K5WA 2R7FA 4FVMA 4QQBX 2OT2A 2VQFL 1GM5A 4DR4L 4AYBG 4JPBW 3V05A 3TBIB 4UP7A 1XXGA 1PTOD 1Q7YC 1YNNC 3G4SA 1PTOB 5IIFA 3NP8A 2NZOA 5KNDA 4HIOA 1V1PA 4DV7Q 1SNPA 5LMNL 2UU9L 1H9JA 2FFKB 4LNQA 2D0PA 4JVZA 2F0WA 1G91A 1Y8NB 4KHVA 4HSPA 4JI4L 4HTHA 4L5TA 2IY5B 3CCEA 4A3JG 3G7LA 3STBD 3HEJA 4RG1A 1B3AA 2CW0D 2JSOA 5IGGA 1R4PB 1WCMH 3DM3A 4G4KA 4KLKA 2N78A 1Q1BA 1KRSA 3FKIG 2E2HH 2F0KA 1NTGA 2NN6I 3VR3A 1SR3A 1E22A 5C0XI 1Y1VG 1HQRD 2K1BA 5LMNW 3SK5A 1AP0A 3HGBA 4CDDC 2EE1A 1HQMC 1JWUD 2PMZE 4GOPC 2V4DA 2F3VA 3D0FA 5IYCG 2JQOA 3WOEA 2GVAA 4B3ML 4X65Q 1SNQA 4POGA 3IFDA 1KXLA 1S5DD 5GADC 2C5CA 3KDFA 4DR2Q 3P75A 3S2DH 5HGTA 1H9RA 1STNA 1OTCA 1JJGA 4EGVA 1SNCA 1SMXA 2EY6A 3PO3B 2OCEA 1KABA 3ERSX 1HNXL 1SE4A 3GTJH 3I8ZA 2A74C 4GZYC 1CFMA 3CQZB 4DV4L 4ZAIA 1IHZA 4BBRB 1RDPD 1TWCH 4JI2L 1PDQA 2K50A 1Y69U 2PZTA 2ATWA 3I4NB 4NB3A 3Q8DA 3D8GA 3KK7A 1RIPA 2K32A 3H0GG 2WAQE 4KI0A 4CDFC 1SRUA 1I50H 1YITA 3S1QH 5A35A 3V2TA 5HURA 2MQHA 2JA9A 1H9SA 1EUJA 1MKHA 1O78A 1DXMA 5LL6S 5ELBA 1B1ZA 2F0LA 5I9OA 1G8ZD 3HOZB 2ALYB 2F0PA 1J6QA 1PMRA 1FNVA 4OWTB 3ND9A 1EY9A 2B2WC 1E3PA 2OEOA 2I5HA 4B3RQ 2XN9C 4HIDA 3WOFA 1PRTF 2L1BA 5HY6A 4JI7Q 4V0BA 4MZ9A 1GUTA 2EJMA 2NWGA 3H15A 4BBSG 4GKKQ 4IQZA 4K5XA 1E1OA 1SNMA 1TXYA 2PO4A 3K7UC 4OXPA 4JI8L 3J80i 3X3NA 4WJ4A 1VDZA 1ILPA 4C3JH 3K5MA 5IE8A 1CQFA 1ML0D 4DV2L 2WKDA 4A3DG 4B9XA 1F2LA 5D3DA 3D3RA 4IFDG 1QG7A 3NQIA 1S5FD 2UUCL 1UE1A 1TIID 1S40A 3T1YL 1K83H 1Y14B 3T56B 2KOLA 3HOWH 3HOUB 2VNUD 4EVOA 3KOJA 1TWFH 4AIMA 3URYA 1QNUA 1U0LA 4YCUA 1EWCA 2RCNA 1NJIC 1U5KA 4ILWA 5C0XG 1BUVT 2N49A 2VY3A 1VMPA 4R8NA 4A3KG 4CKBA 5DNFA 1KD1C 1QJOA 3QJYA 3Q23A 5JVH3 2XRQD 2B2YA 4JBWA 1ASYA 2F0QA 2EYFA 4APVA 1EIHA 2UXCQ 4UPAA 3MC0B 4DV1Q 1VQNA 3J7AF 1SJED 2B29A 4X6AH 3F2BA 2Y0SE 2YU9B 1AZPA 1AN8A 1IYUA 3PCOB 3M4YA 5CR3A 1IBLQ 4MTKA 4CDCC 2NVXH 4RGNA 2EVBA 2QILA 3J81c 3NTKA 2ENBA 1EEFD 3I56A 1O7LA 4DU9A 3GTKB 1X56A 3M7NA 4C1NK 4U673 2KCCA 3S15B 1NR4A 1H9KA 3M3YH 3FVQA 4FF2A 3OPOA 3A8KE 4DV3Q 5IWAQ 1KIXA 2F4VL 1Y8PB 4LF7Q 4CKCA 1JWSD 3ULJA 4MHEA 3TZDA 3CCVA 4KD3A 1NMGA 1DYQA 5CV4A 2FHTA 1Z47A 3JAML 4IALA 1K8GA 2JA8G 1LTGD 3GD7A 1QILA 2Z9HA 4K6LA 4E6IA 1DOKA 2KJXA 2CWPA 3S1NB 2K5DA 1KNEA 4TRDA 1MI2A 4RH6A 4IFDI 1HTPA 3HFZB 1A62A 4OHJA 2HHHL 2O5IC 1B9NA 4KHPL 2B63H 1HJPA 3CRLC 2AHOB 5EAYA 3DUZA 3I4OA 5M9OA 3J7YW 1JOQA 3I72A 2JA7G 1U4MA 4YWKA 2QCPX 1YHQA 1RF2D 2PYKA 4JI5Q 5K36G 5JJKA 1KAAA 1YNND 2VUMG 4GN5A 1EQVA 1O7YA 5FLXE 4JW0A 1SROA 2YTXA 1CK1A 1B2TA 2VXWA 3BZDB 1CKOA 2NVXB 1FJGL 1U4RA 4ULLA 2HD3A 3MWYW 2D5DA 5DM73 3GV6A 1NAPA 5M5YH 1WTHA 3JAMc 1GUNA 4CBVA 2PW5A 3PF4A 4L8JA 1WI5A 3CCJA 1HFGA 4F7XA 1LTAD 4UP8A 2UXBL 2LMCB 2CHBD 2EQSA 2KA7A 2J4XA 1X3QA 3AFQA 4GLAC 1YJ9A 5H1SE 4DV7L 1C9OA 2UU9Q 3NWTA 4BBSH 3K80C 2HQLA 2K04A 4HJ7A 1NY4A 3FRPB 1G2TA 3QO2A 2R92H 4JV5Q 5LMUQ 1Q12A 2Z0SA 4KJNA 4IPHA 3CCRA 2CKZB 2QKIC 1PZKD 2B3GA 1N33Q 3MHBA 2SOBA 5TSSA 5IYBG 1E0BA 3CPFA 2EPBA 3IL8A 2O5JC 4P72A 3GTQH 3G48A 1QZGA 2CWAA 2DY8A 5I9PA 1DCZA 2EYPA 4BWGB 3OIPA 1TY0A 5JPNC 5J39A 5DAUA 4JI1Q 3T13A 2K28A 3N6RA 5EPKA 5A2QL 4B3MQ 2YTVA 2CW0C 4Q0FA 3PF5A 1A8VA 3K59A 3ULPA 1G291 1SXTA 2MUYA 5C3EG 3M9BA 5M5XB 1GHKA 1E2WA 1T5XD 4Q5VA 1V8QA 1B70B 2HIVA 5BN4A 2GVBA 1IKMA 4AYBE 4ABNA 4DXGA 4NXNQ 4LAAA 4QIWB 2N55A 1XNQQ 2VW9A 1WTQA 2TMPA 2KCMA 4LF5L 5KGUA 2PZWA 3QG1A 5AJ3Q 4X62L 2XRSD 1L2FA 2QF7A 1GJXA 5KYLA 3SEBA 4WRDA 5M5XH 4LUZA 4YCVA 1MJEA 1PV4A 1J8IA 2K52A 1I3QB 1SYEA 3FKIH 1CM9A 4DUZQ 2B2UA 1VQ8A 2XWJB 1MHWC 4GNXC 1SNOA 1J5EL 4A3FG 3F2CA 1F9RA 2HDLA 1EOVA 4YIJA 4P2CB 3HOZG 4JI8Q 1OXTA 1V1QA 1QNKA 1I4RA 2VB3X 4QCLA 4IOAA 3KDFB 5DM63 1PFNA 1Q86C 3CQZH 2AQ3B 5JJLA 2UUCQ 1M1KC 3K58A 3H91A 1Q8KA 1Y1WG 1VQKA 3STBC 1JC7A 3GTGH 2F0JA 2XSCA 4DK3C 4JI0L 1M8AA 2UXDQ 1WTWA 3PUWA 4K0KQ 1D5XC 2BCOA 2RKSA 1ENFA 2KVMA 3SK4A 1R9TB 1PTOF 1SJHD 4I7AA 1FGUA 2K5NA 1CUKA 3EFXD 5C3XA 3MVVA 3IAYA 1RD9D 2JXMB 1VQHA 4DV1L 1BCPD 1NE3A 2KEDA 2RDFA 5IT9E 3KUPA 3S17H 1N8RC 1S5ED 5BR8L 2F0TA 4FXKC 5EBDA 4NPSA 3S14H 1EIFA 1B53A 1IBLL 3Q22A 1PH8A 5IT9c 3ONAB 1UE7A 2BDOA 1LTSD 2RDGA 1FR3A 3NPPA 5CORA 3TMEA 2GA4B 1XWEA 1A3VA 1VQDA 2EJGC 3HOUH 3I7FA 4FDBA 4C3IB 1LT3D 2AQ1B 2A1AA 1O7IA 2CFMA 2MO0A 4XT1B 3OMCA 3TP8A 2EYOA 1TKWB 2OWOA 2KCNA 3E3XA 2XNAC 2E5LL 2NVQB 4DV3L 1HNWQ 2F4VQ 3HOXB 1GD7A 4EQ5A 3J81L 3CAMA 4LF7L 3I4MH 1PXUA 3I70A 4O42A 3VR4A 4IPCA 1VQLA 3C3LA 5D14A 1HZAA 3O13A 3D31A 5CBEE 4A3DB 3CMAA 3J7A5 4PMCA 2NUCA 3QB3A 5IGCA 1G2SA 1JT8A 1A15A 1JE4A 1EOTA 2IJ0A 4JBKA 5FJ8H 4DNRB 3RLFA 4S3SA 1AZQA 1S72A 2QA4A 4A3IB 4BBRH 1WVLA 2ZM6L 5ELNA 5C0XH 4KHPQ 2K5VA 1CKNB 2WB1E 1RJTA 4A3DH 4KY5A 1NSNS 1DOLA 4DK1A 3CCMA 4DR5Q 4HMJA 2ZJQA 4JYAQ 3OW2A 4A3BG 4OL7A 5FOBB 4JI5L 1HR0W 1VMCA 3U58A 2H4OA 2IW3A 2L12A 2KHJA 1CKMA 2F0HA 4I65A 1DJRD 4DXFA 1ESFA 4MTNA 1I6HH 4ID6A 3HS0C 2B2TC 2E2HB 4H02A 3RUZA 2OTJA 1LT6D 2IHFA 3PQIA 2HUGA 2K6AA 3KF6A 3ZYYX 4X66Q 1MJCA 1B3QA 3SK8A 3VR2A 3E9IA 1BCPB 2GN5A 1HUMA 1E2VA 1LABA 2M2LA 1E24A 3TQYA 2C9OA 2PCFB 3UE0A 3FMCA 1B8AA 2UUBQ 1I4HA 1E1TA 3PMFA 2B39A 3ZJYC 1X65A 2EYMA 4F88A 3EVQA 2RHQB 1UNSA 4A3MG 3EQLC 1LT4D 1KAWA 4L63B 3RZDH 1WOCA 3W1GA 2A69C 3UDGA 2JA6B 2NN6G 3S14B 3FPUB 4DR7L 3NK9A 3L7ZC
chains in the Genus database with same CATH topology
2UUCL 1UE1A 3SGIA 1S40A 2HHHQ 3T1YL 1K83H 1WYDA 1Y14B 3I2ZA 3HOWH 2VNUD 3KOJA 3IRBA 2NVYH 1TWFH 4AIMA 1G6PA 1U0LA 4YCUA 1IBML 2UUAQ 2JA8H 2IHEA 1VQKA 5J3BA 2RCNA 3HOYH 4QGUA 1WCMG 1PFSA 4GOPB 1U5KA 3W5OA 1NJIC 4A3LG 4O0AA 2ZM6Q 5C0XG 3GTKH 4JG2A 2N49A 4YWMA 5JEAJ 4LFBL 2VY3A 1EQRA 3NENA 4A3KG 3KJPA 4DR5L 3GTOH 1KD1C 3GO5A 1XJVA 3RNUA 1NMFA 4JBWA 1ASYA 5IYDH 3KYHC 2A8VA 4B3TQ 4APVA 1TWHH 2K75A 1YHBA 4JI3Q 2UXCQ 4UPAA 3S24A 4DV5Q 4DV1Q 4OWWB 1XNQL 4BBRG 1VQNA 2B29A 1Q81C 4X6AH 3F2BA 1IXRA 3LGJA 1VS0A 4XTCS 2Y0SE 4OX9Q 3H3VH 4P75A 5IYBH 4DR1L 3J80c 3PCOB 5AJ3L 3BZCA 4JBJA 1IBLQ 3CXCA 1VQFA 1VCIA 3DLLA 2NVXH 3J81c 1TWGH 3CCSA 2OQKA 5IYCH 4QY7A 3HKZE 2R93H 3I56A 4HJ5A 4IJLA 4IJHA 4YCWA 4X64L 4L5RC 4GOPA 3EIVA 1X56A 1Q82C 3PUXA 2EIFA 1IYJB 3M7NA 1I94L 1PH3A 1PH2A 5DLQE 3KFUA 1N36Q 2F52A 1A0IA 3TS2A 5GQOA 5FLXc 5LMNQ 4B3SQ 4JV5L 3WWVA 4DV6Q 3M3YH 4HJ8A 1TWAH 3HOVG 4DV3Q 1QUQB 2WP8J 3UDFA 5IWAQ 1KIXA 1PVOA 2F4VL 3TREA 4HIKA 1JB7A 1VQ5A 4YWLA 2K14A 5FLMG 4LF7Q 1VQ4A 3ULJA 1CKNA 2WFWA 3NEMA 3PSIA 4DAMA 3CCVA 2CCZA 1NMGA 4GLVB 4GKKL 3HOWG 1Q1EA 2KBNA 1Z47A 4LF6Q 2R6GA 2QEXA 4IPDA 1HNZQ 1K8GA 4GKJL 2JA8G 3OTOL 4XIGS 3HOZH 4IFDJ 1BBWA 3GD7A 1X54A 4A3IH 4PZ8A 2CWPA 2R7ZG 5GAGC 4IFDI 2E2IH 4R4CA 1T9HA 1QZHA 1PYBA 4DR7Q 1BBUA 3HFZB 1SN8A 1A62A 4OO1G 5ELOA 2HHHL 3T1YQ 3K7AH 4KHPL 2B63H 4JI0Q 3B6YA 4LWCA 3A5ZB 1HJPA 4KHZA 4X65L 2AHOB 1K73C 5EAYA 1VQLA 2R92G 4K0KL 4DR2L 4PZ6A 1GO3E 1VQ6A 3I4OA 3CCQA 1LYLA 1KL9A 2JA7G 4YWKA 1YHQA 4LFAQ 2ZJPA 4P71A 1YJNA 1N34Q 4JI5Q 5K36G 4LFBQ 3FHWA 5JJKA 2DUDA 4NXNL 2V1CC 4C2MH 2C35B 3EN2A 5GAEC 2VUMG 1N32Q 3U50C 1BVSA 4GN5A 2NZHA 4A3FH 1YNXA 3GTMH 1X3GA 1SROA 5GAHC 4OO1I 4J15A 4QL5A 2YTXA 3BJUA 3PIPA 2Q2TA 4B3TL 1P16A 2BA0A 4JI2Q 1OXUA 1CKOA 4X62Q 1VQ9A 3U4ZA 4DKAC 1FJGL 4LFCL 5BR8Q 1XMQQ 4DUYL 3NELA 4DAYB 1MIUA 4A93G 4Y52H 4BXXH 4DR3L 1S3OA 5M5YH 2WB1G 4LF9L 2LXKA 1VQCA 3JAMc 3PF4A 4P73A 1HZ9A 2Q2IA 1WI5A 1IZ6A 5IP7G 3PO3H 2CQOA 2Q2UA 3CCJA 1NBWA 2YV5A 3HKSA 2K5HA 4UP8A 4AH6A 2UXBL 2EQSA 2R93G 4OWXB 1LUZA 2ZJRA 3AFQA 4GLAC 1YIJA 1YJ9A 4LF8Q 1PH4A 5H1SE 4L5SA 2Y0SG 2I5MX 3J81i 3BZKA 1C9OA 4DV7L 1AH9A 1SLJA 2UU9Q 1QUQA 4A4IA 1J5EQ 4BBSH 1PH1A 1XNRL 3HOXG 3K80C 2DGYA 4C3HH 2HQLA 1N36L 1Q46A 4DR6Q 4HJ7A 1HNWL 4A3MH 1NY4A 3CF5A 2R92H 4JV5Q 3GDEA 5LMUQ 1VQOA 1Q12A 2Z0SA 3ER0A 4LUOA 3HKZG 4Y7NH 3PIOA 4IPHA 3CCRA 1PA6A 3HOYG 2CKZB 2OQ0A 3G6EA 2B3GA 1N33Q 5M3FH 3U4VA 1VQIA 1VQPA 2JA5H 1X55A 3PUYA 4BY7G 5IYBG 1K3RA 2YTYA 1L0WA 3CPFA 3J81j 1YZ6A 1JJCB 4WJ3M 4P72A 4DV0L 3GTQH 1N9WA 3G48A 1HNZL 4P74A 3K8AA 2XGTA 1QZGA 3OTOQ 1AE3A 2CWAA 2VQEQ 3CPWA 1HH2P 1IL2A 5C44G 1XMOQ 2LXJA 1K0RA 3UDXA 4A93H 1GKHA 1VQGA 4PMWA 4DPGA 3CC7A 2YU9H 2UXDL 1WJJA 4JI1Q 4IO9A 3AQQA 4HJAA 2UUAL 2VUMH 4TQUS 4A3JH 4B3MQ 3L0OA 2YTVA 3PF5A 1QVFA 2VZAA 1A8VA 1YVCA 3ULPA 4A3GG 1G291 5C3EG 3RN2A 4JYAL 3M9BA 3L2PA 4AQYQ 1Y1WH 3A74A 1ASZA 2OTLA 1B70B 2HIVA 4NXMQ 2JA7H 2K4KA 2GVBA 4GLXA 1PYSB 4AYBE 2H5XA 3RLOA 3S16H 1SFOH 1VQAA 2ID0A 1PH5A 1QVGA 2I0QA 4JI6Q 4LUVA 1D7QA 3M4PA 4NXNQ 1AE2A 1R9TH 3A5UA 1XNQQ 5C4XG 2KENA 2F3IA 3PO2G 1EQQA 3RZOH 4BA2I 2VW9A 2NVQH 5M3FG 1D8LA 2KCMA 4OX9L 4DR1Q 4LF5L 3OYYA 2VQFQ 4A3CH 5AJ3Q 4QJFA 4X62L 4DR4Q 1UE5A 4DK6C 1FJGQ 1L2FA 1JE5A 3PUVA 2AMCB 1A63A 2D0OA 2IX0A 4X66L 2XTIA 5M5WH 5M5XH 4RMFA 3K81C 3I4MG 4JCVE 5IP7H 1OXXK 4LUZA 4LW1A 4R4IA 4YCVA 4GNXB 1LTLA 1MJEA 3CCLA 3MXNB 4A76A 4A3IG 1PV4A 3CP0A 1KC8C 4LF4Q 3HOVH 2K52A 1BKBA 2UXBQ 1C0AA 2ZTCA 3FKIH 1PH9A 1L1OA 2UUBL 4BXXG 4DUZQ 1YI2A 4LF8L 1K9MC 5FLMH 4JI4Q 1VQ8A 2BA1A 3AEVA 1Y1VH 4L5QA 1EYGA 3AFPA 5IP9G 4GNXC 4R4QA 5IWAL 4A3GH 4A3BH 1J5EL 1YEZA 4A3FG 3F2CA 1XNRQ 1H95A 1CSQA 3PGZA 1JMCA 2KHIA 3HOUG 4DR6L 3T1HQ 1EOVA 1IBKL 1YHAA 3MEFA 4BY1H 5LMUL 3FP9A 3HOZG 2JEAI 4JI8Q 1OXTA 3F2DA 1V1QA 4A75A 1XTDA 1YJWA 1I3QH 4IOAA 3UE1A 1N33L 4HJ9A 3CW2C 3HOXH 3CCUA 3KDFB 4A3EH 1HR0L 1Q86C 3H3VI 2AWNA 5FJ8G 3CQZH 4IPGA 4MNOA 3ULLA 2NVTH 3GTPH 3RN5A 2UUCQ 5JJLA 3TEHB 1M1KC 3A0JA 3CC2A 1Q8KA 2RF4A 2MO1A 1Y1WG 1VQMA 3STBC 3W1BA 2MNAA 2KCTA 3J7ZC 4C3IH 4O2DA 4A3CG 2VQEL 1Z9FA 1M90C 1IBMQ 3GTGH 4PZ7A 3BU2A 1YBYA 4DK3C 1V9PA 4JI0L 3G71A 2JA6H 2D62A 1FVIA 2UXDQ 4BA1I 3CMEA 4JI1L 3EBEA 3PUWA 1CSPA 4K0KQ 1GVPA 2VL6A 1VQJA 3AYHB 1VQEA 4R4TA 1HNXQ 1FGUA 2K5NA 1E7ZA 2JEBI 5C3EH 3PO3G 4LFAL 3H0GH 1CUKA 1N34L 3PV0A 3RR5A 4DV4Q 4AQYL 1EWIA 2IX1A 1EIYB 4NXML 4JI3L 3TRZA 5IP9H 4YHHQ 2I5LX 1VQHA 4DV1L 4IOCA 4UP9A 1NE3A 4TVAB 2R7DA 3UDIA 2L15A 2JJQA 2RHSB 1W3SA 2A19A 3S17H 2JE6I 1N8RC 5BR8L 5E7NA 4R1JA 2HT1A 1VQ7A 4NPSA 2AWOA 1EIFA 3S14H 4DR3Q 1QVCA 5C44H 5C4JH 1IBLL 2LSSA 1B7YB 1I5FA 4LF9Q 1PH8A 2R7FA 5IT9c 4JC0A 4QQBX 4YY3Q 4LF5Q 3E9HA 1XPUA 2VQFL 1GM5A 1UE7A 2N3SA 1PH7A 4DR4L 4AYBG 1JJ2A 4UP7A 4EX5A 1KHIA 1Q7YC 3G4SA 1OXVA 4X64Q 1VQDA 5IY0A 5IYDG 3HOUH 3I7FA 4FDBA 3RLNA 1L1OB 2VS1A 2NZOA 4HIOA 2A1AA 4B3RL 1O7IA 2CFMA 2MO0A 4R4OA 5LMNL 4DV7Q 4B3SL 2UU9L 2OWOA 1LM0A 4JI7L 3I4NG 2FXQA 4LF4L 2E5LL 4LNQA 2D0PA 4DV3L 1HNWQ 3S1MH 4DUZL 2F4VQ 4A3KH 4JI4L 1GD7A 1K8AC 4L5TA 2IY5B 4GN4B 4EQ5A 3CCEA 3CAMA 4A3JG 4LF7L 2JK8A 3STBD 3I4MH 3JAMi 5JJIA 1SE8A 2WAQG 4RG1A 5C4XH 1WCMH 3I55A 3DM3A 4GNXA 4A3LH 2N78A 1OXSC 2ZTEA 4IPCA 1VQBA 4KLKA 1Q1BA 1KRSA 3M85A 4DV2Q 3FKIG 4OONA 1HZAA 2E2HH 1RL2A 1NTGA 2NN6I 5M3MG 4GKJQ 1X9NA 3D31A 1P8LA 1SR3A 4POFA 3CMAA 1E22A 2AKWB 3J7A5 5C0XI 1Y1VG 1X6OA 5LMNW 1JT8A 3NBHB 4ALPA 3TS0A 1PHJA 4JBKA 5FJ8H 2PI2E 1UWVA 3K0XA 5HGQA 3RLFA 1XMOL 3CD6A 1S72A 2QA4A 2PMZE 3CC4A 3PO2H 4GOPC 4ME3A 3D0FA 3KF6B 4BBRH 5IYCG 2ZM6L 2JQOA 5ELNA 4KHPQ 4BY1G 2K5VA 1CKNB 2GVAA 2WB1E 1UE6A 4B3ML 4X65Q 4A3DH 4POGA 1KXLA 3KJOA 3CCMA 5GADC 4DR5Q 2ZJQA 3KDFA 4DR2Q 2ASBA 4JYAQ 3OW2A 4GS3A 2B63G 3S2DH 4A3BG 2Z6KA 3F1ZA 1DGSA 1OTCA 1JJGA 5JEAG 1SMXA 4JI5L 1HR0W 2OCEA 3U58A 2UXCL 3F8TA 3ERSX 2PNHA 5C0XJ 1HNXL 2KHJA 2E8GA 4DV5L 3ICEA 1CKMA 1N32L 4JOIA 3GTJH 1EFWA 4JI6L 2PQAB 2PQAA 4DV4L 1X3FA 4MTNA 1I6HH 1L1OC 3S15H 3KF8B 1TWCH 1C7YA 4JBMA 4JI2L 2K50A 4DNIA 4H02A 4YHHL 3JC66 2ES2A 4LFCQ 2ATWA 1XMQL 4DUYQ 3VDYA 2JA6G 4NB3A 3Q8DA 1X3EA 4JOIC 2OTJA 1RIPA 1V43A 3H0GG 2WAQE 4KI0A 1PH6A 1SRUA 1I50H 1YITA 2QGQA 2IHFA 4PG3A 1W2BA 3S1QH 4UY8C 2ZTDA 1KQSA 2MQHA 2Z6KC 2HIXA 2JA9A 1EUJA 1MKHA 1UEBA 3PUZA 4HIMA 3KF6A 4X66Q 1G51A 1MJCA 3S1NH 3M4OH 4YY3L 1I94Q 3E9IA 2GN5A 3S1RH 1HZBA 2IT1A 1E24A 2EXDA 4A3EG 2ALYB 3TQYA 3E0EA 2YYZA 4DV6L 1J6QA 2E2JH 3UE0A 1B8AA 4GN3B 4OWTB 2UUBQ 1E1TA 1E3PA 2I5HA 2R7ZH 3GTLH 2N8NA 4B3RQ 3KLWA 4HIDA 1FL0A 1XPOA 3ZJYC 2BH8A 1XPRA 5HY6A 1KRTA 4JI7Q 1X65A 4MZ9A 3H15A 4BBSG 2E5LQ 4GKKQ 3M4QA 3T1HL 2RHQB 1IBKQ 1E1OA 4LF6L 4A3MG 1TXYA 3K7UC 1HZCA 1KAWA 1WFQA 5GROA 4OXPA 2BH2A 4JI8L 3J80i 4WJ4A 2PI2A 3RZDH 1WOCA 3W1GA 3UDGA 4C3JH 2Q2HA 2MFIA 5IE8A 2JA5G 1HR0Q 3S2HH 4DV2L 2NN6G 4DV0Q 4A3DG 5M3MH 4BY7H 4QIWE 4IFDG 3I4NH 4DR7L 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC L;  1UE1 A;  3SGI A;  1S40 A;  2HHH Q;  3T1Y L;  1K83 H;  1WYD A;  1Y14 B;  3I2Z A;  3HOW H;  2VNU D;  3KOJ A;  3IRB A;  2NVY H;  1TWF H;  4AIM A;  1G6P A;  1U0L A;  4YCU A;  1IBM L;  2UUA Q;  2JA8 H;  2IHE A;  1VQK A;  5J3B A;  2RCN A;  3HOY H;  4QGU A;  1WCM G;  1PFS A;  4GOP B;  1U5K A;  3W5O A;  1NJI C;  4A3L G;  4O0A A;  2ZM6 Q;  5C0X G;  3GTK H;  4JG2 A;  2N49 A;  4YWM A;  5JEA J;  4LFB L;  2VY3 A;  1EQR A;  3NEN A;  4A3K G;  3KJP A;  4DR5 L;  3GTO H;  1KD1 C;  3GO5 A;  1XJV A;  3RNU A;  1NMF A;  4JBW A;  1ASY A;  5IYD H;  3KYH C;  2A8V A;  4B3T Q;  4APV A;  1TWH H;  2K75 A;  1YHB A;  4JI3 Q;  2UXC Q;  4UPA A;  3S24 A;  4DV5 Q;  4DV1 Q;  4OWW B;  1XNQ L;  4BBR G;  1VQN A;  2B29 A;  1Q81 C;  4X6A H;  3F2B A;  1IXR A;  3LGJ A;  1VS0 A;  4XTC S;  2Y0S E;  4OX9 Q;  3H3V H;  4P75 A;  5IYB H;  4DR1 L;  3J80 c;  3PCO B;  5AJ3 L;  3BZC A;  4JBJ A;  1IBL Q;  3CXC A;  1VQF A;  1VCI A;  3DLL A;  2NVX H;  3J81 c;  1TWG H;  3CCS A;  2OQK A;  5IYC H;  4QY7 A;  3HKZ E;  2R93 H;  3I56 A;  4HJ5 A;  4IJL A;  4IJH A;  4YCW A;  4X64 L;  4L5R C;  4GOP A;  3EIV A;  1X56 A;  1Q82 C;  3PUX A;  2EIF A;  1IYJ B;  3M7N A;  1I94 L;  1PH3 A;  1PH2 A;  5DLQ E;  3KFU A;  1N36 Q;  2F52 A;  1A0I A;  3TS2 A;  5GQO A;  5FLX c;  5LMN Q;  4B3S Q;  4JV5 L;  3WWV A;  4DV6 Q;  3M3Y H;  4HJ8 A;  1TWA H;  3HOV G;  4DV3 Q;  1QUQ B;  2WP8 J;  3UDF A;  5IWA Q;  1KIX A;  1PVO A;  2F4V L;  3TRE A;  4HIK A;  1JB7 A;  1VQ5 A;  4YWL A;  2K14 A;  5FLM G;  4LF7 Q;  1VQ4 A;  3ULJ A;  1CKN A;  2WFW A;  3NEM A;  3PSI A;  4DAM A;  3CCV A;  2CCZ A;  1NMG A;  4GLV B;  4GKK L;  3HOW G;  1Q1E A;  2KBN A;  1Z47 A;  4LF6 Q;  2R6G A;  2QEX A;  4IPD A;  1HNZ Q;  1K8G A;  4GKJ L;  2JA8 G;  3OTO L;  4XIG S;  3HOZ H;  4IFD J;  1BBW A;  3GD7 A;  1X54 A;  4A3I H;  4PZ8 A;  2CWP A;  2R7Z G;  5GAG C;  4IFD I;  2E2I H;  4R4C A;  1T9H A;  1QZH A;  1PYB A;  4DR7 Q;  1BBU A;  3HFZ B;  1SN8 A;  1A62 A;  4OO1 G;  5ELO A;  2HHH L;  3T1Y Q;  3K7A H;  4KHP L;  2B63 H;  4JI0 Q;  3B6Y A;  4LWC A;  3A5Z B;  1HJP A;  4KHZ A;  4X65 L;  2AHO B;  1K73 C;  5EAY A;  1VQL A;  2R92 G;  4K0K L;  4DR2 L;  4PZ6 A;  1GO3 E;  1VQ6 A;  3I4O A;  3CCQ A;  1LYL A;  1KL9 A;  2JA7 G;  4YWK A;  1YHQ A;  4LFA Q;  2ZJP A;  4P71 A;  1YJN A;  1N34 Q;  4JI5 Q;  5K36 G;  4LFB Q;  3FHW A;  5JJK A;  2DUD A;  4NXN L;  2V1C C;  4C2M H;  2C35 B;  3EN2 A;  5GAE C;  2VUM G;  1N32 Q;  3U50 C;  1BVS A;  4GN5 A;  2NZH A;  4A3F H;  1YNX A;  3GTM H;  1X3G A;  1SRO A;  5GAH C;  4OO1 I;  4J15 A;  4QL5 A;  2YTX A;  3BJU A;  3PIP A;  2Q2T A;  4B3T L;  1P16 A;  2BA0 A;  4JI2 Q;  1OXU A;  1CKO A;  4X62 Q;  1VQ9 A;  3U4Z A;  4DKA C;  1FJG L;  4LFC L;  5BR8 Q;  1XMQ Q;  4DUY L;  3NEL A;  4DAY B;  1MIU A;  4A93 G;  4Y52 H;  4BXX H;  4DR3 L;  1S3O A;  5M5Y H;  2WB1 G;  4LF9 L;  2LXK A;  1VQC A;  3JAM c;  3PF4 A;  4P73 A;  1HZ9 A;  2Q2I A;  1WI5 A;  1IZ6 A;  5IP7 G;  3PO3 H;  2CQO A;  2Q2U A;  3CCJ A;  1NBW A;  2YV5 A;  3HKS A;  2K5H A;  4UP8 A;  4AH6 A;  2UXB L;  2EQS A;  2R93 G;  4OWX B;  1LUZ A;  2ZJR A;  3AFQ A;  4GLA C;  1YIJ A;  1YJ9 A;  4LF8 Q;  1PH4 A;  5H1S E;  4L5S A;  2Y0S G;  2I5M X;  3J81 i;  3BZK A;  1C9O A;  4DV7 L;  1AH9 A;  1SLJ A;  2UU9 Q;  1QUQ A;  4A4I A;  1J5E Q;  4BBS H;  1PH1 A;  1XNR L;  3HOX G;  3K80 C;  2DGY A;  4C3H H;  2HQL A;  1N36 L;  1Q46 A;  4DR6 Q;  4HJ7 A;  1HNW L;  4A3M H;  1NY4 A;  3CF5 A;  2R92 H;  4JV5 Q;  3GDE A;  5LMU Q;  1VQO A;  1Q12 A;  2Z0S A;  3ER0 A;  4LUO A;  3HKZ G;  4Y7N H;  3PIO A;  4IPH A;  3CCR A;  1PA6 A;  3HOY G;  2CKZ B;  2OQ0 A;  3G6E A;  2B3G A;  1N33 Q;  5M3F H;  3U4V A;  1VQI A;  1VQP A;  2JA5 H;  1X55 A;  3PUY A;  4BY7 G;  5IYB G;  1K3R A;  2YTY A;  1L0W A;  3CPF A;  3J81 j;  1YZ6 A;  1JJC B;  4WJ3 M;  4P72 A;  4DV0 L;  3GTQ H;  1N9W A;  3G48 A;  1HNZ L;  4P74 A;  3K8A A;  2XGT A;  1QZG A;  3OTO Q;  1AE3 A;  2CWA A;  2VQE Q;  3CPW A;  1HH2 P;  1IL2 A;  5C44 G;  1XMO Q;  2LXJ A;  1K0R A;  3UDX A;  4A93 H;  1GKH A;  1VQG A;  4PMW A;  4DPG A;  3CC7 A;  2YU9 H;  2UXD L;  1WJJ A;  4JI1 Q;  4IO9 A;  3AQQ A;  4HJA A;  2UUA L;  2VUM H;  4TQU S;  4A3J H;  4B3M Q;  3L0O A;  2YTV A;  3PF5 A;  1QVF A;  2VZA A;  1A8V A;  1YVC A;  3ULP A;  4A3G G;  1G29 1;  5C3E G;  3RN2 A;  4JYA L;  3M9B A;  3L2P A;  4AQY Q;  1Y1W H;  3A74 A;  1ASZ A;  2OTL A;  1B70 B;  2HIV A;  4NXM Q;  2JA7 H;  2K4K A;  2GVB A;  4GLX A;  1PYS B;  4AYB E;  2H5X A;  3RLO A;  3S16 H;  1SFO H;  1VQA A;  2ID0 A;  1PH5 A;  1QVG A;  2I0Q A;  4JI6 Q;  4LUV A;  1D7Q A;  3M4P A;  4NXN Q;  1AE2 A;  1R9T H;  3A5U A;  1XNQ Q;  5C4X G;  2KEN A;  2F3I A;  3PO2 G;  1EQQ A;  3RZO H;  4BA2 I;  2VW9 A;  2NVQ H;  5M3F G;  1D8L A;  2KCM A;  4OX9 L;  4DR1 Q;  4LF5 L;  3OYY A;  2VQF Q;  4A3C H;  5AJ3 Q;  4QJF A;  4X62 L;  4DR4 Q;  1UE5 A;  4DK6 C;  1FJG Q;  1L2F A;  1JE5 A;  3PUV A;  2AMC B;  1A63 A;  2D0O A;  2IX0 A;  4X66 L;  2XTI A;  5M5W H;  5M5X H;  4RMF A;  3K81 C;  3I4M G;  4JCV E;  5IP7 H;  1OXX K;  4LUZ A;  4LW1 A;  4R4I A;  4YCV A;  4GNX B;  1LTL A;  1MJE A;  3CCL A;  3MXN B;  4A76 A;  4A3I G;  1PV4 A;  3CP0 A;  1KC8 C;  4LF4 Q;  3HOV H;  2K52 A;  1BKB A;  2UXB Q;  1C0A A;  2ZTC A;  3FKI H;  1PH9 A;  1L1O A;  2UUB L;  4BXX G;  4DUZ Q;  1YI2 A;  4LF8 L;  1K9M C;  5FLM H;  4JI4 Q;  1VQ8 A;  2BA1 A;  3AEV A;  1Y1V H;  4L5Q A;  1EYG A;  3AFP A;  5IP9 G;  4GNX C;  4R4Q A;  5IWA L;  4A3G H;  4A3B H;  1J5E L;  1YEZ A;  4A3F G;  3F2C A;  1XNR Q;  1H95 A;  1CSQ A;  3PGZ A;  1JMC A;  2KHI A;  3HOU G;  4DR6 L;  3T1H Q;  1EOV A;  1IBK L;  1YHA A;  3MEF A;  4BY1 H;  5LMU L;  3FP9 A;  3HOZ G;  2JEA I;  4JI8 Q;  1OXT A;  3F2D A;  1V1Q A;  4A75 A;  1XTD A;  1YJW A;  1I3Q H;  4IOA A;  3UE1 A;  1N33 L;  4HJ9 A;  3CW2 C;  3HOX H;  3CCU A;  3KDF B;  4A3E H;  1HR0 L;  1Q86 C;  3H3V I;  2AWN A;  5FJ8 G;  3CQZ H;  4IPG A;  4MNO A;  3ULL A;  2NVT H;  3GTP H;  3RN5 A;  2UUC Q;  5JJL A;  3TEH B;  1M1K C;  3A0J A;  3CC2 A;  1Q8K A;  2RF4 A;  2MO1 A;  1Y1W G;  1VQM A;  3STB C;  3W1B A;  2MNA A;  2KCT A;  3J7Z C;  4C3I H;  4O2D A;  4A3C G;  2VQE L;  1Z9F A;  1M90 C;  1IBM Q;  3GTG H;  4PZ7 A;  3BU2 A;  1YBY A;  4DK3 C;  1V9P A;  4JI0 L;  3G71 A;  2JA6 H;  2D62 A;  1FVI A;  2UXD Q;  4BA1 I;  3CME A;  4JI1 L;  3EBE A;  3PUW A;  1CSP A;  4K0K Q;  1GVP A;  2VL6 A;  1VQJ A;  3AYH B;  1VQE A;  4R4T A;  1HNX Q;  1FGU A;  2K5N A;  1E7Z A;  2JEB I;  5C3E H;  3PO3 G;  4LFA L;  3H0G H;  1CUK A;  1N34 L;  3PV0 A;  3RR5 A;  4DV4 Q;  4AQY L;  1EWI A;  2IX1 A;  1EIY B;  4NXM L;  4JI3 L;  3TRZ A;  5IP9 H;  4YHH Q;  2I5L X;  1VQH A;  4DV1 L;  4IOC A;  4UP9 A;  1NE3 A;  4TVA B;  2R7D A;  3UDI A;  2L15 A;  2JJQ A;  2RHS B;  1W3S A;  2A19 A;  3S17 H;  2JE6 I;  1N8R C;  5BR8 L;  5E7N A;  4R1J A;  2HT1 A;  1VQ7 A;  4NPS A;  2AWO A;  1EIF A;  3S14 H;  4DR3 Q;  1QVC A;  5C44 H;  5C4J H;  1IBL L;  2LSS A;  1B7Y B;  1I5F A;  4LF9 Q;  1PH8 A;  2R7F A;  5IT9 c;  4JC0 A;  4QQB X;  4YY3 Q;  4LF5 Q;  3E9H A;  1XPU A;  2VQF L;  1GM5 A;  1UE7 A;  2N3S A;  1PH7 A;  4DR4 L;  4AYB G;  1JJ2 A;  4UP7 A;  4EX5 A;  1KHI A;  1Q7Y C;  3G4S A;  1OXV A;  4X64 Q;  1VQD A;  5IY0 A;  5IYD G;  3HOU H;  3I7F A;  4FDB A;  3RLN A;  1L1O B;  2VS1 A;  2NZO A;  4HIO A;  2A1A A;  4B3R L;  1O7I A;  2CFM A;  2MO0 A;  4R4O A;  5LMN L;  4DV7 Q;  4B3S L;  2UU9 L;  2OWO A;  1LM0 A;  4JI7 L;  3I4N G;  2FXQ A;  4LF4 L;  2E5L L;  4LNQ A;  2D0P A;  4DV3 L;  1HNW Q;  3S1M H;  4DUZ L;  2F4V Q;  4A3K H;  4JI4 L;  1GD7 A;  1K8A C;  4L5T A;  2IY5 B;  4GN4 B;  4EQ5 A;  3CCE A;  3CAM A;  4A3J G;  4LF7 L;  2JK8 A;  3STB D;  3I4M H;  3JAM i;  5JJI A;  1SE8 A;  2WAQ G;  4RG1 A;  5C4X H;  1WCM H;  3I55 A;  3DM3 A;  4GNX A;  4A3L H;  2N78 A;  1OXS C;  2ZTE A;  4IPC A;  1VQB A;  4KLK A;  1Q1B A;  1KRS A;  3M85 A;  4DV2 Q;  3FKI G;  4OON A;  1HZA A;  2E2H H;  1RL2 A;  1NTG A;  2NN6 I;  5M3M G;  4GKJ Q;  1X9N A;  3D31 A;  1P8L A;  1SR3 A;  4POF A;  3CMA A;  1E22 A;  2AKW B;  3J7A 5;  5C0X I;  1Y1V G;  1X6O A;  5LMN W;  1JT8 A;  3NBH B;  4ALP A;  3TS0 A;  1PHJ A;  4JBK A;  5FJ8 H;  2PI2 E;  1UWV A;  3K0X A;  5HGQ A;  3RLF A;  1XMO L;  3CD6 A;  1S72 A;  2QA4 A;  2PMZ E;  3CC4 A;  3PO2 H;  4GOP C;  4ME3 A;  3D0F A;  3KF6 B;  4BBR H;  5IYC G;  2ZM6 L;  2JQO A;  5ELN A;  4KHP Q;  4BY1 G;  2K5V A;  1CKN B;  2GVA A;  2WB1 E;  1UE6 A;  4B3M L;  4X65 Q;  4A3D H;  4POG A;  1KXL A;  3KJO A;  3CCM A;  5GAD C;  4DR5 Q;  2ZJQ A;  3KDF A;  4DR2 Q;  2ASB A;  4JYA Q;  3OW2 A;  4GS3 A;  2B63 G;  3S2D H;  4A3B G;  2Z6K A;  3F1Z A;  1DGS A;  1OTC A;  1JJG A;  5JEA G;  1SMX A;  4JI5 L;  1HR0 W;  2OCE A;  3U58 A;  2UXC L;  3F8T A;  3ERS X;  2PNH A;  5C0X J;  1HNX L;  2KHJ A;  2E8G A;  4DV5 L;  3ICE A;  1CKM A;  1N32 L;  4JOI A;  3GTJ H;  1EFW A;  4JI6 L;  2PQA B;  2PQA A;  4DV4 L;  1X3F A;  4MTN A;  1I6H H;  1L1O C;  3S15 H;  3KF8 B;  1TWC H;  1C7Y A;  4JBM A;  4JI2 L;  2K50 A;  4DNI A;  4H02 A;  4YHH L;  3JC6 6;  2ES2 A;  4LFC Q;  2ATW A;  1XMQ L;  4DUY Q;  3VDY A;  2JA6 G;  4NB3 A;  3Q8D A;  1X3E A;  4JOI C;  2OTJ A;  1RIP A;  1V43 A;  3H0G G;  2WAQ E;  4KI0 A;  1PH6 A;  1SRU A;  1I50 H;  1YIT A;  2QGQ A;  2IHF A;  4PG3 A;  1W2B A;  3S1Q H;  4UY8 C;  2ZTD A;  1KQS A;  2MQH A;  2Z6K C;  2HIX A;  2JA9 A;  1EUJ A;  1MKH A;  1UEB A;  3PUZ A;  4HIM A;  3KF6 A;  4X66 Q;  1G51 A;  1MJC A;  3S1N H;  3M4O H;  4YY3 L;  1I94 Q;  3E9I A;  2GN5 A;  3S1R H;  1HZB A;  2IT1 A;  1E24 A;  2EXD A;  4A3E G;  2ALY B;  3TQY A;  3E0E A;  2YYZ A;  4DV6 L;  1J6Q A;  2E2J H;  3UE0 A;  1B8A A;  4GN3 B;  4OWT B;  2UUB Q;  1E1T A;  1E3P A;  2I5H A;  2R7Z H;  3GTL H;  2N8N A;  4B3R Q;  3KLW A;  4HID A;  1FL0 A;  1XPO A;  3ZJY C;  2BH8 A;  1XPR A;  5HY6 A;  1KRT A;  4JI7 Q;  1X65 A;  4MZ9 A;  3H15 A;  4BBS G;  2E5L Q;  4GKK Q;  3M4Q A;  3T1H L;  2RHQ B;  1IBK Q;  1E1O A;  4LF6 L;  4A3M G;  1TXY A;  3K7U C;  1HZC A;  1KAW A;  1WFQ A;  5GRO A;  4OXP A;  2BH2 A;  4JI8 L;  3J80 i;  4WJ4 A;  2PI2 A;  3RZD H;  1WOC A;  3W1G A;  3UDG A;  4C3J H;  2Q2H A;  2MFI A;  5IE8 A;  2JA5 G;  1HR0 Q;  3S2H H;  4DV2 L;  2NN6 G;  4DV0 Q;  4A3D G;  5M3M H;  4BY7 H;  4QIW E;  4IFD G;  3I4N H;  4DR7 L;  3L7Z C; 
#chains in the Genus database with same CATH topology
 2F1M A;  1EZ8 A;  3TZU A;  3NUC A;  1PTO C;  1EEI D;  5CMD A;  3IRB A;  5I4D A;  3CHB D;  1T5E A;  4QGU A;  1QOH A;  2M9V A;  4A3L G;  2B8G A;  4O0A A;  4M1U B;  4F8M A;  4ZRZ A;  3V96 A;  5JEA J;  1B50 A;  4H7B A;  2B2Y C;  4KD4 A;  1SFO B;  3SK6 A;  5I6W A;  4ZUI A;  3K5N A;  3RNU A;  5E1F A;  4RWS C;  3MTS A;  5A2Q E;  1D5Z C;  1C8C A;  1TWH H;  2K75 A;  3ERO A;  4JI3 Q;  4N9T A;  1I4Q A;  3S24 A;  4OWW B;  1XNQ L;  1TWC B;  1IXR A;  1EY5 A;  3TP6 A;  3H3V H;  4OGQ C;  5IYB H;  5AJ3 L;  3BZC A;  4JBJ A;  1VQF A;  1PRT B;  2NBF A;  2OQK A;  5LHY 1;  5IYC H;  3MFY A;  3R93 A;  4IJH A;  4X64 L;  4L5R C;  4R9W A;  4M8A A;  3EIV A;  5IT9 L;  2FMM A;  1IYJ B;  3NXW A;  3J7A V;  1N36 Q;  1ZYR D;  5EKL A;  3TS2 A;  3I90 A;  5M3F B;  4B3S Q;  2A6E D;  3HOV G;  4G7H C;  1KDB A;  3UDF A;  2K05 A;  4PQX A;  3TRE A;  1KLU D;  2JA7 B;  1ENA A;  1S5B D;  3NQT A;  1VQ5 A;  5CV6 A;  4DAM A;  4GKK L;  3HOW G;  4CJ0 B;  1Q1E A;  3UI2 A;  4HN7 A;  1GUW A;  5C5L A;  1HUN A;  3H09 A;  1X54 A;  4A3I H;  3BYY B;  2XVS A;  2E2I H;  1A3U A;  3MFG A;  5JPM C;  1K8O A;  1BBU A;  3W2D A;  1SN8 A;  1JOO A;  4OO1 G;  3D6C A;  5ELO A;  4J1M A;  3T1Y Q;  4JI0 Q;  4LWC A;  3A5Z B;  4DGZ A;  1VF7 A;  2CQA A;  1F77 A;  4K0K L;  5EKK A;  2Z8L A;  3DEP A;  3OWE B;  4XQJ A;  3CRK C;  1ET6 A;  4HCS A;  5EBC A;  3GQB A;  4UHV A;  2IL8 A;  1CT1 D;  1BR9 A;  3EN2 A;  2K01 A;  1BVS A;  2NZH A;  1A2T A;  3CKI B;  3GTG B;  5JJZ A;  1X3G A;  4ZLT F;  1FNU A;  5GAH C;  2Q2T A;  3BJU A;  3PIP A;  1P16 A;  3QOJ A;  1NR2 A;  1OXU A;  5BR8 Q;  1S4Z A;  3NBI A;  3NEL A;  4A3G B;  4DAV A;  4HR7 B;  1MIU A;  4A93 G;  4X3T A;  2LXK A;  3FDT A;  1VQC A;  1MD2 D;  2Q8I B;  1JQY D;  1HZ9 A;  5IP7 G;  2B2V C;  2Q2U A;  4RGO S;  1U4L A;  1RTO A;  3SDZ A;  4EQO A;  3WDN A;  1LUZ A;  3C1F A;  2ZJR A;  3S17 B;  4QUF A;  4LF8 Q;  1AFP A;  2A6H C;  2P5Z X;  4L5S A;  2R92 B;  2SDF A;  2Y0S G;  2I5M X;  2Z4I A;  3BZK A;  4RKB A;  4A4I A;  1XNR L;  2DGY A;  4C3H H;  1IL8 A;  3GTM B;  2PZU A;  4BY7 B;  1HNW L;  3CF5 A;  2OXP A;  3ER0 A;  3LNN A;  2Z6B A;  1TS2 A;  3HOY G;  3G6E A;  2RSN A;  5L37 A;  5M3F H;  4XQN A;  4C3I G;  1VQP A;  1F2M A;  5IGB A;  1X55 A;  4KY7 A;  4G7Z C;  1ET9 A;  4BY7 G;  5CV8 A;  1RHP A;  2L0C A;  1L0W A;  4DF7 A;  1EY8 A;  1JJC B;  4DV0 L;  4XYQ A;  2XGT A;  2VQE Q;  3CPW A;  3T16 A;  3RZO B;  1HH2 P;  1Q90 A;  1STG A;  2LXJ A;  1VQG A;  4PMW A;  1KTK A;  4RGM A;  3AQQ A;  2VUM H;  2UUA L;  4A3J H;  4PMB A;  3J80 L;  2VZA A;  2K5Q A;  3A56 A;  4JYA L;  4LJZ C;  2EOT A;  3OMG A;  3BVG A;  2RSO A;  1Y1W H;  1ASZ A;  3RMH A;  3QR8 A;  4GLX A;  5C3W A;  2H5X A;  1SFO H;  2ID0 A;  2I0Q A;  1AE2 A;  4U68 A;  1DZ1 A;  1R9T H;  3A5U A;  5C4X G;  2KEN A;  3PO2 G;  1LV9 A;  4BA2 I;  3BVZ A;  4ZKC B;  3EA6 A;  2EXZ A;  1D8L A;  4OX9 L;  3VYU A;  1O7Z A;  1FJG Q;  1HA6 A;  1PZJ D;  2IX0 A;  4X66 L;  2XTI A;  5C5M A;  3K57 A;  1HTL D;  2CVR A;  2EY2 A;  4LW1 A;  4R4I A;  4B9W A;  4A76 A;  2DNC A;  4A3I G;  3CP0 A;  3HOV H;  4LF4 Q;  2UXB Q;  4ZCK A;  4BXX G;  2UUB L;  1SYB A;  1YI2 A;  5FLM H;  1A3T A;  5E4X A;  2J7Z A;  3AFP A;  4A3G H;  4DA2 A;  4A3B H;  1AEX A;  2LS0 1;  2KQ3 A;  4A3B B;  2CH4 W;  1HXY D;  1YHA A;  5LMU L;  2G5D A;  4IZ8 A;  2BE5 C;  1N33 L;  4J6H A;  4HJ9 A;  4A3K B;  5M5Y B;  1STY A;  1HFN A;  2DJG C;  2JA8 B;  1EL0 A;  5FJ8 G;  4IPG A;  1TU2 B;  3SXH A;  2L55 A;  2NVT H;  4CGY B;  1PZI D;  3TEH B;  2RF4 A;  2J0T D;  2MO1 A;  1VQM A;  4A3C G;  3J7Z C;  3A7A B;  1RCV D;  2WIN B;  4KN4 C;  4XYO A;  5K5P A;  1Z9F A;  4ME5 A;  1H9M A;  3FKI B;  1YBY A;  1PRT C;  1V9P A;  5FK9 C;  3G71 A;  4WOR A;  1FVI A;  4JI1 L;  2X6L A;  4OIK A;  1GVP A;  3AYH B;  4R4T A;  1K3B C;  5C3E H;  3C46 A;  3PO3 G;  4FYD A;  3E6Z X;  1LO5 D;  2F0V A;  4XXE A;  3PV0 A;  4IUT A;  3RR5 A;  3TSS A;  3A55 A;  1EWI A;  1FGB D;  3DHQ A;  3G6J B;  3OSO A;  4JI3 L;  4BBS B;  4H13 C;  4YHH Q;  3GTL B;  2R7Z B;  2F0I A;  3R3O A;  3MXU A;  2BDN A;  4UP9 A;  3QWN A;  2R7D A;  4RCN A;  2L15 A;  2JJQ A;  2G9D A;  1W3S A;  4K2K A;  2Q8T A;  5KNB A;  5C44 B;  1K8M A;  5EQ0 A;  2IX3 A;  2AWO A;  3P7J A;  4DR3 Q;  1QVC A;  5C44 H;  4MN3 A;  2HCI A;  4IUN A;  4FXG C;  4LF9 Q;  4UAI A;  4YY3 Q;  4LF5 Q;  1XPU A;  2N3S A;  2PPB C;  3MZ5 A;  4EX5 A;  2NVY B;  1TR5 A;  1OXV A;  4X64 Q;  5IY0 A;  5IYD G;  5FO7 B;  3QIA A;  3RLN A;  1L1O B;  2WKC A;  3P20 A;  1A2U A;  3H0G B;  4N9P A;  4B3S L;  3I4N G;  2FXQ A;  1EYC A;  2NN6 H;  1IW7 C;  3S1M H;  4G7O C;  4DUZ L;  1LAC A;  4GN4 B;  5JJI A;  3JAM i;  1SE8 A;  1RTN A;  4HSV A;  3A8J E;  3SHL A;  1OXS C;  3M85 A;  4FP5 D;  3OW7 A;  4OON A;  1TWG B;  2B2U C;  2A68 D;  1P8L A;  4POF A;  4CHT B;  3S1Q B;  2AKW B;  3KBX A;  1GHJ A;  2F4I A;  1SYG A;  3AB9 A;  2RQX A;  3TS0 A;  2PI2 E;  1UWV A;  1XYI A;  1XMO L;  3CD6 A;  1J9O A;  1K28 A;  3PO2 H;  3HG9 A;  4KJO A;  4ME3 A;  3KF6 B;  4C1N I;  1ESR A;  1TWF B;  4BY1 G;  4IUQ A;  3HOW B;  3KJO A;  2F03 A;  4NMZ A;  1ZYR C;  2ASB A;  2O4X A;  4GS3 A;  2B63 G;  3BDC A;  2Z6K A;  3F1Z A;  2F0U A;  2DN8 A;  3F8T A;  4B08 A;  5C0X J;  1CZW A;  4OIJ A;  4DV5 L;  1TWA B;  2RCF A;  5BN5 A;  1TVX A;  5JVG 3;  1EFW A;  4JI6 L;  2NYZ D;  1X3F A;  3S15 H;  1LLR D;  3KF8 B;  4TSS A;  1SSO A;  1C7Y A;  4K8I A;  2N88 A;  4DNI A;  4HMI A;  3JC6 6;  2ES2 A;  2JA6 G;  3VDY A;  4JOI C;  1X3E A;  3KLS A;  1U9R A;  1V43 A;  5CV9 A;  1PH6 A;  1CZG A;  2QGQ A;  1HA5 A;  4UY8 C;  1SYD A;  1ONL A;  2HIX A;  5COY A;  1UEB A;  3PUZ A;  3Q6S A;  1SEB D;  1MSG A;  4FO2 A;  3MA2 B;  3Q0A A;  2VB2 X;  1I94 Q;  3S1R H;  3S16 B;  2RDH A;  3E0E A;  1C48 A;  2YYZ A;  4OO1 H;  2WV6 D;  4DV6 L;  3KF8 A;  4GN3 B;  4F87 A;  2N8N A;  3KLW A;  1FL0 A;  4H44 C;  4NW2 A;  2BH8 A;  1XPR A;  2M00 A;  2E5L Q;  4EQP A;  5DEH A;  3T1H L;  4A3J B;  1IBK Q;  1KNA A;  5ELE A;  4LF6 L;  1WFQ A;  2BH2 A;  1SE2 A;  5IGE A;  3MXP A;  3S1M B;  2Q2H A;  1WD0 A;  1L0X B;  2MFI A;  2JA5 G;  4DV0 Q;  1EU4 A;  5M3M H;  4FF3 A;  1STB A;  3I4N H;  1CA5 A;  1IYV A;  4KTA A;  1WYD A;  3I2Z A;  1Y1W B;  2NVY H;  5AFW A;  4DFA A;  2UUA Q;  1G6Z A;  2IHE A;  1I4G A;  1WCM G;  2E76 C;  2MPM A;  2ZM6 Q;  3ND8 A;  4K8J A;  4JG2 A;  4YWM A;  4LFB L;  1EQR A;  3KJP A;  3TP5 A;  4DR5 L;  3GTO H;  3GO5 A;  1EWH A;  1XJV A;  5EPL A;  1WD1 A;  1NMF A;  5IYD H;  4OEM B;  2A8V A;  3C1E A;  4B3T Q;  1JWM D;  1YHB A;  1WCM B;  2RVL A;  2L11 A;  3VYT A;  3F2U A;  3LGJ A;  1GOZ A;  3GTP B;  4OX9 Q;  4P75 A;  1VF5 C;  4N8X 1;  1YNJ D;  3J80 c;  2CH4 A;  3QOL A;  3CXC A;  3DLL A;  3D4R A;  3CCS A;  4XQQ A;  1DD2 A;  3HKZ E;  3DWP A;  3J80 E;  4HJ5 A;  4IJL A;  4KN7 C;  4BY1 B;  5CYU A;  1Q82 C;  5FKA C;  3PUX A;  2EIF A;  4R8I A;  1PH2 A;  4FNF A;  5DLQ E;  3NSW A;  4RGT A;  1TT2 A;  4HJ8 A;  1AW7 A;  3HZX A;  2WP8 J;  1JB7 A;  4YWL A;  3DMU A;  5JAV A;  2CCZ A;  2KBN A;  1D2B A;  2R6G A;  1HNZ Q;  4GKJ L;  3OTO L;  4XIG S;  3HOZ H;  4IFD J;  1W6J A;  1BBW A;  1OO9 B;  1B4O A;  4WJW A;  2F0G A;  3MAQ A;  5G3L F;  4PZ8 A;  4KKT A;  4RCO A;  4A93 B;  3TDQ A;  1T9H A;  3S9W A;  4DR7 Q;  3TN2 A;  4NKL A;  2EYH A;  3P1H A;  3B6Y A;  2F0F A;  3K5L A;  2R92 G;  4PZ6 A;  1VQ6 A;  5C4X B;  3CCQ A;  4DN4 M;  1KL9 A;  4P71 A;  1WTO A;  3FHW A;  2DUD A;  3E5S A;  1JB3 A;  2V1C C;  2C35 B;  2F0N A;  5GAE C;  1N32 Q;  3U50 C;  3HKZ B;  2SEB D;  1YNX A;  2SNS A;  3NHH A;  1A6X A;  4J15 A;  4QL5 A;  3BVM A;  2BA0 A;  1ILQ A;  2XWB B;  4DKA C;  4LFC L;  1XMQ Q;  4DUY L;  1TQO A;  1BCP F;  5IGD A;  4Y52 H;  5E4W C;  4BXX H;  4DR3 L;  5EGT A;  1S3O A;  4LF9 L;  2QDB A;  1HPC A;  2Q2I A;  4EQN A;  1IZ6 A;  4IUU A;  4X3K A;  2CQO A;  2ZXR A;  2YV5 A;  2K5H A;  4RKL A;  4AH6 A;  1TWH B;  1SND A;  2R93 G;  4OWX B;  4L6T B;  5KEE A;  1GUS A;  1PH4 A;  3J81 i;  1SLJ A;  4PNY A;  1PH1 A;  3HOX G;  4V19 0;  1N36 L;  4DR6 Q;  3I91 A;  4HED A;  4LUO A;  3PIO A;  2K7V A;  3I4L A;  4K5V A;  2OQ0 A;  4QF4 A;  1VQI A;  2JA5 H;  2KHS A;  4NDX A;  2Y0S B;  3A8I E;  2Z1C A;  4WJ3 M;  5CV7 A;  1I4X A;  4P74 A;  3R8B A;  1AE3 A;  2EY5 A;  5C44 G;  3RZD B;  1XMO Q;  1K0R A;  3D4W A;  4DPG A;  3GTO B;  3D6W A;  1SAP A;  3CC7 A;  1WJJ A;  4HJA A;  1BO0 A;  4K5W A;  4TQU S;  3I4M B;  3L0O A;  2HDM A;  5E3F A;  3R2I A;  3L2P A;  3SVM A;  3BDL A;  4LMQ D;  4AQY Q;  4UDU C;  3A74 A;  1EY7 A;  2KEC A;  5EJW A;  1UAP A;  4NXM Q;  2K4K A;  2D2C C;  4ZKB B;  3S16 H;  1VQA A;  4JI6 Q;  1D7Q A;  1QVG A;  3GV3 A;  1GUG A;  1SMY C;  1PRT D;  1JCK B;  3PIO 3;  2NVQ H;  2A6H D;  1WTV A;  4DR1 Q;  1PLF A;  2VQF Q;  5FO9 B;  4QJF A;  4DR4 Q;  1UE5 A;  2B2W A;  5IGF A;  1A63 A;  2D0O A;  2NTT A;  3X3M A;  4K2L A;  5M5W H;  1PTO H;  2DNE A;  4ZYS A;  1EYA A;  4JCV E;  5IP7 H;  1OXX K;  4C3J B;  3Q24 A;  1LTL A;  3PO2 B;  4KKS A;  4DK0 A;  3MXN B;  3ITP A;  1KC8 C;  1C0A A;  1QE6 A;  2LY7 A;  4LF8 L;  4JI4 Q;  2BA1 A;  1STH A;  1Y1V H;  4L5Q A;  4R4Q A;  1YEZ A;  1XNR Q;  1H95 A;  1CSQ A;  3PGZ A;  2KHI A;  1CA6 A;  4G57 A;  3AMU A;  3T1H Q;  1IBK L;  3KBG A;  5J1Z A;  5C6A A;  1BOS A;  2DJF C;  4A75 A;  1I3Q H;  3UE1 A;  3CW2 C;  3CCU A;  5J22 A;  2H1E A;  1B9M A;  4A3E H;  3H3V I;  3ULL A;  1V1O A;  1PYW D;  1SE3 A;  3W1B A;  4C3I H;  3DXJ C;  2TSS A;  4FXD A;  2VQE L;  1DOM A;  1M90 C;  4PZ7 A;  3T4A C;  3S2H B;  1K0S A;  3J81 E;  2D62 A;  4BA1 I;  3CME A;  1YNJ C;  5FLX L;  4N8F A;  2JA5 B;  1CSP A;  1I6H B;  2VL6 A;  1NUC A;  1VQJ A;  1HNX Q;  2WB1 B;  4Y7N B;  4LFA L;  1TS4 A;  3H0G H;  1N34 L;  4DV4 Q;  3VA5 A;  3GP7 A;  1EIY B;  3K7A B;  5ELC A;  4IUP A;  4CJ1 B;  3FEW X;  2F3W A;  4TVA B;  3MXG A;  3UDI A;  2RHS B;  2F0M A;  2JE6 I;  4CDE C;  2WAC A;  4R1J A;  2E2D C;  3M3Y B;  2LSS A;  1B7Y B;  1EQT A;  1O80 A;  3I73 A;  4JC0 A;  3NBH A;  2NTS A;  3E9H A;  4C2M B;  3E0J A;  5NUC A;  1PH7 A;  5KYI A;  1JJ2 A;  2FJ2 A;  1KHI A;  1HCZ A;  1QCB D;  2VS1 A;  1X32 A;  3HRZ C;  1BBX C;  4B3R L;  3OOC A;  4R4O A;  2Z4H A;  4JI7 L;  1LM0 A;  1Q8I A;  4LF4 L;  2IWH A;  2XIW A;  1LTR D;  3T51 B;  1XX8 A;  4A3K H;  1K8A C;  2JK8 A;  3U9O A;  1D5M C;  2WAQ G;  5C4X H;  3I55 A;  2A69 D;  4Z9C B;  2BOS A;  2ZTE A;  4GNX A;  4A3L H;  1VQB A;  2R93 B;  4DV2 Q;  1CQV A;  1RL2 A;  5T1G A;  5M3M G;  4GKJ Q;  1X9N A;  1LTT D;  5ISR A;  1X6O A;  5I2X A;  2QDL A;  1MBY A;  3NBH B;  4ALP A;  2O2L D;  1PHJ A;  3K0X A;  5HGQ A;  4A3M B;  3CC4 A;  3PIP 3;  1F9P A;  1NNX A;  1FYC A;  3LWU A;  4C3J G;  2B2V A;  1UE6 A;  1UEA B;  3DEO A;  5EPJ A;  4IFD H;  1W6K A;  2I46 A;  1QWY A;  1CHP D;  1DGS A;  4A3F B;  3N52 A;  3K0Y A;  5JEA G;  2PQE A;  2UXC L;  2PNH A;  3HOV B;  3K6O A;  2E8G A;  3ICE A;  1N32 L;  4IN3 A;  4JOI A;  5C4Z A;  2FMC A;  2PQA B;  2PQA A;  2PW7 A;  1L1O C;  4FF4 A;  4OEL B;  1WTP A;  2B8F A;  2E75 C;  1SMY D;  4JBM A;  4BS9 A;  2K33 A;  4YHH L;  3T53 B;  4ODG A;  4LFC Q;  1XMQ L;  4DUY Q;  1II3 A;  1SBB B;  4PG3 A;  1W2B A;  2ZTD A;  1IW7 D;  4ZQ3 A;  1KQS A;  2Z6K C;  2QEJ C;  4HIM A;  4KK7 A;  1G51 A;  3S1N H;  3M4O H;  5F2D A;  2K03 A;  2L9H A;  4AYB B;  4YY3 L;  4MIU A;  1HZB A;  2IT1 A;  5D3I B;  3DWQ A;  2EXD A;  4A3E G;  2E2J H;  1CI3 M;  2EYJ A;  2B63 B;  3DM1 A;  4QB4 A;  2AUJ D;  2R7Z H;  3GTL H;  1I50 B;  3A7L A;  3NWS A;  3GTQ B;  1XPO A;  1ZEQ X;  2A73 B;  1GXD C;  1KRT A;  3M4Q A;  2I07 B;  3S1R B;  1QB5 D;  2X69 A;  1HZC A;  3H6M A;  5GRO A;  1BQQ T;  2PI2 A;  2IPK D;  1ROD A;  3H94 A;  4TKO B;  1HR0 Q;  3S2H H;  4CJ2 C;  3DWA A;  4BY7 H;  4QIW E;  3NE5 B;  1L0Y B;  3SGI A;  2HHH Q;  1TY2 A;  4RAU C;  2Q8R E;  1G6P A;  2JN4 A;  1IBM L;  2JA8 H;  1U4P A;  5D65 A;  5J3B A;  3HOY H;  1PFS A;  4GOP B;  3W5O A;  4RHS A;  4RA8 A;  3L9A X;  4O1N A;  5G3L D;  5CC4 A;  3GTK H;  1C4Q A;  2AUK A;  4KV6 A;  5C3E B;  3NEN A;  3K5O A;  2E74 C;  3VYS A;  2ICE C;  3VA7 A;  3KYH C;  1I6V C;  1XTC D;  2NVT B;  3MEH A;  4QMG A;  3VYR A;  4DV5 Q;  3CU7 A;  1CTM A;  2QW7 A;  4BBR G;  1D1I A;  1V1P B;  1Q81 C;  1HRJ A;  1BCP C;  1KDA A;  2RA4 A;  1HHV A;  1FD7 D;  3R2T A;  1VS0 A;  4XTC S;  3EJI A;  5K36 H;  4RHR A;  4DR1 L;  1M4V A;  3NTH A;  3M4O B;  2L5T A;  1X3P A;  4DAY A;  1VCI A;  3LX0 A;  5JOB A;  1TS3 A;  1TWG H;  4QY7 A;  5LL6 X;  2R93 H;  2R61 A;  4YCW A;  4CKE A;  4K14 A;  4GOP A;  4ZUJ A;  1PFB A;  5KNC A;  1I94 L;  1PH3 A;  1ZKO A;  3BG3 A;  3KFU A;  2F52 A;  1A0I A;  5GQO A;  5FLX c;  5LMN Q;  4JV5 L;  5BN3 A;  3U9S A;  3WWV A;  4DV6 Q;  1TWA H;  1QUQ B;  2F0S A;  1D1K A;  1PVO A;  1ICW A;  4HIK A;  4HCE A;  2K14 A;  2A5H A;  2MGS A;  5FLM G;  1VQ4 A;  1CKN A;  2WFW A;  3NEM A;  3PSI A;  5C4H A;  3JAM E;  4GLV B;  3D4D A;  4LF6 Q;  1F2Y A;  2QEX A;  4IPD A;  5CV5 A;  4H0L C;  1LT5 D;  1MGS A;  1PFM A;  2R7Z G;  4NP5 A;  1EZ6 A;  5GAG C;  3HOY B;  1EY0 A;  4R4C A;  4QUC A;  5FO8 B;  4WFN 3;  1QZH A;  1PYB A;  2LKV A;  4ZK9 B;  5KRU A;  4XT3 B;  5EKI A;  3K7A H;  4C3H G;  4KHZ A;  4X65 L;  1EFI D;  1WTX A;  1FNW A;  2A6E C;  5JEA H;  1K73 C;  4DR2 L;  1GO3 E;  1LYL A;  3KLR A;  1Z7T A;  4LFA Q;  2ZJP A;  1YJN A;  1N34 Q;  4LFB Q;  2E2I B;  3SE0 A;  4NXN L;  5IOC A;  4C2M H;  3FPP A;  3KLS X;  1Z6H A;  4A3F H;  4C3H B;  3GTM H;  3AU7 A;  3ERQ A;  4OO1 I;  4B3T L;  1NCV A;  2EZV A;  4JK1 C;  4JI2 Q;  1EYD A;  4KMU C;  2F0O A;  4X62 Q;  1VQ9 A;  3U4Z A;  4DAP A;  4DAY B;  3VR5 A;  3OWF A;  1SYF A;  2DY7 A;  2MJ8 A;  2WB1 G;  4P73 A;  3PO3 H;  5KIX A;  3LWE A;  1NBW A;  1F9Q A;  3HKS A;  3L3O C;  3S2D B;  4PV1 C;  2MHV A;  1YIJ A;  2G9H D;  2ZXO A;  1BF4 A;  1AH9 A;  1QUQ A;  1WTR A;  1J5E Q;  1Q46 A;  4A3M H;  1KLG D;  3GDE A;  1VQO A;  1DON A;  3HKZ G;  4Y7N H;  2SNM A;  2FIN B;  1PA6 A;  1ENC A;  2AQ2 B;  1EIG A;  3U4V A;  2F0D A;  1KDC A;  3PUY A;  1UUP A;  1K3R A;  3BYT B;  2YTY A;  1BXT A;  1EY4 A;  1F2Z A;  2HQE A;  3J81 j;  1YZ6 A;  2X6G A;  4KKU A;  1N9W A;  2R3Z A;  5I2Y A;  1HNZ L;  3K8A A;  1F9S A;  2LFN A;  3OTO Q;  2RBM A;  4LK1 C;  1IL2 A;  4J8Q A;  1STA A;  3M7G A;  4A93 H;  3UDX A;  5CBA E;  1GKH A;  3NTI A;  4K6D A;  2YU9 H;  2UXD L;  4IO9 A;  1JIC A;  1BNZ A;  2JP1 A;  3W3A A;  1QVF A;  1YVC A;  4A3G G;  1E2Z A;  3RN2 A;  2ICI A;  1JR0 D;  4X3U A;  2OTL A;  4FF1 A;  1K83 B;  1SYC A;  5CGK A;  2JA7 H;  1TS5 A;  1LTI D;  1PYS B;  3RLO A;  2HCC A;  1PH5 A;  2VUM B;  2D9U A;  4LUV A;  3M4P A;  3VR6 A;  1LTB D;  2KEE A;  2F3I A;  3GTJ B;  4KY6 A;  1EQQ A;  3RZO H;  1B44 D;  2WAQ B;  3HP3 A;  2NZ1 D;  5M3F G;  3OYY A;  3RD4 A;  2WII B;  4A3C H;  5M5W B;  4DK6 C;  1JE5 A;  3PUV A;  2AMC B;  3OHX C;  3IKJ A;  3TP7 A;  2OF1 A;  3SR1 A;  3A54 A;  1EY6 A;  1STE A;  4RMF A;  3K81 C;  1JOR A;  3I4M G;  4GNX B;  3CCL A;  1Y8O B;  5ELF A;  1JOK A;  4I7Z C;  1BKB A;  2ZTC A;  1PH9 A;  1EU3 A;  1L1O A;  1DM0 B;  5ELD A;  2NB0 A;  1K9M C;  2KUM A;  2JYO A;  3AEV A;  1EYG A;  1I4P A;  5IP9 G;  3C2P A;  5IWA L;  1JMC A;  1CHQ D;  3HOU G;  1ICF B;  1R4Q B;  4DR6 L;  2L4N A;  1H9S B;  3MEF A;  4BY1 H;  3FP9 A;  1ZXT A;  4A3E B;  2JEA I;  1RKN A;  3F2D A;  2E2J B;  1YJW A;  1XTD A;  4X3S A;  1MSH A;  1D6E C;  1GUO A;  3HOX H;  3BS1 A;  4XDX A;  1HR0 L;  3H3V C;  3IFT A;  2AWN A;  4MNO A;  3GTP H;  3RN5 A;  2ZT9 C;  3CC2 A;  3A0J A;  3OIQ A;  2KCT A;  2MNA A;  2EJF C;  4O2D A;  2EDG A;  4RFB A;  4HAE A;  1IBM Q;  4DNT B;  3MXN A;  3BU2 A;  4IUV A;  2JA6 H;  5T1I A;  1IKL A;  3EBE A;  2B2T A;  1VQE A;  2F0E A;  1E7Z A;  2JEB I;  1Q3L A;  2PMZ B;  4AQY L;  2IX1 A;  1BDO A;  5IOD A;  4NXM L;  1S5C D;  3TRZ A;  2BE5 D;  5IP9 H;  2I5L X;  4IOC A;  3BDO A;  2MP1 A;  4IUR A;  5I6Y A;  2A19 A;  2EYL A;  1Y1V B;  1SDF A;  2ZXP A;  2PNR C;  5E7N A;  5C4J B;  2HT1 A;  1VQ7 A;  2A68 C;  3I3C A;  2EY1 A;  5M3M B;  5C4J H;  4C56 C;  1I5F A;  2K5W A;  2R7F A;  4FVM A;  4QQB X;  2OT2 A;  2VQF L;  1GM5 A;  4DR4 L;  4AYB G;  4JPB W;  3V05 A;  3TBI B;  4UP7 A;  1XXG A;  1PTO D;  1Q7Y C;  1YNN C;  3G4S A;  1PTO B;  5IIF A;  3NP8 A;  2NZO A;  5KND A;  4HIO A;  1V1P A;  4DV7 Q;  1SNP A;  5LMN L;  2UU9 L;  1H9J A;  2FFK B;  4LNQ A;  2D0P A;  4JVZ A;  2F0W A;  1G91 A;  1Y8N B;  4KHV A;  4HSP A;  4JI4 L;  4HTH A;  4L5T A;  2IY5 B;  3CCE A;  4A3J G;  3G7L A;  3STB D;  3HEJ A;  4RG1 A;  1B3A A;  2CW0 D;  2JSO A;  5IGG A;  1R4P B;  1WCM H;  3DM3 A;  4G4K A;  4KLK A;  2N78 A;  1Q1B A;  1KRS A;  3FKI G;  2E2H H;  2F0K A;  1NTG A;  2NN6 I;  3VR3 A;  1SR3 A;  1E22 A;  5C0X I;  1Y1V G;  1HQR D;  2K1B A;  5LMN W;  3SK5 A;  1AP0 A;  3HGB A;  4CDD C;  2EE1 A;  1HQM C;  1JWU D;  2PMZ E;  4GOP C;  2V4D A;  2F3V A;  3D0F A;  5IYC G;  2JQO A;  3WOE A;  2GVA A;  4B3M L;  4X65 Q;  1SNQ A;  4POG A;  3IFD A;  1KXL A;  1S5D D;  5GAD C;  2C5C A;  3KDF A;  4DR2 Q;  3P75 A;  3S2D H;  5HGT A;  1H9R A;  1STN A;  1OTC A;  1JJG A;  4EGV A;  1SNC A;  1SMX A;  2EY6 A;  3PO3 B;  2OCE A;  1KAB A;  3ERS X;  1HNX L;  1SE4 A;  3GTJ H;  3I8Z A;  2A74 C;  4GZY C;  1CFM A;  3CQZ B;  4DV4 L;  4ZAI A;  1IHZ A;  4BBR B;  1RDP D;  1TWC H;  4JI2 L;  1PDQ A;  2K50 A;  1Y69 U;  2PZT A;  2ATW A;  3I4N B;  4NB3 A;  3Q8D A;  3D8G A;  3KK7 A;  1RIP A;  2K32 A;  3H0G G;  2WAQ E;  4KI0 A;  4CDF C;  1SRU A;  1I50 H;  1YIT A;  3S1Q H;  5A35 A;  3V2T A;  5HUR A;  2MQH A;  2JA9 A;  1H9S A;  1EUJ A;  1MKH A;  1O78 A;  1DXM A;  5LL6 S;  5ELB A;  1B1Z A;  2F0L A;  5I9O A;  1G8Z D;  3HOZ B;  2ALY B;  2F0P A;  1J6Q A;  1PMR A;  1FNV A;  4OWT B;  3ND9 A;  1EY9 A;  2B2W C;  1E3P A;  2OEO A;  2I5H A;  4B3R Q;  2XN9 C;  4HID A;  3WOF A;  1PRT F;  2L1B A;  5HY6 A;  4JI7 Q;  4V0B A;  4MZ9 A;  1GUT A;  2EJM A;  2NWG A;  3H15 A;  4BBS G;  4GKK Q;  4IQZ A;  4K5X A;  1E1O A;  1SNM A;  1TXY A;  2PO4 A;  3K7U C;  4OXP A;  4JI8 L;  3J80 i;  3X3N A;  4WJ4 A;  1VDZ A;  1ILP A;  4C3J H;  3K5M A;  5IE8 A;  1CQF A;  1ML0 D;  4DV2 L;  2WKD A;  4A3D G;  4B9X A;  1F2L A;  5D3D A;  3D3R A;  4IFD G;  1QG7 A;  3NQI A;  1S5F D;  2UUC L;  1UE1 A;  1TII D;  1S40 A;  3T1Y L;  1K83 H;  1Y14 B;  3T56 B;  2KOL A;  3HOW H;  3HOU B;  2VNU D;  4EVO A;  3KOJ A;  1TWF H;  4AIM A;  3URY A;  1QNU A;  1U0L A;  4YCU A;  1EWC A;  2RCN A;  1NJI C;  1U5K A;  4ILW A;  5C0X G;  1BUV T;  2N49 A;  2VY3 A;  1VMP A;  4R8N A;  4A3K G;  4CKB A;  5DNF A;  1KD1 C;  1QJO A;  3QJY A;  3Q23 A;  5JVH 3;  2XRQ D;  2B2Y A;  4JBW A;  1ASY A;  2F0Q A;  2EYF A;  4APV A;  1EIH A;  2UXC Q;  4UPA A;  3MC0 B;  4DV1 Q;  1VQN A;  3J7A F;  1SJE D;  2B29 A;  4X6A H;  3F2B A;  2Y0S E;  2YU9 B;  1AZP A;  1AN8 A;  1IYU A;  3PCO B;  3M4Y A;  5CR3 A;  1IBL Q;  4MTK A;  4CDC C;  2NVX H;  4RGN A;  2EVB A;  2QIL A;  3J81 c;  3NTK A;  2ENB A;  1EEF D;  3I56 A;  1O7L A;  4DU9 A;  3GTK B;  1X56 A;  3M7N A;  4C1N K;  4U67 3;  2KCC A;  3S15 B;  1NR4 A;  1H9K A;  3M3Y H;  3FVQ A;  4FF2 A;  3OPO A;  3A8K E;  4DV3 Q;  5IWA Q;  1KIX A;  2F4V L;  1Y8P B;  4LF7 Q;  4CKC A;  1JWS D;  3ULJ A;  4MHE A;  3TZD A;  3CCV A;  4KD3 A;  1NMG A;  1DYQ A;  5CV4 A;  2FHT A;  1Z47 A;  3JAM L;  4IAL A;  1K8G A;  2JA8 G;  1LTG D;  3GD7 A;  1QIL A;  2Z9H A;  4K6L A;  4E6I A;  1DOK A;  2KJX A;  2CWP A;  3S1N B;  2K5D A;  1KNE A;  4TRD A;  1MI2 A;  4RH6 A;  4IFD I;  1HTP A;  3HFZ B;  1A62 A;  4OHJ A;  2HHH L;  2O5I C;  1B9N A;  4KHP L;  2B63 H;  1HJP A;  3CRL C;  2AHO B;  5EAY A;  3DUZ A;  3I4O A;  5M9O A;  3J7Y W;  1JOQ A;  3I72 A;  2JA7 G;  1U4M A;  4YWK A;  2QCP X;  1YHQ A;  1RF2 D;  2PYK A;  4JI5 Q;  5K36 G;  5JJK A;  1KAA A;  1YNN D;  2VUM G;  4GN5 A;  1EQV A;  1O7Y A;  5FLX E;  4JW0 A;  1SRO A;  2YTX A;  1CK1 A;  1B2T A;  2VXW A;  3BZD B;  1CKO A;  2NVX B;  1FJG L;  1U4R A;  4ULL A;  2HD3 A;  3MWY W;  2D5D A;  5DM7 3;  3GV6 A;  1NAP A;  5M5Y H;  1WTH A;  3JAM c;  1GUN A;  4CBV A;  2PW5 A;  3PF4 A;  4L8J A;  1WI5 A;  3CCJ A;  1HFG A;  4F7X A;  1LTA D;  4UP8 A;  2UXB L;  2LMC B;  2CHB D;  2EQS A;  2KA7 A;  2J4X A;  1X3Q A;  3AFQ A;  4GLA C;  1YJ9 A;  5H1S E;  4DV7 L;  1C9O A;  2UU9 Q;  3NWT A;  4BBS H;  3K80 C;  2HQL A;  2K04 A;  4HJ7 A;  1NY4 A;  3FRP B;  1G2T A;  3QO2 A;  2R92 H;  4JV5 Q;  5LMU Q;  1Q12 A;  2Z0S A;  4KJN A;  4IPH A;  3CCR A;  2CKZ B;  2QKI C;  1PZK D;  2B3G A;  1N33 Q;  3MHB A;  2SOB A;  5TSS A;  5IYB G;  1E0B A;  3CPF A;  2EPB A;  3IL8 A;  2O5J C;  4P72 A;  3GTQ H;  3G48 A;  1QZG A;  2CWA A;  2DY8 A;  5I9P A;  1DCZ A;  2EYP A;  4BWG B;  3OIP A;  1TY0 A;  5JPN C;  5J39 A;  5DAU A;  4JI1 Q;  3T13 A;  2K28 A;  3N6R A;  5EPK A;  5A2Q L;  4B3M Q;  2YTV A;  2CW0 C;  4Q0F A;  3PF5 A;  1A8V A;  3K59 A;  3ULP A;  1G29 1;  1SXT A;  2MUY A;  5C3E G;  3M9B A;  5M5X B;  1GHK A;  1E2W A;  1T5X D;  4Q5V A;  1V8Q A;  1B70 B;  2HIV A;  5BN4 A;  2GVB A;  1IKM A;  4AYB E;  4ABN A;  4DXG A;  4NXN Q;  4LAA A;  4QIW B;  2N55 A;  1XNQ Q;  2VW9 A;  1WTQ A;  2TMP A;  2KCM A;  4LF5 L;  5KGU A;  2PZW A;  3QG1 A;  5AJ3 Q;  4X62 L;  2XRS D;  1L2F A;  2QF7 A;  1GJX A;  5KYL A;  3SEB A;  4WRD A;  5M5X H;  4LUZ A;  4YCV A;  1MJE A;  1PV4 A;  1J8I A;  2K52 A;  1I3Q B;  1SYE A;  3FKI H;  1CM9 A;  4DUZ Q;  2B2U A;  1VQ8 A;  2XWJ B;  1MHW C;  4GNX C;  1SNO A;  1J5E L;  4A3F G;  3F2C A;  1F9R A;  2HDL A;  1EOV A;  4YIJ A;  4P2C B;  3HOZ G;  4JI8 Q;  1OXT A;  1V1Q A;  1QNK A;  1I4R A;  2VB3 X;  4QCL A;  4IOA A;  3KDF B;  5DM6 3;  1PFN A;  1Q86 C;  3CQZ H;  2AQ3 B;  5JJL A;  2UUC Q;  1M1K C;  3K58 A;  3H91 A;  1Q8K A;  1Y1W G;  1VQK A;  3STB C;  1JC7 A;  3GTG H;  2F0J A;  2XSC A;  4DK3 C;  4JI0 L;  1M8A A;  2UXD Q;  1WTW A;  3PUW A;  4K0K Q;  1D5X C;  2BCO A;  2RKS A;  1ENF A;  2KVM A;  3SK4 A;  1R9T B;  1PTO F;  1SJH D;  4I7A A;  1FGU A;  2K5N A;  1CUK A;  3EFX D;  5C3X A;  3MVV A;  3IAY A;  1RD9 D;  2JXM B;  1VQH A;  4DV1 L;  1BCP D;  1NE3 A;  2KED A;  2RDF A;  5IT9 E;  3KUP A;  3S17 H;  1N8R C;  1S5E D;  5BR8 L;  2F0T A;  4FXK C;  5EBD A;  4NPS A;  3S14 H;  1EIF A;  1B53 A;  1IBL L;  3Q22 A;  1PH8 A;  5IT9 c;  3ONA B;  1UE7 A;  2BDO A;  1LTS D;  2RDG A;  1FR3 A;  3NPP A;  5COR A;  3TME A;  2GA4 B;  1XWE A;  1A3V A;  1VQD A;  2EJG C;  3HOU H;  3I7F A;  4FDB A;  4C3I B;  1LT3 D;  2AQ1 B;  2A1A A;  1O7I A;  2CFM A;  2MO0 A;  4XT1 B;  3OMC A;  3TP8 A;  2EYO A;  1TKW B;  2OWO A;  2KCN A;  3E3X A;  2XNA C;  2E5L L;  2NVQ B;  4DV3 L;  1HNW Q;  2F4V Q;  3HOX B;  1GD7 A;  4EQ5 A;  3J81 L;  3CAM A;  4LF7 L;  3I4M H;  1PXU A;  3I70 A;  4O42 A;  3VR4 A;  4IPC A;  1VQL A;  3C3L A;  5D14 A;  1HZA A;  3O13 A;  3D31 A;  5CBE E;  4A3D B;  3CMA A;  3J7A 5;  4PMC A;  2NUC A;  3QB3 A;  5IGC A;  1G2S A;  1JT8 A;  1A15 A;  1JE4 A;  1EOT A;  2IJ0 A;  4JBK A;  5FJ8 H;  4DNR B;  3RLF A;  4S3S A;  1AZQ A;  1S72 A;  2QA4 A;  4A3I B;  4BBR H;  1WVL A;  2ZM6 L;  5ELN A;  5C0X H;  4KHP Q;  2K5V A;  1CKN B;  2WB1 E;  1RJT A;  4A3D H;  4KY5 A;  1NSN S;  1DOL A;  4DK1 A;  3CCM A;  4DR5 Q;  4HMJ A;  2ZJQ A;  4JYA Q;  3OW2 A;  4A3B G;  4OL7 A;  5FOB B;  4JI5 L;  1HR0 W;  1VMC A;  3U58 A;  2H4O A;  2IW3 A;  2L12 A;  2KHJ A;  1CKM A;  2F0H A;  4I65 A;  1DJR D;  4DXF A;  1ESF A;  4MTN A;  1I6H H;  4ID6 A;  3HS0 C;  2B2T C;  2E2H B;  4H02 A;  3RUZ A;  2OTJ A;  1LT6 D;  2IHF A;  3PQI A;  2HUG A;  2K6A A;  3KF6 A;  3ZYY X;  4X66 Q;  1MJC A;  1B3Q A;  3SK8 A;  3VR2 A;  3E9I A;  1BCP B;  2GN5 A;  1HUM A;  1E2V A;  1LAB A;  2M2L A;  1E24 A;  3TQY A;  2C9O A;  2PCF B;  3UE0 A;  3FMC A;  1B8A A;  2UUB Q;  1I4H A;  1E1T A;  3PMF A;  2B39 A;  3ZJY C;  1X65 A;  2EYM A;  4F88 A;  3EVQ A;  2RHQ B;  1UNS A;  4A3M G;  3EQL C;  1LT4 D;  1KAW A;  4L63 B;  3RZD H;  1WOC A;  3W1G A;  2A69 C;  3UDG A;  2JA6 B;  2NN6 G;  3S14 B;  3FPU B;  4DR7 L;  3NK9 A;  3L7Z C; 
#chains in the Genus database with same CATH homology
 2UUC L;  1UE1 A;  3SGI A;  1S40 A;  2HHH Q;  3T1Y L;  1K83 H;  1WYD A;  1Y14 B;  3I2Z A;  3HOW H;  2VNU D;  3KOJ A;  3IRB A;  2NVY H;  1TWF H;  4AIM A;  1G6P A;  1U0L A;  4YCU A;  1IBM L;  2UUA Q;  2JA8 H;  2IHE A;  1VQK A;  5J3B A;  2RCN A;  3HOY H;  4QGU A;  1WCM G;  1PFS A;  4GOP B;  1U5K A;  3W5O A;  1NJI C;  4A3L G;  4O0A A;  2ZM6 Q;  5C0X G;  3GTK H;  4JG2 A;  2N49 A;  4YWM A;  5JEA J;  4LFB L;  2VY3 A;  1EQR A;  3NEN A;  4A3K G;  3KJP A;  4DR5 L;  3GTO H;  1KD1 C;  3GO5 A;  1XJV A;  3RNU A;  1NMF A;  4JBW A;  1ASY A;  5IYD H;  3KYH C;  2A8V A;  4B3T Q;  4APV A;  1TWH H;  2K75 A;  1YHB A;  4JI3 Q;  2UXC Q;  4UPA A;  3S24 A;  4DV5 Q;  4DV1 Q;  4OWW B;  1XNQ L;  4BBR G;  1VQN A;  2B29 A;  1Q81 C;  4X6A H;  3F2B A;  1IXR A;  3LGJ A;  1VS0 A;  4XTC S;  2Y0S E;  4OX9 Q;  3H3V H;  4P75 A;  5IYB H;  4DR1 L;  3J80 c;  3PCO B;  5AJ3 L;  3BZC A;  4JBJ A;  1IBL Q;  3CXC A;  1VQF A;  1VCI A;  3DLL A;  2NVX H;  3J81 c;  1TWG H;  3CCS A;  2OQK A;  5IYC H;  4QY7 A;  3HKZ E;  2R93 H;  3I56 A;  4HJ5 A;  4IJL A;  4IJH A;  4YCW A;  4X64 L;  4L5R C;  4GOP A;  3EIV A;  1X56 A;  1Q82 C;  3PUX A;  2EIF A;  1IYJ B;  3M7N A;  1I94 L;  1PH3 A;  1PH2 A;  5DLQ E;  3KFU A;  1N36 Q;  2F52 A;  1A0I A;  3TS2 A;  5GQO A;  5FLX c;  5LMN Q;  4B3S Q;  4JV5 L;  3WWV A;  4DV6 Q;  3M3Y H;  4HJ8 A;  1TWA H;  3HOV G;  4DV3 Q;  1QUQ B;  2WP8 J;  3UDF A;  5IWA Q;  1KIX A;  1PVO A;  2F4V L;  3TRE A;  4HIK A;  1JB7 A;  1VQ5 A;  4YWL A;  2K14 A;  5FLM G;  4LF7 Q;  1VQ4 A;  3ULJ A;  1CKN A;  2WFW A;  3NEM A;  3PSI A;  4DAM A;  3CCV A;  2CCZ A;  1NMG A;  4GLV B;  4GKK L;  3HOW G;  1Q1E A;  2KBN A;  1Z47 A;  4LF6 Q;  2R6G A;  2QEX A;  4IPD A;  1HNZ Q;  1K8G A;  4GKJ L;  2JA8 G;  3OTO L;  4XIG S;  3HOZ H;  4IFD J;  1BBW A;  3GD7 A;  1X54 A;  4A3I H;  4PZ8 A;  2CWP A;  2R7Z G;  5GAG C;  4IFD I;  2E2I H;  4R4C A;  1T9H A;  1QZH A;  1PYB A;  4DR7 Q;  1BBU A;  3HFZ B;  1SN8 A;  1A62 A;  4OO1 G;  5ELO A;  2HHH L;  3T1Y Q;  3K7A H;  4KHP L;  2B63 H;  4JI0 Q;  3B6Y A;  4LWC A;  3A5Z B;  1HJP A;  4KHZ A;  4X65 L;  2AHO B;  1K73 C;  5EAY A;  1VQL A;  2R92 G;  4K0K L;  4DR2 L;  4PZ6 A;  1GO3 E;  1VQ6 A;  3I4O A;  3CCQ A;  1LYL A;  1KL9 A;  2JA7 G;  4YWK A;  1YHQ A;  4LFA Q;  2ZJP A;  4P71 A;  1YJN A;  1N34 Q;  4JI5 Q;  5K36 G;  4LFB Q;  3FHW A;  5JJK A;  2DUD A;  4NXN L;  2V1C C;  4C2M H;  2C35 B;  3EN2 A;  5GAE C;  2VUM G;  1N32 Q;  3U50 C;  1BVS A;  4GN5 A;  2NZH A;  4A3F H;  1YNX A;  3GTM H;  1X3G A;  1SRO A;  5GAH C;  4OO1 I;  4J15 A;  4QL5 A;  2YTX A;  3BJU A;  3PIP A;  2Q2T A;  4B3T L;  1P16 A;  2BA0 A;  4JI2 Q;  1OXU A;  1CKO A;  4X62 Q;  1VQ9 A;  3U4Z A;  4DKA C;  1FJG L;  4LFC L;  5BR8 Q;  1XMQ Q;  4DUY L;  3NEL A;  4DAY B;  1MIU A;  4A93 G;  4Y52 H;  4BXX H;  4DR3 L;  1S3O A;  5M5Y H;  2WB1 G;  4LF9 L;  2LXK A;  1VQC A;  3JAM c;  3PF4 A;  4P73 A;  1HZ9 A;  2Q2I A;  1WI5 A;  1IZ6 A;  5IP7 G;  3PO3 H;  2CQO A;  2Q2U A;  3CCJ A;  1NBW A;  2YV5 A;  3HKS A;  2K5H A;  4UP8 A;  4AH6 A;  2UXB L;  2EQS A;  2R93 G;  4OWX B;  1LUZ A;  2ZJR A;  3AFQ A;  4GLA C;  1YIJ A;  1YJ9 A;  4LF8 Q;  1PH4 A;  5H1S E;  4L5S A;  2Y0S G;  2I5M X;  3J81 i;  3BZK A;  1C9O A;  4DV7 L;  1AH9 A;  1SLJ A;  2UU9 Q;  1QUQ A;  4A4I A;  1J5E Q;  4BBS H;  1PH1 A;  1XNR L;  3HOX G;  3K80 C;  2DGY A;  4C3H H;  2HQL A;  1N36 L;  1Q46 A;  4DR6 Q;  4HJ7 A;  1HNW L;  4A3M H;  1NY4 A;  3CF5 A;  2R92 H;  4JV5 Q;  3GDE A;  5LMU Q;  1VQO A;  1Q12 A;  2Z0S A;  3ER0 A;  4LUO A;  3HKZ G;  4Y7N H;  3PIO A;  4IPH A;  3CCR A;  1PA6 A;  3HOY G;  2CKZ B;  2OQ0 A;  3G6E A;  2B3G A;  1N33 Q;  5M3F H;  3U4V A;  1VQI A;  1VQP A;  2JA5 H;  1X55 A;  3PUY A;  4BY7 G;  5IYB G;  1K3R A;  2YTY A;  1L0W A;  3CPF A;  3J81 j;  1YZ6 A;  1JJC B;  4WJ3 M;  4P72 A;  4DV0 L;  3GTQ H;  1N9W A;  3G48 A;  1HNZ L;  4P74 A;  3K8A A;  2XGT A;  1QZG A;  3OTO Q;  1AE3 A;  2CWA A;  2VQE Q;  3CPW A;  1HH2 P;  1IL2 A;  5C44 G;  1XMO Q;  2LXJ A;  1K0R A;  3UDX A;  4A93 H;  1GKH A;  1VQG A;  4PMW A;  4DPG A;  3CC7 A;  2YU9 H;  2UXD L;  1WJJ A;  4JI1 Q;  4IO9 A;  3AQQ A;  4HJA A;  2UUA L;  2VUM H;  4TQU S;  4A3J H;  4B3M Q;  3L0O A;  2YTV A;  3PF5 A;  1QVF A;  2VZA A;  1A8V A;  1YVC A;  3ULP A;  4A3G G;  1G29 1;  5C3E G;  3RN2 A;  4JYA L;  3M9B A;  3L2P A;  4AQY Q;  1Y1W H;  3A74 A;  1ASZ A;  2OTL A;  1B70 B;  2HIV A;  4NXM Q;  2JA7 H;  2K4K A;  2GVB A;  4GLX A;  1PYS B;  4AYB E;  2H5X A;  3RLO A;  3S16 H;  1SFO H;  1VQA A;  2ID0 A;  1PH5 A;  1QVG A;  2I0Q A;  4JI6 Q;  4LUV A;  1D7Q A;  3M4P A;  4NXN Q;  1AE2 A;  1R9T H;  3A5U A;  1XNQ Q;  5C4X G;  2KEN A;  2F3I A;  3PO2 G;  1EQQ A;  3RZO H;  4BA2 I;  2VW9 A;  2NVQ H;  5M3F G;  1D8L A;  2KCM A;  4OX9 L;  4DR1 Q;  4LF5 L;  3OYY A;  2VQF Q;  4A3C H;  5AJ3 Q;  4QJF A;  4X62 L;  4DR4 Q;  1UE5 A;  4DK6 C;  1FJG Q;  1L2F A;  1JE5 A;  3PUV A;  2AMC B;  1A63 A;  2D0O A;  2IX0 A;  4X66 L;  2XTI A;  5M5W H;  5M5X H;  4RMF A;  3K81 C;  3I4M G;  4JCV E;  5IP7 H;  1OXX K;  4LUZ A;  4LW1 A;  4R4I A;  4YCV A;  4GNX B;  1LTL A;  1MJE A;  3CCL A;  3MXN B;  4A76 A;  4A3I G;  1PV4 A;  3CP0 A;  1KC8 C;  4LF4 Q;  3HOV H;  2K52 A;  1BKB A;  2UXB Q;  1C0A A;  2ZTC A;  3FKI H;  1PH9 A;  1L1O A;  2UUB L;  4BXX G;  4DUZ Q;  1YI2 A;  4LF8 L;  1K9M C;  5FLM H;  4JI4 Q;  1VQ8 A;  2BA1 A;  3AEV A;  1Y1V H;  4L5Q A;  1EYG A;  3AFP A;  5IP9 G;  4GNX C;  4R4Q A;  5IWA L;  4A3G H;  4A3B H;  1J5E L;  1YEZ A;  4A3F G;  3F2C A;  1XNR Q;  1H95 A;  1CSQ A;  3PGZ A;  1JMC A;  2KHI A;  3HOU G;  4DR6 L;  3T1H Q;  1EOV A;  1IBK L;  1YHA A;  3MEF A;  4BY1 H;  5LMU L;  3FP9 A;  3HOZ G;  2JEA I;  4JI8 Q;  1OXT A;  3F2D A;  1V1Q A;  4A75 A;  1XTD A;  1YJW A;  1I3Q H;  4IOA A;  3UE1 A;  1N33 L;  4HJ9 A;  3CW2 C;  3HOX H;  3CCU A;  3KDF B;  4A3E H;  1HR0 L;  1Q86 C;  3H3V I;  2AWN A;  5FJ8 G;  3CQZ H;  4IPG A;  4MNO A;  3ULL A;  2NVT H;  3GTP H;  3RN5 A;  2UUC Q;  5JJL A;  3TEH B;  1M1K C;  3A0J A;  3CC2 A;  1Q8K A;  2RF4 A;  2MO1 A;  1Y1W G;  1VQM A;  3STB C;  3W1B A;  2MNA A;  2KCT A;  3J7Z C;  4C3I H;  4O2D A;  4A3C G;  2VQE L;  1Z9F A;  1M90 C;  1IBM Q;  3GTG H;  4PZ7 A;  3BU2 A;  1YBY A;  4DK3 C;  1V9P A;  4JI0 L;  3G71 A;  2JA6 H;  2D62 A;  1FVI A;  2UXD Q;  4BA1 I;  3CME A;  4JI1 L;  3EBE A;  3PUW A;  1CSP A;  4K0K Q;  1GVP A;  2VL6 A;  1VQJ A;  3AYH B;  1VQE A;  4R4T A;  1HNX Q;  1FGU A;  2K5N A;  1E7Z A;  2JEB I;  5C3E H;  3PO3 G;  4LFA L;  3H0G H;  1CUK A;  1N34 L;  3PV0 A;  3RR5 A;  4DV4 Q;  4AQY L;  1EWI A;  2IX1 A;  1EIY B;  4NXM L;  4JI3 L;  3TRZ A;  5IP9 H;  4YHH Q;  2I5L X;  1VQH A;  4DV1 L;  4IOC A;  4UP9 A;  1NE3 A;  4TVA B;  2R7D A;  3UDI A;  2L15 A;  2JJQ A;  2RHS B;  1W3S A;  2A19 A;  3S17 H;  2JE6 I;  1N8R C;  5BR8 L;  5E7N A;  4R1J A;  2HT1 A;  1VQ7 A;  4NPS A;  2AWO A;  1EIF A;  3S14 H;  4DR3 Q;  1QVC A;  5C44 H;  5C4J H;  1IBL L;  2LSS A;  1B7Y B;  1I5F A;  4LF9 Q;  1PH8 A;  2R7F A;  5IT9 c;  4JC0 A;  4QQB X;  4YY3 Q;  4LF5 Q;  3E9H A;  1XPU A;  2VQF L;  1GM5 A;  1UE7 A;  2N3S A;  1PH7 A;  4DR4 L;  4AYB G;  1JJ2 A;  4UP7 A;  4EX5 A;  1KHI A;  1Q7Y C;  3G4S A;  1OXV A;  4X64 Q;  1VQD A;  5IY0 A;  5IYD G;  3HOU H;  3I7F A;  4FDB A;  3RLN A;  1L1O B;  2VS1 A;  2NZO A;  4HIO A;  2A1A A;  4B3R L;  1O7I A;  2CFM A;  2MO0 A;  4R4O A;  5LMN L;  4DV7 Q;  4B3S L;  2UU9 L;  2OWO A;  1LM0 A;  4JI7 L;  3I4N G;  2FXQ A;  4LF4 L;  2E5L L;  4LNQ A;  2D0P A;  4DV3 L;  1HNW Q;  3S1M H;  4DUZ L;  2F4V Q;  4A3K H;  4JI4 L;  1GD7 A;  1K8A C;  4L5T A;  2IY5 B;  4GN4 B;  4EQ5 A;  3CCE A;  3CAM A;  4A3J G;  4LF7 L;  2JK8 A;  3STB D;  3I4M H;  3JAM i;  5JJI A;  1SE8 A;  2WAQ G;  4RG1 A;  5C4X H;  1WCM H;  3I55 A;  3DM3 A;  4GNX A;  4A3L H;  2N78 A;  1OXS C;  2ZTE A;  4IPC A;  1VQB A;  4KLK A;  1Q1B A;  1KRS A;  3M85 A;  4DV2 Q;  3FKI G;  4OON A;  1HZA A;  2E2H H;  1RL2 A;  1NTG A;  2NN6 I;  5M3M G;  4GKJ Q;  1X9N A;  3D31 A;  1P8L A;  1SR3 A;  4POF A;  3CMA A;  1E22 A;  2AKW B;  3J7A 5;  5C0X I;  1Y1V G;  1X6O A;  5LMN W;  1JT8 A;  3NBH B;  4ALP A;  3TS0 A;  1PHJ A;  4JBK A;  5FJ8 H;  2PI2 E;  1UWV A;  3K0X A;  5HGQ A;  3RLF A;  1XMO L;  3CD6 A;  1S72 A;  2QA4 A;  2PMZ E;  3CC4 A;  3PO2 H;  4GOP C;  4ME3 A;  3D0F A;  3KF6 B;  4BBR H;  5IYC G;  2ZM6 L;  2JQO A;  5ELN A;  4KHP Q;  4BY1 G;  2K5V A;  1CKN B;  2GVA A;  2WB1 E;  1UE6 A;  4B3M L;  4X65 Q;  4A3D H;  4POG A;  1KXL A;  3KJO A;  3CCM A;  5GAD C;  4DR5 Q;  2ZJQ A;  3KDF A;  4DR2 Q;  2ASB A;  4JYA Q;  3OW2 A;  4GS3 A;  2B63 G;  3S2D H;  4A3B G;  2Z6K A;  3F1Z A;  1DGS A;  1OTC A;  1JJG A;  5JEA G;  1SMX A;  4JI5 L;  1HR0 W;  2OCE A;  3U58 A;  2UXC L;  3F8T A;  3ERS X;  2PNH A;  5C0X J;  1HNX L;  2KHJ A;  2E8G A;  4DV5 L;  3ICE A;  1CKM A;  1N32 L;  4JOI A;  3GTJ H;  1EFW A;  4JI6 L;  2PQA B;  2PQA A;  4DV4 L;  1X3F A;  4MTN A;  1I6H H;  1L1O C;  3S15 H;  3KF8 B;  1TWC H;  1C7Y A;  4JBM A;  4JI2 L;  2K50 A;  4DNI A;  4H02 A;  4YHH L;  3JC6 6;  2ES2 A;  4LFC Q;  2ATW A;  1XMQ L;  4DUY Q;  3VDY A;  2JA6 G;  4NB3 A;  3Q8D A;  1X3E A;  4JOI C;  2OTJ A;  1RIP A;  1V43 A;  3H0G G;  2WAQ E;  4KI0 A;  1PH6 A;  1SRU A;  1I50 H;  1YIT A;  2QGQ A;  2IHF A;  4PG3 A;  1W2B A;  3S1Q H;  4UY8 C;  2ZTD A;  1KQS A;  2MQH A;  2Z6K C;  2HIX A;  2JA9 A;  1EUJ A;  1MKH A;  1UEB A;  3PUZ A;  4HIM A;  3KF6 A;  4X66 Q;  1G51 A;  1MJC A;  3S1N H;  3M4O H;  4YY3 L;  1I94 Q;  3E9I A;  2GN5 A;  3S1R H;  1HZB A;  2IT1 A;  1E24 A;  2EXD A;  4A3E G;  2ALY B;  3TQY A;  3E0E A;  2YYZ A;  4DV6 L;  1J6Q A;  2E2J H;  3UE0 A;  1B8A A;  4GN3 B;  4OWT B;  2UUB Q;  1E1T A;  1E3P A;  2I5H A;  2R7Z H;  3GTL H;  2N8N A;  4B3R Q;  3KLW A;  4HID A;  1FL0 A;  1XPO A;  3ZJY C;  2BH8 A;  1XPR A;  5HY6 A;  1KRT A;  4JI7 Q;  1X65 A;  4MZ9 A;  3H15 A;  4BBS G;  2E5L Q;  4GKK Q;  3M4Q A;  3T1H L;  2RHQ B;  1IBK Q;  1E1O A;  4LF6 L;  4A3M G;  1TXY A;  3K7U C;  1HZC A;  1KAW A;  1WFQ A;  5GRO A;  4OXP A;  2BH2 A;  4JI8 L;  3J80 i;  4WJ4 A;  2PI2 A;  3RZD H;  1WOC A;  3W1G A;  3UDG A;  4C3J H;  2Q2H A;  2MFI A;  5IE8 A;  2JA5 G;  1HR0 Q;  3S2H H;  4DV2 L;  2NN6 G;  4DV0 Q;  4A3D G;  5M3M H;  4BY7 H;  4QIW E;  4IFD G;  3I4N H;  4DR7 L;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...