1XMPA

Crystal structure of pure (ba0288) from bacillus anthracis at 1.8 resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
KSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQMPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PurE (BA0288) from Bacillus anthracis at 1.8 A resolution
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase
molecule keywords phosphoribosylaminoimidazole carboxylase
total genus 53
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1xmpA00
5C5DA 1U11A 2NSHA 3TRHA 5CLHA 4YCJA 4ZC8A 5CVTA 3ORSA 1D7AA 2ATEA 2FWBA 4ZMBA 4YCBA 4B4KA 1XMPA 2FWPA 3OPQA 4YCDA 5BOSB 5CLJA 3KUUA 3RGGA 2NSJA 2FW1A 2FW7A 2FW8A 2FW9A 1O4VA 4AY4A 5CTJA 3OOWA 2NSLA 2FWIA 4JA0A 2FW6A 4AY3A 5CLFA 2H31A 5BOSA 1QCZA 2FWJA 4ZJYA 4ZK2A 3LP6A 2YWXA 4GRDA 5CLIA 4Z7JA 5BORA 4YCCA 5CLGA 2FWAA 3RG8A
chains in the Genus database with same CATH superfamily
5EFZA 4E3WA 4B7CA 3QBDA 4YQZA 4UQOA 4S04A 4DXAA 1FVOA 5D3QA 4YV0A 4QRIA 2TMGA 4Q9NA 5FBLB 3WS7A 2AEMA 3S5UA 3I30X 4BQQA 1QK5A 4NPAA 1UWLA 3ZVKA 3SZUA 2WQ6A 4DCNA 3EFOA 3TBKA 4BXOA 4R51A 1WEKA 1U5BB 4WLEA 8ABPA 1MQAA 3JASB 3TSAA 3WLTA 1VSBA 1XZ8A 2WWIA 5TVGA 1IBMB 1N2HA 1T2CA 2X5JO 3ELYA 4TYNA 4CM3A 2ZM5A 4MEAA 4RETA 2C9MA 4E08A 2BBOA 3IHTA 3SGLA 2OFWA 3MQ2A 3V2HA 1KYVA 5J1SB 2K5UA 3CPSA 3L41A 3Q12A 2QT9A 2RHTA 1T9AA 2NTJA 1GZUA 5ER6A 2QGFA 3OTHA 3LO5A 3N7UA 3J7AC 2CFSA 3TQQA 5K0SA 1G8KA 3AFHA 3G59A 5JIBA 2BFWA 2R86A 1OLOA 4RPLA 3E61A 1T26A 2H00A 3C5CA 1GY8A 3RABA 2GSDA 3FNFA 4TKZA 1J6UA 4YWHA 3O8CA 3U4QA 2JGKA 1OYOA 2OA0A 1TM4E 3TQCA 1V16B 2AYXA 4JYAB 3U5ZB 2OV1A 4IFEA 4MDYA 4CT0A 1JKMA 4OJQA 3DKKA 1A5AB 2XRYA 4FINA 5IJXA 2VQEB 5F77A 3GLGB 4OM8A 2NAFA 3WYDA 3KEGA 3EISA 1WJGA 2EJVA 3H17A 3AJRA 4UTVA 2V5UA 3PJFA 1GPLA 2PSSA 3G2JA 1M34E 4ND8A 1CUWA 2QVZX 3Q3GE 2EW1A 1GPKA 2DXIA 2ZBQA 1SK9A 3C7TA 3BGOS 2ZE6A 4KIWA 2XWPA 3ZWQA 1C0PA 3TI9A 1I94B 3THRA 4C6RA 2REXB 5ALHA 1C7EA 3BB3A 3O8DA 3C14C 2QSYA 2BEVA 4FFNA 4IQ8A 3F97A 4KVFA 4EHAA 2X9VA 4PLPA 1AN0A 3SYRA 1SU4A 3IEUA 3L4BA 4GLFA 5L3ZA 4MRRA 2FMUA 1Q3KA 3G7NA 3O8LA 3O1JC 1K9SA 3U4MA 1TDJA 1L7VC 2OSBA 1YDFA 1R00A 5E2IA 1I01A 2A0XA 4DMKA 1RM4A 3PEVA 4G84A 3RWOA 4KMOA 2Z56A 1E2LA 4UTXA 5KTNA 4HJXA 4CR8A 2HLDA 2VWGA 1OILA 1YA6A 2XDQA 3M70A 1X87A 2WT4A 3WYNA 3VTZA 2QZPA 2QM8A 1A9QA 1CUCA 1K8RA 3BWBA 3DOFA 4AJ4A 2HB6A 1I4TD 3Q98A 5ENZA 3EW9A 2ID7A 4PLFA 3AUUA 4W9RA 5KNDA 4LYJA 1KAHA 2A5YB 2H5EA 3HWRA 4ZI3A 2FN8A 4V0KA 2E1PA 1ZCBA 4WASA 3CR7A 2ZYVX 4X61A 1JU4A 1DJQA 1YJCA 2GJKA 4BZPA 4C14A 5B1IA 2GXQA 5I8ZA 1ITZA 1T4CA 5B58C 1SVLA 2QRZA 5KYYA 1MH9A 5AHOA 2CXUA 3OMLA 4MV0A 3QUTA 1A3CA 4RVFA 4M7WA 4OLAA 2PKQO 1H6BA 2QTLA 2BJWA 4D6XA 2F4NA 1PTKA 3K20A 4D4GA 5HIAA 1FDSA 2ZT7A 3RYFA 4ARZB 3MJTA 1YZQA 3OEHD 2QTVB 1KKLA 1W46A 2C03A 1IB0A 2GH1A 3SR0A 3KQOA 4QUJA 3TXYA 3GH3A 3AOEA 1QRRA 2ZJ3A 1RQ2A 1L7OA 1TVCA 4MUAA 3OBBA 4LWQA 3UK1A 2J7PD 4E5SA 3KUCA 4AFNA 3K2IA 4CMCA 3ZDCA 1QOZA 1KOJA 3R9XB 3ZDQA 1P7YA 1PWEA 5AESA 5EJ5A 1KDPA 1H1DA 1AF4A 2O2ZA 3ZIAD 4DMFA 1LUAA 2DPHA 4XRRA 2KBFA 5KTRA 1FEZA 3A8TA 1UDAA 3HDTA 2CJXA 4TKUA 4PR3A 5KTPA 4RGYA 4GI2A 1P5ZB 1TRHA 1NUQA 1XTIA 3HKEA 4O4IF 2JH8A 2DWQA 5L3QB 5GIPE 3OHSX 2VDPB 1NN1A 3LS2A 4PX3A 1EQUA 3T4UA 4PLVA 1CQZA 1T8RA 2RHBA 1BCSA 5T3YA 2H52A 5DHRA 5LJIA 1Z83A 1Y89A 4NOJA 2HJGA 1LGYA 3HDVA 3O93A 1Z2DA 4AECA 1HA3A 1ENOA 1WF6A 1M6VB 3JRXA 4FEYA 2PRYA 2VJQA 3PHHA 1E6WA 1GV0A 1BWRA 1TCUA 1GQQA 1JPVA 1KY3A 3SJBA 4I9FA 1DELA 3RVMA 5G40A 1WXXA 2HK9A 3Q0EA 1ZNXA 4EUEA 2QT0A 3BSYA 4UZEA 4F45A 1J0AA 3ZV4A 3OQPA 1K4MA 2BR4A 3SFZA 5IJWA 3G7SA 3S44A 1ORHA 3WL4A 4M8KA 3KQHA 4TROA 4FFLA 4OHPA 4C4RA 4CQMA 1KEKA 2WZQA 4YMWA 2OHGA 2IS1A 2OAQ1 4YREA 3GJTA 2X76A 1I0LA 1L8QA 4OH7A 3TQHA 1AS2A 4YRGA 3D3WB 3IMFA 5B4UA 4EF5A 2PUHA 5LXTF 1M0EA 4XLZA 1F2UA 2QUKA 3OP4A 1GT91 4D0GA 4Z51A 5MGBA 2ZG6A 1RP1A 4MAAA 3WA6A 3T5DA 4BMDA 5HUJA 1HL3A 4HFMA 3F73A 3I0ZA 1K0UA 4UCWA 1J24A 4MW7A 4YP1A 4N47A 4MPJA 4E7PA 3AV3A 4EZEA 2VPWA 1K4YA 1NIJA 3HZZA 3HBFA 5TRTA 3EEOA 3TLEA 1NFQA 4TV9F 2Q8PA 2JLRA 2XEDA 1R0YA 1TO2E 2YJ3A 2ONCA 4RH0A 3UMCA 4P4GA 2HXYA 5IU6A 1WXIA 2AOUB 5JAIA 5P21A 1C7ZA 1X0XA 1KU0A 4LFAB 3Q7QA 4FFDA 3RAJA 5LKRA 4KH0A 3FFWA 5JQGA 3ETHA 1KVUA 3TX2A 4MHOA 1XRNA 1D4AA 2C88A 2FTKE 1C29B 3B1ZA 3QXHA 3T1NA 1V3UA 5C7IO 5KHLB 2IEZA 4IIJB 3F67A 4BNXA 1JYFA 1I1OA 1LLFA 2CXTA 3L0CA 4P0TA 3H5VA 2BCEA 1OFIA 1U8AA 2ZI6A 3LPAA 4NABA 4BL5A 5MDHA 4TOIA 2NZ8A 2IDKA 2VNSA 3AI7A 3AR2A 3EBLA 4MUMA 3IESA 2B2XA 1NLMA 1JIVA 1YDHA 3IPXA 3PJDA 5DHTA 3WZMA 3RUEA 4NZOA 1HT3A 5CYFA 1RPZA 3ORYA 2H4ZA 4L02A 1XR3A 1Z16A 4BBZA 3GAMA 1YSCA 4JS0A 4ZCTA 2C9DA 4MRMB 2PWPA 1PT5A 3ZHZA 1E9CA 3HI6A 4MWSA 2AJBA 2YV1A 3PR1A 3C39A 4UM9B 2PD4A 1O96A 4Y6LA 3S6JA 3VNRA 5K0BA 3G88A 4FFMA 4HDNA 3T5GA 1T6ZA 3ONNA 1OU4A 1Q0UA 4P22A 1QNFA 4QNRA 1UBRS 4CKEB 2OUKA 1P5FA 1LCIA 1AMOA 2BEUB 3CEMA 1J2UA 2EGHA 5KAPA 5DCYA 5KI6A 1CUBA 4YEDA 2GDZA 2D5IA 4JEMA 1P9RA 4ALNA 2FLWA 1JQJC 1AS3A 1P4JA 3EWSA 4HAIA 4UE6A 2Z2IA 5G0SA 4NPCA 2RDMA 2Z3WA 3AJAA 2HMSA 3HH8A 4CIAA 4DG9A 1YQUA 2IHNA 3RJ5A 3EEYA 1FQJA 1QZTA 4EJSB 3RQSA 4V0QA 2VDOB 5ITSA 1EJ6A 3RYCA 3KKOA 4YCJA 5FLXA 2A9PA 3L0OA 2IUFA 1E8DA 2RI0A 3OOJA 1RYBA 3OJXA 3L5OA 5CB6A 2P2GA 3GJQA 1P77A 4YAFA 1QF9A 3U7QB 4L6CA 3I1FA 3BL5A 4QDXA 3JATA 4EHIA 1BAPA 2V9PA 3GGDA 4ZDIA 3GOQA 5BW4A 9MHTA 3K6SB 3P7MA 3TCNA 1OH6A 2IX9A 1CZLA 1D7OA 4JODA 4PQGA 1QKIA 1TMYA 4LW8A 3DKIA 1DXHA 4S12A 3KTFA 2DEUA 3UCFA 3TVYA 4KV9A 1PJ4A 4AWBA 1NN3A 4WVFA 3PBKA 5JZOA 4R1TA 1AG9A 5ALEA 5U9CA 4U6QA 1E3SA 2XCTB 3P2MA 2PCJA 1C9YA 4ZGBA 2A1UA 3Q7PA 4M0MA 1PBNA 2YYYA 1PT9A 1KWGA 2V8BA 4PZDA 3VO1A 3IP1A 2V5AA 5IAAA 1NBAA 4YRFA 4NEQA 1CPYA 4XM0A 1A9XB 3LK6A 1KBZA 1J06A 4NMXB 3AEUA 4XUEA 2E4XA 4KQCA 1QLHA 2D3TA 3JTMA 1M74A 1RU3A 4FOTA 4RS4A 2RIRA 2GEFA 2XKKA 2CJWA 2O4UX 3HWX1 4FGWA 5EIXA 4MQFA 5CDSA 2EHJA 2MJLA 2GCOB 2O0HA 1Z0AA 3HV2A 3FYCA 4LBVA 4EKIA 3OQVA 5H5JA 3PR3A 4AZ0B 1LZKA 5ICMA 3CJQA 4YLEA 4ITVA 1XAGA 2YH2A 2Y1DA 4NEHB 3JQFA 4YDSA 1M6VA 1QC5B 3I9KA 3SOPA 821PA 2OC9A 1WY5A 4O1HA 4PIPA 4CKEA 3E1KA 1XNHA 5M3BA 3SZRA 2ID8A 3ANSA 3T3HA 2CXSA 3GD7A 4JI8B 1R6UA 3L4EA 3ZIDA 5JS8A 1RZRA 1WSAA 1F8XA 1AMUA 1BD3A 2C5BA 1E5QA 3FPHA 5EEGA 2QX9A 3KPYA 5AJWA 1F4VA 1XF9A 4XD7A 5HBRA 4KFUA 2GXAA 1L7RA 3ZHQA 1NYLA 2EQ5A 2JAWA 2Z43A 1B00A 1A1SA 2NXEA 3L8HA 4HFNA 2PZAA 4LZOA 2OD2A 3SNKA 3TLMA 5K6RA 4N5LA 4RJJA 3MJEA 1K3UB 2A8YA 2CGEA 3NWOA 1H2XA 4B6FA 4MIKA 3BRWA 4CRWB 2H7VA 3JQCA 5G1OA 5A06A 1NGSA 3Q3EA 3L1JA 5KNDD 5AP9A 2YVKA 2RAVA 3QVLA 1OJLA 2OWEA 1GXSB 4KQ6A 3WLPA 3SBXA 2QTVA 1Z0JA 1O7JA 4BLWA 3GPLA 4D9BA 2P2NA 2JGLA 4MJXA 3QKWA 2AK3A 4UU8A 4ZHQB 1RBQA 2VDLB 3EASA 4ICIA 4Y9UA 2YCBA 1OZ0A 3H2BA 3ESQA 5F9MA 1INLA 4BO5A 3E0XA 1ECFA 1W9HA 4U5QA 1LPNA 3AYZB 4PXSA 1DXOA 3CNEA 1ZXXA 3C15C 3FOAA 2OGZA 4MOWA 3X1KA 3ZG6A 3A2KA 5EJGA 4B9AA 3DT6A 4G0XA 1QQAA 1OXVA 3PG5A 1PGJA 3IVRA 2FVYA 1MB2A 3CH4B 3VBEA 3SC3A 1PJLA 2GA9A 4RE6A 1PR9A 1M54A 3RNLA 4V2IA 4ZOBA 2A5FA 2FWBA 1FFCA 2I2BA 5FPYA 3ZHUA 2Q0XA 5T6MA 5BURA 5AFSA 3E35A 4XJVA 5B3JC 3RT1A 2VT3A 1FLAA 3P9ZA 3IAAA 5LNK6 3HUEA 1Z5GA 5JISA 4ME6A 2QPLA 4GPIB 4HAVA 4IW3B 1RHJA 2AHRA 4LXTA 3TLGA 2CL6X 2ZVQX 1OA1A 1YC5A 3UKJA 1SKYE 2CHVA 4UULA 6Q21A 1Y1KE 4PG6A 4Q48A 2D2XA 1G8HA 4RD4A 3TZLA 1NR1A 2L69A 2QORA 1KDTA 1ZD9A 1WPXA 2QI9F 1VXOA 1MU0A 1IMJA 3M89A 2RD2A 5ICSA 3KVRA 3WJ7A 1WMFA 4CMKA 5KQGA 1U2DC 4L15A 3PNYA 3BZUA 4YN3A 1RLUA 1J8QA 2F55A 4K3VA 4E12A 2FMFA 1I6KA 3U17A 3NHAA 1E77A 2R48A 1T0UA 3WOHA 4ZO6A 1M1XB 1FUEA 3AP3A 4BEVA 3X43A 3N5KA 1G5TA 1E3JA 4M46A 3WICA 4CV1A 1O6BA 2AMYA 5SZIA 3A9SA 1SUAA 1XFAA 5ENDA 3QLVA 5BY2A 3T3DA 2ZTMA 1H0KA 3W6PA 3E9YA 3ZZ0A 2CVQA 1GGMA 1I8TA 3ORRA 4F71A 5EZ6B 4OX9Y 2CDBA 3K9GA 1NSYA 3ABIA 5ERYA 3QH4A 3PXBA 1ZH2A 5BN5A 1KOFA 4GEGA 4OYYA 4ZZ2A 5IUJC 4QO7A 3WLAA 1XZBA 1FE8A 5AWFC 5LUAA 3GJ7A 1U2GA 1Y3HA 3CB4A 2VA9A 4B7UA 1CW2B 1O97D 4AYXA 4BZQA 4YMLA 3FSGD 3N28A 5DNEA 3SHTA 4TS9A 2GARA 3UV7A 3ESRA 2HK6A 4DN6A 4DLNA 1KYQA 3LRPA 4JYBA 3DB2A 3WFIA 4X7RA 4D98A 3MWLA 5T67A 1FYXA 3JWGA 3QMMA 2VHQA 4B47A 4K87A 1CJCA 2C2XA 4KGDA 2R6GA 2FSFA 4HFRA 1TM7E 2VNIA 4R1OA 4WIAA 2A7XA 3U37A 3LQQA 5CB4F 1Q22A 3ULKA 1Y3AA 4YCAA 2X8WA 4OXXA 3DCYA 4PONA 1S9DA 4REMA 1ESNA 4I2NA 2BVNA 4N8SA 2OZLA 2JI8A 5I7EA 1C3OA 2AB0A 5F64A 2FMIA 2AI2A 2P35A 4Q9HA 1D2GA 1E1CA 1O1YA 4FWIB 4LJKA 5HM6A 2FZCA 2IU0A 3SZGA 4DLLA 5KKCA 3R0IA 4JJ6A 4LJLA 3VC1A 4C0QC 2ZJ6A 3WZ2A 3CG4A 4CPDA 5JWOA 3P0JA 5DMHA 3KZCA 1E63A 2ZJBA 1LW7A 3LECA 4M76B 3V8VA 4OLJA 3WL6A 4G63A 4EKGA 4Q02A 5HTOA 2IIBA 3RS9A 3KVVA 3P9NA 4WY5A 3MGKA 4BKUA 1TMGE 1CS4C 3NDRA 2X0NA 1EYZA 3QX8A 2ZUBA 1IBRA 3HTXA 3ONWA 1ZBQA 2VH1A 3I6MA 3H2YA 3ABSB 5FTKA 4RD6A 1T3ZA 3TE7A 3LY5A 2XDYA 4F46A 3K1ZA 2OTCA 1NUHA 1UJ6A 4NICA 4NOLA 3UANA 3IBGA 4WLNA 2VUHB 3FKQA 4IJMA 3ZGVA 3EY4A 1Z2EA 2NXWA 3GLIE 2Q9AA 2VQ6A 2BSXA 3AKYA 3AVQA 2WWGA 2WUGA 3EGWA 3KPJA 2CFOA 4PHTA 1OJ7A 2LDBA 4Q7EA 1U8XX 4OTZA 5E1OA 3UV6A 5E9QA 1KMMA 2O05A 1AKTA 3DLIA 4X63A 1P1CA 4MWDA 4WBNF 2NO4A 5JOQA 3FMOB 1NF9A 4UXIA 3L7KA 3N0XA 3M6LA 3BCUA 4HZIA 2C20A 4W8GA 1ZK4A 2X0JA 3TRDA 2WZCA 4WFIA 1A77A 1TUIA 2HPAA 3KVOA 4TWRA 3TLGB 3LTNC 1XVIA 1CB0A 1PEYA 4H7IA 1EWRA 3WBFA 4W1PA 4FYIA 3USZA 1P33A 3ER8A 5KPDA 1TYAE 1Z5NA 2GHRA 3G9QA 4OQQA 1NZJA 3PFWO 1FVFA 3N70A 2WQZA 2VPZA 5DEOA 2QXYA 3BJMA 1WV0A 4QYSA 3WRVA 2J33A 4RJIA 3STWA 2JI9A 4XSVA 5L7WA 1LSSA 4AF7A 5ILOA 2OQ2A 5DLEA 2P1DA 2X40A 4DV2B 1EESA 3EOBI 3IIJA 2VK2A 1GA1A 5JYDA 2WI8A 1XTSA 2NWQA 1PL8A 1HFEL 1TZCA 3QVXA 1CERA 1ZINA 4CI9A 4TQGA 4GYWA 2W6OA 3QEAZ 2JIQA 1IC6A 4IDHA 3JD3A 5GGXA 1Z5ZA 3LBHA 1E9VA 1K27A 3ML1A 1C7IA 4EGSA 2UYQA 4YRZA 3S29A 1NN5A 1U5BA 4W5QA 1K6EA 1RXYA 1QLJA 4NRDA 3UB3A 1DCTA 4X41A 5C51B 3QPVA 1HT0A 2PMWB 5FV7A 3LL4A 1DX4A 2W6PA 1E5XA 4B7XA 3C8HA 4G8DA 4TXJA 4HLUA 3EIHA 4O4JF 5B58T 5LQKA 1MPXA 2CLCX 3AEUB 3BXHA 4OJMX 4BKQA 3MAJA 1JA1A 4MMZB 4C7JA 4D4HA 1SVIA 1NMSA 2QLBA 3LF2A 5TT1A 3TAHA 3PDUA 3ICVA 2QTBA 3Q2KA 4ZVSA 3A6JA 3F7TA 4GMKA 2DP4E 3ZX5A 2H4WA 2CXNA 4KFRA 3V7WA 3RR2A 2NSHA 1RKBA 3MT0A 4W7SA 4I1PA 4J2TA 4UUAA 3DZ8A 2IEIA 1DNPA 3SC4A 4XDHA 4ZVMA 1J90A 1QGOA 1PDOA 1JJBA 2C9YA 3E3LA 2JFBA 1AUXA 1JXMA 3I2FA 3OUUA 3DFKA 3E9QA 4HUJA 1TA0A 2WBLC 3MTIA 3R3SA 4ID3A 5IANA 1BJKA 3V00A 2UV8A 3I6YA 3Q0TA 4L3VA 1XDSA 3ISTA 4GMXA 3C8UA 4GMDA 4TUYB 1YJAA 5ADUS 1AO0A 1XQ9A 1NRIA 2C4NA 1W8IA 3G13A 1UBCA 4L85A 4F6RA 2JFQA 4ER7A 3ZEAA 1NBOA 4XM1A 2A35A 3E18A 4BEJA 1HEIA 3DE7X 2W2NA 3P2IA 4H0FA 5EPEA 1P62B 1PJQA 1RCFA 1UXOA 4LJYA 4UMEA 2AN9A 4CODB 3K71B 3CRW1 4Q9JA 4Z53A 2ZQ5A 1V7PC 1NM5A 4IVPA 4G8BA 3D9QX 1QFYA 4BP3A 4BRWA 1M7GA 1KI6A 1AN9A 2GBFA 3PL5A 4N5DA 5EGSA 1P6XA 1YUBA 3VQTA 2XZLA 5AI9A 5G1PA 3VC2A 4X62B 4PSVA 1EAYA 4TTVA 5B3LA 1ZY2A 1XMPA 1KF0A 4GYJA 1OIVA 8ATCA 4LFCB 3B6MA 5D8DA 1XVAA 2FW6A 4HDKA 5A0FA 4MDFA 4BZXA 3MTGA 1B0ZA 1BZYA 3MCUA 1N2IA 2BKXA 1JHMA 4P84A 3P52A 5BMVB 4V0ME 1O8BA 3FUXA 3QVWA 4OF4A 4Q1DA 4DQUA 2DQ4A 3K9BA 1Q17A 3D5QA 3VAYA 1GCIA 3ZEIA 5ICGA 3P9RA 1T0BA 3HKBA 4DDTA 4R2JA 3P19A 5KS2A 4O0MA 3K5WA 4B3SB 1XMVA 1XYVA 2GKOA 3NM6B 5J63A 3U7QA 1I4DD 4MUXA 1UKEA 2O8DA 4RV5A 5E6RB 1W0JD 2VP9A 3UM9A 4GBMA 3LTEA 2Q3BA 1JXAA 1YQTA 3G5UA 4XX0A 1XRLA 5EHGA 4EM6A 1VG1A 5J4HA 3OU6A 4M38A 4HWOA 4IMRA 2HOQA 5IT5A 2D5AA 4ND7A 3K0AA 3OLXA 1XDBA 5I7UA 3DVQX 3QNWA 2C2OA 2QZ4A 4YRKA 3QQPA 3T52A 2OWDA 1TTQB 4JR1A 2QDKA 4LXGA 1XRQA 2FQWA 1JSRA 5J40A 2FQYA 4EBBA 4UQPA 4J4BA 5CA1F 1L7XA 2WTAA 4DR1B 4QVKA 3QFRA 3HUDA 3WSWA 4TLBA 1RI4A 1VHQA 2MT9A 2VTVA 1BMDA 3E9MA 2O8EB 1EVLA 4LZLA 4OFWA 4PGGA 4L9AA 1JDSA 3EPJA 3DNFA 4W6ZA 3WK7A 5EFOA 4EF4A 5E2BA 2GYUA 4TTSA 1BHSA 3ZBQA 2ERCA 3HQ4O 4MVJD 1EEXB 1NVDA 2JLBA 1W36B 2QJWA 1Z82A 2I9KA 5ALDA 3GIDA 2H4YA 4GOLD 3NCTA 4LOLA 4EL5A 2HXSA 3DOOA 4FYXA 2OAGA 4WNYA 3H3JA 2FV8A 1TEVA 4OHWA 3AF5A 4TV8B 1F2DA 2R6AA 1JILA 1RPAA 5KOIA 1VPTA 4I3HA 2HQSA 3M1IA 3CEHA 1N2CB 3ND7A 4DUYB 1EFVB 4KR2A 4DCVA 3QOXA 3PA6A 2WSBA 3ZGOA 2IIQA 4KDFA 1BWPA 4IIBA 1I0ZA 5FOSA 1V1RA 1NBHA 4EB6A 5F7OA 4H60A 4D46A 2BTEA 1DO8A 3L7IA 3IRVA 2WM8A 3V32A 2FW1A 3GK3A 3WHPA 5KYWB 4AY4A 5ARBA 2QN3A 2FUG6 5E7QA 2NACA 1NQUA 4U7DA 4U2EA 2CHUA 3ESZA 2H31A 3KDAA 5YASA 4L0DA 1TMKA 2G04A 3CYFA 2JHPA 2HADA 2UZIR 1XI2A 3M1YA 2ATXA 3CKYA 4ZAFA 4F5EA 2UU9B 5JCPA 1O77A 3DE3X 5AUQA 3LQFA 1B15A 4IDQA 1CEQA 2QRPA 3FRJA 4UAUA 1ZD3A 4B44A 2VF8A 4UZFA 4US2R 4YQYA 3RSFA 1JHYA 4BQIA 1YE8A 2ZUEA 3D4LA 1E6LA 3GLTA 4GHWA 4QJ4A 3U60B 3GZJA 4F85A 2YVUA 3E5RA 4EKDA 2Q6KA 2V7EA 4I4TB 4DQVA 2PMBA 2C0PA 3I9NA 1P2VA 1XKTA 1VBKA 4XJSA 4BECA 1YBAA 3C45A 3TQTA 3WA7A 2ZBRA 4QT4A 5AVQA 3BB1A 1TO6A 2VP5A 3GDHA 1RLJA 5CT4A 4YMHA 1LDGA 2Z5GA 2ZR8A 4I9HA 3EBOA 4Q7KA 4POAA 2G1KA 1MJFA 4Q1VA 4BYGA 2HK7A 2IYXA 3FBWA 5DK6A 5B53A 5KNCA 3BGDA 5ITVA 4J49A 4BNMA 5KWSA 4LY3A 1W0KD 1T9ZA 2CNNA 1MRSA 3KCNA 4PPQA 2Y1OA 4U2DA 3NAQA 3PIIA 1JIJA 1A97A 2VH2A 3ZTYA 1Z56C 4LMAA 2JLQA 5B3JA 2XSZD 1P1IA 3OLZA 3WGUA 1LKZA 1JR2A 2FVXA 2ORWA 1GPYA 4JD5A 1D2RA 4JYCA 4NDNE 2W6CX 1TM5E 3BCSA 5CAEA 5MFZA 1DS6A 2GCGA 1RC1A 2JK0A 2ZR9A 5D5PA 4F06A 4RTRA 3FI0A 4OQEA 3ZH2A 5JFOA 6ADHA 4QICA 1IHOA 3H11A 3DYIA 5JSYA 4FHCA 3L7JA 2F1OA 1CR2A 4E2WA 4UJ5A 4S1WA 3IAM6 1G1AA 4TTQA 1DC3A 2X1HA 3MWEA 4KWCA 2HU8A 3EH2A 5EZQA 3TJRA 2P9ZA 1SU8A 1IU9A 2O3RA 4R2HA 2FPSA 3CIFA 2MSCB 3GUYA 4FC6A 1FP4B 5JH7B 2E5LB 2O8CA 5GQSA 2GERA 2Z2YA 1ZC4A 1GM5A 2W93A 2V7UA 2W6IA 3RHTA 1EP3B 2WSIA 3FHCB 4C6SA 4CKCB 1ODLA 1QX3A 3IKJA 4A6DA 1E5LA 1YONA 3ZXIA 4Q4AA 4EGJA 3RAGA 1O95C 3FBGA 3FWYA 1N3BA 1NNUA 2JI6A 2Q3MA 1CDZA 3E22B 1R18A 3H0KA 2BH2A 5THKA 2D7DA 3M4YA 2XBMA 2DBYA 5JWHA 4GMGA 1JMKC 3LWBA 1AS0A 2HSZA 1XTQA 3N8IA 3OFJA 3S8YA 3QZUA 5FORA 2AKEA 2BFDA 1S1MA 1TT5A 4LCJA 3FOWA 2M32A 3RYFB 4PSDA 4MPPA 2ZUCA 3V3TA 3VR5H 1QGZA 5IM4A 3IMCA 4JR2A 1DT3A 1QCZA 1TB4A 2VEOA 3CF0A 3EPRA 3HB5X 4F60A 4NE9A 1U0NA 3TZBA 1G1MA 1Z18A 2J6HA 5CLGA 3B6JA 1SGWA 5LYJA 4CTKA 2IIPA 3DOIA 1J23A 5IDQA 4HLUC 1DKLA 3K9HA 1RJDA 2MINB 1RZRD 5EWMA 1PQUA 1A1VA 3K70B 1KEVA 3ETDA 1W6RA 4F1KA 2C3OA 1SQFA 3E3NA 4PLWA 4BC0A 4U7GA 2VDQB 3OJFA 5ICEA 1O54A 4IJ5A 4MRVA 4N54A 1WE2A 4WEQA 1QYRA 5D3KA 5DNCA 1FMTA 1R8QA 4BCCA 3EFEA 4ZODA 4BMPB 4M1WA 5I9NA 3LCCA 4ZU6X 3IB3A 5IXYA 4DBLE 1N3IA 4OKNA 3Q5GA 4PWZA 5DRYA 2CF6A 4GQIA 3O31A 3GLHA 3PDIA 4JBYA 4ZXFA 4WGFA 2ZAIA 4XUDA 3MWEB 1YBMA 1J2TA 3DEZA 4M55A 1FYVA 2IS4A 2W8BB 1XZLA 1XVTA 5JC1A 2FR8A 1Z6ZA 3GLVA 3L2OB 3MWDA 3PPVA 2ZI7A 2O59A 1X2EA 3BULA 3G5AA 4OIFA 4ZCMA 3C0KA 2BEVB 2DU8A 1MIOB 1ZMXA 4BMOB 1U9CA 4MAMA 1VXRA 1XNGA 2A30A 2F64A 1QMGA 4HOYA 4KO8A 2VNKA 4TSFD 1ZA1A 2QU7A 3C6YA 4MUGA 4KLAA 2HXGA 3GJ4A 3U3ZA 2Y66A 2LCQA 3ZNPA 1RACA 1NQWA 2YY5A 3JYNA 4MA5A 5CD9A 3TLCA 4GP6A 4CCYB 1CUIA 1FDTA 1ZS9A 3WMWA 1JT2A 3VYSB 3TOXA 2BSQA 1N2CA 1V4BA 3FA2A 4Q3BA 1ETUA 3NAZA 1GRNA 2C1EA 4BNZA 2XGGA 1DMRA 4B6EA 3FF1A 5CCDA 3RTEA 2Q29A 3FM9A 5DP2A 2I1LA 4O6VA 2WJ6A 3GD5A 1RQPA 3KXLA 1WXWA 1PP4A 1YQWA 2ZYWX 1C4OA 1K89A 4KO1S 5KCMA 4MTLA 4Y6GB 5CB8A 4NZNA 4HFJA 1FTSA 3EH1A 2HC9A 2YIVX 3F3YA 4DDVA 4CKZA 1VKOA 2LR0A 4IJ6A 4FJ2A 2NU8B 3NATA 3K72B 4OP3A 1L5KA 4UFNA 1XPUA 2P9QA 3FLMA 4NMLA 1C9NA 2ZRIA 3CLKA 4MIOA 1QH8A 3CPJB 3HLYA 3HKCA 2X0RA 4XIGS 5CXSA 4C9BA 1W0CA 3MM4A 4C7KA 5A03A 1BXZA 2YR0A 1ZSYA 2VYNA 3IUJA 3QUQA 4JT8A 4NHEA 1YRAA 2OCKA 3BM5A 3RVNA 1BXKA 1M75A 1J5PA 1VRWA 2CNOA 3AKDA 4JEIA 5I9TA 3VR6H 5K0TA 4QUDA 1KPGA 4OK6A 2V7VA 1JEYB 4FC7A 4YMIA 1IN1A 1OT5A 2H8GA 1FLDA 1Z0SA 3HS3A 2WVAA 2FSGA 1LDNA 3I72A 3RBXA 3ZV3A 2X6TA 3SIRA 1POWA 5I7FA 1ZFNA 1GQFA 1O95D 3R0QA 2Q2OA 3FI9A 3RREA 5DW3A 1LDEA 1X9GA 4M9RA 5BYKA 4M1ZA 5FPQA 1DTSA 4IWNA 3F8TA 3O47A 2WUWE 4H0NA 3GLFE 1D1SA 3JD4A 4FOOA 4EGAA 2GPNA 5JDCC 2R1VA 2OLKA 4FS8A 3SM9A 4HNTA 3ABRB 4PG4A 3L6RA 4C7XA 5JANA 4LF4B 3ENZA 3PC4A 5IDYA 2I2CA 4WK4B 3RVDA 1SU7A 2ODAA 4EG3A 4ERXA 1KQPA 2XAUA 1JTVA 5IJAA 4YCNA 1A7KA 2FMXA 4EKEA 3VHRA 2W0MA 5C7OO 3THYB 4ZJZA 4LQDA 1U7UA 5EYPA 1F06A 1F6DA 1W0KA 3DF7A 2VKQA 3ELWA 4KYVA 2GFIA 3L8GA 1UQRA 1LDBA 4MMXB 3ADOA 4OQMA 2DPLA 3B13B 1QHIA 1SOVA 3LHIA 4NZ9A 4D26A 3QELA 3AEQB 3NORA 3G3EA 2HAEA 3CX4A 1K6XA 4JL5A 2V1UA 2FSVA 1SUFA 1DEHA 2ZAMA 3CWQA 5ALKA 4LOIA 3LPNA 3A28A 5HSGA 2DR2A 5IDVA 4DM7A 4QHYA 2B6HA 3TQSA 4CDGA 3K0EA 4M0CA 2B1GA 1R6XA 3VZBA 4ER0A 2X9LA 2VYND 2WF7A 3THWB 1TCCA 2ZJAA 2BH9A 5AW2A 5JXIA 3OCZA 3UAOA 2ANCA 4X7PA 2BCGY 3UGTA 1TIKA 2WF9A 1VP3A 2ZYSA 3Q3CA 1DARA 3A9UA 1SB8A 3IERA 4HO1X 4P33A 5KOHA 2I29A 1SMKA 2QZJA 3KKMA 3H3XA 3NIWA 1EFAA 1QRTA 2P0EA 2HLNA 3LQ4A 3MJ4A 2OCGA 3ESYA 5JD5A 4ZVTA 1P7WA 4DLSA 1SKYB 3A9VA 2G07A 4BKOA 3DLHA 3KXKA 2C2WA 4R8RA 4US0R 1JE0A 4LVCA 4IDEA 1G7TA 3W2GA 2VUUA 2I6FA 2HX1A 2COUA 1YOBA 2NU9B 4IGKA 3EQ9A 1VIMA 4K88A 2ECOA 2FPGA 2XLBA 4LBZA 2BL4A 4R1UA 2NPIA 1EM8B 3RSSA 4JQSA 4ETNA 2Z5VA 5J2TB 3AF1A 5HS6A 4WLFA 1M72A 2Y1CA 2FH5B 2PD6A 3M0EA 4Y9SA 3ZKAA 1XTTA 5IASA 3K70C 2DH6A 3FFXA 2UAGA 3KLOA 3THYA 5EHIA 4A2QA 4YJ3B 3IDAA 2NV2B 1FLNA 2R3SA 1ZM2A 5M34A 5JBNA 3D8HA 1HPLA 1TLFA 4HUTA 4KYIB 1YFJA 3HUTA 2QJFA 3GAAA 2ZAGA 2Y76A 3PQCA 3CVXA 2OBXA 2Z30A 3FTDA 2NZWA 4AO7A 1RBZA 1X1CA 3BKXA 1CJBA 2LD4A 4FFOA 3DFMA 4I9GA 4PTZA 4MW9A 1GAWA 1Z08A 5TQ0B 1SXGA 3ZWKA 3O4VA 3RYCB 3WDSA 2FMHA 3BUSA 2HQ1A 3WLKX 3C48A 4Y8VA 5IT9A 4QJIA 4J0JA 4G36A 4MS1A 1OHHA 1LTQA 1Q0PA 5TVKA 1KDVA 3KR9A 1C1DA 4LZPA 4TV8F 1CDEA 4R5MA 3GN2A 3Q1KA 4S24A 4FJ0A 3ROXA 4RAQA 3ZR4B 2O5VA 1S7GA 4TTIA 2CFTA 3KRTA 4I14A 1IHPA 1RKUA 1P18A 3B70A 4LDQA 1ZN9A 2CNDA 2J3HA 4MKFA 4UNPA 4FFWA 4X71A 4XGKA 1F5SA 4JJZA 3B82A 3T1QA 3SXJA 1LRKA 1V3VA 1GGKA 3L6OO 4KPYA 3W06A 1VGQA 1DI0A 1OX4B 3OQBA 4JMLA 5T4BA 4RHTA 5C46F 1SC4A 3DFIA 3P0HA 5ECYA 4JXXA 1GSIA 2EF1A 2ADMA 1V26A 3DL2A 2MSDB 4MUJA 4BU0A 1H4TA 4XGNA 1ND6A 3JW8A 4GM1A 1JYEA 4X5OA 3UWDA 1P19A 3MMSA 3M9LA 2EKQA 3PC8C 3KLMX 3F49S 3DDZX 4CG2A 3B9PA 1YK0A 2IQ5A 2WOJA 4LXUA 1EP2B 1LLCA 4DHWA 3P4YA 3V8RA 4D42A 2X19A 1L5NA 1N0HA 1UZNA 3KFVA 4R0VA 1PR1A 2J4DA 1NI4B 3U4DA 3W6ZA 5A4MS 2FFQA 3TTUA 3AL3A 4DWWA 5HOQA 4FSXA 4CLRB 1EHCA 4Z0HO 1LI4A 3CX7A 5JLAA 3W04A 4BKPA 2QNIA 2AFIB 2JATA 1F9EA 3LPDA 4LJ9A 1SK8A 3KETA 4GQAA 4FQ5A 1VYHA 1BS1A 4F1JA 1FDVA 4UBKA 4ARIA 3GIWA 3CF4G 3OPYB 4J94A 3AEQA 3A4LA 4AWXA 4ZO7A 1ISFA 4CM7A 3FYTA 1WUYA 1F1BA 3QHAA 3BHIA 4F2DA 2CL0X 3KR0A 4F91B 1ONOA 1Q50A 3DVLA 4M37A 1E1KA 3NV9A 1JR3A 1I2MA 4Y0VA 4EFDA 1TECE 1PR3A 1T4DA 1HE1C 5FT9A 3UYLA 3VU9A 4UZSA 5JXJA 4R54A 3PUVA 4PC7A 1SBIA 3JZFA 1YRQA 2NVWA 2Q3HA 2C2BA 3OY7A 1GSOA 2UXBB 4ZVPA 2Z9BA 4ESVA 3UOAB 4UBNA 3ROPA 1D5CA 3JQAA 5EQJB 2X3FA 2YFKA 5K0FA 2BN4A 2W37A 3CVOA 4LHXA 4IIHA 3ROQA 3LE8A 5A2GA 1K68A 3DPIA 1EP9A 4YAGA 4AXBA 1Y4DE 3EPHA 2H1OA 4ZYUA 3DM9B 1J39A 3H18A 3SIXA 4L57A 5AOBA 5I47A 3DXXA 3GLKA 1L5RA 3EDCA 5DTIA 4RJTA 1ZVQA 3G2MA 2VN8A 3JALB 1AQYA 2GAOA 2X8AA 1DKQA 3QU2A 4L75A 3IEVA 4H15A 5KQPA 1E1YA 2LIPA 2GCNA 3SKYA 2G09A 5LQNA 5A5GA 3QEOA 4B6QA 4BQEA 5CTJA 5EHXA 1ECBA 1PBTA 2P78A 5JG7A 3I4CA 3K5IA 4HVTA 3AIIA 1NPTO 4IGIA 1FUUA 1JEDA 2PH3A 3D4PA 3B85A 4M7RA 3C6XA 3HCEA 4AU1A 2KLBA 3MELA 2FFBA 1ZZGA 2KBEA 1ONBA 4UUBA 5JH7A 3EPLA 2XVZA 3EOAI 3QBJA 1U63A 5CW2A 2ARKA 3K8OE 1N0WA 3P9PA 5ESDA 2CE7A 1HKUA 5BV1A 1MB3A 2ONZA 2MTBA 3L9WA 5TMDA 4MPRA 3D2BA 1FU8A 1C3OB 2QTAA 3UB4A 3WYEA 5ITWA 3SDSA 3UPTA 2QLTA 2C58A 2ZSUA 1ZXBA 3UHPA 5IDWA 2JH3A 5DN9A 1EKXA 2Y9MB 3O8QB 4Y2UA 2Y05A 4N5NA 2GGSA 3PQ6A 4RTPA 3D0RA 2OGUA 3AVVA 3NHPA 2GF0A 2QPTA 4MLDA 3LIPA 4GG1A 4KSYA 5JAPA 1SC9A 1YR9A 3C3AA 2HDNB 2Z6VA 3WWOA 1PZFA 4WESA 4FMDF 1EUDA 1EEHA 4TM8A 4EYGA 3H9GA 5ALVA 2JCGA 2GAIA 2VK8A 5KTTA 5DTMA 4Q7LA 4RESA 4AMBA 3TR5A 2YV3A 1DC7A 2Q8QA 4OI4A 3LNCA 1OTHA 2G82A 5DCLA 3KB1A 5IWAB 4MLPA 2WA1A 3ZWMA 1AKUA 2CBXA 2I4MA 4JIGA 4BNDB 2ZCJA 2I3ZA 3B6EA 4RF4A 4PZAA 4IS2A 1A04A 2VSOA 4HAZA 4NMHA 1QBGA 2E0IA 4JWKA 4CM9D 1EVEA 1JHRA 2FQQA 3OM1A 1YRLA 5EIBD 1LNZA 2PH5A 3C7CB 5G0VA 3BZBA 3NDIA 4MW1A 5LL6P 2F8TA 3RVJA 1ZICA 2B1IA 3KB6A 5AXDA 2B0CA 4CV0A 2G28A 2PH7A 2AGVA 2WAYA 4UVGA 4X92A 1GVNB 1C0KA 3DLAA 1QP8A 2AN4A 1IDOA 3CJRA 3H4MA 3HFRA 3HLKA 3KSDO 4M9QA 4UTNA 1JG3A 3B53X 5LYJB 3R1IA 1T36B 4CQJA 4F9FA 3QF7A 5JSQA 1QO0A 3A58B 2ASEA 3K0SA 3T5CA 1OFHA 1BYIA 3PWZA 4OHVA 1WQ4A 4MWOA 2UZ1A 3R7DA 4D3YA 3LPMA 1A9ZA 3GXBA 1IIBA 3SDZA 3JASA 3ZCQA 3UWPA 2WT9A 3TTVA 2YC4C 1ACMA 2A5GA 3TB6A 3B5JA 4JUFA 3QX3A 2VJAA 3EMDA 3DE5X 3HPQA 5DNDA 2PH1A 4O5OA 5LP6A 5ARCA 3M81A 1MEOA 3G2QA 5B3KA 2JC3A 1BJRE 3ES9A 3AOEC 4AJJA 2NU6B 4F4JA 5KDOA 2IBSA 5IZ4A 4NOMA 4ER3A 1AHIA 4NJEB 4ZOEA 2IF2A 2HBZA 4UHFA 2OMEA 3EGXB 3DQZA 4H18A 5BOVA 2J6IA 2MR5A 1KQ3A 4KN9S 3QSYA 2O8CB 3WLOA 4L6IA 3VR6D 5JNRA 3ZPXA 1RJWA 2RG7A 2LZ0A 4HADA 4ENRA 3EPPA 3VYRB 3KJQA 3RIMA 4DLVA 1TTHA 2CEKA 2XF2A 1C9DB 1Z15A 2DTXA 2QUJA 2YFYA 4QDZA 4TGLA 1N6IA 5AM1A 2DQKA 2D8MA 2ZDGA 1Z35A 1ISHA 1D2AA 2BI4A 1XCMA 2X5KO 2RJOA 4G5HA 4PAGA 3BPSA 4QU5A 4QRDA 1KDZA 1L4YA 1DOAA 1JV2B 2A94A 1E4YA 1UBSB 3SBEA 3IVAA 2J6CA 3IO3A 4O3MA 1ZVJA 2ZS9A 2VP0A 4IIDA 3A14A 4BFVA 3BWXA 1HNWB 3OJEA 3PFKA 4R1MA 5AQEA 3AF3A 3H05A 4IUCS 1A4UA 3TQOA 3WQHA 4FHFA 1NE7A 5TDHA 4EI8A 5I9LA 4EWLA 4Q34A 1JWBB 4NMMA 5F3RA 4CEJA 2CMDA 5REQA 3BE4A 4C4ZA 1G6OA 3N7AA 4JJ8A 5IC5A 3KYJB 3KV1A 4G8CA 2I3DA 2YL2A 4LK3A 5D86A 2ZPTX 1CETA 2J32A 3VSCA 1H3FA 2B0JA 4I4NA 5F5XA 1K63A 4UTOA 5B7NA 1AHPA 5F1YA 2OOKA 2NTYC 4CCAA 3CKLA 4UMDA 2QTRA 1YUNA 4MARA 5HCUA 5HF6A 2JRLA 1WAMA 2C3YA 3OCXA 3CA8A 2E4WA 3T7DA 2RMKA 4TMZA 3LGAA 1D1QA 3B5EA 1FSZA 3TNYA 2G8LA 4F4DA 1E3DA 2JFNA 1B0UA 1P74A 2WU3A 3OQ6A 4DLKA 1X7ZA 4QQFA 4KOAA 1RMTA 1V47A 3KKQA 1JHAA 1JFLA 3EW7A 2WABA 2BGKA 5DM0A 5F2KA 2WIKA 3MXOA 1VPLA 2LE0A 3UHOA 1GU1A 2CZQA 1E2QA 1IG0A 2ESRA 1JR6A 2FW7A 1H8EA 1XYYA 3GUZA 3W4IA 2PX8A 4UAVA 5K4HA 4B3HA 3EZLA 4WZBE 3C7KA 1XTZA 4PO8A 4M9UA 3ZQJA 4PLHA 1T9KA 3H5TA 4AJ1A 4H7FA 3EZNA 3IUBA 1T91A 3IURA 1GPBA 1UIRA 3TOCA 1GHTA 3HXQA 4N18A 5KWIA 2JGDB 2P6MA 4TZTA 3F96A 1FXWF 2PL1A 1XKXA 1B1CA 4OI2A 1X19A 3CF2A 5EP1A 1T1RA 4ZAXA 3ZQ4A 2ZBPA 1P5HA 4EHDA 3MS2A 4ND5A 4TV8A 4F3YA 3KQQA 4LX8A 2OHHA 1J0CA 1HSZA 1IDN1 4CM6A 1SJ9A 3CXUA 4JFAA 4N12A 4YCMA 2DKFA 2IXDA 1PQYA 1VE7A 3LC0A 3WMEA 1YZNA 5IT4A 4B43A 1A71A 3MA0A 2EVWX 4QPDA 2PXAA 4YB8A 3RS4A 2O2DA 4J1QA 3F6CA 5ITZB 1J0XO 2X8JA 1IQUA 3U4IA 4H7EA 1Y80A 1YOVA 2BKUA 2QLFA 3AEKA 1THMA 4L0MA 4QYXA 2DPXA 3VHXA 5IZCA 2XITA 4F3RA 3IV6A 3HU5A 4FEAA 5FUYA 2DFDA 4JEUA 1LRLA 2OO3A 2IWRA 1V2GA 1USUA 4IHQA 4IWXA 3RT7A 2GT1A 1TJ5A 3L1VA 3Q6IA 4FDAA 5K2MA 3C1TA 3ICEA 3W7AA 2XIJA 4FDVA 3DDOA 5A4IS 1UM8A 2CHEA 2H7CA 3IAFA 1EX6A 2H9IA 4G85A 4TYMA 3GA5A 5KNBD 3L01A 1VSQA 4MS1B 2WJYA 1BX3A 4RQUA 4AO6A 1XDWA 1NVGA 3H5NA 1KZ4A 3K3PA 3O90A 1FCJA 1AO3A 1XVVA 2KJQA 4Z3DA 5CIQA 3TL6A 3R41A 4XX0B 4E14A 1T9CA 3L8YA 2WYHA 4AWAA 3MINB 2HCTA 3OVMA 5BNZA 2Q4TA 1RHKA 2B37A 3OOHA 4PPNA 3BL8A 5FNVB 3AP2A 5BN4B 3F7OA 2B3DA 4BWFB 1MC5A 2C7QA 2XWSA 3KQUA 1TTTA 1JMYA 1I6MA 1N1GA 2WD7A 2OFPA 3L0SA 1SBZA 2X86A 4K40A 2MSKA 4QVGA 5GJCA 3RSHA 3TDKA 2GSWA 2HO4A 4QU9A 2YS7A 4XWYA 5C8DA 1FDRA 3S2SA 2ACEA 2QSJA 3O74A 2OILA 1MGOA 4QPCA 4M2LA 1KPHA 3WL7A 1GG9A 5J47A 4YALA 2H07A 3FKSD 3EMBA 3PZRA 3R5HA 2FWNA 2EJWA 1OKKA 1XZMA 2PMEA 2Z5FA 3KALA 2BEWB 2IOFA 2ZIAA 1ORIA 4UNNA 4EECA 1PV2A 3CRQA 3DL7A 2GEJA 4FKBA 4MS4A 2XZOA 5EVJA 2ZT5A 3R20A 5PNTA 1C3XA 2Q6LA 4Q9AA 3VI3B 5CB4B 3AHCA 5LWHA 4P0PB 4EELA 3RRJA 4X94A 2ZK7A 4JU8A 2R8BA 1DVRA 1KI6B 1LC0A 1SXJD 5K0CA 5I7OA 1FP6A 4BMCA 2I78A 2WF6A 2QTZA 5C31A 4BB6A 2VCEA 1TKRA 3PYLA 4G41A 4XIYA 2XHEA 3LG2A 4IZHA 1NBME 3OIUA 4WL0A 2BD0A 4ZAZA 5HKKA 3QTBA 2ISSD 2CLIB 2HGZA 3RRXA 4OHKA 4QFMA 4RZ2A 1TK3A 2DLNA 3EUFA 4O0LA 2D1YA 2EQBA 2GETA 2QRJA 2GZSA 2N47A 4MQ6A 2QJOA 3A6DA 5ES4B 4D9NA 3TD6A 4FT4A 4CM8A 2XUHA 2ZSDA 3UA4A 4QGGA 1YHZA 2GBCA 4Z9YA 1OWLA 1TQDA 4NKRA 5A05A 5CX1A 1Z12A 3ZHOA 2QW0X 2BKLA 4CNQA 3H4TA 1Q7RA 1SBHA 1Z2OX 1XPRA 4Q3NA 1UEJA 1S96A 4DCSA 5F9HA 2E89A 1UXJA 1KEEB 1ZCZA 1S8NA 3QX7A 4G1CA 1VLHA 3QE4A 2FP4B 1BHQ1 3UQYS 3O4FA 1DC6A 1GGVA 3STUA 1WTAA 2V6FA 1YL6A 2RH8A 3IJRA 1AQ6A 2EWWA 3L49A 3LPCA 3WLEA 4B3BA 4E1AA 4EO7A 3DBRB 2IODA 3G2LA 3VZRA 1Z88A 4PN7A 1DIHA 1G63A 2QR5A 1ZIDA 3H5LA 3JD1A 4QXOA 2I4IA 3CJTA 1SZJG 3PWKA 2H5IA 3T1HB 2HCBA 3M6VA 3RS3A 2QN9A 3VPDA 4EOGA 1G6KA 3IPRA 1GNVA 4A6EA 4EW1A 2YS6A 4UM9D 2Y0DA 2PLAA 5KHOC 1FDUA 2V4UA 1L4MA 5I7WA 4ZVLA 2C42A 3NCHA 1Y4UA 2ID9A 1DBQA 1ICEA 5CLIA 3M82A 1B41A 4JT2A 2HUPA 4HL6A 3LDUA 1L5HA 3NZEA 3WQQA 3KWMA 1F2TB 1A5TA 3TW6A 4PINA 4FDUA 1E2FA 2Q5FA 4BLQA 4RIGA 2ATEA 4FCTA 1BKYA 1MGPA 3KSZO 5FOXA 4J1SA 4AF8A 4C5BA 3BK2A 3R7NA 2BM1A 1OB2A 1IM5A 4O4LA 4RXTA 4RLSA 2Q4BA 4O3FA 1UWKA 4OXQA 1AC5A 3A4IA 2NSLA 1L5LA 3RROA 1RE1A 4KI0A 1K98A 2DY0A 2PGAA 4H4CA 1W4RA 2R6CA 3PFCA 3PSHA 1UC5B 4F0JA 2X9NA 3HVHA 4X84A 1OLXA 1KH3A 1IN6A 2HCRA 2PZJA 4RKQA 3H2KA 4J4TA 1G16A 1PK7A 1WXFA 4E22A 5BORA 5HZHA 4JMPA 4I6EA 1JGTA 5FUXA 5ABPA 2QY6A 3UGJA 4YRSA 2C96A 1Z34A 3CR8A 4YROA 5ICCA 4DSZA 3BWDD 3GFTA 1XEAA 3FRIA 1XQVA 1Y48E 3U6BA 4OA5A 4JP2A 4ZOAA 2NU6A 3WGKA 2O6HA 5A0TA 5ALXA 2V54A 1YH3A 4OXKA 4RVOA 1FP2A 1XUOA 1J9GA 2PMFA 3D6FA 4R01A 1E2IA 1QGED 4YAEA 4C43A 1NAHA 3T7SA 1EZ1A 1TD9A 4DA0A 3ZCVA 2FKAA 2G3YA 2AC2A 2NT3A 4KPGA 5D3ZA 5KUTA 3ZE1B 2PBLA 4IO0A 1HQKA 2QRVB 4RZIA 1Z0IA 3OKAA 4K6GA 2HHHB 2QVYX 4UHDA 5KVCA 2XX3A 1TU3A 2H08A 3WNCA 5K4AA 1PVDA 5BNFA 4QDUA 3EXHA 1GGJA 5CDFE 1OQAA 4OB7A 1WXEA 4PHCA 3AUJB 3BXZA 4GR5A 4C2BA 3O38A 5KNLA 1FFAA 3GZ4A 1RWXA 4IKOA 3OWHA 4IV5A 4QPJC 4E15A 3O92A 1NV8A 5EJAA 4EG7A 4XCVA 4COKA 4G07A 1L8AA 1VJGA 3DP7A 4NENA 4CMIA 1GZ6A 4D8XA 4BQNA 3MCZA 3CPHA 1IRIA 4TN5A 4I99A 4Z4HA 4I5EA 1I2ZA 4PG8A 3DLBA 3ZDRA 2BTOA 3AUSA 4H7HA 1W87A 5H68A 3RF7A 1IZ7A 2RAUA 2SCUA 2WHPB 1PV1A 3HB4X 3HO8A 3T12A 4U4AA 4N9QA 4B3MB 2BMJA 2CXQA 5AKYA 2CV1A 2PJUA 1XXHA 3A26A 3NT2A 4IX1A 4WFJA 4PBTA 4Q1BA 3EVZA 4RKFA 2QMZA 3FNQA 1SEVA 1RCTE 1UAAA 1O8CA 3BD6A 3PDHA 3S2IA 1KP3A 3SI7A 1ODTC 4BNHA 4KLZA 1UWCA 3KAJA 1I1NA 3ST7A 1QIEA 3I34X 2RG1A 4GXTA 4MRSA 3WL8A 5KC8A 2D6FA 3PI6A 3ZIAA 2O2XA 3FCAA 2ZJ2A 5C52B 2NVBA 5FBRB 3VYTB 1TEHA 3C4VA 3A10A 3JR7A 2EOAA 4WKPA 4INPA 1Z9BA 3SM3A 2FJUA 1YNSA 1EVYA 5JEEA 1UJ5A 3LKDA 3PWTA 4ZZ1A 1U6IA 4N65A 3P32A 2P2SA 4ZDKA 2G1JA 1Q15A 2XDWA 2EW2A 4JHXA 4EKYA 5BMVF 1X6VA 2XUQA 3T1YB 2B21A 1H2YA 4NOKA 2B83A 5KWEA 1YF3A 4Q7QA 5EGNA 3MTEA 1F5NA 2J3IA 3WJ2A 4D8VA 4EO9A 1OI7A 4C06A 4A10A 3ZJTA 3ASZA 3E2IA 2GD6A 2ABWA 1PJ8A 1E3WB 2LBPA 1TYBE 1BHJA 1RC8A 4NCAA 2PG3A 2ZSEA 2FPMA 3OZRA 1FZQA 4Y1RA 1L5WA 3DOCA 3FJ1A 4EX6A 1Y1QA 3OETA 3SFTA 3NJRA 4QOEA 2ZSAA 4BTEA 2Q7XA 2L17A 2ZRAA 2B25A 2FE1A 1USVA 1PFYA 3L02A 4WRRA 3S8EA 3PDCA 2DB3A 1O9GA 3WIDA 4Z49A 3VGPA 4MGEA 1O08A 2X7JA 4KTVE 5AHRA 4KHPB 2HWKA 1WP4A 3MRTA 5JS2A 4B80A 1QOPB 2SKEA 3W6OA 5K05A 4FR2A 4ZEXA 2PQ0A 2P2DA 1K7CA 2ZJ8A 2HT6A 4DT1B 3H6HA 4YHHB 3VNSA 3DZDA 4BAGA 3I5XA 1LWNA 4HQOA 3CZPA 2C8VA 3TH5A 4GLLA 3X1ZA 1A9XA 3A6PC 3I6BA 3T9EA 1NN0A 3FMIA 2C5LA 2C2MA 2J9XB 1PS0A 4FDLA 2VP4A 1H9AA 1UPUA 3GJZA 1IVSA 3D31A 4ZVKA 5BN1A 4PW0A 2FN3A 5KTMA 1O0BA 1FW6A 3G0DA 4DPMA 1V48A 1P4RA 2P2ZA 1E2KA 4Q1CA 1CNFA 3W8DA 1YU9A 4HN2A 4RIHA 5KSYA 4XUCA 3GLFB 4C0KA 4IRMA 4Q1FA 3LT0A 3EXHB 3BVPA 2R8EA 1F4PA 1GPJA 1M8PA 3NIFB 2J9YB 2P77A 3IP8A 1E9FA 4W1RA 1N7HA 5LIRA 4Y18A 1V96A 2AXEA 2GVNA 2ZDHA 2DTDA 2WSLA 1KI1A 4GICA 5CITA 4KQMA 3OMXA 1GTSA 2GPWA 3FTPA 2P6PA 4JBNA 2PQ6A 2H2GA 1KFCB 2IP1A 2PL9A 2FPIB 4XQCA 3I9JA 5H80A 5AW5A 3TSYA 2AR7A 4D9CA 1SH7A 5DYNA 2JANA 3DMTA 3F5QA 1ZW6A 2CW5A 2IUSA 4LN1A 2OP0A 3GLHE 3X2SA 1I4WA 2OO5C 1BQ3A 1CD5A 1EXMA 5GV7A 5JMWA 1N5JA 2GHIA 2PL3A 1Y8ZA 4PO1A 1RBMA 1BDHA 5IHPA 3H7IA 4B6RA 2ZBFA 4Q3DA 4AUMA 3RFXA 3JV7A 1KZ7B 3KLNA 4CTNA 4KR9A 3Q40A 4JYZA 4YIHA 1CLUA 2A1IA 2ZE8A 1QHGA 3DEFA 2VHCA 1S6YA 2P27A 4Y6OA 4C5AA 5CB4A 4BY9E 3TGWA 1AQJA 1Y7TA 3L4KA 1ZKDA 1LQTA 2RHGB 1GARA 3ZDAA 1NJ6A 5E6SB 3DBIA 1W5FA 2CVHA 1DG9A 1Y37A 1KJJA 2ILTA 3NX4A 4HTFB 4MW6A 4N39A 3M49A 1OI4A 1XNJA 2XNDD 4YWJA 1HF3A 1MG0A 1S2OA 1OGJA 1UR5A 3IPLA 5DP1A 3W6UA 3U44B 1P1RA 5FBKA 1BGXT 2PX3A 4B3DA 5K0LA 4M1MA 5F23A 1WZ2A 4B83A 5A3JA 4IUBS 3DT8A 4QREA 4YRCA 5I4IA 4UM8B 2W4IA 5K1ZA 1PJZA 3I01M 1QC5A 4FYYA 1MDBA 1YZTA 3W5JA 1KL7A 1XMJA 4X1KA 3URMA 3HXPA 5ALSA 2OCLA 1UP7A 5B1YA 4ZCRA 2WKSA 1OFTA 3H1EA 1HE4A 1RYMA 2PJZA 5H3LA 1EVZA 3VDXA 3KXPA 2ODPA 2Z3VA 3NFRA 3HNPA 5F3WB 2IQIA 1XV5A 3DDWA 2J41A 1DT5A 1BW9B 2BFMA 1XU9A 2NSJA 1ISIA 3MSCA 4U1RA 1KDOA 5A02A 3L6CA 2UYGA 1F20A 1YDMA 1E3MA 1HWYA 2DG2A 2YY6A 3CZRA 4WNIA 1KDYA 4XVCA 3JAWB 2I66A 1H3EA 4LIPD 3IALA 2OCXA 1U9IA 3M2TA 3P27A 3LP6A 3DBRA 2NVOA 4TRRA 4UEOA 5B1EA 3KPWA 3HJRA 2FWAA 2MYTA 1ZD5A 1I1HA 3V33A 3NBFA 3VRHA 1G21E 2QRQA 4FIDA 3WB0A 2HK8A 2GYYA 3MZ0A 2VF7A 1W2WB 4TQAA 4PLZA 3QI7A 1X7YB 1QH1B 1ZNWA 1BX0A 1RRKA 2XGOA 3OIYA 3OTWA 4JUAA 3GUCA 5AJXA 5A9SA 1JAZA 1X74A 1RXVA 3GAFA 4AICA 4N49A 3JZDA 4XWOA 2P3OA 3LDHA 3E84A 2JG3A 1A9PA 2OBMA 5L7YA 1CJTC 1VOTA 3U81A 3MRVA 1H2ZA 2O19A 2HR1A 2IHVA 2AOTA 2QXTA 1P3Y1 2CUZA 3K0KA 4H3KB 4BIMA 1MVOA 1ZUNA 2XT0A 3FDZA 4O4HB 4MYCA 5IWCA 1JKIA 3RV4A 1GFWA 1ZLYA 5BT9A 5AW8A 4IILA 2CE2X 3T34A 3IKLA 1DPFA 1CFZA 4FS3A 2FA9A 2DQZA 1EWTA 1THGA 3MCVA 3I1IA 3N07A 3W77A 4CVNA 1K5DA 1RRVA 4GMFA 4HHEA 3BIXA 1K97A 1JQDA 1JEEA 5CD1A 3WHKA 3U3MA 3BHJA 5JSZB 4W5NA 2GD2A 4F92B 5H3HA 1LC3A 1OZHA 3ZVNA 4DSNA 4BKRA 3PYMA 3HCWA 4I3FA 4CUKA 4TZ6A 3R3VA 4CZ2A 2D59A 1NLFA 4UTRA 4JX9A 4PBSA 4HAXA 4YBRA 4E07A 3Q5DA 4PGAA 2ZRJA 3EIXA 3HJTA 3N8GA 4MS4B 4O4JA 3DPUA 5C35A 4BCDA 4V1CI 1DO2A 1VHDA 2IA5A 3JYOA 3KUXA 2Z5LA 2VQ3A 1R88A 4RV9A 1BNCA 3C3PA 3REOA 4DLBA 5JZ9A 3L5KA 2JL1A 4V2UA 2J5BA 4U7HA 3DMPA 4Y3UA 3RRNA 3VVCA 4QJ5A 4CKBB 5A9SB 1CQJA 1MH1A 1G9TA 3C6ZA 4NXNB 2HMUA 4BGVA 2EEPA 2QAGB 5EJ9A 4GL2A 3RFUA 1SOUA 4E11A 2BP7A 2DULA 3ROEA 4R8KA 5AKJA 5CFRA 1NXWA 1T2FA 4B8WA 4PVCA 1A8PA 1IIRA 2ZB8A 4RFSA 3R6TA 3OEED 4QUIA 1TOAA 3DVSX 3GHHA 3H1GA 5LJLA 1HE5A 3IIMA 3V4SA 2G17A 4EFNA 4RA9B 3AKZA 1UC4B 4NBTA 5CIYA 1ZRSA 2AA3A 2BMWA 4ERNA 3B51X 3ROFA 1IM8A 1XHEA 2AD1A 1V8FA 4GEKA 4MQLA 4C1NA 3U7GA 1BDIA 3TKYA 4J2OA 1SQ6A 3EVFA 3U16A 6PFKA 2IHUA 2P9BA 2IOYA 1OYYA 5ILQA 4AS3A 5DSXA 4R3WA 2AYYA 4QZVA 4RY0A 3Q7RA 5DISB 2YXNA 3S0JA 2XT9A 1R15A 2OVFA 1T0PA 4KDCA 4KL8S 2GR9A 4FMCF 3JQGA 4PCLA 4C3VA 4Q24A 3NTXA 1KO1A 3ANTA 1DP4A 2HF2A 2IY7A 3FVVA 4U0JA 3KKPA 3F4KA 2PYZA 4DILA 1EUZA 8LDHA 1JVBA 2QLJA 3AESB 5SYAA 1Y5NA 4ZV4A 4AJPA 4FOPA 1F7UA 4PFJA 3O0TA 1D9XA 4BFCA 4Y0AA 1BG6A 3DMTC 3INNA 2VZLA 3IE1A 3BT7A 1M8KA 2PZFA 4NY1A 2IYTA 4UOZA 4A1OA 4V39A 2HA0A 1H1LA 3S2EA 3DL4A 3DE0X 4CF5A 1AURA 2XNJA 3D3WA 4QBIA 3NC4A 1U7XA 4FUQA 2QW8A 4N5HX 4Q18A 1E18A 4LV5B 1Y5MA 2EERA 3Q7SA 4O33A 2YBDA 2IYZA 5E7JA 2X2OA 1QIIA 5CMLA 4EFKA 4MCJA 4TS3A 1STOA 3KM0A 4PICA 4A4DA 4DZZA 1JIQA 2JA2A 1RWPA 3K32A 5IVDA 3R7FA 3VNQA 1XJ0A 1USGA 2GN6A 4I1SA 3V4FA 4RADA 4CDRA 5HZMA 2PCLA 2W2QA 5EXEA 5A3RA 1L5SA 2POCA 3ITDA 3QEMB 1MNQA 3NEJA 3SKXA 3W3AH 5SZHB 3AFIA 1DIGA 3U4AA 1UF9A 2VLBA 2WMOB 5JXWA 1KK3A 5ES3A 2C5SA 4LXYA 4ILEA 2CJPA 4M8IA 5K8CA 2N3ZA 2OL4A 1P3JA 1BU5A 3KHUA 1JQLB 4JBLA 2YWHA 3GQVA 3D59A 1WZCA 4AKHA 1KMQA 4E88A 1SHLA 1MOZA 1QAQA 2MU1A 5EP4A 3V8EA 4LOAA 1EFHA 1BWQA 1F8YA 2G4CA 3B52X 3OEEA 4EHFA 1E1QD 1IXYA 4WMLA 1T34A 3ETLA 2E4UA 2HMWA 3WL3A 1ZHHA 4J0EA 2ZJZA 4NI5A 1GSHA 4G26A 5TQJA 4N48A 2XUIA 1SB9A 1JR3D 4P32A 4BV2A 1DDGA 2N1BA 1GDDA 4AB1A 4JSTA 1AZLA 2YXEA 2H4JA 3FB4A 4NBKA 2FDRA 3WK4A 3ZY3A 3JZMA 2OG1A 2J9GA 3A6EA 2WNIA 3KU1A 3WGZA 1BHO1 4BO4A 4Y2VA 3ETEA 2XVMA 4WDRA 1K5HA 1CY0A 2GPBA 2XUZA 4CCWA 2GYWA 4QXPA 2IUYA 1B6RA 3TNFA 4HUQB 5PGMA 1B43A 1LLQA 3OIGA 3H99A 4IZOA 4XB6B 5AH0A 1PFWA 3F2VA 4Q5IA 1R16A 4YUVA 5JQGF 3RS8A 2BKVA 1QIFA 2P9TA 3IEXA 3SVZA 4B2YA 1HRKA 4FDMA 1MV8A 4I8DA 1YBFA 4KQ9A 3B6KA 3UAWA 4CLDA 2BMFA 3MS4A 3G2HA 4RGQA 1PJCA 2YKGA 1RWMA 5AKLA 5IZCC 1ISJA 2GEUA 5E0KB 4Q4AB 4K2HA 2PGOA 4FWBA 1YVRA 3AZPA 4F6LA 4H0CA 5CYPA 3ZLUA 5EAIA 2CC2A 2QW1A 3QLUA 4GXQA 1PD0A 3A36A 3GDWA 2BLNA 3DLCA 3FXAA 5BN5B 4RMGA 3R3ZA 3A7DA 3S1LA 4EW2A 2QGZA 1R0KA 1XL0A 3KKNA 4HN9A 3T1OA 1JH8A 3ZK9A 1GKYA 3ZHBA 4KNVA 5CVCA 4L9WA 4ZO4A 2XMGA 4M21A 1FVXA 1RQ7A 1OBCA 2GLUA 2JAPA 3HZRA 4QVIA 4BVEA 2X5XA 1YKSA 2P1ZA 2Y1WA 4DAEA 5LCXA 4X8LA 1UBHS 4HAYA 3CQ9A 3L92A 4YP9A 4K0RA 1XWFA 2OBNA 5IH7A 4AC9A 2IHJA 3K6RA 2ET6A 4P3NA 4GNKA 4RZXA 4ZT7A 1QGUB 4H9GA 1QIKA 5FHQA 5DN6D 3GFBA 4DLWA 1D5WA 2FB9A 1H8HA 2AOVA 2FUCA 2HDHA 3CZMA 1UQUA 2XMCA 3R5XA 2QD2A 4QTTB 5ESXA 5I8PA 3P0RA 3RFCA 1EIWA 1GAQA 5FL3A 1ORDA 2ZAYA 3R7BA 4FB5A 1PJAA 1THTA 3L6BA 3PQFA 2GJ9A 3FCUB 3LCUA 3EYWA 3FAKA 4PF1A 3R9KA 3T4EA 3VMMA 3ZVLA 3AGPA 1JECA 5CDGA 1L5MA 4HMOA 3A2LA 3Q2OA 3QNMA 2R1UA 1KRWA 2PV7A 3ERCA 1CCWA 3C8ZA 3HCPA 3IQDB 1O94C 4FMPA 4KAJA 2QQ0A 4B2LA 4EZBA 3EHDA 1GVHA 2XOEA 3IDZA 2VI5A 2VXCA 2XA1A 5J59A 4C4XA 5KOJA 1TAUA 1V16A 2AMJA 2FZLA 1IN5A 4QE3A 4G0PA 2KX7A 3A4YA 4NENB 1QFSA 2BV3A 2I5PO 3HVIA 3W6NA 3ZZMA 4NYMQ 4YRQA 3VYWA 5INTA 3QJYA 1SXJB 2Q45A 3VOAA 1P17A 5HCIA 3SBOA 4KNWA 4DQLA 5BNWA 3VHLB 1VMDA 1CJVC 1TQHA 4X54A 4BVLA 1I30A 1PFVA 1PK8A 1U0LA 4JKIA 5K8UA 2V59A 3BD8A 4IF4A 1U28C 1ZI8A 2G88A 4GWGA 3TW8A 2OV6A 4DHEA 2IU3A 3OPYA 4X8OA 2GWHA 3W1WA 3ZXSA 4NG5A 1UBMS 2WFLB 3HC7A 1HG0A 2CD9A 3QP9A 1EUDB 3GFGA 4WBNA 3IR5A 4GL4A 4HEHA 2BHSA 4MGYR 3UK2A 3W5CA 4G0UA 1SNYA 1Z8HA 4BX3A 3STYA 3MJSA 3E9EA 2IW1A 3WK9A 2QG4A 4FVTA 5ENVA 3WGMA 1PDWA 3CSUA 4D3DA 1E0JA 4OSEA 2WB4A 3HP7A 1GTL1 1J1ZA 3NETA 2BM8A 1JDBB 4OK5A 2ODQA 2Q07A 1JZQA 4G5RA 3NASA 2QRNA 4MTCA 1A2KC 2HBQA 3R3XA 4LV6A 3SEAA 1EUCB 3H6KA 4FJ1A 2VCYA 3NWJA 2ZRDA 3KUKA 3CEJA 3ZKWA 1D4FA 4HWKA 2Q50A 3H16A 1PIWA 3W2EA 1NJ2A 1JG6A 1OLXB 1L5ZA 4IHAA 4QEKA 1BFUA 5CH5A 2XOXA 1IVYA 1EDBA 2PANA 4XCQA 2FK7A 2FI1A 3DXFA 3GVCA 3JQ7B 5B37A 4B4OA 4BNUA 3OX1A 1CUXA 4HYTA 1HLPA 1OWMA 2AZDA 3HRKA 3OJLA 1XLTA 2QYOA 3TGPA 4XGRA 4O02B 3OKFA 3HA5A 4CDMA 3B9RA 1E66A 5TEVA 4LAFA 2I2XB 1I3KA 3CLTD 5HF8A 3UC5A 1F4LA 3UJ8A 3AINA 2VZ9A 1JIUA 3N2KA 2F1JA 3K0HA 4Y2PA 2FZKA 1GIAA 1U6KA 4QOGA 3UBMA 3VV3A 2XT6A 5G4LA 1KK1A 2I0FA 2QAJA 1RLOA 4GT1A 4J0FA 4OKIA 4X8MA 3QOYA 4Z4QA 1RYNA 5LUBA 1KPIA 2QE7D 4H4EA 4L8WB 3WLJA 5CEJA 1UAYA 1XA3A 3UF0A 2VAVA 2AOWA 2FXIA 1OX6A 4K6FA 4B6JA 1XCJA 2V7BA 1T3HA 2R11A 1JLSA 3EY9A 1SULA 4CM9A 2H5LA 1R50A 3VU9B 5JATA 4BDSA 5JXHA 1CKEA 1Q21A 3R5KA 3NYQA 4PNZA 1THZA 3QYAA 2A1UB 4R1NA 2FEMA 1DIOB 3BH6A 5CT6A 2HRBA 3A3KA 2HHAA 3EODA 3LK7A 1SD5A 2Z3ZA 3EC1A 3FOBA 3PXXA 5G02A 1WSWA 4YV2A 3NNDA 1DO0A 1RXIA 3NPMA 4C0XA 3DULA 1VKJA 2YOHA 1ZJ4A 3AI2A 3HSKA 3O21A 3OZEA 4Q3CA 5H3CA 3D7SA 3AHDA 4FE4A 4OB8A 2D5BA 1TVKB 4RHEA 1SC1A 1W4AA 4NBSA 4YDQA 1OZGA 1N6OA 1YI8A 2I9PA 2O2JA 2PU7A 3PHIA 4H1TA 5JAMA 2YIMA 4KO4S 3FSRA 1GG8A 2PHZA 1ZGHA 4DYVA 1NVXQ 2JZNA 4ZAVA 4ZI7F 3DZHA 5JWRA 1RQGA 4ABYA 4BVBA 1XO1A 1VCMA 3UYKA 4MYUA 3GNTA 2CNWD 2WF8A 4C88A 2YMMA 3OJWA 1I36A 1H2FA 4H6WA 4JLNA 2YVQA 4EMUA 3CR3C 1Z2NX 5HXAA 4PIMA 3AV0B 1P45A 4R9NA 1X3LA 2WYUA 1DTWA 3V9PA 2NXNA 4EB0A 3D3EA 1SUDA 4HY3A 5EZYA 2PV0A 3PEEA 1VLVA 3SG0A 3LPLA 3HVKA 1QYCA 2CJYA 4CQLA 3B2NA 5A4KA 1OW3B 5JCJA 1GKUB 4D8YA 4ETWA 3TRFA 2WWXA 3H97A 4I3GA 4EG6A 1P5JA 1D0IA 4LF5B 4FNOA 3ZXXA 1YDGA 4JC4A 2MWMA 3O4HA 2ZBDA 1KAQA 2BF7A 4R3UC 3WV5A 3UGQA 1WDMA 1HGXA 4G6ZA 4IYRA 4WOPA 1Q57A 3UJ6A 3I5AA 1E7QA 2JI4A 1GYPA 4E31A 4J75A 4CLEA 1Z7EA 3PNKA 5KAMA 5JPIA 4DABA 4WLUA 1JAYA 2JVJA 3TAUA 2RH5A 4L5BA 4G2NA 3E48A 5DJ5A 4ZQBA 4IMJB 4BNGA 4Y2JA 3KYDA 1DAPA 3HL0A 4B4WA 4Z8XA 1MZVA 3MS7A 2HL6A 4BRZA 2ZTSA 1COWA 3TNDA 3EB9A 2PS3A 3LGSA 1SOWA 4LI0A 1XN1A 2P2YA 2QLLA 2V4ZA 2H6EA 3GC6A 3A1TA 2VAWA 2EWVA 3P0IA 4NFHA 1ZK3A 4P4SB 4BMXA 1A8HA 5DX8A 4G09A 4FYHA 3ZQKA 1GFZA 5TNXA 1UT5A 1N5RA 2Q7DA 3WGOA 5CPBA 1IRXA 1WUJS 5EIOA 2F1IA 3FZQA 3CLRD 5KYXA 3UB2A 2FEOA 4OQDA 3ZWDA 3LGXA 1Y98A 2VHJA 3FR7A 3NVKI 5CBPA 5HRUA 1M2FA 3TCXB 2EZ4A 4XX1A 1QIMA 2QUAA 2AK2A 1WVGA 4A0RA 4RCZA 2ZIXA 5T4HA 5FXMA 4MVJH 1R1DA 4RCVA 4MQBA 4P2BA 3U0VA 3QE9Y 5BN3A 5GPBA 2RCYA 4HXFB 4EPYA 4ZV9A 3U44A 3IOBA 4LMPA 5FNZA 1KJ9A 1IY8A 1GTMA 1PR6A 3K0FA 2FZ5A 3DONA 4TTPA 2BOVA 5HJ5A 1NVAA 3WL5A 1PF7E 1PJBA 2FRXA 2HN9A 2IHZA 1F0NA 4Z2YA 5K03A 4WXYB 3RODA 4EENA 6REQB 4Z6KA 5BSGA 3THXA 3A70A 3IIEA 1XT6A 5AHXA 1U80A 3C16C 2HA4A 5AVKA 3QVOA 3VYVA 2ZIUB 3BK7A 4A16A 3LOUA 1PJRA 5KEIA 3N0VA 1W88A 1WZUA 3G6KA 3U7IA 4CM1A 1IB6A 1NVKA 1RAAA 3CY6A 2C04A 2GAJA 3N87A 4CU5A 1AGYA 4YT5A 2OK7A 3BMQA 1Z4LA 1F38A 2HU5A 3EOZA 3P20A 3JPYA 3W8RA 4IDBA 4F04A 1YS9A 3MUNA 5CJ2A 5BQFA 4BQSA 4IICA 4P3OA 1EHIA 3CW8X 5AMXA 2PU5A 4CCYA 3T15A 5DEIA 4BFSA 2VJLA 1YS4A 3U1VA 4ITRC 1UPFA 3ZY4A 2QEQA 3WSVA 1U1GA 4ZI5A 5H4HA 1IY1A 1ODIA 3A4TA 3BWEA 3E7DA 4M1QA 1KY2A 3U7JA 4OOEA 1JKJA 1RKVA 2D2EA 2FYTA 1OFVA 4Q93A 5CJJA 4L9RA 5FB3A 1AA9A 3BSWA 3VPBA 1FJ2A 1UPTA 2PTGA 3DEJA 4V0RA 2TMKA 4G5OA 4Y6PA 4R8MA 5AVSA 3DW3X 2GN9A 4V1CB 2GD0A 4IUYA 1T43A 1ODFA 2C5FA 4LMRA 4NJOA 3BSSA 3N8HA 1LPSA 4Z9AA 1KAMA 4YCLA 2OFFA 5KCZA 1U1CA 3KG2A 3DMRA 1BVUA 3K1AB 5DM60 2A86A 4MYTA 1FFHA 2G6TA 5IYZF 2WU4A 4JN6B 1DWUA 3M6FA 2E21A 4KVGA 3TJMA 4YY3B 2BRUA 3RU3A 4XWWA 3HDJA 4V38A 2MIIA 5HJEA 2R65A 2C9BA 3RKRA 1YZGA 4JQOA 5I9IA 1KQGA 1RXWA 2WJGA 1T8TA 5LA6F 1SBQA 4YXWD 1G64A 5TE9A 5B12A 2HNKA 2LRHA 3G89A 3E9DA 2IZ5A 1V43A 1X1BA 5SICE 3WV4A 2ODNA 2VF4X 3WBKA 4CLOB 4DC9A 3CTPA 3HRHA 3U7HB 1CQWA 2B2CA 1U3DA 2A58A 4W99A 1HDXA 1W19A 4HQNA 1NU8A 3DMNA 1Q1ZA 3ZNNA 1G2OA 1RJ9B 1CE8A 1JIXA 1WDWB 2KMLA 4BYMA 1N1EA 4Y9RA 1BXRA 4B40A 2O9JA 3L9XA 3T7AA 4BX8A 5CFOA 3R74A 1H66A 1KAOA 2Q9CA 3C8MA 4CM4A 4RSHA 3WAKA 3D6UA 1L7PA 3AG5A 1J5XA 3H1BA 1V7CA 4MKGA 2G5CA 3I2GA 3I6IA 1HORA 1P2SA 1FLVA 1HDGO 1V5EA 3PNBA 3KD2A 4JFRA 2XJ9A 3W5SA 1WPRA 1T4BA 2ATVA 2VHVA 1O9HA 3HDYA 3OQNA 4DWVA 2Q4DA 2BEKA 5DLDA 2PRKA 3GF4A 4UE2A 5AJUA 2W58A 4XB2A 4JI4B 3EN0A 4H7DA 4EB8A 1YDWA 1MMFB 1EUCA 2L18A 2A9KA 2OEPA 1I4OA 2WMNB 3E70C 4X1OA 2W70A 1SVNA 4ZI7A 4RH1A 4BNWA 4PYMA 5IM4F 3W5IA 2NP6A 2X42A 3G0HA 1TKBA 1UH5A 2JHFA 1DWOA 3A27A 3E81A 3SXUB 3VKFA 2R8RA 1KEWA 1U1FA 2FEXA 2VXOA 2W22A 4Q47A 2IEGA 2DJ5A 3LCVB 4JOQA 1Z6QA 1PT7A 4DKJA 1J9EA 3NUQA 1J8MF 4LMBA 3NDPA 5K5EA 4URUR 1G8PA 1Z4IA 3LP8A 3FFTA 2P68A 2ZSBA 4KLCA 4Q3OA 3REFA 2ONJA 5IVHA 3CW2A 2GD1O 1BJTA 2NNLD 2QU8A 3RHZA 2IZ6A 2XWQA 3N76A 4JOBA 3VU8A 1ZJJA 1NY5A 4ZI7B 2GM5A 1W30A 4RJ2A 1HNZB 1LTKA 4RYDA 1A5SB 1EBUA 4L72A 2IKQA 5EMJA 3HXMA 4I66A 1F12A 4DB4A 1EJ2A 1Y1RA 2HSWA 2JHGA 2N42A 3CM0A 3UMMA 4A2PA 2J6BA 4WA8A 4B7AA 2WICA 1L7EA 4CG1A 3K30A 3A4MA 5JAUA 1XXLA 1GFIA 1LK0A 1ZSVA 2H2WA 4KWEA 5JASA 4LJ8A 4WCFC 5SZJA 1T5TA 5JDIC 4D6YA 5FFNA 3TTXA 4HDMA 2HFJA 4D4LA 4GX2A 1T5OA 1SCQA 1QR2A 2W6ZA 5GIOE 3FWHA 4M22A 5GOZA 3ECCA 1JDUA 2W6ID 1SXJE 2EZ9A 1R7RA 1T8WA 1OWNA 3H5IA 1FNSA 2PX2A 1COZA 1NQTA 2VH5R 2N9UA 2HO5A 2HLDD 5H81A 4B71A 5IBCA 1HLDA 2CD7A 1XTKA 2QM3A 2XA2A 4W9NA 4UU1A 2JRCA 3CZAA 4IIYA 3LH5A 3MAAC 2JIZA 3OZBA 1IOZA 4KWHA 2PYDA 3I23A 3I5YA 1DMSA 2G76A 2I7CA 2DYKA 3LA6A 3MHPA 1GXSA 1LI7A 4GI1A 4QGHA 1GWNA 4EX7A 4JBGA 3QFCA 3PGXA 3C1AA 4V24A 3DKPA 1VBFA 4LTMA 5KINB 1J2JA 2IKSA 5HIIA 1NXSA 3JQPA 1PZGA 3IQXA 1ZOOA 1W5SA 2V7QD 2PXHA 2QYSA 3LT2A 1P0CA 3WADA 3G0GA 2Q49A 4KQKA 4B4KA 1WOMA 5AJYA 1E4EA 4HVAA 5BSRA 5MN5A 1WCV1 2QX6A 4LEIA 4WVLA 2PUFA 4BO0A 5A4DA 2A3NA 5LVAA 4RY9A 1E9DA 3GEPA 3RVLA 5IKPA 3IV9A 4DMUB 5BSKA 5BMOA 1WD7A 5K4GA 3W5DA 1DIRA 4KMSA 1WEHA 2B1RA 2YZNA 1T0JB 1YS6A 4KO2S 3SMVA 4H7KA 1DEXA 3VR2A 3W9YA 1V9LA 3L1KA 1N8NA 2WQ7A 1LW6E 2GPJA 3D5EA 4PAQA 4BFXA 3CLRC 3UATA 2H4XA 2XLCA 4KWTA 1Y8CA 4DIEA 1B23P 4Z9BA 4TT3D 2K2WA 3UMJA 2G80A 1EFCA 1BXRB 4KFTA 3ZLTA 4TSFA 4I50B 4OY3A 2WMDA 3EFHA 1GUDA 1PYDA 1FDOA 2W2TA 3PEFA 1O5IA 4Z8YA 1ZXLA 2I8LA 1SUCA 3OSZA 1UOPA 4QG3A 2FF5A 2IZZA 3GZTB 3Q72A 3NWBA 4DUGA 5IAOA 3EVBA 4EF6A 1L3BA 1XAHA 4EMSA 1F8UA 2Y4OA 1M83A 1BCRB 4NECA 4PSAA 2B20A 4RVNA 3BD9A 4AZSA 4EQ6B 4DUZB 4C7VA 4W1QA 5IMBA 7ADHA 5G3ZA 3Q4GA 3ZHRA 2D1QA 4ZXPA 1CUZA 2PSJA 2WFZA 1IUOA 3L3BA 5EUMA 5BMVA 2I54A 1JLLB 3I05A 5FI3A 3QU7A 3D7MA 2P3LA 2UZ0A 3DDUA 4CL8A 4J90A 4J0GA 4WGGA 3M6UA 1KXJA 2EFDB 3QA9A 1MX5A 4HDKB 3EVGA 3M4ZA 3OQ1A 2C8JA 1PWYE 1WTCA 3F5DA 4Y7DA 2O3UA 1SHTX 2AZMA 4HH0A 4BVHA 2OXRA 3X2EA 3OFNA 3HCOA 5E4FA 3BRCA 3UT5A 3BWCA 3JAKB 2VHZA 2DT5A 3EULA 3UHAA 1RI3A 1CUAA 4D9MA 4E7OA 4BNDA 4TZ0A 1WHTB 3FYHA 3RLFA 1Q77A 2CDRA 2M2IA 1CZKA 2YDXA 3PE4A 2J5KA 5GADl 4CF3A 5FI0B 3WIUA 1RMYA 2G25A 3IC5A 5CYGA 2D0PB 3NTOA 5HKAA 5DVZA 4U7FA 3K94A 5LN1A 2J9FA 2W6QA 3IJ5A 1B26A 2XE8A 1DLIA 3W90A 9LDTA 2PM8A 5I7SA 1D04A 2WHEA 1OI3A 3EG9A 1TQ4A 3GP3A 3H4VA 3OURA 1LDYA 4FW9A 4ANFA 4R7ZA 1N25A 4BUJA 3SVLA 2NO7A 1EVKA 2FDXA 2IELA 1TJPB 5FFFA 4PVDA 2A6PA 1U99A 3OMWA 4FUTA 4LKRA 4RY8A 4FT2A 2IOFK 2E37A 1I6WA 2O6LA 4H6XA 4IGFA 5JVDF 3T9AA 3D3JA 4G5QA 4HWPA 2HZBA 5FYQA 2RC6A 1FY2A 4NESA 4P83A 1JAXA 1QTNA 1JWLA 1C1XA 4UDOA 1UBLS 2JVIA 3LQYA 2JAOA 4GKAA 2HRQA 1FRZA