1XMPA

Crystal structure of pure (ba0288) from bacillus anthracis at 1.8 resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
KSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQMPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoribosylaminoimidazole carboxylase
publication title Crystal structure of PurE (BA0288) from Bacillus anthracis at 1.8 A resolution
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase
total genus 53
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1xmpA00
2FW1A 4B4KA 1XMPA 3LP6A 5CVTA 1U11A 2NSHA 2NSJA 4GRDA 5CTJA 2YWXA 3RGGA 5CLGA 1QCZA 4ZMBA 2ATEA 4JA0A 4ZK2A 4ZJYA 5C5DA 5CLFA 5BORA 1D7AA 2FWIA 4Z7JA 4ZC8A 4YCJA 2FW9A 5BOSB 1O4VA 2H31A 3RG8A 3KUUA 3OPQA 5CLIA 5CLHA 4AY3A 3OOWA 2FW6A 4AY4A 2FW7A 2FW8A 5BOSA 2FWJA 2FWBA 4YCBA 5CLJA 4YCCA 3TRHA 4YCDA 2FWAA 2FWPA 3ORSA 2NSLA
chains in the Genus database with same CATH superfamily
4S2EA 1J2EA 2C2HA 3Q85A 1F12A 3A9VA 3A6LA 5DNEA 1PT5A 4PBSA 4DDUA 2GF9A 1T2NA 5DSZA 2CDBA 3M4NA 5FP0A 1KBQA 5JCJA 2I2XB 3LFUA 4KQXA 3IKJA 1IPFA 1GUYA 3FYHA 5D51S 4Z7OB 5JWOA 1Z16A 2X2OA 4FNMA 2JCGA 2WZDA 3UG7A 5KX5B 2WHYA 2QIPA 2V6IA 3WNCA 3GRFA 2JFZA 4HI0E 3V7UA 4J0DA 4I3HA 2PWYA 2NSDA 2C94A 1JEQB 4J0IA 4HYEA 5K6RA 1NULA 3GH3A 3WYCA 5JQWA 4I1IA 3FSRA 5LWQA 4L8FA 2PKRA 4EMSA 4BNUA 2XRFA 4BU0A 2OZLA 4YMSA 3IEXA 1JFTA 1E9VA 3WRXC 1YVUA 1N2HA 1Q7RA 2EW8A 3DZ8A 3H1TA 4LSZA 4MIEA 4Q34A 2G07A 3KZVA 4I5IA 5A1JA 5J40A 3UGKA 1U0EA 2ZKLA 4RV9A 4ITVA 4DLKA 1VA5A 3HTXA 3D8HA 4N48A 3LX4A 4GOLD 2VJOA 2ZT5A 5ALZA 3P9XA 4Q4LA 3UQZA 2ATVA 3HEBA 3ZTWA 4HNTA 5CVDA 4ZHQF 1IQPA 4FKMA 1Q92A 5EMKA 4Q93A 2YHBA 3UK6A 3IBGA 4MW4A 2BGIA 2EJUA 4BGUA 4HDOB 3OOSA 1HURA 4IXNA 1YD7A 3HXPA 4NKRA 3SC3A 1MW9X 1QO0A 3ITEA 4RJLA 4BKUA 2ERXA 3C39A 3JQGA 4V0LA 2WZBA 4XCQA 2HRQA 1M6VA 3BCSA 1JBQA 5TQ0B 2DOKA 1UDXA 1S0UA 2R7MA 1X3SA 4JJEA 4OP1A 1ZL0A 4Q48A 4F9TA 1VPWA 3IMKA 3NHPA 4LMBA 4PYLA 3W6NA 1BQ4A 2CFIA 2D54A 3VTFA 4AJ4A 1JAIA 1E9DA 2K6GA 4J0QA 3TTUA 1JLHA 5L6MB 4KO4S 1F4LA 4ZU3A 4WV3A 1PLJA 3B36A 5CLJA 4DMKA 2XBMA 4D79A 1YJCA 2GF2A 4IMIB 3U39A 5I7RA 2AOVA 4NPHA 1B2RA 1JEOA 2J0UA 2Z1MA 1IN1A 5EKXA 5A5FA 2BDUA 1Z2PX 4LZNA 2IDMA 2JDID 2O1SA 3ENZA 4RKYA 4AZTA 5BSWA 2WR8A 2ZJOA 4YJFA 1EB8A 3TQRA 2OCGA 1P4HA 3C3AA 4PYOA 3ZTTA 4BEBA 3L4JA 1E6KA 4Z2AA 3HKBA 2IWRA 3ICWA 2BYTA 5E7JA 3AVUA 2AUMA 2OGWA 5M5BA 5JG7A 3WGMA 1JGTA 4OFXA 3GLTA 5CA1F 2BR3A 3WWEA 3R7WA 3FYUB 5JD6A 3C8ZA 1OVGA 3T7IA 3DVAB 2XRMA 3L2OB 2EFGA 4YAIA 1FYXA 4NFYA 4YDSA 5IT5A 4GS5A 5CP8A 3SJ7A 3GJTA 2PS9A 2QMYA 3L5KA 1CUUA 2JIPA 5CYFA 2OCBA 3I52A 2I91A 3GLFA 6AT1A 4HSEA 1RW4A 2WMYA 2L69A 2CNBA 2XUDA 1VGQA 2FN4A 2R1UA 3BTOA 3EPPA 4K6FA 4M99A 4TV9A 1RLMA 4MJLA 3HB0A 2BR5A 2GGSA 4J90A 1ZGHA 1MTZA 1JHAA 4TQAA 3GLFE 2Q5IA 2JFHA 2W71A 2KI5A 1FQOA 1UJ6A 1XJ5A 1FF9A 1Z17A 2HF8A 2OBXA 4I1SA 3U56A 3V1NA 4I4TF 3FVRA 2FZ5A 1TQ6A 4KQ1A 3Q9LA 2FPSA 2FW7A 3TKLA 3EBOA 3E22A 4UU0A 1P9RA 4BQRA 2IUSA 4DHEA 1XRNA 4UHHA 3QKSA 4CVNA 4RXTA 1PWYE 3TB6A 2IXAA 5CG1A 2VF2A 5FUMA 3WMFA 2NNWB 3F5QA 2HJSA 3LAWA 4GSYA 2VP3A 5BRJA 4C4ZA 4DPLA 5E0OA 4CI0B 4CUZA 2WWFA 2ZBEA 3R7FA 4GPZA 3AR7A 5JLAA 1RQXA 2X4GA 1LF5A 1XTTA 3GEEA 1ENOA 2HBQA 3IRVA 5F64A 2HW8A 1D2AA 2HY7A 4TV8A 4TVKA 5GOZA 2KLHA 3IRUA 3AI7A 4LJYA 3NW9A 4WXPA 1CUCA 2JFNA 3OLQA 1B76A 4LDAA 3H5NA 2H5JA 4JZKA 2XTZA 1FUIA 4FEEA 4MMZB 3TLAA 1XD9A 5ALFA 2IZ6A 2WHRA 1NG9A 1GADO 1IQ0A 4IDFA 4KO3S 4B76A 3FSJX 1VG0B 3TLJA 2JFYA 1ZLYA 4OUDB 1R37A 2H1CA 2FMHA 5G0TA 5DLYA 5IN5A 5AIAA 2VP6A 2VLIA 3EMVA 2CFRA 4GZ3A 1R0ZA 3EWSA 2XI4A 4Q7LA 3PP8A 4QOHA 3PL5A 4N3BA 4WLOA 3TIGA 3KSUA 1DRKA 1WCYA 3GFVA 3WB2A 3I72A 3MT0A 2OKCA 4O1HA 3OTIA 4RX1A 1EJ0A 1R27A 1DOHA 1G17A 4O3FA 2LDXA 3PV0A 4LBVA 3RG8A 2BUBA 1QG2A 3QVVA 1X7DA 2VFAA 3CUYA 3I23A 3KEOA 3D6FA 3NTRA 16PKA 3OCCA 3FGZA 1GHTA 2FQXA 5LP6B 4HRXA 1Z6QA 2Z08A 3FPBA 3UATA 1G8AA 2H0AA 3ZW9A 3SAJA 3NBKA 4M1EA 4UBJA 1RYFA 3ZD9A 2V5UA 3CEPB 4AJJA 3DYVA 4Q18A 5FIUA 5JAZA 1V8OA 2PS1A 3KXKA 3BE6A 1FLVA 3SYTA 1MBZA 2YZMA 4O2BB 5CG2A 1N34B 4LF8B 5FBHA 2FSUA 5C5DA 1DDGA 5FUVA 2OHJA 1DKMA 1L1EA 1UBGA 1CY4A 1QC5A 3Q40A 1JJBA 4TMZA 3RLFA 2UZ1B 4E5SA 1P5JA 4EVRA 5A4FS 3QV2A 3VA7A 5KVSA 1HDEA 1NP6A 5LUBA 3WISA 4BKPA 2D2FA 4EENA 4G9EA 1REQB 3AHEA 4B0OA 3WGIA 1PNVA 5T4FA 2FN7A 4ZCTA 3GH1A 4MLDA 4FYJA 5KQMA 5HP4A 3K0EA 1SCBA 5G0VA 3E1SA 1V2HE 3A6PC 2G1KA 1IYZA 5ALGA 3I58A 3RAGA 1KFCB 4CHGA 4PG8A 3NBUA 3E4CA 4H7IA 2PEZA 2VUIB 2DMRA 2E3JA 5T67A 4B9AA 3M8KA 1X77A 3C8MA 2AJBA 4LXHA 3BFKA 5CVEA 2OVFA 2QL5A 3NH9A 2XXJA 4JP1A 4R54A 2IOQA 4RH0A 4GGMX 1WB4A 1VIVA 1M75A 5TJHA 2H00A 2GZMA 4AECA 3O4VA 5JSFA 1QCCA 3M1IA 2G70A 2V7UA 1XZKA 2Z1DA 3P20A 4G6ZA 1XZQA 3L8ZA 4ONEA 4LK3A 1WCXA 2PX3A 4I9NA 4PSUA 4Z5XA 5HKBA 3I39X 2PXCA 4X1YA 4OHOA 4YP9A 1PQYA 1VYTA 2N75A 2RHJA 3E2IA 1AO0A 1JV2B 1AF4A 1MEJA 2QROA 1MGPA 1PT8A 1NYRA 5C1IA 4RPIA 5HRCA 1L5SA 3HCEA 5CDFA 3NWEA 1RAFA 1YZTA 3RC9A 3UWSA 1NQXA 5IDVA 2IUUA 4UOQA 1I51A 1TZMA 3SJCA 4U2EA 1Z82A 3A2MA 4JYCA 3L5OA 5SZJA 3VAZA 5ALPA 2XVAA 3ZV3A 5CDFE 3BHIA 5C31A 2O1WA 3HCBA 4NZZA 1EMDA 3H87A 4KPYA 5DTJA 1A8SA 4DIFA 1OLUB 1QV9A 1HOXA 2B98A 4EYQA 1ZCZA 4DR2B 3QOYA 4TWBA 5MGNA 1JXOA 1LFDB 1W25A 2P79A 1BHSA 1JIUA 1GILA 3L06A 3MILA 3QVSA 4Q9IA 4B3XA 4EZIA 4YBZA 5JAHA 5T7BA 3L4BA 2OV8A 3KCNA 2YOGA 4HPWA 1PEYA 4R8MA 3AL3A 3M4ZA 5J2TF 4C6TA 1W36D 4Q9JA 5LBUA 3FOZA 4QGAA 1TEXA 1JDNA 2XTJA 5B12A 4DOMA 3JQ8B 2DH6A 2JH9A 5SZHB 2XT9A 2RGCA 5JT1A 3T3MB 3EC1A 4KGVA 1XA3A 2WK1A 4CMBA 1TEZA 2Q45A 3ZU6A 4BP9A 3TPZA 3ICQB 2CFTA 2ZITA 2XB6A 3GVXA 1K27A 1L5ZA 1UBUS 2YJGA 2ODNA 3HO8A 4EG7A 2VXBA 4XE5A 3NHWA 3BA6A 4MA5A 5LC1A 2WUFA 4PR0A 5TMEA 5ALQA 1L4KA 3AVYA 3BEOA 4EGCB 1XDGA 4YRAA 1DC8A 3ET5A 3OZUA 4F93B 2C7PA 1KC3A 1TJYA 4LY0A 3F9RA 4ZV9A 3WRVA 2RC6A 3WC4A 2UVQA 1W2WB 1I7PA 1XAHA 3KOWA 1ZFNA 4MRNA 4XEUA 2FGJA 1T6YA 5SICE 4HR7A 1WB9A 4A7PA 1YFLA 1K08A 3KBBA 4AMGA 3BCRA 3Q6MA 1WO8A 3T8YA 1WS6A 2HWWA 3JQEA 1XLUA 2PJZA 2HJGA 4ZTZB 5MN4A 2Q1WA 2R62A 2VDWB 2PX2A 1P7YA 2R8BA 1D1SA 3IAEA 2J3HA 4OVKA 3T9EA 1YR3A 3DL7A 3VSAA 1X87A 2GPYA 2BMJA 2SBTA 2B92A 2HRZA 4MYDA 1N2IA 2IIVA 1N2CA 3OM0A 4KXUA 1UM9A 5K1ZA 2AXEA 3O1HB 3E7PA 3CF4G 4Q0MA 2OEPA 4B3TB 1DXOA 1CJVC 3BX1A 4HTFB 4DWVA 1HT3A 2ENUA 2J3DA 3NNDA 1JYSA 1NPYA 1N5MA 3UCFA 1N2CE 4KDRA 3DR5A 1COZA 2CV2A 1X1QA 1CIVA 4YC7A 4BS9A 2Y1LA 3AEKA 4X8OA 1LC0A 2PNJA 2Z6QA 2UXCB 1KVRA 1ORVA 3CF2A 4DEVA 2P8JA 2OYRA 4CKEA 4S1VA 2XBUA 1AZLA 1ZIOA 5BW5A 3NFRA 4QOEA 2C54A 5ECGC 1R16A 3ZWWA 4TWJA 4E2WA 3R2JA 2AR9A 2NWQA 2XMBA 2P62A 5CVTA 1Q1GA 3LKVA 4FINA 4XM0A 4JWTA 2OQVA 3RC2A 1YQ9A 2PZ8A 5B4UA 1FTWA 4EITA 3NDPA 1XG5A 2EOAA 4KACA 4P98A 3AWIA 4TZ6A 1W8DA 1X92A 3QHPA 4U7FA 1NF3A 2WJYA 2JS7A 2Z8YA 5CMLA 5JV5A 4N54A 3H86A 2P41A 3EDMA 5TGZA 3QXXA 1H6BA 3BD8A 4FQ7A 3WLNA 3O8NA 3MD9A 1HT2E 3GOQA 1IXSB 1E1MA 3QPBA 3KHSA 4LRSB 1BXGA 3WAGA 1CNFA 3KSRA 1SOAA 4JLAA 5K8JB 3E8SA 2DVMA 4MVJF 2HWKA 1TW3A 2BEJA 2NU8A 4EUNA 1L7OA 1CY2A 1J42A 4FYHA 4TN1A 2B94A 2C92A 4WXMA 4EKEA 1JG7A 1RVDA 1YF3A 3KG2A 3QA9A 4LG1A 1ZH0A 3DBLB 3H5AA 3VOAA 5T41A 1JX6A 3QLTA 4L6AA 4N41A 4HBZA 1MAWA 3LBFA 3O1JC 4Q3CA 1GQQA 2I67A 4KX3A 4CEJA 2BFDB 1E3LA 1D4OA 2NZYA 3KLPX 3MJFA 4RHUA 3V7NA 2H4HA 5L45A 2C9MA 2ZM6B 3N5CA 1BDHA 5K3FB 1M0SA 4Q3LA 1MQSA 3F96A 1VIMA 5KEIA 2GZ3A 4ZI3A 4E09A 2OWEA 1DJNA 1U3CA 5UKDA 5AI9A 3NJ8A 3STYA 3ZV6A 3HCWA 5CH3A 4C7JA 1K97A 2FPGB 3L6RA 3KAPA 2J08A 4EB8A 4ZT6A 1DKNA 4IIJF 1N2EA 4FCVA 1DGQA 3ISTA 2FPIB 1ESCA 2MJLA 1WIWA 3H4IA 1T26A 1DLIA 3U19A 3CHYA 1XTUA 3O92A 2ILTA 1O97C 3H84A 4QBTA 2QMQA 4CUKA 4QT0A 5SYMA 3W2TA 5JLJA 1RIFA 4UATA 1VJ5A 1C0LA 1P33A 4RULA 5LMUB 2IUYA 5ITWA 3ND6A 3U0BA 3D3NA 3IPRA 3RS8A 4KLCA 5ITVA 1RC1A 2O3JA 4FFBA 2WJZB 4BATA 5I8PA 1XCBA 2NO9A 3NAQA 3QFFA 4BLUA 4F9FA 4R9RA 3M70A 2QM8A 5KTMA 2FPKA 1SUCA 1T2FA 1V1RA 2YN0A 1B23P 5K2OA 3WJAA 1FDIA 4PIMA 3UAGA 2ZSEA 2H11A 1LTQA 1SRRA 3CNHA 2VHWA 1L4GA 4WFQA 2EQAA 3ROQA 4NP6A 2P4EA 2ZE7A 5CIYA 3IEMA 2PO5A 2WKQA 1GVHA 4YXFA 1QGED 2XCOA 3QUCA 4Z7QB 3A26A 4MIKA 2YVAA 2BN4A 4YMWA 2ZRKA 1TU3A 1T9GR 1S7CA 2BKEA 2DWCA 2J46A 3DCIA 3H16A 1V2GA 4O2AF 3GJSA 1W0JD 1OOEA 2V55B 4IEIA 4PZAA 2GEJA 5HFJA 5HKKD 2VSXA 4RHFA 5JARA 1XRJA 3KD2A 1MAHA 2REBA 3UMSA 1LA2A 3BBLA 4UREA 4L4SA 3HJTA 1T5BA 2DQSA 2G1JA 5GM1A 3SVTA 4NPCA 4QPZA 5LNK1 2P9EA 4IYRA 1HA3A 1ADJA 4S3MA 1M0EA 4FONA 1KY2A 1QTNA 2XNSA 4YUXA 2EKDA 1KK3A 5A4AA 4LF9B 4O8CA 4C7KA 2DZDA 1ZNWA 3MUFA 4MW2A 3OMLA 1SBTA 4ZPXA 2IS1A 1ND6A 4UASA 1DCTA 2C42A 1JZTA 1RKBA 2CLDX 4KOEC 9ABPA 4EHIA 4O02B 4LBZA 1J07A 5J4KA 2ZUFA 1U28C 3Q8WA 4MW0A 1P74A 3UFBA 3OWXA 4YMHA 1AC5A 3ZDYB 5AW8A 3H2ZA 3KHKA 3T35A 4EB3A 1KOJA 1YRBA 2BW0A 1HF3A 5IWCA 1QR2A 1ZI8A 2LR0A 2VYQA 1KZGB 5FA5A 3JVUA 1P73A 2Q6OA 4Z4IA 3RCBA 4F97A 5CVCA 2AV6A 1DPFA 1NW6A 4H7DA 4KIWA 3FKQA 3D0QA 4BNVA 2RARA 4F0JA 2XUGA 4JX9A 1QDUA 3T7RA 4JROA 1Z12A 5D84A 4UQOA 1B1AA 2PRZA 4KQKA 4MV1A 2OCIA 2ZVDA 5GAJA 3GLIB 4RJTA 2YICA 1Z2AA 1BMQA 4OGFA 3BZWA 1E2LA 3B13B 1TPZA 3KELA 3A11A 1KAHA 4Y2RA 5BN3A 5KO2A 2WJHA 2C1EA 2R6R1 4BRZA 2P6UA 2RHBA 4OGGA 2EDAA 3KJFA 5HUJA 2NO7A 3HC7A 4OREX 2YN2A 1GN8A 1YJQA 4KBYA 3L04A 1SMKA 2YIDA 4P33A 1TT5B 1R12A 4YIKA 5BV7A 5FTLA 5AKLA 4MYRA 4D2IA 3ZR4B 3FI9A 4FN4A 1E5QA 3IQZA 4OHPA 5DBGA 4FFSA 2GCOB 2I4MA 3E0XA 3WLSA 2IOHA 4JGIA 2FOLA 3DMTA 4R2LA 1NRJB 3HB7A 4GR5A 1GQ2A 1KPHA 3O4IA 1F7UA 3LUCA 4RF4A 3DP7A 3HACA 3H5VA 4BEVA 3G2IA 2YCLA 4WADA 2TYSB 5AOAA 5AKHA 1EFKA 2VDNB 4L5IA 3TCXB 3U7JA 1MV8A 1E0AA 1U2TA 2H7CA 2HNBA 2V9CA 4LIPD 2OCYC 2O48X 4RVSA 3P97A 3TDMA 4LGCA 1GXSB 2R86A 4MI6A 3QXHA 1I1NA 3VX3A 1AVTA 1QDEA 3DOJA 5DXAA 4PPYA 4RZHA 2GK3A 1UODA 5GONB 3THOA 1J06A 1SA0B 3JZFA 4ZO8A 5AJHA 3QRWA 4C5BA 4XTCS 3ZVNA 4BVBA 4Q4HB 3P32A 4UFOA 4KKXB 3U1TA 5MF6A 1SQ0A 3EUEA 1ZEMA 3A7DA 3D6HA 5CPBA 4G4GA 1HFWA 1NMZA 3LHDA 2Z6UA 2F1RA 5IG2A 2ALJA 2BWJA 5IKOA 4V1CI 2X1HA 1CUXA 3L0IB 3LC2O 2VPTA 5DASA 4WESB 2XNDA 5GJWC 1JDUA 3SYKA 1F48A 2GPWA 3NVDA 1YBVA 4JI5B 1J33A 4CTKA 5ICSA 2PUVA 5JR3A 4D97A 2QLMA 2YV5A 3VAYA 3K2IA 1I0IA 4UBMA 4R1OA 3VC1A 4ERNA 5JTUA 2H1VA 3GLHA 4HO1X 4HNQA 4U7GA 4RE5A 3IBFA 2VJQA 1U9JA 1WVGA 2I6FA 1K8XB 3E2PA 3PS9A 3IHWA 4MKHA 1OPXA 2CB0A 5DZSA 5JFTA 1FMCA 2R5WA 4HNUA 3B3AA 4FIZA 1P5FA 1CDEA 3GLHE 1XEFA 1H5QA 4J4BA 5IEBA 5KVVA 1AKYA 2Q5EA 5AQEA 3V34A 1UP7A 3Q10A 2QRMA 1XYGA 2WU3A 5JZ9A 1QJ4A 1NW4A 2CBZA 4YQZA 1MXHA 1PYOA 2WJ4A 4CXMA 3O2SB 4G09A 3P4UA 4RIGA 4ZVPA 4ARAA 4CKBB 3ADCA 4HWTA 5GPBA 1H5UA 2X77A 3UB3A 2JCVA 3F8TA 1K3TA 4MCAA 4PGGA 3BXHA 3P9IA 4QGFA 1EUCA 1ZC4A 4O4LA 4YCLA 4ZV4A 3HA3A 3VV2A 4EKGA 5BVGB 1E59A 1TX4B 4JYZA 4LY6A 1U0NA 2J0QA 1G8SA 1N2OA 3A3OA 3CVJA 3JWIA 3TRJA 1KYQA 4EUHA 5JANA 5J58A 3FNFA 1RWWA 3N2GB 4CT0A 2YOHA 4FEYA 1YZYA 4RCVA 4LZWA 5D5HA 1PWXA 4EEZA 4DMRA 1XZHA 2YJ4A 1YUMA 1DIHA 2A0FA 1SZCA 4MQ4A 2AG1A 2PMKA 4BE4A 4ESEA 1ATIA 3QFHA 4QULA 4PAQA 1DQYA 1Z6GA 4JI8B 4XDHA 3PXEA 1B4DA 1PJAA 4TLAA 4XQCA 3RR2A 1DAPA 4EY5A 3QSYA 1AJEA 2ZYAA 3O8QA 1Z74A 3IP8A 3EXHA 4LZAA 5NULA 1GGMA 3OQIB 4B74A 2AR0A 3QF4B 4YTEA 1PE0A 1W4ZA 1A95A 3L7OA 4ZQFA 5EZ5A 3DMPA 3UK0A 3RLIA 4TTAA 2Q1SA 4YAFA 5F7JA 5DBIA 5LQAA 1NVTA 1YVPA 3BD9A 1CRLA 1ZMBA 3U9TA 3NOQA 2RGXA 5ESDA 3EXFB 3KC2A 4C0KA 1E0DA 3WK6A 1T6BY 3AI2A 1ISHA 1I7NA 1ZWKA 2CLFB 2R6JA 2YS7A 1ZVQA 4DQKA 3UICA 3ZYZA 2AC2A 2XMPA 3BCHA 1T9ZA 3OCWA 2M2IA 5HM6A 2XZTA 4Q9HA 1JIVA 4F4HA 4YRBA 5B3LA 4X66B 2HUNA 1NWHA 3JWPA 3KXDA 3KP1A 3MRTA 1C3OA 4FCTA 4EG5A 1G21B 1NG1A 2P0YA 3O8DA 2CDRA 4UCFA 5K8TA 2KSQA 1U99A 3LCVB 1IXYA 2J30A 3Q12A 1WEHA 4L02A 5HMMA 3AIOA 3RAFC 5L3ZA 3IAXA 4QAJA 3ZLJA 3ISJA 3U3JA 2AWNA 2NSJA 2RI1A 2YMPA 5CPFA 4CKWA 2XB2A 2ISSD 3GYGA 1RQ2A 1TE2A 2X1MA 4NG4A 3IR5A 4NYIQ 1MB2A 2R1VB 2VF5X 3RTEA 2CLEB 1GR1A 1OTYA 3AOEC 1L7EA 2JB9A 1T4BA 1MA3A 2IYRA 3BJRA 1HDZA 4IINA 2ACEA 3DL2A 5JXHA 2GAAA 3F9IA 5JUWA 4E5NA 4F4CA 5FNVF 5JNRA 4HQ0A 4I50F 4RA6B 5F4BA 1F2DA 1ESDA 1L3BA 4A6PA 1SZDA 1NOIA 1DEAA 2QUJA 3CPHA 4NBUA 4YCCA 3KEQA 2JJ2A 3OH8A 1A1VA 4J43A 1DARA 4QWWA 2YVUA 3OKAA 4RYLA 3QMPA 2XWJI 4C3ZA 1LPBB 3AHGA 3NWOA 2P40A 2P69A 2GPBA 3KO8A 4Z1MA 4J2OA 4NMMA 1T1GA 2BR4A 1NRXA 1RBYA 1QCZA 4ZDKA 1NI4B 1RRVA 4MCHA 1H0SA 1P1KA 4HVTA 5EMJA 3N58A 2E4YA 5E8JA 3KQHA 2DPHA 1V1MA 2FWIA 4D1YA 1WB5A 2FRDA 2PR7A 1N5JA 2ZE6A 4DSOA 4EATA 4EK9A 2ET6A 3ZZ1A 4GHWA 4B2YA 4F6RB 3PVSA 2TMKA 1L1RA 1UPAA 3ENQA 2AMFA 3ENWA 3H6HA 1DFHA 4IS3A 1E2DA 3W6PA 2BKVA 2WKSA 3DF9A 3BSFA 4K9MA 3URKA 3CCCA 3JYPA 2V9PA 3NC1C 4K6CA 1ENPA 3FFWA 5TY0A 3V00A 1Z6YA 4EKNB 3LVRE 2J7KA 3C3KA 3HN6A 2P2SA 3ZCUA 5DCUA 3K1JA 2Q6KA 3KJQA 5HF9A 4CWAA 2P0AA 1VRCA 1UBEA 1YZVA 2DT5A 2HC9A 2WG1A 4UEOA 5CLQA 4MUKA 3D6NB 1UC4B 2B82A 3K73O 4PN7A 4FWTA 3JRWA 4IHJA 4OF4A 1QVVA 3FIUA 3G0CA 3D2AA 3JQBC 5JROA 3VYTB 5EUQB 1ZGBA 3WAJA 4KN5A 1JR6A 1WLYA 3GOHA 1FP4A 1RTTA 3B9RA 4XM2A 2VA9A 5C3UA 2IYVA 2QAJA 4UEWA 3ZHOA 4RK5A 1WB6A 2Y4OA 3V4RA 3D4LA 3OOWA 1I2BA 1R9GA 2B8NA 3BD7A 1E3MA 2C59A 2WDPA 1GV1A 4D4JA 4H18A 3FWHA 4LJ8A 3EPRA 5CNJA 4ZK6A 2PMCA 4U7JA 1C29B 1GU7A 2AHRA 1CR6A 1MCZA 5EHQA 4K1XA 2PJUA 2BGUA 3PXXA 4LZLA 5ISMA 1VJRA 2BEKA 4REQA 2BDEA 5EMNA 2OCAA 4TTJA 3X1YA 5IM4A 2NVOA 4JU9A 2Q50A 3AVOA 2ACWA 4XIIA 3H18A 1QHIA 1W2GA 1NPTO 5LYJB 2GTPA 4NENA 1T9AA 2PMWB 2Q4TA 4ER3A 5AHRA 4B4VA 4JIMA 2NOAA 5J4VA 2ZYIA 4EG8A 4L9RA 1QNLA 1ZH2A 4ICIA 4URUR 3KZ1E 5HBGA 3U7HB 2CLOB 2C8LA 3AKEA 3OX4A 4H4DA 1C7JA 1JJFA 3C5VA 1I3OA 4LCJA 2VA8A 3K0HA 3QFRA 3F67A 1R9NA 1U2SA 1GAXA 1RVV1 1H42A 3LHIA 1B0AA 2MT9A 3CRVA 1JHVA 3CLKA 4QXQA 4XLZA 3A6HA 3MJEA 4WOPA 3FTEA 1E3TA 4JKIA 1ESZA 1S2IA 2JJ2D 5DHPA 5BURA 4WCVA 5DN6A 5A9SB 5ER6A 4GSKA 2WPDD 2Q1YA 2N47A 3KHTA 1RXCA 2VAVA 1X7XB 2GM4A 2YQ4A 1HTBA 4ITUA 3JARB 4TKMA 1M7HA 4GC9A 2WSSA 3OPQA 4JLKA 1M8JA 1FC0A 5ERYA 1MU0A 2AG0A 4J2TA 4WCFA 3LT5A 2TSYB 1XMIA 3QEJA 4M8KA 4F6CA 2QLNA 1NU6A 4P4SB 3VDRA 4KVZA 2LDBA 5K09A 3KEFA 1XTVA 3R3JA 4KAJA 2BEWB 2Y76A 4EFLA 5JYDA 2DPYA 3DTVB 4GEGA 4PHCA 3ZEIA 4ZFNA 1HNXB 1BA3A 5LLDA 1KEWA 4JLDA 1KP9A 4RK7A 1YO6A 2DUJA 3UANA 2A0KA 1TO1E 4YJKA 1AQNA 1IBKB 2HJRA 3MBOA 5E6UB 3S27A 1OX6A 4B5LA 1XMSA 3DL0A 3QKUA 3QVMA 1YZUA 2W6QA 4UKDA 5FA6A 4FKBA 3GGSA 1CUHA 1C0IA 3M1LA 4MWBA 4IILA 4ZRMA 3UVEA 9LDTA 5IT0A 1NW9B 1JPVA 2C82A 2W2MA 3KUXA 2GN9A 2ZFUA 5CXUA 2EZ8A 1ZMOA 3GXBA 4HXEB 1L5HA 1J0DA 3RFTA 1I1OA 1HNNA 2CL5A 2G88A 2QAGC 3I4FA 1WD5A 2WWGA 4L5JA 4KWEA 4E2FA 1E8MA 5TC4A 1UK9A 3HB9A 3JQAB 4CV1A 2NO4A 4RENA 3DBIA 4YACA 4UM5A 2FW1A 2P0EA 4TUYB 4W63A 4WIAA 5CXSA 3TN7A 1JVSA 3VPDA 3TFOA 2ZUEA 3DTNA 4D98A 3CKKA 4D4LA 2JGFA 2XCUA 4ZMBA 3ZY2A 1CZUA 1P9LA 3CIFA 1W75A 3IDSA 1WCIB 2C3MA 4CFSA 4K86A 4DN6A 1D2EA 5FUXA 1H4QA 5DM2A 2NGRA 3TE6A 1YFKA 1ZUIA 4JC5A 1GPH1 4Y67A 2DFKB 2OC9A 2IX9A 4R1NA 3OOEA 2OCKA 2VHQA 4H6PA 3C3XA 4MQ6A 3QVOA 5G0UA 4MRSA 2QX6A 1GRCA 4J6FA 3ESXA 2PO7A 3J80A 1ZPDA 2EP8A 2VNJA 2QJTA 2HREA 1HXHA 5EJFA 3AVXA 3NX4A 2H1RA 5LA6F 1RWMA 4LWOA 1Y42X 3IQIX 1UBCA 4B8YA 1EGAA 3IUYA 1WP4A 2AG5A 5IH7A 3HO1A 1XFAA 3TJZA 3KV3O 1E5XA 1EK6A 4QUGA 3TS1A 3HDHA 4H6XA 3R5KA 4KE8A 1K89A 1K75A 4XRRA 3H6KA 5LZ9A 5F51A 2XLCA 4M7RA 1C0PA 1FJHA 1SK8A 4F38A 1S96A 2YY7A 3RG2A 2XYPA 4XR4A 4MLCA 3GJ3A 1CRWG 2ODPA 4RK0A 1OBVA 3UTCA 3WGTA 2Z6AA 2PX0A 3KSZO 3PENA 1LK7A 3C70A 1H1LA 4Q9DA 3DOFA 5FRDA 2VXOA 2LZ0A 3I2KA 1QGDA 4TKUB 1HEYA 3DONA 3P9RA 3PQ5A 3JZAA 1ZJZA 3MWKA 3MTAA 1WVMA 3GRZA 4BX3A 1ZRHA 3MOSA 5LNK6 2EKBA 1E3DA 4PQFA 3W78A 2WAAA 1CBUA 4LVCA 3NLLA 3I5YA 3I62A 1KWGA 2AQHA 4BJ5A 2A3NA 1O9HA 3B3JA 5CLGA 2ZIAA 4EH1A 4LFAB 4ID3A 2F00A 4HV4A 3EFBA 2HCRA 2Y27A 4NDNE 3IVMA 4IOKA 3MJHA 1PR6A 3EAFA 3RYTC 4K9DA 2NUAB 4B3IA 1C3VA 3DHYA 1U8ZA 3S5JA 4DUGA 2XKKA 2J5KA 1KIAA 1OROA 4CLRA 1A2BA 1GIAA 4OSEA 1BD3A 2Q2NA 1ZD2P 2V7BA 4CM8B 4OEHA 3RUCA 5CNMA 1XZPA 2P2DA 3FUVA 3QBEA 4OQDA 1RJ9A 4M1TA 1QRAA 2QTTA 5L4LA 3OPMA 5AW7A 3OP1A 5F12A 2EJTA 2C5AA 3DT6A 5TPZA 3K6SA 4NF2A 1SK9A 1Y7IA 3UZUA 2HM7A 2IDZA 3BWXA 4RD4A 4MR8B 1B93A 2OSBA 3IPYA 4G3XA 4LNAA 4OFZA 1A2QA 3K35A 1JEJA 5A05A 3VC2A 3WDLA 2HHLA 5I4CA 2GBLA 4JBXA 2P2NA 1X1DA 3D8UA 5E4YA 1OH6A 4MR7B 2B7CA 2VSQA 2ICAA 5EYPA 1E2PA 4N5MA 1S2NA 1B16A 1BXRA 4DCVA 5JH7F 3WLTA 2N1BA 2QTGA 4H1UA 1M2EA 1ULSA 4K81B 1I5OA 4EGQA 5CX4A 3TBHA 1UKZA 3VR6A 2QM3A 2NU6A 3PJGA 3VPCA 1ZWLA 3PJEA 1CTQA 3N8GA 5LKAA 4OH1A 3ETDA 4YNBA 4JT9A 5BQPA 4D4MA 2O9JA 4KMMA 5I51A 1WQ4A 1G3UA 1E79A 3TIXB 1DRWA 1BX0A 2EL7A 3QJGA 4I1PA 4ZQHA 2VHEA 1LZKA 4GBED 2DHDA 2GEVA 5PGMA 3JSAA 4UTRA 1CUIA 3AGQA 1Y6RA 1U8FO 1ODKA 3A9RA 3FUCA 3U80A 1GDHA 3AVQA 4HFMA 1NLMA 4RABA 2ZE8A 3C3JA 4GQIA 3GLUA 9MHTA 1W73A 3CZQA 2N3ZA 4BMSA 4Q3EA 3UPUA 4HWSA 2O8BA 1M66A 3H75A 4I7EA 1ZL2A 4I6JA 1FDTA 3NXSA 4IUCS 1RM4A 4UUOA 4DMUB 1GPWB 2AZ4A 3P5SA 4GLLA 4M1SA 3VKFA 1J7KA 5KX5A 5D7NA 2X4IA 3GQBB 2XUAA 3KZXA 4K6MA 5DYWA 1R4MB 2AYZA 4R7TA 1JEQA 4WFIA 5JPCA 4YYEA 1CC1S 2RKWA 3M49A 4ZCSA 5DO9A 4DG8A 1SWVA 5CFOA 1G3IA 4YRRA 4GKBA 3KKKA 2F3QA 2V65A 4GSLA 4QXPA 5IS2A 4LSMA 4AQYB 2R7LA 4HP8A 3UA4A 4ZVQA 3KVVA 3GJZA 4IVQA 1UMKA 1EFTA 3CNNA 2YMQA 3M9WA 2XCSB 3VKHA 4OMCA 4CF6A 2I34A 3FOBA 3AP3A 4MUJA 2VNKA 3FFAA 4XUCA 2VKTA 4D0SA 3HU2A 2AH5A 4YLGA 4DAEA 4BFSA 2W48A 1P5HA 4ZQEA 4GAEA 4ZD6A 2X0FA 1EH5A 4AS2A 4F3TA 2I8AA 1TF5A 3GMTA 4BE9A 3IP3A 3RSLA 4EEXA 3QNUA 4Y6PA 2KM1A 4M0EA 4URXR 1Y3DE 1P17A 1ISJA 2DKFA 2R11A 5AHWA 5TPZD 4ZOEA 2CHFA 4LC1A 4YLYA 3A2NA 2Q0HA 3RQSA 4YT8A 4WN9B 3R5HA 4YECA 5EKUA 2C7OA 1GA4A 1V7CA 1W35A 1ISPA 2G36A 2ZVQX 4JJIA 1BGXT 3VPBA 5BP7A 5REQB 3LKBA 1SKAA 1O2DA 4B81A 2COEA 2J0EA 1ZHHA 3QNMA 3AC0A 2A9JA 4LPKA 5EXXA 2JLVA 4UM9D 1PZXA 1RACA 2CF6A 4K2AA 4M60A 1GA6A 4F04A 1YBAA 3BWCA 1I4TD 3RSHA 1FOEB 2W6ZA 4MP3A 5FYQA 5HTKA 4BIMA 4AIRA 2NN3C 2PBFA 5AOCA 3A9WA 4RY8A 4YR7A 4W4TA 3UAVA 3EF0A 3GJ5A 2BE9A 2RGRA 3ZGZA 1YI1A 3O75A 2ARKA 4P9NA 3WMXA 4Y6RA 1ZO8A 3WIBA 1JHPA 1LSUA 1E2JA 2IHZA 3H65A 1R88A 3CEJA 3KVNA 3Q5GA 4NEGA 4D9NA 1E79D 1JEEA 2O3UA 3ZY5A 5LZ2A 3ZQKA 2B3TA 1YUBA 3JWJA 4MKRA 4TV9F 2NPOA 1C7FA 3FDZB 3QVKA 4W5WA 4XJTA 4QHYA 4CMEC 1BA2A 3EC7A 5FEUA 2JIZA 4MARA 3S40A 3C7KA 1CLUA 5J2UB 5BOSA 1X2BA 3NEAA 2A0UA 1D03A 2ODAA 1OFHA 1RXWA 4D82A 3L77A 3FYUA 4A0HA 2R2AA 1KYWA 1JR4A 3AERB 4UMDA 2QPTA 2YZ7A 3ILSA 3KPYA 5CFRA 4F86A 5SV2A 4INJA 1XA0A 2HUPA 3LT0A 3P9NA 1DBVO 2GVDC 3PQ7A 1R4AA 1TM4E 7AT1A 4KB5A 2PSEA 3HVUA 5H70A 2HA3A 3EIFA 4O6VA 2R0QC 2OCPA 3U17A 1WULS 2HYIC 2X42A 4N76A 3MRSA 4EIWA 1C50A 4W5HA 2QS9A 5FPHA 3QE3A 2G5PA 1IY8A 1RHMA 4NCNA 1Z4QA 2DAPA 3NBXX 2ZG6A 2YJ3A 4ZKDA 3E9MA 3K5HA 4TV8F 4K6KA 5F4ZA 4MW6A 1P7CA 3WY9A 4DADA 5IAOA 3QE9Y 4PM4A 1RP7A 3HB1A 4ALJA 3RUPA 3LYUA 3TVTA 3X2SA 4KFUA 4DUPA 3WNDA 5KSWB 2IOFK 4DDMA 1VP9A 4XX0B 5EERA 5FUBA 1DZIA 2D8MA 1XZLA 4MUIA 4C0JA 1Z37A 2IITA 3T4UA 3X2EA 3E53A 1KERA 5BSVA 1XELA 4WRRA 1G7CA 2W5UA 3T3EA 1Q1BA 4C3OB 2UZ3A 2WV7A 3EGXB 4F1JA 3BMOB 2J59A 2LV8A 3NEYA 1RZ3A 2GYVA 2VRBA 3TNLA 3BQNB 3UUEA 3OZAA 5E95A 3MW8A 4KAAA 1T3GA 4K1LA 3UJAA 3C3CA 1UC9A 2ZS9A 3LTEA 4MUAA 2RBKA 3VFDA 4CKYA 4UMVA 1TMYA 2PD3A 2HBYA 1N3IA 1GFIA 4GBJA 4W82A 3IE1A 2I7DA 1IVNA 2BL4A 3PUXA 3WFZA 2B2XA 4JSYA 5K6AA 1A72A 1U5BB 2GX6A 1NN3A 2AGVA 4PZUA 1AOXA 2F1IA 5DVZA 2A3RA 4DV4B 2FPRA 4BB5A 1OWPA 1M2VB 2O2IA 2FJUA 4L50A 3TIIA 3ZH9B 3N0VA 1UKEA 3CBGA 2CHUA 1CCWA 2QVYX 1ZD1A 2R68A 4H6WA 1L9XA 4LGMA 2QN2A 1J8VA 4XSVA 2PMBA 2JFWA 3DZDA 2CXUA 2J48A 4OUDA 5AKKA 4ASUD 5AVYA 3ZD8A 2OP1A 3VHQA 3L7DA 4BO3A 2YIMA 2R00A 2W2PA 3RE1A 5KYKA 2JA2A 3RJ5A 2JFPA 2I3DA 4BMOB 3B9BA 5B58T 4CV3A 2O3RA 2PUEA 1KI1A 3NO4A 1QOZA 2LTAA 1BMDA 3H2YA 5H68A 1QHHB 1Z83A 1GR0A 4E12A 4DNOA 1TXGA 3PC7A 5LP6A 1YB4A 1XEXB 3RFCA 5A9RA 3OZEA 3PR3A 3QY0A 1EBBA 2BPOA 3F6CA 4YBRA 1T9GS 1Z0ZA 1L9KA 2B37A 2FE4A 2I87A 3PVZA 4ILKA 4R2WA 5L6LB 4L0QA 2VDPB 3IP7A 2MDTA 4S1PA 3D4OA 4FFRA 1GDDA 4MW5A 2CY0A 4IIYA 4INAA 3WGKA 4A6DA 3ZZTA 4BAGA 4BNTA 5BOVA 1W49A 4EPVA 2EG5A 1VL8A 2GF0A 3HP1A 3QHAA 4O2BA 1VB5A 2V6GA 5EJ7A 1OW3B 3EIEA 4D46A 3F5FA 4QDJA 4GL2A 1RQPA 4HWOA 4QUHA 2UZ1A 1FNBA 5KTNA 4ERXA 3DEYX 1PR2A 1IEQA 3B1WA 5JIBA 1W581 1YI8A 4H1HA 4XUDA 3QFCA 1RZRA 5TQJA 4BFZA 1FVXA 4Y8VA 4FN5A 1UXHA 4UDXX 4Y2JA 1DBPA 3T1HB 3UXHA 3ZDFA 4DUYB 3K8OE 1KZ7B 5ALVA 4AC9A 2FK8A 5E3JA 1WPXA 3AXTA 7ADHA 1LK0A 1OKKD 3EYWA 3CUWA 4PRZA 4JVMA 4HAUA 1F2UB 1Z29A 2ZVJA 3KX2A 4IDNA 5A4IS 721PA 4O4IB 1EP2B 1JDBB 3BM5A 3NM5A 4H17A 2RHLA 4UAGA 5CIWA 4B2IA 4C2AA 3DMRA 4R41A 3NBQA 1SKUA 2JIRA 4PCLA 4U9IS 1V8BA 1J7JA 2AF4C 3N7TA 1K66A 3PC8C 4QDXA 4QJ5A 4F3KA 3R9XA 2XUPA 3TXAA 3B89A 5TT1A 3TTVA 3E48A 2QZJA 1O95A 1W88B 3UAOA 1WZ2A 3LCCA 3RJTA 4F96A 2OHGA 1U98A 4A0FA 2WJAA 4MQEB 4OMUA 3C7DB 4R9SA 1QBKC 1AUVA 4OO3A 4Y1RB 1QFJA 4L7VA 2I2WA 3CVYA 3V1MA 3ZCQA 1FYVA 3C3PA 1KH1A 4LJRA 3NP9A 4J16C 3PNMA 1EE9A 2J4FA 4B82A 3EPLA 1TKRA 2PS0A 3DDNA 2H2DA 1OLUA 4JHLA 4LHXA 3HN7A 4JCCA 2ZGVA 1G3RA 4CN9A 2WE8A 1II0A 3K8QA 5FO1A 5JAQA 2QDKA 4Q1EA 4OU5A 3U61B 3GCDA 4KI7A 3BRSA 5SYAA 4TROA 3A1NA 1SHTX 2DFVA 1SUAA 1TF7A 1XPUA 5EP3A 3JQ8A 5IULC 4MPTA 3AY6A 2V96A 2IXTA 2YYSA 1QG6A 1D5WA 1QLJA 3W6UA 4I1RA 3O3CA 1R5OA 2ZI5A 1ATZA 1F5SA 1XL0A 4RU1A 4NYJR 2QXUA 3AO0B 2VTBB 4YJGB 2W58A 3KWMA 2QR5A 3AM5A 1L4FA 3EJ6A 5JSYA 2H5IA 4TLLB 4E5DA 3CLTC 4ON9A 5C1OA 1G98A 3H5WA 2I4IA 1R9JA 4K9SA 3V7YA 5G3YA 5K3SA 4DABA 4MITA 4DG5A 2OBLA 1BHQ1 3RK1A 1QRTA 3UH1A 1JT2A 3JR3A 2CV1A 1H66A 3IT1A 3GN2A 3MVEA 1PFUA 4NABA 4UFNA 3VPGA 4CR7A 2FW0A 3NWJA 5K3DA 4YQYA 4L85A 1SCNE 1Z68A 5C81A 1W52X 4ZZ3A 1RE0A 2QU8A 3H2GA 3D2CA 2EP7A 3VR0A 3O8CA 4AI6A 1IXRC 3FMVA 1Y6ZA 2QMZA 1YDGA 1YKSA 3OLZA 1A69A 2ZRQA 3IDOA 1Q77A 4MVJG 4PIVA 2FXVA 1TCBA 2GUGA 5FADA 5J23A 2X6QA 3KD3A 2RK4A 1WV0A 5FJJA 2XY4A 2VDWA 1DAEA 1QAOA 1UM8A 3ETGA 4FUQA 4N5HX 2I3AA 1LDBA 1OWMA 1R4ZA 1SULA 2PT5A 3ESQA 3Q11A 2P1DA 2FFQA 3CH5A 1NF9A 5BVHB 2FQ1A 1G4AE 3IPAA 2CBXA 3D4NA 1UXJA 3IBYA 4NG5A 4GG1A 3TRFA 3BKXA 1S3FA 5IVPA 5LB2A 3ZIAA 4R1UA 4RQAA 3IERA 4HTFA 3L0YA 1Z5NA 4DWJA 1CDZA 4R1MA 1O94D 1DZ3A 4V38A 3HN2A 5IMSA 4EO9A 1WLSA 2IPMA 1IIRA 1CRPA 3FHLA 4WEQA 2CNWA 1J8QA 5KQRA 2ABWA 4FYMA 4UDNA 4CYMA 3TSZA 5JALA 4CQLB 1JFVA 2C99A 3CLSD 5EHGA 1JS1X 1O95D 2H4JA 2ZUWA 4P92A 2PV0A 3N07A 1XWFA 5GZ6A 4JXKA 1GD1O 1H2BA 2V6JA 3DE0X 1KNXA 3VR3A 5IBCA 4XKJA 1H8HA 2RKBA 4ZO7A 5D87A 4JP2A 2NZWA 4QARA 4S1TA 4Q9NA 4ETNA 1NKSA 2V7QD 5DYNA 3ASUA 2QZSA 4ND5A 3D7KA 1IL0A 3ZNOA 3W05A 1Z0KA 4D02A 3HZZA 1QIKA 1W5FA 2V58A 5B4TA 3IIJA 5H5JA 5K3OA 1T2VA 3G17A 4HEQA 2VATA 5AI6A 3ZJYA 5B30A 2B34A 2YTZA 4DIDA 4GP7A 2DY1A 2QRLA 4LJKA 5K8CA 2RSLA 3NHSA 1JE1A 3L43A 3CSUA 4GYJA 1QX3A 4XWWA 3BREA 1DV1A 1TD1A 2NXWA 1BHJA 4QYWA 3C3EA 3G5MA 3T3HA 4ZEWA 2O52A 5A6VA 2Q3EA 2BY4A 5C18A 4YJ2B 3WA7A 1TK2A 4BLRA 1VPVA 3DBLA 2D5BA 3ESCA 3L0BA 521PA 1FXUA 3DS8A 4FWIB 3ZE0B 1XO1A 1UANA 1A7UA 2VWPA 3AILA 4MVJH 1B00A 3DEHA 3TQOA 4TLEA 1Z88A 2BFDA 3AEXA 2QSYA 1PW5A 3ZNQA 2ACKA 2QMHA 3EG9B 1IPHA 3RU2A 3ZDBA 5K3FA 3COSA 1SZPA 1FSFA 1UJ4A 3UMFA 4ZAZA 2WLSA 1LX7A 4OA5A 3CR7A 4HX9A 1O6GA 2C4TA 4PQEA 1UK8A 2FPGA 2W0SA 1FUEA 3IEVA 3HH8A 4GIBA 2O57A 1HNZB 1CZLA 1Y33E 2CCGA 2EAUA 2FPIA 1N6LA 4YX9A 2NW6A 2WY2D 3PB3A 4M55A 1DRJA 4EOGA 2G4VA 5BUCA 1DDIA 1KO4A 1OSNA 3GAMA 2C2GA 1MORA 2F8LA 4JL5A 1TYZA 4EWLA 2XQFA 3M83A 4WAUA 1Z2EA 2IEBA 4CF3A 2PL3A 2D1RA 1GM5A 1U4NA 2GVNA 3WLJA 2JK1A 2XUZA 1ONPA 3PR1A 4C5AA 5F2NA 1JHXA 1CIJA 5TEVA 1Y5RA 1VL5A 4IIHA 2O0HA 1P2SA 2ZUBA 4U8GA 5FJIA 3VRHA 5A5VA 5EHZA 5FOWA 1DBIA 1K7YA 4FMCB 4TRRA 3DE4X 5T5QA 3ZIAD 2XV1A 4TPKA 3E1KA 3S44A 3SSOA 1D8AA 3JU3A 3OBBA 4FMDB 4J0EA 3IUNA 3RSZA 3W0LB 3W5JA 1X70A 5KNCD 1C7EA 3EGDB 4H2DA 3SZGA 3C24A 3PJFA 1U1EA 3AX6A 2ZJ6A 2QM0A 4NZOA 1AQJA 3REFA 3L0OA 3EXEB 2ZRGA 3RBZA 2AEEA 1WM1A 3GVHA 1AUOA 1ZISA 3TXYA 1TQ8A 1QQ5A 4WOJA 2BGGA 1U2QA 3HCDA 1G6Q1 1OAOC 4D5EA 1Y6GA 2BFCB 5E1DA 2PRJA 1XKXA 2FPLA 3AUFA 2XUQA 3BFPA 1LQUA 1M10A 1Q12A 1ZOIA 1AE1A 3IE2A 3MWDB 2UVPB 3F4KA 2AVNA 2P78A 3PWKA 5C0OE 3ZBQA 3FNGA 4ZT7A 4RMJA 2YNMD 1WF3A 4XVRA 2QD2A 4FOOA 1YJ8A 3GUZA 3EZ9A 1CDOA 1C1XB 1EVEA 5EZSA 3GBPA 2YFKA 3W1VA 1Y6QA 3DPUA 2IU4A 3GD7A 3IILA 3G0IA 1KJ9A 4ALMA 1QWSA 5CT5A 2G08A 5K3EA 2EFJA 1EVQA 3PYLA 5DW3A 4L73A 4RC9A 3TVYA 3MC1A 3BIOA 4I9HA 2E7ZA 3GPCA 4FR2A 2Z9DA 1NVXQ 2AHOA 3N1UA 3N3AC 2XMDA 1XCPA 1XRLA 1LNSA 2FJ0A 2Z83A 5IJXA 1PGNA 3KKLA 1STOA 4KXVA 2WF5A 1B0ZA 3I09A 3ZHBA 1QGYA 5CYPA 1KI7A 2JEZA 3NZEA 4J7AA 1MP0A 1E7QA 2RK6A 4QLAA 1QO9A 1HT0A 3TUJC 1OA1A 1B0UA 4G0NA 1GQRA 1Z3CA 5BYJA 2PLAA 5FTNA 1UINA 3KYBA 1T8UA 1YRYE 2WFAA 1ABBA 4EW3A 4G97A 1DEXA 1ZRSA 2B30A 4LNUB 5B2EA 4IX1A 3O3NB 3B1JA 1SUPA 4B80A 1A3CA 2AI3A 4CIAA 2QT0A 4HDMB 1QP7A 1JQLB 3K0AB 1YH3A 1PR5A 1HC7A 1Z5GA 2FFJA 4J94A 5ARDA 2XXAA 3GLIA 1MT3A 4W99A 1Q95A 2BTQB 3LZ6A 2ZDHA 2XYGA 3M4JA 2IY9A 4N6NA 4O25A 2EDCA 2SKEA 1UKVY 4V0NA 1E4YA 1V45E 2ZYWX 4LV6A 4LV5B 1S89A 3I2GA 4FFDA 2PRYA 4N3CA 4OYLA 1U2GA 3L6OO 2HI0A 3GLIE 2PA3A 4CR8A 4G26A 4NFHA 3GROA 4IJ6A 3T95A 4GW3A 3KVRA 2Z5FA 5FCDA 1NASA 1KOFA 3MRXA 4QNMA 5C37A 4IBOA 3KHUA 5I7AA 5IJ0B 2H2AA 1TT5A 3VC7A 2JLWA 1Q6ZA 2NTVA 4MWCA 4EHAA 1VJGA 1L4LA 2IYYA 3ZQJA 4ARSA 3PVCA 4FCCA 2GCOA 1Q1ZA 2IKSA 1BFDA 3WIEA 4N18A 1T0PA 2ANCA 2AN3A 3UNXA 3PYMA 1Z4IA 2GT1A 4J7UA 4KAFA 1MZPA 1EE2A 1ISFA 4RHEA 4I5FA 3RT1A 5L53A 3OU2A 1ACMA 4LRUA 2E4ZA 2QQFA 3MWJA 1Y34E 3IJ5A 2QZPA 4FDMA 4MX8A 3R5TA 4UMFA 5LJIA 3KFXA 5A02A 1C8LA 3ZV4A 2PYDA 4UFPA 1HSOA 4Z3DA 1NVBA 4JBLA 1GXSA 1YR6A 3INYA 3HEAA 1G6HA 3LY8A 2NV0A 1OFUA 1NXOA 4WZBB 5BNZA 2ZWVA 1Y89A 1YTUA 2ZEJA 2Z6VA 2XD9A 5GONA 1GRNA 4N9WA 5K8UA 5L3QB 3ZCRA 1SA0A 4HN4B 1RHKA 2WYVA 1HE4A 2JCYA 4Q4HA 5EE9A 4R51A 3QKRB 1OILA 1SCKA 4NULA 4RETA 1O77A 5CW1A 5FFMA 1V3UA 4PN3A 1KEKA 2XE4A 2A8YA 3PDJA 5KSOA 2PE5A 1GG5A 1UT6A 5KSZA 3HSKA 1P2UA 2JVJA 1SOWA 2GBCA 5DMHA 2QOEA 3FVWA 5IP5A 2GCEA 1X8XA 3F4BA 3CVXA 3FHTA 3FPJA 2JLXA 2QP3A 4LVNA 2XWBF 1TIPA 3NHMA 1YCDA 3BWEA 3TSCA 4CLHA 4Z51A 5B7GA 1VSVA 1Y6FA 1P29A 1S3SA 1L5VA 5HFAA 3SEQA 4CL2A 4UUBA 4RM3A 4UEQA 2HIGA 2I71A 3WLFA 2QIOA 4O4LF 5EIAA 3EGWA 1U2DA 4AMYA 5L3VA 3QBDA 4NLLA 2OENG 2OM6A 2A0XA 2GFIA 2JL1A 3OZFA 4IJVA 4DBLE 3F0TA 4B87A 5A1TA 1UJMA 1SXJC 1QIHA 2A57A 1I2DA 1U2PA 4TVOA 1JLRA 1LSJA 1Y7TA 4CKBA 3FUUA 3TCKA 3L8FA 4AXBA 4ZEVA 3T9DA 4AZ0B 4NDZA 3SJUA 1UPXA 1AV7A 4WJZA 3VBEA 3SNKA 4CG1A 1FFEA 3H8VA 3BJIC 1G9TA 1JVNA 4PSVA 1T1RA 2HJWA 2PKCA 2PVPA 4KIGA 5CB4B 4RMGA 1KQOA 1TCVA 2HJHA 3UCEA 1EUZA 3DBOB 4FDAA 3QOXA 1KF0A 5BVGA 1JLLB 4M1KA 4M76B 3QENA 5DYTA 2V1UA 2I5PO 4M37A 1ZCJA 3RC1A 3VZSA 4OKIA 3KVYA 2QPAA 5LDDC 3LLVA 4ZJPA 4Y98A 3N2GA 1GCOA 1F38A 2FN9A 3REGA 1FPMA 2A67A 2VH5R 3RM3A 1QU2A 3FCAA 3AETB 5I3ZA 3SE0A 3P8ZA 1TF2A 2WA1A 2P4SA 5E7IA 1MB9A 5DNVA 1SB8A 2V6MA 1Z62A 1X3LA 2P3OA 2Q3FA 4L3OA 4P4LA 1TT7A 1RR6A 4LUCA 1TKBA 4TS1A 2D5IA 2X86A 4DSUA 3FVTA 3LQ4A 3OQIA 3QF4A 4Y0VA 2PT7A 1JTFA 1IJEA 2HBRA 1NPDA 3HGMA 3QP9A 5FTKA 3OFNA 3OCJA 3VPXA 4F72A 5H8WA 4FU0A 3QLUA 3NT4A 1G7RA 3A0RB 3FM9A 4P35A 2EFCB 3NT5A 3PUHA 1ZBDA 2A5FA 3W77A 3KQWA 4IFTA 1T2AA 4UAUA 4LQCA 1V6CA 3TFQA 3LY7A 5HK9A 4A2QA 2WAYA 2XE7A 3EXFA 3NFYA 3T12A 2GPSA 5JRZA 5B1DA 1NM5C 1SB9A 4FIDA 4GQBA 4JB8A 5B37A 4CLDA 2O8BB 3GDOA 4P7FA 1I2MA 4AYTA 3IR7A 3PYXA 5B2ZA 2IV2X 1ZVMA 3P2OA 3QW4B 1CPYA 2HTEA 1UWCA 1GYQA 4QOSA 1G21A 2CFCA 4LRXA 4IWYA 3OZCA 1QHGA 2VYNA 1O6ZA 1VE3A 3QPDA 4RWZA 4IMRA 4ARZB 1ZJYA 4CETA 1VIDA 3TZEA 1D2HA 5JFOA 1PHPA 1YXMA 1G21E 5F35A 4PYIA 2A1UB 1YMQA 2YRWA 4Y0NA 2KYRA 2ZSBA 1KYVA 2XGOA 3OJEA 3K70D 2R1VA 4KDCA 1AK1A 1NQWA 3C3YA 2Q5OA 3SZUA 1JWAB 3FIJA 3PUYA 4OHKA 1SVIA 1Z5PA 4ZYVA 2VH1A 3S7TA 2FZEA 2H92A 3CUUA 4FQ5A 1FU4A 2QX8A 5FORA 3BSSA 4W6QA 4UTPA 1WD7A 1YAHA 1JKMA 3UAYA 1FB5A 3R7AA 2QN1A 5C4GB 1C0EA 4YMLA 3H5RA 2O8EB 4CLEA 4AF6A 1PDOA 5HSGA 4E1BA 3S6JA 2VT2A 4BKQA 1CS0B 1FDUA 2O7NA 5FPTA 5DBOA 4KGDA 1XCJA 3WVNA 1NI4A 2I1LA 4FD3A 4L4YA 2OGUA 1OIXA 3N7AA 4IHJF 4EPTA 1TA0A 5L8VA 2E4AA 4MVJM 4UULA 1QKJA 1SOUA 1X1RA 4RZXA 2B1QA 3AB7A 3DDZX 3EFHA 3ITNA 3DAHA 4AJKA 4AP6A 1HDIA 4B85A 4F6RA 5EMHA 2EVWX 3QXSA 3GG9A 2H9AA 4HLQB 2Q4OA 3P2JA 3QWIA 4XDYA 5AJYA 3KT3A 4WINA 1IN7A 2HADA 3BXOA 4XQ0A 1MOSA 3C7CB 4E7OA 2HK9A 1SXGA 5D5PA 4JQOA 5EZ6B 3EISA 2CZGA 2HFJA 1T34A 2QD4A 1P1JA 2XWPA 1Y5IA 2YWXA 4AMBA 1IRIA 2OCDA 4YUYA 2G28A 1GN9A 1EJ6A 1BG6A 2YIJA 4TQ9A 3C43A 1NOKA 1ENZA 2ZBVA 1TFRA 2JLSA 3EJWA 2GK4A 4RPJA 2DBZA 4TTSA 4Y2SA 3G49A 4NBRA 1EFVB 1NR5A 3T41A 1BU5A 1EBUA 3DLAA 3CG4A 3FY4A 3P4YA 2ZPTX 2ZBFA 3NM6B 4NEHB 1IM5A 3RU3A 3BWYA 3QOWA 3JQQA 4PX2A 5IM4F 1N1GA 1VCOA 3BJMA 3D7SA 3IVRA 4ZAYA 1K8RA 3AL0C 3E84A 2HGZA 2B9EA 4E3ZA 1K63A 4IKOA 3B38A 1AN0A 3DOEA 3ZJ4A 2H4FA 3ND5A 1SGWA 4QXMA 2RGYA 3RDPA 3QJYA 1N1EA 1U7WA 1TQ2A 2Y0EA 1QUEA 3ZX4A 2D7JA 3NIGB 4FGLA 1D0VA 1FTNA 3JQFA 4B3FX 1PVDA 1QYVA 2PWBA 2YRFA 4FR5A 4UDYX 3B2EA 1CB0A 1PX0A 3KRTA 4LRQA 4Y9DA 3FGOA 2FQQA 1VG8A 4S05A 3W2EA 2WTBA 3WRYC 4FGSA 3E7XA 4AJEA 1F8XA 1Z0JA 3V1KA 4MKFA 5IASA 3VR5A 5KYUB 2HOQA 3KPWA 4V3CA 2C2ZA 4GM0A 1OT3A 3IIEA 1NTOA 5LYJA 3NC0C 2WJGA 2I66A 3HQ4O 5EIBC 4EA6A 3UBMA 5E6SB 3PD1A 4HMOA 1NSFA 2VH2A 3BL6A 5FEMA 3ZV7A 4BFXA 4F3NA 1HKUA 1K7XB 4PVCA 1X74A 3GDHA 1NR1A 4KK3A 3LXMA 4F2HA 4YUZA 5EZYB 4EHBA 4X8HA 1V16B 1ZM3A 2CUZA 1O6BA 4HMPA 2JASA 3W04A 4AQDA 4F56A 3H3JA 3P9KA 1AKTA 1BH2A 3QG5A 4HLUA 4S1NA 4HX2A 2FPXA 1NBIA 2HV8A 2PGIA 2Q7DA 4EAAA 3ZWDA 4GR4A 1FXWA 1DHTA 1D9ZA 3PQ3A 3MFQA 5G1NA 3UWMA 1G7SA 1R0WA 3F7MA 4KR0A 4OGKA 3TDKA 4YS6A 1H05A 2BC9A 2FCAA 4TMTA 4YB8A 1U4OA 2XJ9A 4HAOA 2HWXA 2ZJFA 1A7JA 3W9YA 1QYCA 1NVGA 1AU9A 1E0SA 1SVOA 2OO5C 4JQCA 5IW8A 5C1DA 4HD8A 3V3TA 1Y8CA 3PFBA 4DSTA 2OXFA 4MRRA 1JJAA 2HU2A 3A4MA 4AIIA 3LX8A 2BI8A 3GNQA 4WLUA 3UMCA 1YKFA 5C8YF 4P4SA 2Z56A 4JP3A 5JDCC 3QVJA 1UOOA 2C07A 1H2FA 3ETLA 3LCMA 3CO0S 1FRVA 2UUOA 2BOVA 4KQGA 2CMKA 2HD4A 4M6WB 2PH3A 4Y2HA 3RGGA 4LOLA 3ND8A 1R00A 4X41A 2OC4A 3JAWB 4NYMR 5AJTA 2AOXA 4DT1B 3B6ZA 2CSXA 1PUXA 4ENTA 4AL4A 4BO9A 1BMFA 1IMJA 2JG3A 1XF1A 1Y4SA 2OMEA 5BNWA 1QP0A 4IPTA 1RWNA 3H9BA 2OHFA 1U0OC 2NADA 2RC5A 3AH8A 3AYXB 3TSWA 4TZKA 3L1IA 4BMDA 3FRIA 3TGLA 1VL1A 1MB4A 5IH3A 2B9VA 3SQLA 4A3SA 3ANLA 4IXTA 4CDRA 3IKLA 4HB4A 3DV9A 3FVQA 4KO1S 4OUKX 2JAPA 2I76A 3N0XA 2IODA 2KX7A 1VJCA 2PKQO 1DO2A 1DJLA 2OWDA 4M2LA 3JQAA 3VOSA 3Q6NA 3DC2A 4GX1A 5BMVB 1G63A 1JQEA 4IDOA 1DQNA 1QVZA 2GEFA 2VL7A 1RWBA 2EQBA 3T3PB 3WGHA 1EQUA 4DJJA 3F6SA 2ATIA 2O19A 1SQGA 1FLNA 1Y1LA 2JVIA 1O0CA 2PCLA 1ZX1A 4PONA 1EWKA 1YDHA 1ZXXA 1BW9B 4MIOA 4NH0A 4J0JA 1JG2A 4DSNA 3SJAA 3G7NA 4ZYXA 4OH7A 3NHKA 3KQVA 1W96A 1EHYA 4WH0A 5TQ2B 1MC8A 4EY8A 3TECE 4YRNA 1POWA 1PU2A 4XIYA 1F3LA 2WJ3A 2YMLA 4DV6B 4RM2A 2PU5A 4D25A 2OBMA 3RB8A 1VYHA 2EZ4A 2H5EA 2O7RA 2HLDA 2VDMB 4NBLA 4ZVOA 2PSHA 1SCUA 1R3UA 3PX3A 1M0WA 5ANRB 3U5ZB 3F6EX 1DNPA 1MRNA 3T52A 1CE8B 2X7JA 2ZWAA 4OJMX 4AY2A 2D62A 1JTVA 2A88A 2DPXA 2Y9PB 3A4VA 3BE5A 3PDWA 3PFKA 3I01M 1PR4A 5F52A 4QTXA 4MB0A 5FQOA 1IJFA 1HYHA 1Z4NA 4A82A 1C7ZA 3ON5A 2O8CB 4ER7A 5LYYA 2QTVB 3D6JA 4M83A 1ETUA 4TS3A 4R2XA 2GS9A 1H93A 1WF6A 3CX4A 3O4GA 4OJTA 4P31A 1CP3A 3UY4A 4B44A 1KQFA 2WWWA 4KJZA 2B7LA 1M7GA 3I34X 1C8KA 1DELA 4Y9SA 1A8IA 2R6DA 4B7AA 4PNEA 5E4FA 4M9XA 3B78A 4Q39A 2FU5C 4GMGA 1BYUA 2H8KA 4BEJA 4TKUA 5FBLB 2ZWPA 4WXYB 4U00A 1SG6A 1SO8A 2DT8A 1MG5A 3D1VA 2G83A 3M6WA 4F4JA 3W2IA 3UENA 4EYSA 4UTXA 4GZLA 1FQJA 3KB6A 5F1YA 5K3CA 3ROMA 2J6HA 2HCTA 3BAZA 2ZSJA 3PQDA 1GZUA 3QPVA 3WLKX 4QVIA 3ZX5A 1P39A 2WP8J 5I48A 3Q3VA 3ZD6A 5I47A 3X2FA 1XR3A 4YLEA 5AM5A 3S28A 1D1TA 2DLNA 2FPWA 4Y2GA 1G5RA 2W6OA 1XDWA 1T0HB 2CN1A 5F5NA 4AJ1A 4BX0A 3UXYA 3DTVD 4BFTA 2NUAA 4N3NA 1MJGA 1RADA 3EVDA 3IBTA 4QRIA 4BNDB 4PG7A 5EWJA 3VSDA 3VVCA 1E7MA 3EMDA 3CZ9A 3VAAA 4UD6A 4CM8A 3ZLBA 3DP9A 3Q0TA 2LCIA 4AKEA 3LJKA 1CUAA 5TV2A 1P18A 4QGSA 5AHKA 1AHNA 2YFYA 2AZTA 3HKDB 3C1AA 1KHTA 1TL7C 2G09A 1P81A 2DWPA 3MUNA 3SBDA 1GPNA 3KETA 1SVSA 2JK0A 2GZSA 4GRAA 3WJ2A 5B64A 4YAUA 1U6KA 1ZP6A 4MR8A 1KY5A 1N2GA 1O96B 1K2VN 2VNHA 3ND7A 4Q3NA 3IAM1 5HQ3B 2ZZMA 1SHKA 4WA8A 1ZQ9A 3C97A 3FCYA 1HNWB 1V11A 4YXWA 1IN6A 4MR7A 1WNTA 2VPYA 4F3YA 3DM9B 4MEBA 3IQFA 1EHCA 4MQUA 4C4SA 1AKWA 5CDHA 3ZKWA 1LBQA 3H2HA 2XYHA 5LN1A 4PHFA 4L28A 4QVGA 5IAJA 3OQMA 5BN4B 3G7UA 4XB6B 1VIAA 2V0GA 5E9AA 1RAAA 3B7WA 1N5RA 2PV7A 1GQSA 1G0NA 2YN4A 1YA6A 4TYPA 3WOVA 3QJ5A 1GPJA 1KL7A 3SYNA 2BHNA 4AROA 5ER9A 1HUQA 1IOLA 2XMSA 1T0UA 3GZTB 4LZZA 4JR0A 4BFVA 5FAKA 1D4ZA 1Y8QB 3EA5A 4EYKA 3DBVO 3TR5A 1WMBA 4R81A 3TLXA 1J8MF 3T94A 2HK8A 2C4NA 2Y67A 3AQ4A 3SBXA 3T3IA 3D3JA 1EGVB 4BTVA 1YRWA 2V4MA 3C6YA 3UJ8A 4FNAA 2WSMA 2B20A 2RAFA 3I4CA 4U0KA 4KXXA 5IVIA 5A2GA 2ISCA 4NV1A 3JCZA 2PR2A 3ILHA 1OXTA 1OBCA 1LS6A 3FJYA 3UO8B 5JNVA 4KIUA 2DKNA 4X44A 2QRHA 3A7EA 1T2EA 1OPRA 2C9OA 3OTGA 3U3DA 4DQLA 4IM7A 5E9WA 3USCS 2X5JO 3AUSA 4RK4A 3UJ6A 4ETMA 1QYDA 1ULTA 2QQEA 2QV7A 3GQBA 1IZ7A 1SIUA 4AJHA 1D2MA 5BORA 3C6MA 1FDWA 2H1HA 2WQ7A 1JSXA 1R4MA 3D2BA 1F0YA 1NE7A 2QP9X 1TNDA 3R7DA 3L7IA 1BOOA 3EMBA 4NOJA 4EELA 1UBSB 1WHTB 2XA1A 1GLNA 3SLGA 4AT1A 1M1XB 2A9RA 1N9KA 1DP4A 3OPYB 1QR6A 4D0NA 2VPXA 1S9DA 5BNIA 2X9QA 5FUYA 1CUZA 1FRQA 1GG8A 3I32A 3K09A 4HLDA 1FRFS 3HU3A 2BP7B 3ZWMA 2PPVA 3P52A 4WWHA 2DR2A 3B6IA 4IUDS 1OHHA 2C2KA 4F9EA 1NE2A 2ZULA 3HEMA 4XI9A 3ZZUA 1F1JA 2Q9AA 1QH0A 4B32A 3HV0A 1UPTA 2XAUA 3O93A 4NCHA 1G5IA 1L3IA 1WMFA 3NOXA 3SBOA 1D8TA 1E5VA 5FV4A 1FS6A 2XBLA 3TKAA 2IY7A 1EK0A 4ZA2A 1VMIA 4EFMA 1O9BA 1OWLA 4R5HA 1K8YB 4DZZA 3FE2A 2BGRA 4QGHA 1MG0A 3STUA 4IJQA 2BEUB 1LS1A 2M9MA 3K9BA 4OYRA 5JZVA 1FMLA 4E2XA 4DM4A 1NYQA 2XA9A 5KNCH 3LRTA 2AA3A 4WN9A 4E03A 4B8ZA 1YR1A 4QM6A 3V55A 2H2WA 1NFFA 5REQA 4CODB 4LMPA 4YXWD 4R0VA 1I13A 1Y98A 5FOTA 3OE4A 1PX2A 2AQIA 4B3SB 3QXJA 4P7GA 1T13A 2XB9A 5HCIA 1XVUA 2DPGA 3LF2A 1X38A 3OQ1A 3BG5A 2RI6A 4UBOA 3BMCB 4CIVA 5DNUA 4BCDA 2A4MA 3WK4A 4NARA 4ENUA 5CJPA 4OK6A 4RHTA 1OE0A 2HMUA 3SQDA 3IOBA 2FG5A 1OFGA 2AZDA 4U5XA 4OLAA 1TTQB 3LGXA 3OQJA 3ZWVA 4BOYA 3VYVA 1T8TA 3RFVA 4I6EA 1MAUA 1OIVA 2FR8C 2YUTA 1LVUA 1Z07A 3GN1A 3SC6A 2ZBPA 5DU2A 3UHOA 4J07A 2ONZA 2QUKA 1XOIA 6ABPA 3FCOA 1YVDA 2FRXA 4JQZA 4LRTB 5FBZA 5J2UA 3AFGA 3RIGA 4I1UA 3MIIA 3QEBZ 1ODTC 3BVPA 1GL9B 4CUJA 3TOVA 5B1HA 1X1EA 5K03A 4DV7B 1RI5A 2NTYC 2KE5A 2VAWA 4EF5A 4N1AA 3TOZA 2IHYA 3KKQA 1KVSA 3T7DA 4AJNA 4ZOCA 3QEMA 3BB4A 4C1BA 1DC4A 4R71A 4RXUA 2KPOA 5LXTF 1JI0A 5L4SA 1BDMA 3COVA 2GAIA 2R84A 3KYCA 3WLOA 4H16A 3RYHA 2NSYA 2WKPA 4TWAA 3RRBA 2AOTB 3UF0A 4BJ3A 1YQDA 1B6RA 2H0QA 1OLXB 3HI6A 3D43A 3NJ4A 4KSYA 3PUWA 4Q6BA 4AN1A 4TXJA 2ID9A 3BQ9A 1XJCA 4Q03A 3G9TA 4XX1A 4CCSA 3GFGA 5EJ9A 4A2CA 2FP4B 2IEYA 2E5FA 3PC3A 3QYJA 3LP6A 5AK6A 4XX0A 4HQNA 5JBNA 4IQFA 2GXQA 2PZLA 2QORA 4QLBA 1IU9A 1E18A 4KJXA 3VPFA 3FLBA 1G5TA 3KYDB 4MKIA 2G9RA 3QYFA 4E22A 3CH4B 5HM8A 2JZOA 3EGXA 3JVVA 3BMOA 2VQDA 3LRXA 3O3MB 1GTMA 1OHHD 5A6SB 4A0GA 3D4PA 4G1CA 4XFJA 1IHXA 2HRCA 4OB8A 5GOTA 1ES9A 3TD6A 3ESZA 3U48A 1GT6A 1KQNA 4ZI7B 5CH8A 1J90A 3C4JA 1IY0A 5K0NA 2WFLA 2JAUA 2VYVD 1WTAA 1EFLA 2VOJA 4G9BA 4JT4A 3SYLA 4BVJA 3VOBA 3IDQA 5EEGA 3H9UA 2WUDA 1CZNA 4LZPA 1U5BA 3R8CA 3ROKA 4PR3A 3UT0A 3TW8B 3X44A 1KE1A 3ZDXB 4L8YA 4JI0B 3H19A 5AXAA 4C4OA 1L4NA 1M2VA 4UUNA 1SWWA 4YIHA 1WXGA 3PXDA 3EBLA 4S1WA 3DCNA 1B8VA 4MV7A 3WYBA 2NT3A 1JXQA 2IH2A 3MK31 2YC4C 3A1FA 4D74A 3E27A 2HQSA 1XP8A 3GLGB 2OOSA 1Y37A 4GZ5A 4H7FA 2O0KA 2QJWA 2YWDA 4Q3BA 3A9TA 3KCQA 5EJAA 2R5NA 4O2BF 1H94A 5KSPA 1FSZA 2HN9A 3EHEA 4BV2A 1QHHA 1N77A 1L7VC 1X42A 3V80A 1AF7A 1T9DA 4YI3A 4YCSA 2O06A 1FIUA 1XEXA 2BF7A 2O59A 3EGVA 2FYTA 2IS6A 3G68A 1GRVA 4PGFA 1CY7A 4PZCA 1AHIA 1KZ4A 4UUMA 1EUQA 1E1QA 1U0TA 1N0VC 3DCYA 4XW2A 4BPBA 2VT6A 1MTOA 1JE0A 1LY1A 1FSPA 1JZQA 3VNAA 2EKZA 2PZKA 3F98A 4ALNA 1TZBA 3KL4A 3UUFA 3ZWBA 3ENNA 4EYEA 4AKGA 1A8QA 4D81A 2V7EA 1KGDA 5ADVA 2B6NA 4PSDA 2AR7A 2WG0A 3LBHA 1JQ5A 3GJ7A 3PT5A 5K2MA 3DVRX 2ZZNA 1JAYA 3AW8A 4ZYLA 4RZUA 4H6VA 2EZ9A 3J81k 5T4HA 4OJKA 3F73A 3K1ZA 1PLLA 2B25A 4WKGA 2EBWA 1PJ2A 2HZBA 3F6BX 2ECKA 4OQMA 5KNLA 3FOEC 1ZAYA 5BRAA 1H0RA 3M6MD 3E7FA 2IXDA 2XJ4A 3MBIA 1IK4A 4GUAA 1J8FA 3MFYA 5FL7A 1GNLA 1NXTA 2ZT7A 4UOEA 1UFOA 2VVTA 5A0VA 5JQGB 4WMLA 5JEDA 4DCGA 3VR1A 3OLXA 1DUSA 5CGZA 1KSHA 1V43A 2ORVA 3KDAA 5DPMA 3RNLA 5FHQA 2P3QA 1F2UA 3ZVLA 5HZMA 4X5OA 2ASVA 4O4IA 3MRVA 1EWTA 3THXB 1VG1A 2FPUA 4XGKA 3DCJA 3R74A 3CG0A 3RRXA 4KR7A 2QBYB 5JJLA 2D2EA 2ZETA 5G40A 2IZ7A 1KI3A 3LT4A 3P45A 1FYEA 1GRQA 3A9UA 5E6RB 4EJFA 5F7XA 3ANNA 1W88A 1ZC3A 4NJOA 4NE7A 4R9NA 4JKOA 2MINB 1OXSC 3CZPA 1NMXA 1RKVA 2QUIA 2WM3A 3OMXA 4XDZA 2PU7A 2RCNA 2ZTSA 3OEYA 4MQEA 1RLJA 3KOXA 3TX6A 4AG3A 1H6DA 5FLEX 3PEEA 4Y1RA 3CPEA 1M0TA 2MR6A 4RYDA 3VZBA 1T8RA 2VIIA 5K0CA 3A1EA 4PLWA 3ZDZB 2X8WA 2RGUA 1Y3AA 4BX2A 1DCFA 2BTOA 2WYUA 2Z2ZA 3OY7A 3Q7RA 4KAXA 5FBKA 5DWQA 1FJXA 2P9ZA 1NUTA 2RB5A 2VTEA 4I19A 4UPDA 2J41A 3OSUA 5JSZA 1WXWA 3ROEA 3Q5EA 1WJGA 2LPMA 1S4MA 1V5IA 1NHGA 3E05A 4UPEA 1RQ7A 3TNJA 4GI5A 2K87A 1PWZA 1R6DA 3HV2A 3L7AA 4RVDA 2PMFA 2IHVA 2BM8A 1WXQA 3ADBA 1KYZA 1Y3IA 2H18A 2Y2UA 4ZO6A 1S2LA 5CD1A 2PIDA 3I5MA 1EFRA 3A05A 3S81A 3FOFC 3PNLA 2VTBA 1WDMA 4YJGA 2QDXA 3B51X 3GZNB 4G5XA 5HJ7A 1LNZA 2CXQA 1IXZA 5DNYB 4JB2A 2BGKA 5EE0A 2TMGA 1ZOOA 4LXGA 2GB4A 3FNEA 5AICA 3T1NA 3CY6A 3NNSA 4JMLA 4DJTA 4LDNA 2CZQA 3RYIB 1GUFA 3HY6A 3ZE6A 1PT6A 2WUWE 4D9IA 4DEYA 2I62A 3JD4A 1F20A 1WZCA 5KPDA 3V8QA 3T7CA 4JBYA 3TUZC 4P0PB 1QO7A 1U31A 4I3GA 3WICA 3DAGA 2D5LA 1NYLA 1A9YA 2UDPA 3GCGA 3ONNA 5H4HA 1NBMA 4OYHA 5HILA 3ZXIA 4A0SA 4JYAB 1K4KA 1UDAA 3PD7A 1ZAKA 2AF3C 4RJIA 1EJ2A 3IQDB 5ESRA 3ZY4A 5FR2A 1VPTA 4X91A 5F2OA 1NXQA 1NBOA 3CUKA 3HJCA 3GBVA 1CYEA 1NBME 3I1IA 2PGAA 3FHJA 4MUMA 3UKDA 3W2HA 5LQDA 1YGPA 3CR8A 1PFKA 1J2UA 3KR0A 4P5PA 1D6MA 1CYDA 2XSZA 1Z13A 3NI2A 4WOCA 3SSNA 4DCOA 4JDUA 2GOYA 4KOAA 2OCLA 3SMVA 1A8HA 3U1VA 2AN4A 1Y5NA 1AIPA 1UXKA 1RRKA 2ZXFA 5B7QA 2CJXA 3A3NA 1HX7A 1O54A 3CE6A 1ZGAA 3KNZA 3AP1A 1YOVB 1XZ8A 4RXMA 3WG9A 5I7SA 1O97D 2ZP1A 3GLGE 2QVGA 1MJ5A 3DHEA 3TMAA 1CUFA 3VZRA 2QL9A 2BISA 4QWMA 5IBRA 3EUWA 3ZHZA 4B6EA 2J45A 3OUTA 4DEXA 1EUYA 5AW9A 2GYWA 4HSGA 3ADPA 3KQQA 3AR6A 3AM1A 1BKSB 4D9CA 4F8YA 5FOVA 2K7FA 1IQUA 4G0VA 1XNRB 2ZBUA 1JDTA 1QDLB 1T3TA 1IH8A 3PJDA 5TGDA 2CXXA 4ZYWA 5FPKA 4ZGWA 3A6JA 4HAZA 3ETEA 2F48A 1MIOB 1COWA 5ECYA 4M0LA 1P1BA 1PKEA 3SM3A 4NZ9A 3PZBA 4E4TA 1NT2A 4XD7A 1PW7A 4DKXA 5JEEA 1J1ZA 5JC1A 1GYRA 1YHNA 4GYWA 2VK4A 3STTA 9LDBA 4F9GA 3KUDA 1Q7BA 1R4NB 3AYZB 3D5QA 1UDWA 1F0PA 2YWRA 1KIMA 1HRDA 2CYCA 5AKYA 5A9TA 2VHCA 4UEJA 1GZVA 5CVVA 2XUKA 4ZGBA 2HU5A 4EY7A 3FROA 4GFDA 5TMPA 3GVIA 3T9FA 1DINA 4NI5A 4LDPA 3SS7X 5DTIA 4A8JC 4YJ2A 1CEQA 4KE7A 2BBTA 1MT0A 2YWEA 1C1YA 5JISA 1QVWA 4Z4QA 5HS6A 1QQBA 4OA8A 2FLWA 4PYRA 1BD4A 1CT9A 1DAKA 1RYHA 2HTFA 2SICE 2OD7A 2RJOA 3EG9A 2H9YA 2X5NA 3IAS6 4JVOA 3E7DA 3Q7PA 1EVZA 1UEXC 4ZQCB 4BUJA 1A5TA 2I78A 3CSSA 2UYOA 1SEPA 2DU8A 4MICA 1V5GA 1F8UA 1LGYA 2YWHA 4PF1A 4TS9A 4G07A 3IAM6 3OF3A 1VMKA 2VHJA 1Z2DA 4OXQA 5B5SA 2Q5FA 4B35A 3VJRA 1I2AA 1EFUA 1NBMD 3JQPA 4N12A 4DQUA 3EQ9A 1U9IA 4FMBB 2KQUA 1FS5A 4FBMA 2QTNA 3NANA 4KIFA 5BW8A 3EVZA 3B6MA 2YHSA 1U8EA 3H8JA 3UWKA 1PP4A 2WHPB 1XKLA 4ZZ2A 3LBYA 1W6UA 2BKLA 1XAGA 2QTRA 3N2EA 3FMOB 3OT1A 4IFEA 2FPPB 2VJPA 1EWVA 4BVAA 1J4AA 2ECFA 2FFHA 3D6TB 1UBFA 1B8OA 5TVGA 5FOQA 1UF9A 3ETJA 3UV3A 1NDQA 2AMLA 2XSZD 2Q6TA 1Z39A 4G81A 4MI3A 4Q4JA 4N6OA 4XOUA 3GPDG 4FWBA 5C7YA 2HGSA 4D3DA 3WNVA 2GPTA 4CF5A 5G2OA 2GQ0A 3TD2A 4Z3OA 2EFDB 3COWA 2QSZA 3EGDA 2XT0A 1ZXLA 4H3HB 1XQ9A 1NJ5A 1CQIA 1P3JA 1TQHA 2FG6C 4HNSA 3WLAA 2HA0A 1TLFA 2B0CA 1CIPA 2CKMA 2V98A 1XPRA 3EXEA 1MIHA 3R6WA 5KKAA 2YH2A 1TC2A 2ZDGA 4Z7NB 2CLKB 4KQMA 1PZEA 3CW9A 1NBHA 2J9XB 1PAUA 1YDWA 2PKWA 1B3RA 2WDZA 4IJ5A 3QX8A 1RJEA 4W7HA 4YVFA 4UM7A 5EVCA 3WMEA 3KSAC 2BFCA 3CJTA 4AKHA 4F91B 2WINI 2CXRA 3BUSA 1KBOA 4G41A 2QRVB 3H9GA 4E2ZA 1VGVA 2NXCA 4HQFA 5EXDA 3VZDA 3MWDA 1WMDA 4YRLA 1VKRA 4EHJA 1PK7A 2ATEA 2UVPA 4FSDA 2ZJZA 2UYQA 4J1TA 3NHRA 4QPCA 2BFNA 1UZMA 5ITSA 3KQUA 3WJ7A 3HXKA 5A4MS 4XVQA 3R9XB 1SVKA 2YYAA 4DMGA 1C1XA 3D54D 4HH4A 4BMYA 3F7NA 1MQ8B 4PG4A 4AO8A 4MNTA 1SD5A 1W1UA 4C0WA 2RAPA 2XKAA 4DQVA 2X4LA 3DKKA 4LV8B 1ULUA 1U1GA 1MNAA 1P1IA 1H2RS 2G72A 2BI7A 2HIAA 2IIPA 2ROQA 5F23A 2W2OA 5LD2C 2KJQA 3GDWA 3FI0A 2O5EA 1IDOA 2R9VA 1TDJA 1ZNQO 2BKXA 3FHCB 3WK9A 3LPMA 3UGTA 5DKFA 3MLBA 1CETA 1U9CA 2W2LD 2XECA 4KTTE 1GGFA 4N03A 4Y6LA 8GPBA 5GTDA 2NO1A 4AD8A 3G2LA 3VUEA 2BEVB 5KVCA 1TK9A 4EUSA 2UUAB 3KS9A 2IYZA 3E35A 4IIBA 1SUBA 4HDKB 3H2JA 3W7AA 1DWQA 2X2EA 1CP2A 2R85A 3BA1A 3M1AA 4YT2A 4LNUA 1E92A 1BN7A 1MRZA 1L5MA 2OM2A 4TN5A 3VH3A 3M4XA 3Q7QA 4HDMA 3K0AA 3NBFA 3S7ZA 1FDOA 1V8DA 5BQ5A 1XDZA 1XLVA 2BTQA 1RMYA 2EBFX 3GT0A 2IE0A 2BBOA 3PTLA 4MS4B 421PA 2ZI9A 5JNTA 1C5KA 3LBIA 4KRGA 4QEKA 3V33A 1CQWA 2YV4A 1A04A 1VL2A 3MELA 5AHXA 3OJLA 5AVJA 2AQKA 4HEA1 1BGVA 5BN5B 1HDCA 4YUVA 4A1FA 2NZXA 4CNBA 1T8YA 4LKRA 2LKCA 4NQZA 1OJ7A 5IJ0A 1CVRA 1I24A 4QNNA 1TI7A 4YONB 1YZLA 1HE2A 1UKYA 5GONF 5K0BA 2HJVA 3JQ7B 2JPDA