1XMPA

Crystal structure of pure (ba0288) from bacillus anthracis at 1.8 resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
KSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQMPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PurE (BA0288) from Bacillus anthracis at 1.8 A resolution
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase
molecule keywords phosphoribosylaminoimidazole carboxylase
total genus 53
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1xmpA00
2FW7A 5C5DA 3OPQA 4Z7JA 5CLJA 2FW6A 5CTJA 3RGGA 1U11A 5BORA 4JA0A 4ZMBA 5CLFA 2FWJA 2H31A 4YCDA 4YCBA 5CLIA 2FWBA 2FWIA 4GRDA 4B4KA 5BOSB 1O4VA 3OOWA 4ZJYA 3LP6A 3RG8A 2NSLA 1QCZA 2FWAA 5CLGA 4AY3A 2YWXA 2FW1A 3KUUA 5BOSA 2NSJA 2FWPA 5CLHA 4YCJA 4YCCA 1XMPA 4ZK2A 4ZC8A 5CVTA 2ATEA 3ORSA 2FW9A 3TRHA 4AY4A 1D7AA 2NSHA 2FW8A
chains in the Genus database with same CATH superfamily
3GA7A 2Q0HA 3CLRC 1AKQA 4MYUA 4X92A 4B84A 3UGJA 3C8UA 3BBPA 1O0BA 4IJUA 1UOEA 2ZRPA 4RBNA 4WPGA 4EPVA 3L9XA 1DAIA 4JKOA 4M9ZA 1GILA 1DPFA 1NJ1A 2JDIA 4UEKA 5J63A 3ZHZA 1HL7A 3FCEA 4EFDA 1SCJA 1DELA 3BGOS 4LXIA 3UTDA 3VOAA 4FILA 4F3YA 2FEXA 4DZRA 4AJ2A 1GJRA 5IT9A 5J2TB 4PEVA 2R7MA 4RCYA 4CRWB 5LQNA 4C03A 4IP0A 4KK3A 4X63A 3RUHA 4E15A 4I55B 2WAOA 4PSKA 2ZU0C 1TVCA 4D6PA 5HGJA 3RRJA 4CM8A 1Z5GA 5B1DA 2YNMA 5FWAA 3H0CA 1JTVA 4FM9A 1X3SA 2WHYA 3KUCA 2EHJA 4PAWA 3H17A 3C4JA 4HVAA 2PZKA 5JRJA 5KVQA 4DLYA 4URVR 5GADl 2P1ZA 4M2LA 4BB0A 1VCOA 3TLZA 1O97D 1IN5A 2YHIA 3I37X 4OBXA 4ZQIA 5KBYA 2AF3C 1IU9A 2UXDB 1ABBA 4XWTA 1UKYA 4PG4A 2ZIXA 1SR8A 2Q62A 1RWKA 3RWMB 5LDDC 2PSHA 2VH5R 5AFSA 1PZHA 1M1YE 1WB4A 3RVMA 4PYJA 5JSQA 1Z0DA 3SHTA 5LZ5A 3C1TA 3KRTA 3X44A 3V80A 3DAOA 1PV4A 1JQDA 2RGAA 2FN4A 4KQIA 4MUMA 3ZJTA 4Q3CA 2GJ8A 4UOZA 5KYXA 5IYZA 1P0CA 2O0MA 2LUOA 1EHCA 2AG6A 5JXIA 1YUNA 1TQDA 4DA6A 5BSUA 1KZGB 1QIJA 4G0OA 4U9HS 4Y6RA 1FUEA 1K5DA 1XJ0A 1XMSA 9ABPA 3W8FA 4GNRA 2QTLA 1K3TA 4OHVA 3THWB 4L8LA 2Q0XA 1WBDA 3KYIB 4TYNA 2QV7A 2H2GA 2YWBA 4PNPA 3X1MA 4OGKA 3MT9A 4BO3A 1VLZA 5G2OA 5K3SA 2P9JA 4YMLA 3V5NA 1U0TA 2PL3A 2DLNA 2FQQA 2X58A 3GLFB 3KIPA 1T3TA 2DUWA 3AH8A 5DV9A 3E2IA 4MVJG 5LQCA 3I9NA 1EWYA 4MQBA 4GH5A 5FDFA 3ZDCA 3F3YA 1X7ZA 4M7RA 5HKAA 3A11A 4UTZA 1QZTA 3ENZA 1XPOA 2R87A 2Y8EA 4FDTA 3AHDA 4G0MA 1K1EA 1MORA 1A5SB 1W85B 1YFKA 4DZTA 1AVTA 4ENTA 2QRNA 1U1FA 3CX7A 4IV8A 1RPJA 4DA4A 3MQ2A 3WDMA 5HQJA 3FOFC 4V39A 1EVYA 4TS9A 1RI3A 1GGVA 3QHAA 4LY3A 3OU7A 4YP5A 1T2EA 2O23A 2X15A 4R6XA 2P65A 4R2MA 5F9HA 5SYMA 4DV0B 3LBFA 4BKQA 1LC0A 1K3UB 1W0KA 1CRQA 5LQRA 2ZUBA 2GVZC 3CVXA 4HGQA 1VYUA 2WUDA 3OFJA 1SEVA 4NAUA 3AB3A 2ZP1A 5FP0A 1RADA 1B26A 5IBCA 4QWWA 5MFZA 1K8XB 1Q50A 4CN8A 1ESCA 2WG0A 2JFWA 3EVCA 2EZ8A 3SXUA 4D0RA 2BTQA 1H42A 1M1UA 2ZI3A 4P9NA 3HU1A 3CJRA 2R66A 3BJIC 3KOZA 1JS1X 1TIPA 2RHDA 4IIJF 1A88A 5T6BA 3WK4A 1POWA 4KQEA 1JQ5A 1QZZA 2V98A 3NV9A 4BZZA 2DGDA 2AFHB 2G88A 1YDHA 3IUPA 4GKAA 4JLSA 5BT9A 3F9IA 3KZ1E 2YBEA 3QELA 4LRQA 2PA0A 1L4MA 2CB0A 2OHJA 1F51E 1IXRC 1GFZA 1SB9A 3Q7SA 1XEXB 4BECA 3CBQA 3RADC 3ITKA 4DJJA 3GDWA 4P3KA 5DWQA 2ONJA 3OCVA 1NBAA 1VPWA 3WXMA 4XIJA 2IIPA 2YBDA 3IJ5A 4MW2A 4BNFA 3KJQA 3NHMA 1R6VA 4A8TA 4NNPA 1APBA 3CVUA 3FJ1A 5C4IA 2EW2A 1QK5A 4PPYA 4R8RA 1V6AA 3HDVA 4CCYA 1R8JA 1X80A 3H2KA 2FETA 5JFTA 5DNYB 1WCYA 1Y3CE 5C31A 3AP3A 4BYMA 4QT4A 2XHZA 2JIRA 2DBQA 2WKRA 3SSAA 4Y6PA 4BNZA 4Q01A 3NORA 5EYPA 5F51A 3WFJA 3P97A 3STHA 1SUIA 1YXMA 2HDWA 3N0XA 4PNZA 4JLVA 2PS0A 3ZHOA 4Z4FA 4FJ0A 3CH5A 4MP3A 4KITB 3RTEA 1EK5A 4G5YA 4PC6A 5F64A 4BZWA 3X2EA 2FE4A 2PMKA 2BKVA 4B81A 5EINA 1ABFA 2I8AA 4YP7A 3RABA 3WLRA 1RRGA 1VBMA 1G6Q1 2X14A 3LDFA 3ND7A 3NPMA 1MH1A 3QOXA 4BFYA 2PJRA 2QR5A 4AD8A 4EJSC 2FI1A 2P9GA 2VCYA 2WYHA 4HTFB 4RVFA 2HWKA 1Q1AA 1DDGA 4PIVA 3VOBA 2GXAA 1KO1A 3GLTA 1X1AA 1R1DA 1SXGA 1IZZA 2HKIA 4D6YA 1ZESA 5BOSA 1MU0A 1DAKA 1DEHA 1W0KD 3AVOA 4NABA 5BWLA 4FB5A 3AR7A 1HYBA 3ASVA 1IYZA 2YHBA 4IF4A 1E2NA 1XCBA 2HYDA 1UBRS 2R5WA 4I4NA 3R5HA 4JQCA 2A6PA 2OCBA 1QV6A 4QUBA 2CVOA 2JD2A 2XNCA 4N12A 2PSDA 3FIUA 2Q2NA 1KZ7B 3PL5A 1JAYA 3DWFA 1E96A 4XJTA 4B7CA 4G0UA 4KREA 1R6DA 3BK7A 2J3QA 4BKRA 4OXRA 3RU7A 1KEEB 1HYQA 3OE5A 3D3KA 1TYBE 4KX5A 4ARZA 4P92A 1Q77A 3OKPA 4LGVA 2AQKA 2BH9A 5KAMA 5KNLA 1PBTA 4W6ZA 3PYMA 5GTDA 2BN4A 4OQ4A 1FBTA 4DV1B 1B74A 2DMRA 1UXHA 2DCUA 2F9MA 2O2CA 2QK4A 3KQWA 4EHLA 4L9WA 1ISPA 3EC7A 1WO8A 5KOHB 3BG5A 3VAYA 4ON9A 2R65A 2VH2A 2VSNA 1MGOA 1ABEA 2G5PA 1TFUA 1CZRA 1QR6A 3JWJA 2P27A 3PKIA 3VDMA 1I1QB 2QTTA 1MB0A 4BVLA 3JQAB 4N3AA 5CNJA 3GLIB 1PSDA 1WF6A 5AT1A 2ZPUA 3G89A 5H81A 3DDCA 2BCEA 2ZSIA 3R3SA 4MKHA 1IJEA 1QH8A 1ENOA 2DFTA 1RVDA 4PG7A 1FL9A 3O93A 3AUXA 3MB8A 4FMDB 3COVA 3OOYA 3GJ7A 3E3AA 3F5SA 1F5NA 2REOA 3DEJA 3IB6A 1MOQA 1PNTA 5CX1B 3ZKAA 2BLLA 1R0KA 5B4VA 4KQJA 3UT5A 3Q2OA 4I6JA 3FDJA 1E99A 4WKPA 3ANXA 3JASB 2DT5A 3DHVA 3LYAA 2R6JA 4RD6A 3CZ4A 1CF9A 3RS0A 1AGNA 3MIIA 5KPJA 2IUTA 4NH4A 3UYLA 3OZUA 1PE0A 4QJ3A 5JD4A 1L8XA 3HXKA 5ALEA 4EKNB 4F4DA 3DW3X 3OQNA 5CHYA 1QGZA 2XRMA 4WCFB 3PP8A 3W1VA 4TMZA 4AJHA 2J3DA 2PY6A 2ZUDA 3JALA 3P2OA 3X1WA 4DT1B 1XTKA 3QMWA 1IOWA 3VDQA 3ZDAA 3QX7A 4FFNA 1UWKA 1YOBA 3RO7A 3EZGA 1M2WA 1SC9A 4BCBA 1O87A 1Z63A 2ZBEA 1AQUA 4C0BA 4DNQA 1TD9A 1GN8A 1YOVA 1PQ4A 3U4QA 5U1PA 5D01A 2ZJ4A 3TL3A 4OFWA 8OHMA 1MPXA 2VHZA 2AXEA 3DNMA 4AJ4A 2ESRA 3FUWA 1DOHA 3DPIA 4HWKA 3RS9A 3L8CA 1KSJA 3JVIA 3BRWA 3REFA 1T15A 1WIWA 2FPIA 3L79A 3LUAA 2XUZA 3AKCA 3MAGA 3GNLA 4QDZA 1KO7A 1OD6A 3BFKA 3ILXA 1B16A 2ZAIA 3HZRA 3Q9LA 1FS4A 4KNWA 2FWBA 1JBQA 2EATA 3GFRA 4URZR 3TVDA 1LPPA 3DOOA 1VSVA 5ALWA 4YR9A 3TLGB 3AERA 4RFSA 2FOLA 1U7UA 4F84A 4X8HA 4C78A 5KREA 4IW3B 5ICGA 3JYOA 3STTA 5K4GA 2VK8A 4L27A 4J8PA 1E1QD 3KT8A 5JAMA 3MFQA 4QXMA 3JYNA 4LVNA 4AJ9A 3DBIA 1NUAA 3EIHA 4P2BA 3SF8A 3LO5A 4GMFA 1QYIA 1QAQA 1Z5ZA 1K63A 2XODA 4IH9A 5DBGA 2YWHA 4U63A 2ZRMA 5A3JA 4GI1A 1NMQA 5AI4A 3OQJA 2EKPA 2XKJE 5LJIA 1VJDA 3DM5A 5FF9A 1L5VA 3DTVD 3QX8A 3IP3A 4KXVA 2O7RA 1X1TA 4FOSA 1I3OA 1U2RA 1N1GA 2HIAA 4YFYA 3TZCA 3VJMA 1PGJA 1FDIA 3AI7A 1VLQA 3GJYA 3MOGA 4WESA 2I8LA 4J94A 4CN9A 1CQIA 5FBRB 1WKBA 2Z58A 3C14C 2ZZNA 3LPMA 3ZV6A 5SZIA 4JI3B 1IH8A 4EB3A 1T9GR 1VPVA 3Q7RA 1EJ0A 4PYMA 3O03A 1E98A 1T3LA 2H1LA 3FXAA 2WMYA 4CEHA 3ZD7A 1W96A 3AR4A 5DGXA 5JV5A 2WUWE 4NATA 1QIKA 4DFDA 4FE4A 5JMOA 1C3OB 1DRUA 1GQQA 3QLUA 1EFAA 4HNVA 3GUUA 1GPNA 2VPTA 4C0HA 1H4SA 3HACA 2C2BA 5LMUB 2C2KA 3O8RA 1KY3A 2HA6A 1PWEA 3G2QA 4BMNA 5C4GB 4S1NA 5KX5F 3P5BA 4LGYA 1T2FA 5BWBA 2J87A 1CY8A 4GC5A 5E4FA 2G28A 1RBQA 4M1EA 3RVQA 3EDQA 3GDGA 5DPMA 1CJTC 4XPZA 5M3BA 4A5SA 4MCIA 4RA9A 1JIJA 5ANRB 4TGLA 3L0SA 3OPYB 1ZM4A 3N1UA 3ZPXA 5LXTF 4ITVA 2PUAA 1EP2B 2OORA 2MYUA 2CMDA 3I76A 4LW8A 4TV9F 3ZHBA 3F6YA 4QHYA 2GB4A 4DQKA 2I2FA 1ORWA 4HWRA 1V9LA 1YB6A 3X1XA 1PEYA 1ST3A 2OA0A 4ZI7B 1M6NA 1YIAA 3UWDA 1Z4OA 1Q74A 1WSAA 1IPFA 4LZPA 3NHUA 1B8VA 3S44A 2AC4A 1R8SA 4B0PA 2NTJA 4FIDA 2J5BA 1E20A 1K7SN 1M1YA 2YJ4A 3Q0TA 4ZALA 3GIWA 4JUAA 4ETNA 1LWNA 1QHYA 2RHJA 1WXHA 3UN1A 2KBFA 2OFPA 2OHIA 5TX7A 3JQ7A 4CMCA 1TK2A 1II8B 4IVPA 4JMPA 4PSAA 3QSGA 3T4UA 3DE5X 2H17A 2H06A 1QHNA 2NU6A 4HNSA 1I3KA 1KEUA 1RQNA 2GYYA 5CUQA 5SZJA 3AKEA 1EG2A 4R1SA 3KWFA 3I73A 5ICMA 2QN8A 4ZQHA 1AQIA 5FNZA 1LF5A 3D4NA 1HMPA 1K7XB 4EI7A 3BBLA 3M82A 4KAXA 2NPFA 1WVIA 3AJAA 4MRSA 2I29A 4MW6A 5J5VA 4ZJZA 1XJQA 2AKEA 1P5HA 5KJ6A 4IJVA 3ZR4B 1BOFA 4WXPA 4BVKA 2JFFA 1Y5NA 3EULA 4ARVA 2IRWA 5E2AA 5L95A 3EUAA 3DE0X 1B00A 3E15A 4B4WA 2HJVA 3CO5A 2IE0A 3G02A 1R18A 3LZCA 1TA0A 2FWAA 4EA9A 4DDKA 1WLYA 5GIPE 2D00A 2KX7A 2PLFA 1RCUA 1MTZA 4O4JF 1KDVA 1X1CA 2BKAA 4MRNA 1F2UA 3U7JA 1PZXA 2ADMA 2CKMA 1PAUA 4I1RA 1JR3E 4PGAA 4PZPA 4GX2A 3GRRA 3HLKA 1C9JA 2E2WA 1KDZA 3UEOA 3GJ3A 2XE7A 3D1JA 2FPOA 4Z49A 1OC4A 3W5AA 4KX3A 2EQ5A 3DVQX 4JLOA 1QJ4A 2A9RA 3F6RA 4C4TA 1LRKA 3DEYX 4FDLA 5A5EA 2FWNA 3D8BA 4EJMA 1U11A 3IVCA 1XFAA 4L9AA 1NMZA 2J67A 4BTEA 4Q4AA 4A27A 1FJHA 2D13A 1UBHS 3PDIA 4GP7A 4BQSA 1JZQA 4GXQA 1P1CA 1NKSA 2VIIA 2WVHA 5FUWA 1EBFA 1R5BA 1OF1A 4X85A 1JA1A 1YFLA 4BO0A 4WESB 1SZDA 1UC9A 1KO5A 4TROA 2D6FA 2GNPA 1PWHA 4ZVLA 2IYZA 1D5CA 4UVEA 3VR5H 2WJIA 2NUBA 4KYIB 1ZD3A 1L5HA 1N8SA 4BAGA 1YBAA 2LPMA 2Q45A 2QE7A 1MP0A 2PQ2A 3G9UA 3GRYA 4MMXB 4MWGA 1BG6A 5ALDA 1SCIA 2WZBA 3PDWA 4PAGA 4H1UA 3LDAA 3PL1A 2IH5A 1FSSA 3A1UA 1AC5A 2Y1XA 3A9UA 1Z0FA 2O05A 2H2IA 5DYNA 4YY3B 4AS2A 4BY9E 3GPBA 1NWCA 3BSWA 1CVLA 1O6FA 1KC1A 3WRWA 4KYTA 3C8DA 5A9SB 2IS1A 1KSFX 1UBEA 5IABA 4LF6B 3E7PA 2B5OA 2ZSAA 2EKLA 1R8YA 2GPAA 4HL6A 5B3LA 3WXBA 4ZYLA 1ZWKA 2B7LA 1DHRA 2GPBA 3KEGA 4O4IA 5CXQA 4EB6B 3IPYA 5EZYB 4MP8A 3RBVA 3NHAA 2CFOA 3VGPA 2D8AA 4YVFA 2PZMA 2YCBA 1PGOA 3NNDA 2RB4A 3MPUA 3O90A 3ILYA 1T0PA 3PBKA 1K92A 2D74A 3L01A 4JC8A 4QE3A 4CI9A 3KETA 4F3NA 2J59A 2NVWA 1N7JA 4GX1A 2OTCA 4C6TB 3EAFA 1K6XA 3QQPA 4OU4A 2WE8A 4CBVA 1XRSB 4RZIA 1WMFA 6LDHA 1C7IA 4N4AA 3NWPA 3GLIA 1TJ4A 5K3OA 3ZZ1A 2VAPA 3NTQA 4D99A 1LI7A 4WCFA 2JLYA 1NASA 1VCMA 2J8ZA 2FX3A 1GOTA 1W1IA 4H7EA 1IN1A 2WHPB 1SK9A 1QG0A 4BLVA 3A1SA 4JLUA 1L4FA 5I9TA 2HRBA 3BMOA 5BWNA 1VE1A 1MPTA 1Y1TA 4F06A 2GFIA 4OQPA 2F8SA 2I1QA 2NTVA 2IQIA 5B36A 2YY7A 4FOPA 3WAJA 1QQAA 4BFSA 4GL2A 3RJ9A 5B12A 3U5TA 1EXWA 3IX7A 1XTVA 3T1VA 4KG7A 4G63A 3KR2A 5IJAA 2FSSA 3G1UA 3L7OA 3TZEA 1HE4A 2N1BA 4M9RA 1BE1A 4YRBA 3LE8A 1KMIY 1AX9A 2PUBA 2G6BA 2BR3A 3P9YA 4BLTA 1YQDA 5B2FA 2BHRA 3B1JA 4QOEA 1ATZA 1SCQA 4XWKA 4PLTA 4HGOA 2VJCA 4DIKA 2BSQA 1YRAA 3KM0A 5A3RA 5J4LA 4W8GA 2QAGC 2R0QC 2BCJQ 1KQOA 3FAZA 4I66A 4Y9DA 1UDCA 3G59A 5HTOA 3ROFA 4PO9A 2YJGA 4QYWA 5ALHA 1I14A 3UMBA 1FOEB 1S3GA 2B1JA 3GY0A 3L6RA 4WXRA 5AW5A 5TT0A 4LV6A 2WZCA 2F9LA 5I9NA 3ZGNA 3SEZA 1E9CA 4H1VA 1JU9A 3KZOA 4LX8A 2OCDA 3RNLA 3RKRA 3ND6A 3EA0A 1LBTA 5EVCA 4F6CA 4NMMA 1E2GA 1CQWA 1PEAA 4Z86A 4JFAA 4MJ7A 2ZRGA 3PFIA 4R05A 3V2UA 1Z62A 4O4HA 4GGOA 3VFDA 2ZIVB 4QG7A 1TMOA 4QQKA 2M1ZA 3E5NA 4P32A 3MCUA 1W76A 3PNMA 1QLWA 4G23A 5TY0A 1XTRA 5DSZA 5C7IO 2UVPB 4KIGA 4JVSB 1AG9A 1XTJA 1T13A 2DPYA 1Z8DA 4RZQA 5IBPA 4U3JA 5C0OE 3WMXA 4BASA 1ZWLA 9LDBA 1B0UA 3JQ9C 4AMZA 4UPEA 5GINE 1PVDA 1QGDA 3CH6A 1TX4B 3ECAA 5CEFA 4H6VA 2RCYA 2JI9A 2C20A 1VL6A 2OO7A 4KDCA 3ZWKA 3ABSB 3MK31 4D9HA 5CA0F 2I71A 2J9ZB 3HL0A 1OFGA 2C7QA 1XD2B 2X7JA 1M1NB 4Q3AA 4MUJA 3W7AA 2DR2A 1Y1LA 1EUCB 2NG1A 2PGIA 4PHHA 3C5EA 4UTXA 1T2AA 4GOJA 2JIOA 1E1YA 1TUEA 2GM3A 4PR0A 5IWAB 3T7EA 1ZUNB 5AHWA 3AB8A 1JI3A 4GOOD 4L4YA 3IPLA 2PVSA 1FDTA 3D43A 1NLUA 1OHHA 2YC2C 3OTWA 1Q1EA 1W5TA 2WHPA 3DNPA 3IALA 1GYQA 1OGIA 2EVWX 5IWCA 2ZRLA 2NO1A 5B1YA 1RU3A 2WNHA 2OO5A 1UQRA 5CNKA 1SN7A 5DXAA 5ARCA 3TKLA 4BRWA 4XUCA 2GBIA 2OAEA 5K6AC 5L3VA 3HY6A 3CONA 3RRZA 1UINA 4FYYA 4CEJA 4ND8A 1O9GA 3PPXA 4UAVA 2JCVA 4WEQA 1T25A 1RQXA 1ZK0A 2J9FB 1LI4A 3GMIA 4PFKA 4ZC1A 2XCOA 5DLDA 3EPHA 1JUDA 2Q0SA 4BDTA 4D4KA 1PHPA 1Q1GA 3QKSB 5K3CA 3RT9A 4L5YA 3X1DA 4PE5B 4LFCB 5EZ6B 4D9FA 1MABB 1FUKA 1KEVA 2ATIA 2JJ1D 4ND3A 5DHUA 3COWA 3K32A 5B7PA 1VA4A 2QBYA 1YMUA 5D3MB 2TMYA 1L7BA 4NU8X 1TTPB 2OMKA 2VDLB 5IJ9A 3W6UA 1FNCA 3DV0B 2I4IA 3B2NA 1ZONA 2MINB 3G1TA 1JKMA 3NBYC 4DLXA 4M8NE 2KJQA 3LIIA 1BDMA 4ICIA 1U99A 4WBSA 4LSGA 3MJCA 5TE9A 1Z12A 3QPAA 4W1PA 2NU9B 4H9GA 5ALYA 1SC6A 3KPWA 3TEFA 3RROA 2RGCA 3DCYA 3TG2A 2QU7A 5CM8B 3R23A 5ALQA 3BHMA 1X7GA 1VIYA 1MO6A 5JU6A 3I83A 1NBIA 5CITA 4JU8A 2BGUA 1G16A 2FZEA 4G1MB 4PZEA 1Y6FA 4DR2B 2BM0A 3X3HA 4RTLA 1DRJA 2I7DA 3FHCB 1WCXA 2VAXA 5K01A 2B1QA 3BDVA 1Z2PX 2QDKA 3ENQA 1N4DA 1XTIA 1ND5A 2CJFA 3EXFA 4J3NA 3AVYA 3DCJA 4CMIA 3TSCA 1YACA 4YRCA 3S7ZA 4ISBA 2AEEA 4MPJA 5HW0A 1YASA 3ZY5A 3B12A 1ENYA 1BFUA 2IPOA 1WDLA 4X1OA 2V3WA 2XNKA 2P7HA 5BMOA 1IXSB 1R5OA 4KRFA 1A76A 2VK4A 1KK2A 2QAJA 4JLJA 4YNBA 4IXWA 5TEVA 4AO6A 2WR8A 5C7YA 4IIFA 4N01A 4X1KB 2XCUA 1QQ5A 4S2EA 4YV2A 3QA3E 1Z2AA 1NATA 1VE6A 3PGVA 2A1TS 1OCEA 5TMDA 1PFVA 5IKMA 1FFYA 1K68A 2HRDA 4W7HA 3JARB 6ADHA 4FHGA 5F9FA 3SQXA 1PQYA 5EE1A 3OPQA 1XHEA 4JHLA 3NRBA 3M6UA 5AM4A 1VSTA 3MT0A 1SWVA 3PUYA 4KIWA 3T7KA 3WYFA 2CE7A 1B3RA 1KKMA 1XTSA 2HJRA 3VKVA 4E12A 1D8TA 3ZK7A 4K6HA 3ITNA 4JENA 4F85A 2GAAA 1EA5A 3MPOA 1U2GC 2XB4A 4D57A 4I4CA 2FZ4A 5M7EA 3G5LA 1CNEA 1TUGA 5FFMA 3HN2A 1E6MA 3OLWA 1G8KA 4ZPXA 2OVFA 1KQFA 1G20B 4Y1EA 1NTOA 4I1UA 4MJLA 4OQXA 1ZHOA 2BZSA 1O6GA 3KSBC 4Q19A 4BZQA 2CC2A 2YYSA 3VDXA 1MW8X 4OAOA 4OF4A 1C1XB 1U2DC 1OXXK 2PYIA 2P7IA 1ISMA 1U3GA 3GFQA 1N5MA 1X7YA 2PRSA 1PGPA 4MPDA 1EWKA 2YOFA 4RD2A 3TZQA 3WRYC 2OXRA 5K8TA 3AF0A 1AGPA 3DT9A 5F2NA 3PWZA 3SR4A 5DBHX 4ZVVA 3ZC3A 1I01A 1HQCA 3I32A 2PE5A 1U4NA 5JYBA 4XVQA 4C06A 2KLBA 3A1NA 1TF7A 3DBOB 5KTOA 2NSLA 3AEQB 2B2NA 1GUFA 4GBGA 1RRKA 1FMCA 4PN3A 3PXBA 1T1IA 4L5CA 3M6FA 5EZYF 3VOSA 4M86A 2LCFA 5JI2E 1V45E 2GXUA 2H7XA 2J6IA 4UD2A 4US0R 5DX0A 3PPVA 3ZDRA 4ZZ3A 3L06A 5DLYA 1BWQA 1CDDA 1SCDA 3D0KA 4HS4A 3A2MA 4J4BA 4C7BA 4GS5A 3W4IA 1O6BA 3OFND 4IH1A 4OKNA 1Q0QA 3RVOA 1JIVA 1MO5A 3I04A 1ZNQO 3N2LA 1OSNA 1CUIA 3KYDA 4I4TB 3FR7A 4QDOA 3TQSA 3WADA 5J2UF 2LZ0A 1XXHE 4D0SA 1LK7A 5KVCA 2X1VA 4BFCA 5LOVA 5LP6A 4K3VA 3L2OB 5CVJA 2EJUA 3DQQA 1NI4A 2ZIAA 5JH7B 4WZAA 4DCSA 5LIRA 4JT8A 1AN0A 3TLEA 1PFWA 4UBKA 3R9KA 4LZOA 3R6TA 1UBCA 1E6KA 1LF0A 2QQ5A 3T5PA 3TAHA 2BFBA 2DF8A 2AZDA 3OCXA 3ZU5A 4LC0A 5KS2A 4UFOA 4HEJA 2GKSA 2CNWA 5HS6A 2WM9B 2ID9A 3R75A 4FEEA 1RIFA 4CFZA 5TMPA 2ZOSA 3DO5A 1F4PA 1NBHA 2WP0A 4UVIA 3U49A 5DNUA 4H6PA 1YR1A 3QXHA 4JOQA 2XCIA 3WJ2A 3WLLA 5BSGA 4F5DA 2DZDA 4N3NA 4NLLA 4Q9JA 5EMMA 3HXOA 2WB2A 4JU9A 1RI1A 3PTZA 3ZDQA 4NVRA 1NZJA 2UVQA 1UBLS 2OKGA 3DOHA 4HGRA 4BC0A 4R69A 1GXSA 5ALUA 3ICQB 2BUBA 3QTBA 3WGGA 4JH0A 3I5XA 1P2DA 3SOZA 2I65A 3HCAA 2IY8A 4GLFA 1ZG3A 2IBTA 3ICEA 3K6RA 4PSCA 4CLOA 5IXSA 1XEXA 3K0EA 3K16A 3LPCA 4F4HA 2XTJA 1H8ED 2QG4A 3QEJA 3K2BA 3NTOA 1WZUA 2IY9A 3O74A 5A0TA 1CPYA 4FEGA 2J09A 3PQFA 1S8OA 4Q9IA 3RHSA 3VR4A 4EMTA 3G0CA 7MHTA 3LPNA 1L5KA 4N3CA 1NXPA 2CLLB 2W7TA 4DCTA 2O8CA 1KS2A 1I0LA 4YB8A 2CUZA 4GQBA 3CF4G 3LP5A 3IUBA 1UL1X 2FZVA 3HEMA 2XWPA 4GOND 5GJCA 1TM3E 1W94A 1GPMA 5TR9A 4X8LA 3GLHB 2XX3A 2X4GA 1L8AA 4XR4A 4KR6A 1X87A 4KPYA 1VZ2A 1N2CA 4CLHA 1M3SA 1KEKA 2C9OA 1MO4A 2AG0A 2FR8C 2XE6A 4CCSA 2Z2XA 3QY9A 3JQQA 4RL4A 4XX0B 4DLBA 1JDJA 2PKRA 4UU7A 1O58A 3COJA 5BPFA 1Z25A 4D45A 5IEBA 3VZDA 1K66A 1JNYA 4CEHB 5DN6D 2BBTA 2EF0A 3EOAI 4X9XA 5AUPB 5LU8A 1UM9A 1ETHA 1B15A 3UCEA 3ESYA 1OHHD 4TVOA 5CGQB 2J3HA 3RM3A 1U7PA 3A3YA 4D5EA 5D8DA 3GFSA 3ZHXA 1R0SA 2VKQA 5LQUA 2HTEA 3AGQA 4M9XA 5K3EA 2QUHA 4C6RA 1VA5A 5D84A 3KCNA 1CUDA 2ROQA 3BFPA 4IRMA 5JCZA 1NXXA 3I92A 2RH4A 2X7XA 2BWJA 3GGSA 2FPSA 1MA3A 1FP7A 4M3NA 2WVGA 2P5YA 3U48A 2Y1LA 2MSNA 3MCTA 2W6JD 1KYIA 3G2OA 3S2YA 2Z0MA 3DMPA 1U8ZA 3WISA 4M1KA 1JAIA 2W2KA 4E5YA 4GOLD 2QTVB 2R85A 5DSTA 5BY2A 2E9SA 1UK6A 2A9OA 5C46F 4DCCA 2YV3A 1TAQA 4Y7CA 1MAVA 3IDOA 3TDNA 1ULSA 3PC8A 4N8SA 2PWAA 5LA6B 5LWQA 2IPAB 3R8XA 4HH0A 1NC3A 1NUTA 4PYIA 5JMTA 1OLXA 1U2SA 3EDRA 1HDEA 4P7GA 2XF2A 5HJ2A 1LLUA 3B1FA 5HX7A 4CETA 3TFOA 4NXNB 3AX6A 1SKYB 1Z5WA 3AR5A 4Q48A 5BNIA 1NIPA 2ATVA 5DTEA 3KJIA 4K2HA 1WXFA 1BX0A 5EQFA 5JNVA 2F67A 2KB0A 2R6R1 4FOTA 2Y0CA 3AQIA 4Z99A 4DC9A 5CX1A 2ONZA 3ROZA 1RLTA 4HZGA 4MCAA 1PWZA 2HJGA 2C0CA 2GCGA 1RHJA 3ZHYA 5IAAA 1W75A 3HPQA 3SN6A 1OASA 2HPAA 4B7AA 2ZUTA 5F5LA 3DMTA 2HMYB 1TTHA 1Y7IA 3A8TA 4MKZA 4XUDA 5D5PA 2PUJA 1EMDA 4BNIA 4Z54A 3S1SA 5LYJA 5EKXA 4HN4B 3VNUA 5JS6A 3W2FA 4FWBA 1VB5A 4NICA 4ME6A 4XH9B 3DZBA 1A1VA 1G6OA 1XD9A 1C30A 1JYFA 2FHSA 2DPXA 3FE2A 3M8KA 4HXYA 2WICA 4WOBA 3IR5A 4NV3A 3ZYCA 5KDLA 3UMYA 1E2FA 1CCWA 4RTRA 1N2GA 2HBZA 1GWNA 2IEBA 2ONYA 2Q3JA 3W5HA 3LDGA 2F3SA 4WKCA 3RI3A 4IFIA 4I4LA 3URMA 3RJMA 3UXMA 5IDQA 1EK0A 2CMKA 3EA5A 3F49S 3D2CA 3T1OA 4CF7A 4OLAA 2FMFA 5DRTA 2PRZA 4C5BA 1ULHA 1X2EA 4DCOA 1U63A 3OH8A 3EZLA 3LWBA 4TPKA 4CL2A 4HV4A 4MB6A 4ARBA 3LQRA 1EFRA 1GGMA 2X3FA 5BQOA 4RTKA 3Q8KA 4Y9SA 2XBUA 3L7YA 1PYOA 5ALLA 3LFTA 1L9XA 3H8WA 4KN6A 2C5AA 5EYPB 4F4IA 1YUBA 3ACBA 1UEJA 4Z0NA 2FW6A 1H5NA 1P19A 1RM4A 2M98A 3QKWA 3QU9A 2V4ZA 4DDHA 2ODAA 4ZAXA 5B2ZA 5SYNA 4MKIA 3AI1A 1NPTO 4E33A 1KYTA 1B93A 2MINA 3A3PA 1CNFA 2HPZA 3FA2A 3ZJYA 3ED1A 6PFKA 1AMNA 2OG1A 1KMNA 1HLDA 1YHYA 2HBYA 4RF5A 2X0EA 4NOLA 1BHJA 2DBRA 2QYOA 2XECA 4A1FA 2ZAOA 5PGMA 3K1AB 4QFBA 2GZMA 1QKJA 1D5WA 2R00A 4C88A 2A7XA 1C9MA 4XVRA 4Y0AA 4WI1A 3C7TA 3SNKA 1B2RA 1YVEI 4EEKA 2HGZA 1EP9A 4TRMA 2HB6A 1P75A 5CLLA 1E92A 1EAYA 4UEQA 4CKEA 1VG9B 4XGKA 2JCXA 1KAHA 4JQYA 1DFHA 3CRW1 3D2AA 4DG8A 4YHHB 3GBSA 3N5CA 4LJAA 5HG0A 3ZD9A 2XKBA 1PF7E 3MMXA 4OYLA 1B0PA 4DUYB 3HS3A 2H8KA 3KXLA 3Q3HA 1NF2A 5EHIA 3SMQA 5LQAA 4ZO7A 5DZSA 1UQUA 3SBEA 1OH6A 3PNOA 1NW8A 4NC9A 1VTKA 3ZD8A 5KAPA 4GWGA 5BNWA 4NYJQ 3OEHD 4PLVA 3V4OA 3RRYA 2JFNA 3TZBA 4HTFA 5AM1A 3FYDA 2BR5A 4M0MA 1CJUC 4XW2A 4YAGA 2RBKA 1O0CA 3NVMB 5C3MA 3FR8A 3VMMA 4MUKA 2DYKA 2D7CA 3EXIB 1J2UA 2CZGA 1RABA 1BMTA 3NAGA 2IZ5A 4N0DA 4PPGA 1GDDA 1NQVA 4NECA 4XVHA 4Z53A 1HDIA 4RKFA 4YLEA 1NN5A 3M6WA 5P21A 3D3NA 4K9MA 4OMCA 3CZPA 2QR3A 3V2HA 5JIBA 1BS9A 5A5DA 2WEKA 1RXWA 2FQ1A 1OFHA 4E6PA 2BY4A 2CBZA 2OVBA 2W4IA 3ORQA 4ZVMA 6NULA 2DBYA 2QX4A 1W73A 2LD4A 4LQLA 1XL1A 4M83A 4JKIA 3W9BA 2FEWB 2OO3A 3UIEA 1RYMA 1DL5A 4MPRA 3Q3VA 5DNEA 4OX9Y 2QMQA 2AFIE 4DSOA 3ZVNA 2YYYA 5C8YB 4HHEA 5AVVA 2Z5FA 4LOHA 3FCSB 4W5HA 1FLVA 2NO5A 3W79A 3VKGA 2E3JA 4A2PA 1UBJS 5GONA 2RARA 1FY2A 1H2HA 1HZZC 4DE5A 1GYPA 1NQUA 5BN3B 1ZD9A 2QF7A 3AG5A 1G18A 3GJ6A 1JPVA 1XCPA 2Z9CA 3MD0A 4KEAA 5DT9A 3WYCA 4DMMA 4NJOA 4QGBA 4KDFA 1I3NA 1NP3A 2AJLI 1SD5A 2FEAA 1XB2A 4NYMR 5K7SA 1H4QA 1BDBA 1VKRA 1GZ5A 1Y6JA 2W8ZA 4QYSA 1MHTA 4EQ6B 1PR3A 3ETEA 1EJ2A 1XU7A 3H5LA 3QVUA 4N39A 4UBMA 2F17A 4EZBA 5LQDA 3FPEA 3AR3A 3CWQA 3GEDA 2Z2JA 3OIDA 1SO8A 5AM3A 1DU4A 2OHVA 3EJWA 4KRYA 4TX1A 3KQPA 2EZ9A 2NVOA 2IPNA 4MQMA 5EPUA 3UHPA 1R0CA 3IAHA 3E0XA 1Z36A 4NAHA 1Z39A 4HPXB 4PBSA 1CP3A 1G21B 1MENA 1KO8A 1RTKA 3PNYA 3LC1O 3T5DA 4G4IA 4YRJA 5KYXB 1N4AA 3F73A 1K5GA 2MJLA 5DCWA 4JJGA 1C9DB 2Z6VA 3Q8XB 1HE3A 4KI7A 2LRHA 4KLAA 3DNFA 4MYSA 3VSAA 2VRCD 3G7NA 1NQTA 4RVUA 1QGED 5KTYA 3NHWA 4A6PA 2WMNB 2G63A 1L1RA 3PFKA 1DNPA 4BOYA 4DJEC 2ZIXB 5B55A 2EGUA 3T1TA 3M1YA 2WBLC 4B71A 3PLAE 1ZP6A 5HCUA 1ZVQA 5H8WA 4GAEA 2BYTA 2H5IA 4L8GA 1Y1KE 4GU5A 3VC2A 3C3BA 1WV1A 3VUFA 1U7XA 3THWA 1H0RA 2IHBA 2OSBA 3EMDA 3H9EO 5A04A 2ZJBA 2XMQA 4FZ5A 1J0DA 3ELUA 5KYUB 1N5RA 1GTZA 4CTJA 2Z2YA 3NHYA 1XPJA 4CM8B 3OX1A 1WCWA 1E5DA 1Q11A 3SEFA 3GLFA 5LP1A 2WNIA 3RSQA 1IBKB 1SUSA 5HF9A 5DULA 1GDTA 1TPYA 4D7AA 5HKBA 5KTKA 3DOIA 2FW9A 2VNAA 4HFRA 4PO1A 5KNCH 1J4AA 1EQAA 5JJLA 1TU0A 4RJLA 2IW3A 2FPPA 4ZO9A 5IDWA 1U2PA 3V9AA 3WK6A 1GFIA 1CS0A 1T4CB 1QOZA 4H7IA 3DTVA 1VLVA 3H5RA 4F3RA 3QVGB 3A27A 2AI2A 2CEKA 4I5EA 3MTJA 1ML3A 3UFBA 1XQ6A 2ODQA 3NOXA 1VLJA 4NEGA 5E1OA 4LF8B 4Q1FA 4V1CI 3EZXA 2OHXA 3HR7A 4G41A 2CYAA 2J6HA 1J9ZA 3DMRA 4DYVA 1NW6A 2GESA 4PC3A 2CV0A 2WKSA 3DG9A 5DFAA 1QAOA 3C3WA 3OPYI 3H5AA 4GP6A 5TQ0A 3T5TA 5JRDS 1OZGA 5K09A 2E85A 1TUBA 3IA2A 3R0JA 4U9IS 3SICE 2BIFA 4D8XA 4R1LA 1A4IA 3BRCA 1RJDA 2Q3CA 3HB4X 3O83A 2VYCA 3S1LA 1AGYA 4N82A 4DZZA 2RONA 4HDSB 5GOTA 2C4WA 2C5LA 1JJVA 5JE8A 5CH8A 4D4LA 2PX5A 2HXYA 1FZQA 4KXXA 2R11A 4XWYA 4I5FA 3PDHA 3I6ZA 5DHSA 3S8EA 3RWBA 4Q02A 5C3UA 4AN1A 1T43A 1DTWA 1EWRA 1EX6A 3ZXIA 4EGJA 4G2NA 1BHO1 1VIAA 4C3UA 3SVTA 1KBZA 1XLVA 3BERA 4A8JC 4FU0A 2FSUA 2AR9A 2FFRA 3HKCB 3PD7A 5L53A 4UDYX 3ZWVA 4E5KA 1C7EA 2FG6C 1IXKA 4ITUA 1LTQA 1Z2OX 5FFFA 1RRMA 1OWOA 2NN3C 2RGNA 1DBWA 4RENA 4PG5A 4ZT2A 3ZWOA 3DMGA 2UYHA 4K6FA 4B82A 1Z4LA 4A2QA 4M36A 1V8OA 3BK1A 2WT4A 3DKRA 1V4NA 3E3LA 2CLIB 5GAJA 3T61A 1NRXA 4LY0A 3AJEA 3Q40A 1TKRA 4A36A 3EXEB 2RAPA 2VP0A 3JQ9A 3QA9A 3JZMA 4EA8A 1SB8A 3Q85A 2PMWB 1JG1A 2VQ3A 5AK4A 3R44A 5KYUA 1OB2A 1EK6A 1YH3A 4IICA 5FORA 4J1QA 4J9VA 4W5WA 4EF4A 1GQFA 1GM5A 2CCJA 3EOZA 2XB8A 3WSTA 3EVNA 1JQ3A 3WJ7A 2B2CA 1GRNA 2O7VA 1CY4A 4XCQA 3C2QA 3CW8X 2NYAA 4UTVA 3OZWA 3C3CA 5AXAA 1EDZA 3AVPA 5JZBA 4TZTA 5JROA 1BJKA 1ECBA 1N3IA 3DVAB 3Q72A 3RC9A 4YCLA 3M81A 5LWHA 2BRUC 4KXMA 2P68A 4E7OA 1BMDA 3EGIA 5KIAA 2SICE 4JR1A 1I3MA 3OVMA 2BFMA 4IOJA 4LF7B 4ZREA 3NWEA 2WLTA 4EK9A 1KEZA 1KAEA 1AKVA 1GN9A 2B3TA 1KPGA 1L5MA 1RHMA 1WULS 3O3NB 3OM1A 3R09A 4GR5A 1GPH1 2NACA 2VI5A 3PUJA 3WGYA 3GEPA 4K6MA 2GX6A 2K4MA 1LJUA 2YV4A 3TB4A 2GSDA 3KE8A 3UWSA 1B0ZA 4FLFA 3HUDA 4A3SA 1R6AA 2C8JA 2H1HA 4PM4A 5H83A 1OZFA 4NWIA 1KXZA 1XZKA 5AHRA 1VIDA 1P2UA 4QEZA 3PYLA 4KK4A 1GR1A 2QPAA 1PT5A 4E5UA 3EB9A 1HFJA 5CTAA 2WFLA 3MRXA 2B25A 4UU8A 5EPOA 3CMMA 2IXFA 4G5FA 2JI7A 4RPHA 3TQOA 2FMIA 1SIUA 1ZJYA 3B1YA 1WPQA 3LL4A 5GGXA 1B6RA 1WJGA 3PQEA 3PZBA 1KI3A 1BSVA 2VF4X 3VYUB 3W5JA 4IZHA 5LZ7A 1T8PA 4WD3A 2PX8A 3VUEA 4U9UA 4RTOA 1L4HA 1I3CA 1C14A 1NUSA 2ZT7A 2I4MA 1Z18A 5FNVB 5IUKC 4KGDA 2VDOB 5JSHA 1J90A 3UMMA 3DBVO 4HDRA 2HQBA 4N18A 3W4KA 2FOIA 4NBRA 4BNYA 5IULC 1N5LA 4BX9A 1OWPA 2C2HA 2NU7A 1LBHA 3A3OA 1HTWA 1RWXA 1YGYA 3BTSA 2C9CA 2HPVA 3N2KB 4MCHA 2JHAA 4YA6A 4B3JA 4ZN6A 1XF1A 1FTNA 2Y05A 3N86A 5T3UA 3AHHA 4LZAA 5BR7A 3BMQB 4BQPA 3LS2A 4DXHA 3EZ6A 1MC4A 1XGKA 3AF1A 4G86A 4O2BB 5GQSA 4ABTA 5EL0A 1J2JA 1HM5A 5G0VA 2ZWMA 3V6MA 3P19A 1MXHA 1LC3A 2CY0A 3WJ1A 3CN7A 3RAEC 5GZ1A 4JEIA 2VEDA 2O7QA 2B8JA 2IDMA 1LBSA 3OWXA 3QU2A 1U90A 1IY1A 2DSNA 4PLGA 3V8VA 2MSDB 2DBVO 1JDBC 1E6UA 5ERXA 4ZVNA 3VTFA 2J30A 3MQFA 2YJZA 3WNZA 3OTIA 1SQ5A 1FSZA 2QGZA 4HDKB 4TM8A 3LZ6A 3W3AD 2JEOA 4TWZA 1H93A 4H7PA 1A4RA 2LTAA 1KETA 4P4SB 4HDNB 2OHHA 3A7EA 2HC9A 4Q1VA 3P0RA 3VKUA 2C9YA 4LOLA 4EPTA 1E3TA 1NYTA 3EMBA 2HWUA 2PKCA 3MLAA 4HSGA 2OV4A 1UKCA 3PXEA 3ZDBA 1LPOA 5D3MA 4BDSA 4DMCA 3AVQA 1SG0A 2OG2A 3WKAA 2IEDA 4JDUA 5KOJA 1FVXA 1WMDA 2ZBDA 2DEUA 1SBCA 5AICA 1ZRNA 2ZAYA 3VVBA 4D02A 1EK1A 1O6ZA 2K87A 3GZJA 3HE3A 5JVDB 3VR1A 3U5ZB 3I12A 2W42A 2WUEA 4A6XA 2JLCA 4YUWA 3P52A 1T1JA 4HGYA 5J2TF 4QFDA 2VXOA 4AZ0A 1GPYA 1JZTA 5DN9A 4E21A 1YV9A 3LA8A 2E37A 4N6GA 5AJHA 2I6SA 4UVGA 1PX2A 3WAKA 2JCGA 5JW6A 3H2HA 1KRXA 1AKWA 2Y0PA 3CM0A 3TMKA 3U4QB 2GD1O 1NG9A 1LVHA 1CRWG 1NFRA 3OQIA 3ZE8A 5IMSA 1HUQA 4R1TA 3HG7A 4CKYA 4C2AA 1XDBA 4P58A 4D4MA 1LDNA 1QOQB 2QUAA 5JSFA 5J2UA 4ZA2A 3EDMA 1G63A 4MARA 3CVWA 7REQA 3E7FA 5E6RA 1F4LA 1O54A 2XYGA 3MZ0A 4NG4A 1PLKA 2Z1NA 3R9XB 1OGYA 2NVBA 5G4KA 3S2GA 3GYBA 1C50A 2QTHA 1JG7A 3BD8A 5EJ7A 3ND5A 4WFJA 2PJZA 1W93A 1AQJA 3LAWA 5E3JA 3GJXC 3PKZA 1UKEA 3QBVA 5C34B 4KVFA 1CBUA 4OFZA 3TBHA 5DHFA 4D2IA 1U2QA 5KU1A 5AXDA 1H65A 3IBYA 3DDWA 4WQMA 1KQPA 3WL5A 3ORRA 3V97A 3MS4A 1TDJA 5LUAA 3VO8A 2NNWB 2GK4A 3TTXA 1KY5A 1W2HA 1KDOA 1Y89A 3B6KA 4F9TA 3BCRA 4FGZA 5ALFA 1QPBA 3P26A 4XUEA 1NYRA 1JEQB 2SCUB 2YIVX 1YS1X 2A57A 1W5BA 2P11A 3DDNA 3HBAA 3NT4A 4HB2A 4LNUB 5A71A 4KPFC 2EOAA 2I6FA 1GCUA 3AOEC 3BM5A 2XD4A 3H2IA 3HKBB 3A1FA 5K0NA 5K1ZA 1KL7A 5TV2A 5WRFA 4BEVA 3LG2A 4TV9B 4ZIRA 2FUKA 2BMJA 3PHIA 4V24A 4N48A 5B53A 1JDUA 2WJGA 3E22B 3KALA 5AVTA 1SELA 2GCPA 1OYYA 3D5QA 4FW8A 4ER7A 3QE9Y 1EESA 1NM5C 1QB8A 4AECA 3K8QA 3NEPX 3BDAA 2R8OA 3GHHA 5JCJA 1M75A 4BYGA 3N2GA 5MDHA 2NADA 2XCQA 3IEVA 3WL7A 3H19A 1AB5A 2BDTA 2QUBA 3HJHA 1Z33A 1BW9B 1MX9A 3ZGXA 1I7DA 1R37A 4JBXA 1I9CA 3R7FA 3C3YA 2JFYA 3HXQA 1P1FA 1DB3A 2GR9A 1POXA 2KW5A 2VXBA 3KUKA 5HS4A 1JWAB 1F2DA 1G5PA 3QXCA 5KNCD 4WLUA 1N5IA 5HMLA 3LYHA 3IBTA 1U0OC 3MXTA 4E07A 1JVSA 1EKXA 4LHZA 2XCSB 1NPYA 2YZKA 2MMGA 2XBLA 1KWKA 1O97C 4DUZB 1GFWA 1REQA 4CIWA 4B3FX 1W44A 2V6IA 4U8GA 4MR8B 3L4BA 1DEOA 1PDVA 4DTCA 4I9NA 1P62B 2YXDA 3NUQA 5CA0A 1SBHA 2H85A 3EXG2 4PAMA 3D6NB 3LF2A 4XD7D 5AI9A 3ROTA 3ETNA 3U4DA 4EFKA 3I34X 1OAOC 1DAFA 3O6VA 1G8PA 4DHWA 1YSCA 1TOAA 2DTDA 2A1UB 1BKDR 1AQYA 1VKOA 4XSVA 1X1SA 4GT1A 1ZPDA 3G2PA 1F8YA 1M6YA 3P9ZA 3TCKA 1AXGA 3CRRA 5IU6A 1FQOA 2GMWA 4HAUA 3N58A 4URYR 5EZQA 2OPHA 4RIGA 3UOWA 1YU9A 4EI9A 4XOIA 2OZVA 1YQWA 1HG0A 5IFKA 2P3LA 2J5QA 3DZIA 1HI9A 2PH5A 4NXMB 4MTLA 1SGWA 5C5CA 5LD2B 1R88A 3BWBA 3RCBA 3BE5A 1ZSYA 2JBAB 3R5SA 1Y3FE 3I53A 1HE5A 1JAXA 3AR6A 3FNGA 1KI6A 3QKIA 2DTEA 4ZO4A 5HA5A 3R6LA 2YMPA 1VI5A 1BQ4A 4ZZ0A 1RKXA 4CDRA 2VN8A 1FX1A 3CVVA 3RUDA 3F3MA 3WGTA 3GZNB 3AUKA 5FR1A 1RACA 4AS1A 4X66B 4TWBA 4CKCB 4WK6A 3LCVB 1TYCA 1FFBA 2QB5A 2YUTA 4IILA 2E48A 4MVYA 1GR0A 4Q3BA 5T4BA 4IIXA 3OZIA 1UMKA 3OIFA 4JWTA 3UUEA 5BORA 1BZYA 4FN5A 5MN4A 5D1HA 2IK8A 4CIDA 3DLPX 1VHJA 4NCAA 2HA4A 2ZS9A 1GXSB 1I1HA 2IZ6A 1VB3A 3QFHA 4R3NA 5DSXA 3TD9A 2ERCA 4EO4A 2PKEA 1I2DA 3T5CA 4CDMA 3A10A 5DBFA 5FTLA 1E3SA 1FTGA 3KJXA 5HRUA 2ZVJA 1V8PA 4DY4A 3X1JA 2RGYA 1DIHA 4NDZA 2X9QA 3L1IA 4EL0A 2GJ9A 4CM7A 3EF0A 5I51A 2ZGVA 3E7DA 4WOKA 4UULA 5JAPA 3H2SA 3KXPA 5AXBA 3OO1A 4FB4A 4D8UA 5HXAA 2QVBA 3FF1A 2ALJA 4L02A 3LY9A 3M3DA 3CMCO 3LYUA 4ATNA 2H4HA 2WM2A 5DYYA 1YQ9A 2PRJA 1E9BA 3LPLA 1OIVA 4RPKA 4A0SA 3P8ZA 2VQSA 1ZU5A 5H3LA 5LD2C 5DGIA 3THXB 1V16A 5E2IA 4I3HA 2AE2A 4LZNA 2DM6A 3EGVA 1LQUA 1Q15A 5HK8A 1BFDA 3BVPA 2WT9A 1T5LA 4IDAA 2E55A 3S8MA 4EF6A 4JV5B 2DKFA 1ZZEA 5JD6A 1CF4A 2QLBA 1RRFA 2FW1A 3B6MA 5TPWA 5K6AA 2QVCA 5BN3A 4Y67A 4JGGA 1DTSA 1PL6A 1JKXA 4PX5A 5CFPA 2VVTA 1JT9A 4OJKA 3B13B 1JSXA 1HDCA 1YBFA 3H9GA 3MRTA 3OKAA 4ND7A 1CFJA 4NZNA 5COBA 3TECE 4J75A 1VIMA 3VVLA 1XDSA 2ACWA 1D0IA 3JQCA 5BYKA 5E4YA 5DJ5A 4J90A 3N0TA 4R2XA 1ZUWA 4V38A 3SZGA 2W2MA 3WMEA 1W36C 1YQQA 2LVBA 2BGNA 4CG1A 3CCBA 2BGTA 3EPKA 2XAAA 3F90A 4W8OA 1H22A 4HAIA 5JG7A 5JCOA 5LZ9A 1SXPA 2IEYA 3UAWA 2FHPA 1QTRA 3HR4A 3MUEA 1DKNA 1N6LA 1THMA 4OREX 4XASA 3G49A 2NXEA 1NE7A 3D8SA 2NTEA 2VNKA 1N9ZA 2FN9A 4MRAA 3DE6X 3EFOA 5EA2A 4AJLA 3R8FA 3EJ6A 4M7OA 4YCAA 1YCFA 1QIHA 4I9GA 3U81A 1Z3IX 1F14A 3CSSA 3O2QB 1GTJ1 4ZKEA 2O8BA 4MW4A 3ULKA 3HEBA 4HNGA 1M8GA 4JN6B 2JA1A 1XDUA 1FFCA 4IO1A 2WAXA 3Q8MA 2W2PA 3OUTA 2BGJA 2NX2A 3SEAA 1F12A 3RVNA 3T1YB 1SKAA 3KQQA 5B3JC 3MUFA 2NO6A 2Q6KA 4H3HB 2I9KA 2Q3LA 3BGWA 4QUAA 3U62A 4DCPA 3BF7A 5I8WA 1T8RA 3LRXA 4EMSA 3M2TA 5ECYA 1T3ZA 1V8DA 3LXUX 4RVOA 2IOYA 4CV1A 1W9HA 3M1IA 1NUQA 1UK9A 4LNHA 5DCUA 2Q3MA 1R4AA 3RTBA 5ARBA 4B3CA 1W36D 3L7BA 4GVLA 2OLEA 1NKTA 3PSHA 4MYCA 5JWRA 5CXUA 1ODJA 3T5BA 2FP4A 3FVTA 4MV8A 5CTJA 2V7PA 1U5CA 1ZVKA 3QEOA 3WL8A 3UFXB 3H8SA 3I0NA 1OWLA 4HBZA 4OHOA 3JVEA 3KEQA 4MS3A 5KNDD 4YI5A 1ZK1A 2XGOA 4OATA 2C4NA 2O2JA 4WA7A 3URKA 3LP6A 4MUYA 2CZQA 2VZEA 3MRSA 3P2JA 4PQGA 1CJVC 3PX2A 5DWVA 3D7SA 4I50A 4KFTA 4P84A 4RIHA 4Y9TA 4CR6A 3QOYA 5BV0A 4R7TA 4ZFNA 2FX2A 4JBYA 1ZM7A 4IXNA 4IJ5A 4KIJA 4W5QA 1EU1A 1YBVA 4DDMA 4DOMA 5KKAA 3JAKA 3TGWA 4AW9A 5KKCA 5JWOA 5LNK6 3OQMA 3L02A 3UOGA 1AKRA 5A4IS 3BL5A 1Z74A 3TAUA 5L3SA 1P1HA 2EFDB 4EMUA 4OLHA 1X14A 4EBFA 2JL1A 2JIMA 1AZSC 1JNXX 3PNPA 3SU8A 4FK8A 4LG1A 3VOTA 3RBAA 3UW3A 2G5CA 2JAUA 4KDEA 3L5OA 5IF9A 3GT3A 1GRVA 2PGAA 2VPXA 2QTZA 1CC1S 3C8HA 1MD9A 4RJ2A 3QUSA 1KDRA 2OCAA 4PNHA 2C4HA 3MWFA 3SSOA 1KBOA 4G0QA 1IJFA 2AD1A 3BWMA 3CR7A 3EC1A 5HDQA 4AKSA 2A7QA 1C30B 4ND8B 4NENA 4O1IA 1E6LA 1DQYA 2ATCA 2OAGA 2XGGA 2BMEA 3N5KA 5TF4A 5C35A 4PHGA 2XR1A 5DF1A 1XYYA 1J5EB 1RQ2A 1K0UA 2DHEA 3FKQA 3ZVMA 1FPQA 3DB2A 3E5HA 5DT2A 4ZIRB 4RH3A 4HH4A 1BVHA 2NP7A 2O8DA 3FFBA 5B1SA 4EHNA 3FBGA 4JI4B 1IZ7A 3PDJA 4LUCA 1N2CE 2IZ7A 3TRJA 2ECFA 4ARCA 1E9FA 3L7LA 4TN5A 2QU8A 2NPIA 4N6OA 2WJPA 1YOVB 3HNPA 3OP1A 1NJ6A 1PLJA 4XM1A 2AZXA 1HRDA 1G2IA 1K7EB 1XRQA 2ECOA 4V02A 4WLVA 4ZVOA 3NBAA 3SF0A 5BN1A 4TKVB 5EMHA 1FU7A 2P5UA 1A9SA 1AUXA 1FNBA 3T6KA 1ISFA 2JS7A 2V0NA 1T0HB 3Q7PA 1KJYA 2A78A 2PQMA 1IWBB 4NJMA 2JGAA 3ODGA 4ECEA 5B2EA 2W6PA 3MGCA 3W8DA 4D46A 5CDFE 3GPDG 2Q4OA 5AJTA 3AJ9A 4DIMA 4A73A 4RH1A 4QX6A 2O5VA 2E0IA 2VJAA 1GQSA 5EJ6A 2GPWA 2XSZD 3AR2A 4H0NA 2AEMA 3ELYA 2N1MA 3FFXA 4R71A 2KMLA 1UPUA 4MRPA 3IOMA 3NATA 5KOYA 1YDMA 3D6AA 1U2DA 4YJGA 1DADA 4JJ8A 3F5MA 3M3PA 2RHCA 1V1JA 1F5SA 3IRUA 4TWIA 4DV3B 1XAHA 1XZDA 3L84A 4CQLA 1Z16A 4JLDA 2WTEA 4FMBB 1XEWX 3BQ9A 1GTG1 1I30A 4ENSA 4BPBA 2BEKA 3AJ8A 4X0EA 3O9MA 1A2BA 5TS2A 4CMKA 3FLBA 3K31A 2P3OA 3R4CA 5LBIA 2DPGA 2AHOA 2ZG6A 2BR4A 4YBRA 2GOYA 4Q7JB 2HF8A 2JLSA 3ZE9A 1N32B 2ZRKA 1JG2A 1RWQA 3R3ZA 4X1YB 3BWYA 4EVRA 1N2BA 4F38A 1YS7A 5ALJA 3AVUA 4TZKA 2QZPA 2E21A 1COZA 1ZH0A 5ES4B 4BNMA 3R7BA 4B32A 4Q3KA 4Y2PA 5JLAA 3P9RA 4B3SB 5IMBA 4LJRA 2CXXA 2QDXA 2W2TA 2B36A 3PGXA 4CG2A 5FUQA 4HXGA 2XZTA 3HDQA 4J0HA 1N2SA 2FSIA 2CNLA 3OLYA 4MRVA 2RAFA 1RC0A 1KMHA 3HY3A 3O7WA 4M88A 4MS1A 4YJ2B 5NULA 3TQIA 5JZVA 3OU6A 2JIZA 1KYVA 4J7UA 4GQIA 4HGZA 1K8YB 4ND1A 1Y1SA 1NVDA 2BF4A 5LQSA 4X7RA 1U0RA 4LN1A 4RMNA 2Q9AA 3CCFA 3CEAA 4H27A 1E9VA 4M7PA 1HTBA 3ABZA 4ZKDA 2ZTVA 5LA6A 1E2IA 2C00A 2GK7A 2VCHA 4KO3S 1BTOA 5EY5B 5BUQA 1FZTA 2HMAA 3K35A 1F0PA 2OBFA 3GRVA 3WSWA 5ICFA 4KSYA 4XIFA 4XGRA 2P41A 4UU1A 4L4UA 3GNQA 3U37A 1T0BA 1R5JA 3WNBA 4DJAA 4X97A 3SAJA 1Y3DE 4RX1A 4Y6GB 3ESDA 2W2KB 4U7JA 1ITZA 1EINA 3AI2A 3CLUC 1MIOB 1V3QE 2AI1A 5ENDA 3GZ4A 3K5PA 4MWOA 4Z9AA 5KHAA 1GQYA 5EJIA 5KQPA 5JBIA 2LE0A 2KBEA 1KYXA 1TLFA 3MUNA 4C6SA 3AEKB 5EJ8A 4UAGA 2AMLA 1YGPA 3W3ZB 2Q5OA 1T1SA 4K86A 4RMJA 4CCWA 2G72A 2CB9A 1FC0A 2P9YA 3E03A 3ESRA 4D9GA 2PKQO 1RXEA 5TMEA 3PUVA 1RYDA 3BIFA 4LE2A 3THYA 1NIJA 2DVMA 2M6RA 1OUMA 1KI1A 4OIMA 4GE3A 1Q6ZA 3K70B 4AZ3B 4UEOA 4D8VA 4UHJA 1PKEA 1T5BA 1DCFA 3B9RA 1VE5A 4JLWA 1V2HE 2I76A 3B70A 4HYQA 4P4GA 5DCYA 5ILQA 2TMGA 4OPMA 4FR2A 1X1EA 3FNHA 3KUUA 2Y77A 3RLFA 4AYXA 4D82A 2C98A 1HNNA 3WA7A 3FMOB 2CL5A 2H1FA 3CE9A 1VG8A 3SDZA 3DKKA 4QZVA 4YT8A 1ZL2A 5CP8A 3GLKA 3LUCA 3TAXA 4Z7NB 5L40A 4QUEA 3ZLBA 3EWIA 4F1KA 4PGMA 4BRZA 3LRTA 1QANA 1P0MA 1ZM3A 1W30A 3OMWA 4JBLA 4BS9A 1U1CA 3H4VA 3L4BC 4Q4DA 2Q5LA 1ZVJA 3MWYW 3BCSA 1K4YA 1UWVA 3LI2A 1ZIXA 1L5FA 3SZOA 3WB9A 3ZXXA 1GKIA 2V4MA 3KYBA 1NP7A 2G7ZA 2QJTA 2WHEA 4JL5A 4K26A 1GT6A 4R8LA 4UUBA 5ALGA 2XTAA 4ESEA 1RFGE 3JS5A 4R1NA 3MTIA 2MSEB 1WXGA 2RKOA 3MOIA 1E8DA 4JSYA 3ZLTA 4CKWB 1SC4A 3MS2A 4ROSA 4B3XA 3P9KA 2V96A 5A3SA 3ZZNA 4C4PA 4YDSA 2W71A 4IDBA 3S2FA 3Q4GA 5D5QA 3RBZA 3ZG6A 2I2AA 1M6EX 2I5PO 2WY2D 3G8CA 2AH5A 4Y2HA 3PHBE 3ZCTA 2D5IA 1I4EB 1PUXA 2X5OA 4NOJA 4ZVPA 2EIHA 3ZHQA 4PAQA 4B7XA 1KNXA 5KMGA 3BFJA 1N5JA 2GCOB 3WIDA 3VHXA 2XOKA 3AZOA 3SX0A 3N8KA 4NK4A 3JVVA 3RIHA 4QPDA 2ZYRA 1Q57A 4ENPA 4I19A 5EUCA 2B1GA 4Q9HA 4XOUA 5ER6A 3GFVA 1FXWA 2PX2A 3WMWA 1S01A 3O8OB 2ZBUA 1JKIA 5IVIA 1IHYA 2DUNA 4IYJA 2DWPA 1EA7A 1VKHA 3ESQA 4RS3A 4DC0A 3QX3A 2O7NA 5ED0A 4CMEC 1O03A 2VRBA 3MAAC 1V35A 1KWGA 1YJAA 2G9UA 1Z8NA 2CMFA 8ADHA 2YJ3A 4KR2A 1AV6A 3K05A 2X8AA 3ZKWA 2FPKA 3H1TA 4CMBA 3UHJA 3V46A 3EXHC 3ZW7A 5LZ2A 3QE4A 4Q4HA 2W6QA 3IBGA 4GBED 4Y1RA 3VZSA 3H84A 5KQSA 1Z4IA 1ZC3A 3O8DA 4D96A 1OWMA 1A7JA 1PIWA 4IIDA 4OHFA 1E5LA 5JZSA 1WETA 4PZ9A 2Z56A 3G0IA 3IAM1 1UJBA 4MUHA 4OI4A 5IP5A 4ZHQF 1G9SA 4L8FA 5IKPA 1Y6QA 1FQWA 1YZGA 2QZSA 1A9PA 1IVSA 2V45A 2J7PD 1UK7A 5DM4A 1E9RA 3SZ3A 3TDMA 4IVNA 4V2UA 2B5WA 4JI6B 3SKVA 4RV9A 4UTRA 2CXSA 1A1SA 3LY8A 1GGJA 5EWMB 3UMSA 4IS3A 3T4EA 4EQ6A 3LX8A 4RO0A 1QFYA 4DC1A 2ZBPA 3LCJA 1CQZA 1HNZB 3EG5A 3T95A 5DNCA 2OCGA 3W8EA 4YV1A 3L4JA 2ZRNA 2VDNB 3OD5A 4YRFA 1JXAA 4GMHA 3SXPA 1B23P 5JAUA 2ZCJA 1SVSA 4R4JA 1WCV1 4WADA 2GNOA 2F8TA 1QRAA 1AE1A 5KC9A 3F8TA 4R1PA 4UBIA 5B58T 1T35A 2Z6QA 2REXB 2H59A 5EXXA 2QPTA 3MG9A 5AVSA 2EBHX 2Q0QA 3DGEC 2HPHA 3LSTA 4HVCA 3KQLA 2CVHA 2JEYA 4UCXA 5DMXA 5IC5A 4HAVA 4QXPA 2XZPA 3ZHRA 4L51A 4JYZA 2PGJA 1ZGJA 2RHOA 2WI8A 3OZDA 4IX9A 4J0EA 1ZLYA 1QVRA 3BEOA 1I4LD 3K72B 5E9AA 4Z1MA 1JHYA 1FDWA 1U98A 1RVV1 1WUIS 2GCOA 2VC2B 3JQGA 1U9ZA 2ZS8A 3L05A 2VJDA 3N9IA 4MKFA 4HAOA 4DTIA 2F3TA 5CFMA 1SK8A 4FCWA 4NSNA 3MBKA 4DYHA 2J9GA 4H1WA 3R0XA 1Z6TA 5G53C 3WGUA 4K9PA 2FZGA 3DR3A 1E1DA 2GXSA 2CJWB 2VUTA 3WBFA 4FS3A 1N8TA 4HQKA 4OGLA 5FTMA 4BNNA 4D8YA 4XWOA 2PBLA 3FKSA 2AX4A 2C95A 1E0DA 1ZN9A 4FBLA 1KVTA 1KJJA 1NVBA 1M5TA 1NYLA 1UBTS 3MMNA 3P96A 5AOVA 1H66A 1DG1G 5AW4A 1QDUA 3LGXA 2I3BA 2OGUA 2P9EA 3PRHA 3O8QA 3QLJA 2FPGB 4R0VA 2EXXA 3PEFA 4L2IA 1V37A 1Z82A 4MKGA 1BWPA 2AR7A 2G83A 4MAFA 4A91A 4CDGA 4BU0A 4AG3A 3BORA 5IAOA 1BJRE 1SC3A 4RHYA 5H59A 4O6VA 5CDYA 3AUUA 1B73A 3UJ3X 1AM4D 2AV6A 3DEAA 2YL2A 1GNPA 1Q44A 5CT9A 4LDJA 1PVVA 2A0WA 4BTLA 4EHKA 5HNKA 4KV7A 1N25A 3PXAA 3CF2A 3BIXA 1O4VA 3D8HA 4P34A 4V0LA 4ER0A 1M1XB 3ETHA 3C24A 3WMRA 5HZGA 2FOXA 3LOQA 2ZZKA 1WS6A 4QGGA 1G20E 2HJ9A 2YRFA 3CPSA 1A69A 3L82B 5DWDA 4F11A 2HU2A 3AEQA 1QGOA 3OCCA 3C45A 3LRPA 3SPXA 1SOUA 1H6AA 3GLFE 3O21A 1E5XA 1PYDA 3NJ4A 3QVSA 3R40A 4KQKA 4RESA 4YJFA 2QLFA 4MWDA 2P1DA 2WF7A 1X0VA 1E3WA 1MN6A 5FAXA 2HNKA 4IWYA 3ROQA 1E2PA 4IKOA 1TA4A 1USUA 3UAXA 1EHIA 4BO8A 4M87A 2GZRA 2WJZB 2AA3A 4Z9XA 3U1TA 3HBJA 3Q1KA 4Y7DA 1UPCA 2IL1A 3H5NA 4IUCS 4ZCLA 4KOAA 4C0QC 4DCMA 2Q7XA 4TT3D 3GWGA 4AZTA 3OT1A 4QARA 1AS2A 1IEWA 5AW0A 3KJFA 4EENA 3PHJA 1R00A 1YDEA 2A1UA 4L74A 5ARDA 3GD7A 1IZ8A 1GAQA 3FZYA 1NGSA 4BU1A 5F78A 3NYIA 4LDRA 1YZUA 2P8SA 3QIVA 3L7CA 4X6LA 2JDID 2ZRQA 3CCCA 3DMTC 4O2LA 3KPUA 5JDCA 4B76A 4RZXA 3S1AA 3G2KA 3PDCA 3GFTA 4IF6A 1TW2A 2HI0A 2RHGB 4OJTA 4M1WA 1DARA 3VJRA 2O6HA 1QONA 2GDZA 3WR5A 4MCJA 4QBKA 3WB2A 3CKKA 1MAWA 4F6RA 4RY0A 2B92A 1E4OA 4AJ1A 2JHGA 4REMA 1GV0A 3SCZA 1J39A 4BV8A 1XL0A 3K7EA 2EKDA 4Z7OB 3ZWDA 4FT4A 4F96A 4PONA 2H1CA 5JT1A 3QKRA 4DXAA 3JQAA 3LIPA 4IKEA 4CMHA 2ODNA 4BJ3A 2OB2A 2PN1A 4FE7A 3EDOA 3PUXA 3Q98A 4IRUB 4R98A 1WY7A 1ZMBA 4US2R 5IAKA 3KOWA 3U39A 1D7OA 1F2VA 1M2OA 1H0SA 1NJSA 2CL7X 3EXFB 3KDAA 3PNSA 5LUBA 3TLBA 3WO0A 3ANLA 4PBRA 2ID8A 1PZEA 2IYYA 3WYGA 4LYEA 2UUCB 3QITA 1VL8A 3TL2A 5AK0A 3OM0A 1WUHS 2JFGA 4KW7A 3PA6A 5T4EA 1H8HA 3AXSA 4PC1A 1A27A 4LK3A 3ORSA 4DQ0A 5AD1A 3DFFA 1PSWA 3KEFA 4TSRA 3O0DA 1N1DA 5L3SB 4L6IA 4KV9A 4LXYA 3QTTA 2XXJA 3GN2A 5CVUA 3IR7A 5ICEA 3AL3A 5FBZA 3VKWA 1ZD4A 5FD8A 2Z5VA 1W36B 4P4LA 3FCOA 1QYWA 2OBMA 2WPDD 2C3YA 4A8HA 1M1ZA 4D3ZA 4E3ZA 3RTGA 3GLGE 4CKXA 1AURA 2XQFA 4LWZA 4ZI7F 1QG6A 1CERA 4KXUA 4QXRA 3T7RA 1TZKA 3DFZA 5ISMA 3U3OA 4KP7A 1FXSA 2J3IA 2PA3A 4DNXA 4BEJA 1HDZA 3IHTA 5J2UB 4HTAA 3IDAA 2OZPA 1CW2B 2QI9F 3ZLUA 2R6FA 5DRYA 1TKBA 2IHKA 4UHDA 5IM4F 1W4RA 3H1BA 4YP0A 2HHHB 4YC7A 3LKBA 5F3WB 3RUEA 1GA6A 1ZGHA 3LPDA 3W90A 3BK2A 5C18A 3JD3A 1UJMA 2Q5IA 3IB3A 1NMXA 4CF6A 4LC1A 1NBEA 2Y1EA 4WFIA 1A72A 1B14A 3NLLA 3KOOA 4GPTA 4YUVA 1ZVMA 4ZQCB 1TAGA 5AKZA 1ODFA 1TCBA 2Q2OA 2WD9A 4OY3A 5ESRA 3UK2A 1RLOA 2YHSA 4INOA 5LR6A 4OA8A 2Q4EA 1RQRA 3DDSA 4XR9A 3IQZA 2ZB3A 1C4OA 5FA5A 4YRLA 3FX2A 1Q95A 3DBRB 3NIBA 4EDHA 1T2VA 4F91B 1YS4A 4X20B 1Z35A 1VCNA 1B2LA 2JVJA 2VJQA 1FE8A 2HQOA 3ANSA 3ETDA 4J1NA 3RSFA 1KHHA 3SQDA 5KJCA 1K9VF 1YIDA 1TU4A 2B69A 4HKTA 4II3A 5BQPA 1WKCA 4CQMB 1P72A 3KT0A 4L4ZA 4QBGB 4TMWA 4XIYA 4QQRA 1P2FA 4LGMA 3A37A 1JU4A 1E4YA 1KE2A 1F2TB 4N0PA 3TIVA 3FB1A 4TL9A 3U3JA 4HB4A 2AK3A 4C1BA 2Y0EA 3W77A 3E18A 3G9ZA 4B6OA 2PZ8A 3P9IA 4X60A 4WUVA 2XUHA 5CB6A 1RIIA 3QPCA 1EIWA 3ZEAA 4RTPA 1X7WB 3WLIA 1V1RB 1LUAA 1U3TA 4QGHA 4G4GA 4XDGA 1ZNXA 4ACBA 4N5LA 4M9QA 3BOSA 3RYIB 3O4GA 4P0PB 3OHMA 5ALXA 3D5TA 5LDHA 3NKLA 4EGSA 1QCDA 2E82A 3IYLW 4EFLA 5EWJB 4TZ6A 1QX3A 5J1SB 1W1WA 4BKUA 1JLLA 1LTKA 2GUWA 3U4GA 2NU8B 5JSKA 2IUUA 3EF3A 2O4UX 2IIVA 4O4LA 1I51A 4ZT7A 1ZX1A 4ZWNA 1Z8HA 1BCRA 3UGKA 1Z0UA 4QPJC 1I6MA 2FK7A 2RHHA 4OQQA 1F0KA 5KHLB 2VDKB 2G1PA 5JATA 3C5WP 2FMHA 1MFZA 2XYQA 1J5XA 5H0IA 3IC5A 1ZXLA 4JUDX 5JQGB 4BVEA 2B8EA 5C4MA 2H54A 5EIBD 2CFSA 1TEZA 1R74A 4E13A 3H6GA 1J07A 3WIUA 2FFJA 3ACDA 4NQZA 3MMPA 3OF3A 4NQRA 4PO3X 3TW8A 2OWDA 2RBEA 3ZQJA 4EEXA 1E7YA 3K9GA 3I01A 3MF4A 4AYWA 4AAYA 1QFXA 1ZW6A 1COWD 3KQYA 2GZ2A 2VSQA 3BMCB 4JYPA 4JJFA 1C81A 1YI0A 1GARA 2C1ZA 3Q6IA 4MV9A 4OHUA 4IX1A 1VIVA 4TXNA 6CHYA 3K1ZA 2REBA 1CE8A 3W04A 4LNAA 4N54A 3V4RA 2YRXA 4L7VA 1NRJB 3NHBA 3NXKA 5A62A 2HT1A 3FBWA 3M6VA 1VYVA 2OC4A 3K0SA 3QMPA 1KEWA 1G8MA 3SHQA 1B6SA 1VGRA 4JX9A 4Z8YA 1IFXA 3UC5A 3NC0C 3T7TA 2XVYA 3QBEA 4G84A 3PGMA 1FK8A 4HCJA 4ZC8A 3I28A 3RSLA 4AWBA 4KFSA 1A7KA 4EELA 2ZSFA 4HQRA 4UHCA 5J4KA 3EOBI 3LT4A 5CK5A 4EATA 2PEYA 1TD1A 3OZSA 2EKZA 3NTVA 4EUHA 2BV3A 5BW4A 1K6IA 2BUCA 5E9QA 5H82A 3EMVA 1T5DX 4HQNA 4KI0A 4QRDA 4ILKA 5LFAA 3C6QA 3WDLA 4L4RA 1G7SA 2D2VA 1L5WA 2LCQA 5EN4A 1OYOA 5K8UA 3EG9A 5HJ5A 1EFRD 3F4LA 4RY9A 2CXNA 2QBYB 3U26A 1GPJA 2GM4A 5LNK1 2C9ZA 2HTFA 1XK6A 4R2IA 1T29A 2JAOA 3RVPA 3BFVA 2XE8A 2AFIB 1DKPA 3W8NA 4G5GA 3B5JA 1ZISA 2O52A 5KNDA 4EUFA 3DOJA 1E8MA 2Q99A 4WX2B 2G36A 2IU6A 4ENWA 3CFYA 1GUDA 3ICWA 5AVXA 4FCVA 3EF1A 3I2JA 5EXEA 1MVLA 2IHTA 4QOGA 4HAXA 5EIXA 1Z5VA 1UFOA 2WRZA 3NDPA 2FZ5A 3I8SA 3KZXA 4P7FA 5IC4A 2FN3A 4JUIA 2PZLA 3AUSA 4FFDA 1ZH2A 4JEHA 1N2XA 3KVYA 4N76A 3HWX1 1HTTA 2W11A 3ES9A 2A9FA 2OBYA 5B3KA 5CB4F 5CB8A 4FT2A 2LP4Y 3K2EA 3HYSA 1LEHA 5T8KA 3P0IA 3LX4A 2O2IA 1WDTA 2A58A 3WGJA 4A10A 1BGVA 4MHTA 3OBIA 3PNLA 1M6VA 2X0FA 2VA8A 2GYVA 1LS6A 1JSZA 4INPA 1NSFA 4CM9A 1BKSB 5DHAA 3OAAD 1PW7A 1XMPA 3TR5A 2B4KA 2W4QA 4TLBA 5CA0B 5LZ4A 3NG1A 2ZULA 4YS6A 3IP7A 1FUUA 2H1VA 3GFBA 5CA1B 3WIVA 2YN2A 2A9VA 1RYZA 2W98A 3OIUA 5F2EA 5ITWA 3V3TA 1QV7A 1AKTA 4E1AA 4IJKA 3F47A 2DUMA 2XOXA 2HDNB 3RARA 4M8IA 3HFRA 3VR6A 1KAGA 3IVXA 1O96A 4JT2A 1JEYA 5CH5A 4H6XA 1TPZA 5EQJB 1NHWA 5E7JA 1VJGA 2ZRHA 1P2SA 4IHJF 4IIHA 4PSVA 4BWGA 3FWYA 2JA2A 2BKUA 4B5KA 3HN6A 5LYYA 5JY1A 1I7NA 1CYDA 2PUCA 2AJ8A 1IB6A 2R48A 1MKYA 2Z98A 3HB7A 4K88A 4LJ9A 4S24A 1ZCFA 4A15A 3MTAA 3MJ4A 2LIPA 1WM1A 3CNEA 5A03A 4MUXA 3TFQA 3ONNA 4O2RA 3R3YA 1UWLA 3KJZA 4U39A 4HWPA 2FZLA 3DKVA 3RS2A 1VKJA 2VJBA 1C8KA 5FLEX 4JITA 3L6OO 3DR5A 2HK8A 4P38A 3GV0A 1UOOA 2UXBB 3OE1A 3HXTA 5EXDA 1Q1ZA 2PG3A 3NM5A 4A23A 4C2TA 4CQLB 4L50A 2PAFA 1LDMA 1LS1A 2M6LA 3UJPA 3HA7A 1U8AA 5SZHB 1TB4A 1G9XA 2NQ2C 4HEHA 3V1UA 3W2EA 3WL6A 4H4DA 5HZMA 1IRXA 2HEIA 2JK0A 1PR9A 4PIPA 2D1YA 3LUDA 3E9YA 3PWTA 4DLTA 2JH3A 1U7DA 3CXRA 3GELA 1UWCA 3UF0A 1AUQA 4KLCA 3I9JA 2EWWA 3IQHX 4BFLA 3V7YA 1BC5A 2C77A 2YX1A 4IIEA 4FQ7A 2GILA 5L3QA 4NY1A 1R8XA 1Y4UA 4WVLA 4WL0A 1LDBA 3ZJ5A 2J5XA 3PQDA 4UM8B 1J1ZA 2KS6A 3WQQA 2BJVA 2JGRA 2NOAA 4BEWA 4J0IA 4YEDA 1RZRD 5LB2A 3OUUA 3QNWA 4GEKA 2PMEA 1JN0A 2B4QA 4GZ6A 2CWWA 4N3BA 4B9EA 1SBNE 2J3MA 2NQ8A 3H2ZA 3INGA 4IIYA 5A02A 1XLUA 2BFAA 2ZYHA 3FMPB 4RY8A 2GETA 3DLCA 2H2WA 3KVRA 4I8XA 2BM1A 4ETIA 5AVWA 5CURA 2QROA 1O3YA 4BKMA 2Y1KA 1YJ5A 2IXEA 3TLXA 1AQNA 4AZ0B 3TYXA 1HRKA 3H05A 4W99A 5EXSA 4WXMA 4W1RA 4ZEOA 1L4GA 2B9VA 2EFYA 4YJ2F 3WWYA 4MINA 2RE8A 2IS4A 4Q0MA 3UCXA 5A1JA 2PBFA 3WRVA 4COKA 4QM7A 1QJCA 3U9LA 1EUQA 2Q9BA 2QW1A 3GAZA 3H0KA 4XGIA 4DPLA 2X2OA 3L4SO 4EOGA 2J45A 1XZGA 2DCMA 4TV9A 1M2NA 4WGGA 3SHFA 2PS1A 3OZCA 1Y3AA 3H11A 1AZTA 3WTCA 1WX1A 3ZOKA 4M6WA 4EH1A 3WB1A 5I7VA 3A05A 3RLIA 1J1UA 4M53A 1FLAA 3G17A 3G2NA 1ZJJA 3KVOA 3DQPA 3HJGA 1X8JA 2C88A 2W6ID 3ZBPA 2ZYVX 5KKNB 3PT9A 5DO9A 3LMKA 4CW7A 2PMFA 3Q5DA 1U0GA 2C5EA 3KKMA 1GKUB 2HT6A 1P1JA 1PEKE 2WJ3A 2Z5LA 3OETA 1K7FB 2IYXA 2R8RA 4DIFA 3O7MA 4JUCA 4Z7JA 3EVAA 3CUTA 3G8YA 1JKFA 4BFTA 4R81A 1NBME 1VDMA 2BKLA 2I6QA 1DAEA 1VG0B 2PV0A 4BBZA 2P2YA 2J5KA 3JYHA 2LR0A 4HRVA 1TCCA 4XYEA 1AU9A 2I1VB 1MGPA 3OFKA 2EJBA 4K9RA 4RZ2A 2VS1A 1ZU4A 3MN1A 4OKSA 1VRCA 3SEQA 4PYLA 4PLHA 1KMHB 3CZMA 3T15A 2TMDA 4YXWA 3ZIAD 2W6CX 2Q2WA 2WSSD 3IELA 3P0HA 1LX6A 1ZRHA 3B6EA 2EP7A 3Q41A 4DA7A 4C43A 3QFCA 4EYKA 2VTBB 2WW8A 2Y1DA 3HNRA 2NZXA 2Q1SA 3CIFA 3CLHA 5B6IA 2OYRA 2CNWD 1FFHA 3HPRA 3IP8A 4E46A 3U44B 2PVCA 4JYAB 1V7ZA 1QXSA 4LPSA 3MYRA 4YALA 5C32A 4F5ZA 3TSZA 3SI7A 1CHDA 3IEMA 2IYTA 1YNOA 5AI6A 5DTMA 2UYGA 5M34A 4ZCRA 1VLLA 2P8JA 4OAPA 3L8HA 4F5WA 4B31A 4NFSA 3JVUA 1P9OA 4B6FA 3TNLA 4ENRA 4RDIA 1M67A 1PG0A 4UDNA 1SQ0A 3MYYA 2HZBA 1P4SA 1RMTA 2AYYA 5EHXA 3ZGVA 1XP8A 3P2KA 2AN9A 3NDBB 4DN6A 4F6LA 2QTAA 2DY0A 1NFFA 3KYJB 3ZBUA 3ZUGA 1LB1B 2E4UA 4DEYA 2FKAA 3QE2A 3S1AB 2H0AA 3HN7A 4GRAA 3UV3A 2QRGA 2X6QA 1RKUA 2A9JA 2CFCA 3MBOA 2QM3A 3RS3A 2DPHA 4N7RA 3TW6A 4ZJPA 1I7PA 4FYMA 3GJQA 4LTMA 1RS0A 3NHPA 1Z47A 3ET5A 3K0AA 1VHTA 4AMGA 2Z5GA 2EC5A 4O59O 4V2IA 1CR1A 4OGGA 1U6IA 4B6SA 1U8TA 5FQOA 4HDMA 4D4JA 4M9CA 1QP8A 3IDSA 4HWSA 4BVJA 2ZTMA 4LCBA 2BFEA 3HI6A 2JFBA 3PJFA 4UMFA 1E9SA 2VBCA 3TEJA 3WWEA 1RYYA 2BE9A 1T8YA 4L08A 4EGQA 1DJQA 4BHTA 4MS3B 2A94A 2FP3A 4QNMA 2OZKA 4OP3A 4D4HA 3DYBA 3NT2A 3N76A 2JJYA 1EFPB 3DXXA 1QKKA 3PRKE 4NJEA 2JKVA 4ONEA 4MIKA 3ZVLA 2I4LA 4QPNA 3U7IA 1J0XO 2FFAA 2VP5A 4ZEWA 2O8EA 4LJ7A 3D8RA 2JVKA 3W9UA 4B43A 3VU9A 5DXJA 1NUHA 2JI6A 5ALMA 2PDAA 3L1VA 3K53A 5DLPA 4Z0PA 3JZAA 4J3FA 1HORA 4G09A 2QRLA 1H1LB 1GPLA 2QEQA 1KR2A 3B9BA 4IHQA 4DRXB 5C8DA 2FWIA 3LLVA 4J7XA 2Q5QA 3P4UA 4BO4A 1ODSA 3FOZA 2PMCA 4ED9A 1JF8A 5KINB 1VKNA 1SVNA 3KS9A 1DWPA 4YCJA 2JKYA 3F7OA 4B47A 4D3FA 4YV0A 4D1YA 1IN6A 3NRCA 3W5BA 4YP1A 4DJTA 3T9AA 2QAGB 3DOUA 3PXDA 3TLAA 5JNUA 2CBXA 4D0LB 4FCCA 2YVLA 2QL7A 1R7RA 2XVXA 3DZJA 1VBFA 2QMHA 1A3CA 4KBFA 3U4CA 1P9LA 4EJSA 3KB8A 2M6KA 5ICCA 4QREA 4Y6SA 1KNQA 2GN2A 2YIJA 1SPBS 1KO4A 1JEDA 4KRGA 1YFZA 4PVDA 4I4IA 3VU8A 6REQA 1U1IA 2BMFA 3I0MA 2GKOA 1RHRA 1A8UA 3MJVA 1PFUA 2JAHA 4LKOA 1IATA 3FWKA 1GG9A 3FNRA 1NNUA 3H1GA 2EKBA 2C2GA 3O8NA 1TUIA 3T1NA 2AUTA 4AVYA 2PXAA 2PUEA 3UWKA 2PUGA 3IKMB 2PHZA 2DPMA 4MXDA 5L3ZA 4R8MA 1Z2EA 4DJ5X 1CUHA 1PT7A 2PUHA 4D79A 4AMYA 4E22A 3PF8A