1XMPA

Crystal structure of pure (ba0288) from bacillus anthracis at 1.8 resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
b'KSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQMPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoribosylaminoimidazole carboxylase
publication title Crystal structure of PurE (BA0288) from Bacillus anthracis at 1.8 A resolution
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase
total genus 53
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1xmpA00
1XMPA 1O4VA 5CTJA 3RGGA 4JA0A 4ZK2A 4AY4A 2FW7A 5CVTA 4B4KA 2ATEA 2FW1A 3RG8A 2NSLA 5CLJA 2FWAA 4YCDA 4ZC8A 1U11A 5C5DA 2FWJA 3KUUA 4Z7JA 5BOSB 5CLHA 2FW6A 4ZMBA 3TRHA 5CLFA 2NSJA 5BORA 2NSHA 4GRDA 4YCJA 2FWBA 2H31A 3ORSA 3OOWA 2FW9A 3OPQA 5CLIA 5CLGA 1QCZA 2YWXA 4AY3A 5BOSA 2FWIA 4ZJYA 3LP6A 4YCCA 2FWPA 4YCBA 1D7AA 2FW8A
chains in the Genus database with same CATH superfamily
2JFWA 4RPIA 4HK4A 1RI4A 3WC4A 5EHXA 3HO1A 1NQTA 4DG8A 2YIMA 5AOVA 3UJBA 1P1HA 4BV3A 4DOMA 3GMTA 1PR3A 1AK1A 5JCOA 4D4LA 2DR2A 3BD6A 3ZZTA 2R6GA 4KAJA 2PD4A 4BL5A 3TK1A 1PZFA 2WTEA 1NW3A 2AEJA 4OUDB 1ILWA 4YRIA 1P9WA 2QPOA 4RTRA 1SXPA 1Z3IX 8GPBA 4ZDJA 5DVZA 2C2BA 1GPBA 1FUYB 2OAQ1 4JLBA 3GH3A 1MAUA 4KN6A 2CXQA 2BFBB 4RXUA 1Y7IA 3GRYA 1SUPA 1BWPA 2DY0A 1Z07A 2O8NA 2IV7A 2VL7A 4XVUA 4FFNA 1XU7A 2CYAA 1DAHA 3C43A 4M7OA 1AGPA 2XEXA 3VOSA 4FE4A 4DLSA 2R60A 1SCBA 4WJLA 2JIMA 2QZJA 3MTBA 3SYMA 1BE1A 4IJKA 2DWQA 5DTMA 4IDFA 1J2EA 1YS9A 3OFNA 5BYJA 4M36A 4EB6A 4LY6A 5DTEA 1L9KA 4FOSA 2G1JA 2OK8A 3VI3B 4R8RA 3AY6A 4WOJA 4F2HA 1YJBA 3STYA 5EP2A 3VR6A 3GNLA 2GBLC 3LA6A 4L50A 2IQ5A 5K20A 4RFVA 2ZWMA 3NB0A 2JEZA 4UUAA 5B6JA 2HA0A 1ITZA 1WSDA 2ZPAA 3IIMA 5KHLB 3E5NA 3PNQA 3R4CA 1W9HA 1MOSA 2RG1A 1WA5A 2ZJBA 4RFLA 1YB5A 4OBXA 1YCGA 4LOJA 4IYRA 3WB2A 3GXOA 2ENWA 4YPVA 3D5EA 1AF4A 3DE0X 4UUMA 4DLBA 4UBJA 2VZ0A 3PC8C 1I94B 1RYMA 2GEBA 2JZOA 2MYTA 3O8QA 4V39A 3ROTA 1XRNA 2Y1LA 3PHCA 3TTUA 4O3FA 2FJ0A 2H2WA 3VISA 3DHWC 4TQAA 5ITZB 4IMPA 1I7QB 1GPUA 1BJRE 3UXMA 4GD3Q 3VU9B 5HG0A 4CF3A 1RC1A 1TVMA 1Z26A 2GVDC 5LP6C 1NW6A 4DVJA 3HM9A 1SVUA 2ZRBA 3A1NA 1K4YA 4OQMA 2GXAA 2W2NA 3FTCA 2ZS7A 4ZGBA 1FX0A 1W6RA 2UUOA 5E9JA 1BTOA 4ZEWA 3C1AA 1D2AA 2IXFA 3PENA 2W58A 3S8MA 1IB0A 4UDXX 5EQTA 3SHVA 3WWDA 1KXZA 3O2SB 4I1RA 5EJ2A 4HYQA 1F12A 3L8DA 3UUEA 3VAYA 4DQXA 1C1DA 3EG9A 4P3OA 1YNOA 4R5MA 3RAEC 1BKSB 1IZYA 4N0MA 5GONF 1MA3A 2F43A 1EE9A 2JJ1A 5BSRA 3WL6A 3HDJA 4BP9A 1SN7A 3FOEC 1R4MB 3PJGA 2SCUB 1QFZA 3CX7A 3N5CA 2YC4C 4H77A 4DCVA 4BB5A 2ST1A 2HIAA 4YXWA 4CODB 5LQMA 3ESYA 1HMPA 4IH1A 1LGYA 1Q0SA 2A2ZA 1KPHA 3AR3A 4RVNA 5FEMA 5IUJC 2ZI3A 2FMHA 3OIFA 2C5FA 3NAGA 2QGFA 2WQZA 1C9DB 3HYCA 3R7WB 1WOMA 2XVYA 3WO0A 2Z56A 4HFMA 1IYZA 2EBWA 2NW6A 3DBIA 4XR4A 1PAUA 5HK8A 4TVSA 3UA3A 1IBMB 1QANA 1RZUA 3ED5A 4FSXA 4NNPA 5EPOA 1FTQA 1R15A 2ZSUA 4P3NA 2IUEA 4FMDB 4JEHA 1DB3A 3ZHRA 3EY9A 1WMFA 3GFGA 2BBWA 3ENKA 4J76A 2EZ9A 3I58A 2Z3ZA 3EA4A 1V9SA 3LC1O 3RS7A 1NA5A 2PCJA 3AIMA 4OBBA 4N6OA 1EDZA 3KUXA 1L7MA 5IM5A 3ZWMA 4XUEA 4AQDA 1N1MA 4K6GA 4MP6A 4LFAB 2OSVA 2PMDA 3K15A 5IM4A 3CH4B 3V8PA 4JUFA 1RRVA 4XQ0A 1LZLA 4AZ3A 2C5EA 3WISA 5HDQA 2A1TS 3RU7A 3BQNB 2OQRA 3CS3A 3KKQA 4IKPA 4HVTA 1ODTC 5AJTA 1S2GA 5IJ9B 3LNCA 5JAQA 3E8XA 9LDBA 4ZI7A 4HTFA 5EJEA 3OEHA 1PJZA 4C0WA 1T8RA 3QPUA 4R81A 1EUZA 2YJ3A 4UEQA 3CG0A 1KVQA 2NXWA 1UCFA 1DTWB 3GEPA 5FJJA 3TLAA 1CEEA 2FW7A 2QMYA 2YWBA 2WBLC 4WN9B 1XL0A 2G88A 4YB8A 3FUXA 2QX4A 3ZOKA 1Z5PA 4C3OB 2CVHA 1OKKA 1L1QA 1KFJB 5L4NA 1TCVA 4OSPA 4N76A 2ISQA 4D56A 1UXOA 4QTUB 5FBKA 1X1SA 3THOA 2H4YA 1RHJA 1JBKA 2AIRA 2PRIA 4UHFA 4EA6A 3H04A 4U7TB 5DPMA 4EEXA 1JR2A 1SWWA 3L8HA 4G37A 4ZVSA 2KE5A 3MBIA 1P45A 4KO1S 1JU9A 1CSEE 1PT6A 1U8EA 2KWIA 4U7HA 1KI6B 5D6OA 5IK2A 3BFJA 3C4JA 4RA6B 3U3RA 1GLGA 1JFRA 1KRHA 1EDDA 4ED9A 1SQSA 5LZ2A 5DI3B 3V4FA 1O5IA 1RXSA 3LCJA 1PI3A 3MQ4A 2E21A 5SZKB 2R5NA 3DOOA 4G1FA 4I81A 4G8CA 3UJ7A 1WY7A 2GNOA 3IPYA 2DKFA 3KL4A 3O6VA 4L0CA 5IC6A 1G59A 2J5XA 3MZ0A 2FE4A 1ULSA 2X23A 3HY4A 4IOJA 4L4SA 5CVEA 3ABOB 3PGXA 5DMXA 5TB5A 1ZR4A 3BTSA 3RSQA 2Q5CA 1JHVA 1TQHA 1MXFA 2JLCA 3SD7A 1FTGA 3GG9A 1O94D 2WA2A 3BG5A 3DWIA 3RVLA 5H59A 1P74A 2Q5IA 3W8EA 4EA7A 4HVAA 1H05A 3AOGA 3S70A 1TM1E 2R1VB 5A0VA 5SZJA 1JBEA 4JLJA 4D96A 5IT5A 5B7QA 1ZWKA 3VRHA 1W85B 1BE6A 2VUIB 3ETHA 3PXBA 3QWAA 4BPBA 2H63A 3CEMA 3DO6A 3SSOA 3E9YA 3UO8B 4C4AA 2WZQA 5FOSA 1RSZA 4NHOA 5JCZA 3IC5A 2PUGA 4AKEA 3PV0A 5NULA 3OZGA 2ZU0C 3DE5X 1QHHA 3SQWA 2HIMA 2XCSB 3DMGA 4NFSA 2EKLA 1CIPA 1LTHR 1TM7E 4N7MA 1NXVA 5K4AA 4BNTA 2M6KA 1IAQA 3DAHA 3H6GA 4TUYF 2ZP1A 2OXTA 3WGVA 1II9A 2G36A 3PC3A 2Z2JA 1JXQA 1U3VA 4IX9A 2J6HA 3FR8A 2R3SA 4AXBA 1I14A 1OZGA 1L7EA 2F7SA 4G0PA 2AUMA 1PZMA 4RK0A 3U6KA 4IIGA 4LMPA 4LQCA 4AULA 2NYAA 1XNGA 1JFVA 3IV6A 1KYQA 2H1HA 2HA5A 2J87A 2Q0HA 3FPBA 4IFIA 5C31A 5I45A 4LZJA 1ZNZA 1RLTA 1UMBA 4HV4A 4F21A 4YDQA 4M89A 5EN4A 2FDXA 4RCZA 1NASA 4JX9A 3FB1A 3BGOS 2C4KA 4OFXA 4OXQA 4BGIA 2QT1A 5TNXA 3O7WA 1LPOA 3EEBA 1LQTA 3I8SA 3OZXA 4JKOA 4KO4S 5E6RB 4YN3A 5FWXB 5IZCA 5LZ9A 3QI2A 3JZFA 1L3BA 1U90A 3MLAA 3P5BA 4JBYA 4ARBA 3JRNA 1EP1B 4FCTA 4H31A 4F6RA 3QLTA 4L9SA 5J5VA 4D80A 1PRYA 1T9DA 1UKVY 2J9GA 3Q3GE 2B35A 1DJPA 4NXMB 3AVVA 1QNFA 1G5FA 1D1TA 2GF2A 3R24A 3H9QA 3ZE1B 5GONB 4WZBE 3NHSA 1XCLA 1E2QA 2G5TA 3H5TA 3MSXA 4UQOA 1Q0LA 4WTOA 4CIYA 3SEZA 5KNBH 3V48A 2VYVD 4DXHA 4Y2TA 2CVQA 2OXEA 2CVOA 2QVXX 3ASVA 3OZBA 4JL8A 5ARBA 2CYBA 2FWBA 2R00C 2Y0EA 3PDWA 3SX0A 3O8LA 1RM0A 4YUWA 3A9RA 4MRNA 2Y9PB 2YJ4A 4DV2B 2IYYA 3SX4A 3U0BA 3Q87B 5IVKA 2WE7A 1UUFA 4AC9A 2QUJA 3ASUA 1EVLA 5TX7A 1HL3A 3ZJ4A 2P2SA 4EB8A 2WSLA 1XFDA 3M34A 5EL0A 5JS7A 1P4HA 2AX4A 4WKOA 3T7RA 3MWGA 3I5XA 1M7BA 1NPTO 3EPHA 1HKHA 1XTBA 2CXRA 4JNCA 1H1TA 2YYYA 4HPWA 2QRPA 1C0EA 2BJHA 2VPYA 5JBIA 1YUNA 1UJ4A 3RH0A 1O6FA 2WUVA 3TKYA 3O3CA 3BXHA 5I4BA 3MJRA 4ND2A 1OB2A 4QXMA 2LW7A 4DMMA 2RFLA 3DBLA 5K0CA 4A7PA 4NYMQ 1UT8A 3KJEA 1KEZA 1YMUA 4U7JA 3HVHA 1XIVA 3KP1A 4CCWA 2WDPA 4W63A 5TT0A 2X6QA 5T8KA 1N6HA 1R5NA 1YB7A 4CKXA 3STTA 2C7VA 5ALDA 4KRFA 2HV9A 2EFEB 1RIIA 2VTKA 4MIYA 1HSOA 2GOYA 4KAAA 3OOYA 1USUA 4ZIRB 4QPPA 5IUKC 4ADSG 3WRXA 4PYLA 5KUTA 4IXMA 4JMPA 5GQSA 1RBZA 2CUKA 4B6RA 3VPGA 4EVSA 1ZW6A 2P4HX 2ZZKA 4ETMA 3OPYB 3I6MA 4L4YA 4C08A 1EIWA 2XB8A 1N2CE 3ZDXB 1R10A 2BFOA 5T7BA 2ZWPA 3GYBA 4MQEB 5DHRA 2VJOA 3TLXA 3L8EA 3H18A 3PKJA 4U63A 4ACAA 4XSHA 4EKGA 4B3DA 2AUNA 1FQJA 4RXMA 3FHTA 3P9RA 3FNEA 4DWVA 2V0GA 2Q4EA 4JVMA 1XGKA 1E4YA 1PEKE 4EO7A 1VE7A 2LPMA 4NP6A 5D3KA 4BO0A 1FOEB 2WF9A 3IILA 3ND6A 4OXYA 4WY8A 2AGVA 3AB7A 5CDGA 3SCZA 1Q1QA 1S1MA 4NBTA 1OXSC 1UDXA 1ZRSA 2EG9A 2J9YB 3AW8A 3D8RA 4JI8B 5JQGF 3GLHB 1IPEA 3WK8A 3K6RA 5BUCA 4CIBA 3H5LA 2WI8A 1ZH4A 1QJ4A 3AF2A 1O6CA 2HXSA 4RSHA 4ZP1A 1A27A 4XWKA 4MUHA 4WEQA 4UCWA 3I2JA 2Q3LA 3O91A 3UCXA 4JI2B 2AYYA 5J5AA 2VQ6A 1UR5A 3VDNB 2CMGA 3NOQA 1LBHA 3HUFA 3ESCA 3QKSA 2GO7A 3DTVD 3I9KA 3HSYA 5KWSA 2A78A 1W34A 1XMPA 2D5AA 2JBAB 3UKOA 4BXOB 2DXIA 5CP8A 4ABTA 1JPJA 2IELA 2PLNA 1XUOA 2WP0A 3F2VA 4DG5A 1GKYA 3GVCA 2NYRA 4O3MA 1ZRMA 1FJGB 3S3TA 2PX2A 1DNPA 4XQGA 2JKVA 2Z1MA 4AMZA 4CI0B 1SULA 4G84A 3GLKA 2A14A 3LBNA 5BRNA 4QG3A 2DQKA 1MAAA 4Y6OA 3K8QA 3TW4A 3AC0A 2YV4A 3QF4A 5E6SB 2OK7A 3G0GA 4Y9SA 4EATA 2IS2A 1U63A 3KBBA 3ADKA 4E14A 1A2QA 4NWIA 5A5VA 1Z33A 2JZCA 1H6DA 1Y1SA 4H08A 1AF7A 1OT3A 1L7OA 1EB9A 1M2WA 4YJGB 1O9BA 4ERNA 1W0JD 2ISSD 3QYJA 3OESA 1WKVA 2BHNA 4TVKA 2YBDA 4M6WB 5LIPA 2GF9A 3C14C 4CMIB 4PGFA 4TUYB 1IHUA 1Z13A 1WLSA 4JCOA 1R8JA 1EFVA 1OFUX 3B1YA 1PVDA 4MWBA 3ZWPA 1J0BA 4OUKX 4QLBA 1PEAA 1ZK2A 2W4MA 5KQLA 2XV1A 3LXXA 5FBZA 3SJZA 5EIEA 2WZBA 4QODA 5LMUB 2I3ZA 2LE0A 4C7KA 3WHIA 2DLNA 3DAFA 4MA4A 4B6EA 1CU1A 4F4JA 4QYTA 1CT9A 2W6PA 4FK8A 3UV3A 3WGLA 3P0IA 1U2QA 3A3YA 2DOKA 1OROA 5GADl 2R8EA 2CVZA 3RE1A 1N6NA 1FNSA 2VJCA 3H87A 2X4DA 4IL5A 1P39A 4TS9A 2M32A 3L07A 1FRQA 3ORRA 4FYIA 4LDAA 1TQ2A 3OZFA 2CMFA 2IYFA 4FYHA 3RGGA 3MWDA 3RYHB 4IMRA 4DR4B 4FKZA 4OHRA 5F77A 2GJ4A 5M5BA 5LC1A 3MEQA 3PSHA 5JAOA 1U94A 3UC5A 2LVBA 1FPMA 3ZVKA 2B4KA 4ARSA 2XB4A 4MW7A 3P4YA 3P2MA 4M21A 1GQ2A 4UCFA 3T1TA 1IIRA 1PS9A 2WTXA 2GZ3A 1OVGA 2F67A 2Z5GA 3IE0A 4GM1A 2E3JA 4R7GA 3V8NA 2AC4A 1JKJB 3K0FB 4P32A 2CL6X 4XSVA 2BZ1A 4N5LA 3W8NA 4U6QA 3RW9A 2V8OA 3OFVA 2J3DA 3RC9A 3FYDA 5ALMA 2OYSA 4RSGA 1HQCA 4KYVA 4XGKA 3VX3A 4QASA 2J45A 1J49A 4L74A 1KEPA 3GUUA 3PGKA 4M0KA 3OT1B 4W8HA 2IVFA 5FLKA 5T4BA 4E94A 4OIFA 2I87A 5E9QA 3ZWVA 3U3OA 4AJKA 1YVEI 4D4IA 4C4OA 1OPXA 2OY0A 5A3VA 5DMHA 3HJGA 3PQ8A 3U44A 2NZUG 4UNNA 4M1TA 1NN5A 2XYHA 4QHTA 4ENWA 2OHFA 1QE0A 1RAGA 1RYZA 1FYEA 2CNWA 3ESQA 3ER6A 3OI7A 2QTLA 3FUVA 1U2RA 3NIGB 3RVRA 3UMSA 2WPDA 3R3XA 3TRHA 4CYMA 3HUUA 2C92A 3JQ7B 4R7TA 2PBZA 3HCWA 5AVTA 5TF4A 5IN4A 3ME5A 4PCVA 1SRQA 3E1SA 3M1YA 4AO7A 3ABQB 2Z6UA 1BQ4A 3QJYA 4HUJA 4IV0A 5DN6D 1DAPA 3NG1A 4D4GA 3KPYA 2IHNA 1JF8A 1XPRA 3G2MA 3W77A 1D2GA 5B37A 1SU7A 2HQSA 2W6NA 5DCLA 1NW7A 1YDGA 3KSUA 4XASA 2MYNA 2XNDD 5HKLA 1APBA 2H65A 1G20B 2HDHA 2ZIXA 3UYKA 3ZJYA 4HLUC 1JIKA 2P27A 1R00A 4A8PA 4RPKA 3UAVA 3ZD8A 1YR9A 2MMGA 2QYOA 2V5AA 4R2LA 4M0EA 3E6AA 1E62A 1Q7TA 1SD5A 2FWJA 2XZPA 5EAIA 3UATA 1QRRA 4CNQA 3O9VA 5D8DA 1U5BA 4TT3D 2HCBA 2RH4A 5A71A 3DQQA 2Q6TA 3RWMB 3MMPA 1EQAA 4MVJD 2JDIA 1KQFA 3AV0B 4KBFA 2KW5A 2C2WA 2QG4A 3V1LA 1W5EA 3SEAA 3ZZNA 2FWIA 1FSSA 1D9ZA 3D6UA 3SQNA 4E31A 4MMZB 1HUQA 1FBTA 3VOTA 4M9RA 4IG9A 5HF5A 1KJ9A 1GQSA 3E0XA 3QVGB 4E4RA 3INGA 4IP0A 1KAEA 3JQQA 1PQPA 4G4GA 4BNIA 4YX9A 4I14A 2F8SA 2HGSA 2ADFA 2HAEA 2QUZA 3AL2A 1HT0A 3DDHA 1TCCA 4DM4A 421PA 3HMKA 1OJ7A 3DMNA 5JDCA 3T94A 1JN0A 1JJBA 3A28A 1PVOA 3K2BA 2RONA 1BYUA 4BNFA 4DYDA 4DXDA 3CKYA 1RKVA 2OESA 3KKPA 2CDRA 5JQGB 2AC7A 3L4SO 3BMXA 4ZCLA 4RQAA 1QDUA 4RY8A 4Q1EA 4EFLA 3SLKA 2C9ZA 4GZ6A 1NF9A 3QU2A 4P98A 5E4FA 4RDXA 1I36A 3C3PA 1WS6A 1T1RA 3COSA 5DM70 2PZKA 1L7DA 2CNNA 2PTHA 3F3MA 3HL0A 4GH5A 1PFUA 1PO7A 1B3BA 3A3PA 3AKCA 1BOOA 2FQYA 3IUQA 1L9XA 3IMGA 4M1ZA 4OYRA 3RBVA 3OCJA 1EFAA 3RJMA 3PE4A 2H4JA 4P93A 4DY6A 2BELA 5ECWA 1EXDA 3HE3A 3EGDA 1VHDA 2A7QA 2O6HA 2P6UA 3LC0A 4PTLA 2Y4NA 5F2KA 1BHQ1 4OKNA 4AP9A 5BQ3A 4IOMA 2R6CA 4BFWA 4GLBA 2UVPA 1HFEL 3KU4A 1XV5A 2IXAA 3RD5A 3WNQA 1E9VA 4TMXA 1YR1A 1F0PA 2PSFA 3G8BA 3MGGA 1QMGA 2C5SA 4G1VA 4LRQA 2C95A 2XCQA 4G0QA 2PNJA 4MCAA 4NYIQ 1KFBB 4DR5B 4AG5A 1P31A 4FR5A 2OAEA 1SXJE 2O2SA 3KPUA 1T36B 4KXVA 4QUHA 1AHPA 3WB9A 4JV5B 3B3JA 1MC5A 1OI3A 1ZZEA 3D3JA 3AG6A 1R0CA 2FRDA 4PC6A 2JAWA 3RRNA 1G1MA 1CS0B 1OX6A 3KTAB 4Q4LA 1H2RS 1YJXA 3LBIA 4KPUB 1LVGA 1ZC4A 1J5XA 3NV7A 1QZZA 4OGWA 5LR6A 3DBRB 2DHDA 1NVMB 1A4UA 3FPAA 4OU5A 1RS0A 1TTTA 1F7VA 1VYVA 2D74A 3LF2A 1PX2A 1V7PC 4YBZA 4CM1A 1UK9A 4CIAA 1N2SA 1Y3IA 4J6FA 1L4YA 4K46A 1JQKA 1GTRA 3OJLA 1RYDA 3OPQA 1Q3KA 4XJXA 4S1OA 5CAEB 2P9CA 1J2TA 3A0RB 2WFMA 3IBYA 2UKDA 3JARA 5E7JA 3Q41A 1YCFA 4Z2YA 2FR0A 1E0JA 1VL1A 3VH3A 4CMKA 1QWOA 4FGLA 2A9FA 2I3DA 2GHRA 3RSGA 1SUFA 1P8JA 5E7IA 2I78A 2QPLA 4A82A 4BECA 4D25A 1EDEA 3OTGA 1ADYA 4MARA 1DEXA 1QV9A 1FNCA 3P1JA 2IYNA 4G65A 1MPTA 2NU9B 4ZZ0A 1SZPA 1ATZA 3GJ7A 3JAMA 4B85A 2HOQA 2CLHB 4UMDA 1HQKA 3UAWA 5JLJA 3CSUA 3HSSA 4WZAE 2GJKA 1QWSA 4COOA 2HI0A 3ANSA 1EWKA 3L4BA 2VIIA 3TZ6A 2Y0DA 4QEDA 5DW3A 3EOBI 1O9GA 4W82A 3I9V6 4BO5A 3EPJA 4P83A 1JFTA 1C41A 4QUKA 1TVCA 1V96A 3S68A 4EGJA 2LR0A 1DO0A 3BJEA 4NJEB 2W98A 2QQEA 1JYSA 3INYA 4NVRA 4CEHA 2X76A 2CV0A 4GQAA 2OV2A 3OC0A 5BW8A 2BZGA 5FI1B 4CQNA 3G7NA 5L3SB 4CEJB 2I7DA 1FVFA 3FPCA 3GA7A 3R7LA 4F9EA 1N2CA 3QFFA 1YL5A 3M4XA 3MG9A 4NENB 2WWYA 2EOAA 1G55A 2DUJA 2VR1A 2JFNA 2Z8XA 1Y81A 3V2HA 2QR5A 1MC4A 2R25B 1X7YA 4NV1A 3WWPA 2ZROA 1X7ZA 2QR2A 4R1SA 2G9NA 3ZDYB 4DLTA 1MHTA 1B8UA 2FGJA 1RPTA 4L4ZA 2VDNB 4HGOA 1ABEA 2RHTA 4BUZA 2CSUA 4KL8S 5B64A 3MTGA 1EVYA 4JROA 2B5OA 1W5BA 3KYCA 3UH0A 4DLRA 3ZE7A 1NNEA 3CE9A 4OOEA 3G82C 8AT1A 3CG4A 5AI0A 3MBKA 5BOVA 1KO4A 4KB5A 2PEYA 1Y8AA 2WKRA 2Z2XA 3Q3EA 1FUEA 4WKGA 4Z6KA 2WHEA 1AS3A 1KKLA 2FHPA 1U0FA 1RP7A 4TXJA 3KAJA 4CL3A 2CHGA 4RDHA 4ZU3A 3F1KA 1T35A 2RHOA 4LDZA 4BHTA 3D81A 2IDJA 4JUDX 5F2NA 3TOCA 1OBOA 5K3BA 2NSJA 4RD1A 3DR3A 3CLTC 5IUNC 4DLVA 1UKZA 1I4DD 1ZK1A 3BKXA 4UEJA 4XPIB 3SE7A 4AMBA 1ZUNA 4TYMA 2X9LA 2P79A 3AKZA 3JAWB 2GX6A 1HEIA 4C4XA 1WXEA 5J40A 3WYGA 5FL3A 1PJQA 2FQWA 4QBIA 3ZHCA 2WF5A 3GEBA 5KTPA 3O90A 4F6LA 4LRSB 2QD3A 5ILGA 3UT6A 4TL9A 5HJ5A 3D6NB 4OHUA 3D02A 3WK7A 4L8VA 4IINA 3PHIA 4RH0A 1G7CA 2C9OA 4S3MA 2CWDA 3D2CA 4KTTE 1NP3A 1Z56C 4MQBA 1ODCA 3NTUA 4J2HA 5TGDA 3RQSA 5IJXA 4Y2QA 1CZRA 3HJUA 2Q4RA 2ZVPX 5EMMA 2GGSA 4PV7A 3SIWA 4AZSA 1ZMBA 4EAQA 1EVJA 5J43A 2WYWA 1Y6QA 1IQPA 4PR0A 2Q41A 3VR6H 1L5RA 4K9KA 4JYCA 2XSZD 3B1JA 5FUYA 2ORVA 3SZRA 3AUSA 3PR1A 4B2PA 3KAPA 1KSJA 4GWGA 3N86A 2QTZA 5CT8A 2AF3C 3U7QA 4LUCA 4UFPA 1YS7A 2J0UB 2VH5R 3KVVA 5B7GA 1D2MA 2VF5X 4QRHA 3NIWA 1M3SA 3L04A 4LVOA 4ZANA 4DNQA 1K4MA 1SR8A 2FZ4A 2CXOA 3PPVA 3U4CA 4M9CA 1CUIA 1EZ4A 3P0FA 4MAMA 5HF6A 4G3XA 2PQMA 1VHWA 4LAFA 1T8PA 1TU4A 4MVJM 2X1HA 1E0AA 1OMOA 1ZUD1 3DA8A 2P4UA 2XMQA 4I3GA 2QL6A 4HT3B 1YMVA 1FTYA 1R6TA 1TTPB 3PQ7A 4KJZA 2JGLA 4Y1EA 1A4RA 2GR9A 4CLOA 5IAAA 5A4FS 1RADA 2ZWIA 5DP1A 3N8HA 1TYDE 2H4HA 4KMOA 4IR7A 4F71A 1FLAA 3EMDA 3GJ3A 4RFSB 4D9BA 4LWOA 1P3JA 4L4XA 4MDFA 5ADHA 2O06A 3ACCA 1U8ZA 4XRRA 3RTEA 3BCUA 3FHCB 1TJ3A 1XRRA 1KIMA 2DG2A 4LS3A 3M6MD 4UOQA 1U80A 2V6GA 1Y5RA 3NEYA 2XRFA 4O2AF 1HO3A 3ZGVA 4JU9A 1N2EA 2FHSA 2HWKA 3PNSA 1X7XB 5IU6A 2PKCA 4PPNA 2XE7A 2BW0A 4YCMA 1EHIA 2OZLB 4NU6A 1ECJA 2HEGA 1Q91A 2ZITA 3ZHBA 3ZY4A 4TL8A 2VYFA 3T3HA 4IQ8A 3CZ9A 3D6VA 1CW2B 2Q21A 3PVZA 2WJIA 4PSCA 3E8SA 2BDEA 5KHAA 3C8UA 2YZMA 3B1WA 3FXAA 3GBVA 4I55F 1F2TA 3IUPA 3TQSA 4EG3A 3H3JA 3V2UA 4CMHA 2VJYA 1G5TA 1DHRA 2G7MC 4TKVB 2IUFA 3N0WA 4F5YA 4UTNA 3WFZA 3ZQUA 3BJMA 2J3LA 3KT8A 2OG2A 1L0BA 1WLYA 3LWDA 4RIGA 5ARCA 5TVGA 1HYQA 1XVLA 2QAJA 4ZRDA 3QKTA 4FLFA 2O4CA 4MWGA 1MDBA 3E1KA 1PFYA 1R2QA 3I2HA 3KWJA 5LBIA 4CMCA 2WHQA 4MW4A 4UBIA 4ZI5A 2IL1A 3L0IB 4C7OB 2FSSA 1KOGA 3ODPA 4CKYA 4G1MB 3BORA 1JLHA 2P1DA 2ZRNA 1AGNA 3A6ZA 4MW9A 3ZD9A 4DRZA 3OLXA 1BXGB 1E7QA 1OLUB 3F5DA 2ZBRA 2PPVA 3P2YA 2AHOA 1P4RA 2FLKA 2GLXA 3JY6A 3NFYA 4INJA 4TTRA 4F7DA 4FFRA 3DPIA 3FJ1A 2IPMA 1SKYE 3FPGA 4B8WA 1GKUB 4H16A 2OB1A 4QBTA 2XJ4A 4DJEC 1CHNA 3AVUA 3C48A 3AHHA 4RF2A 5JS6A 2MINB 5E3IA 1KOFA 3R7SA 4OLBA 1L4UA 4DM7A 4QOFA 2QT0A 4TQUS 1A76A 3RR2A 5TMEA 3VX4A 3U7HB 1QF7A 1N5IA 2FZCA 2VA8A 2ALJA 3VNRA 1TPZA 5AK3A 2IUUA 2RAVA 4PM4A 1T0IA 3LX6A 3D6AA 5DHSA 1IM5A 3K0BA 4DN6A 4OY3A 3ZE9A 3G79A 2QD1A 3A1EA 3HBLA 3RG8A 4FHZA 4JP8A 3V1NA 2PH1A 3DOIA 3MGBA 4HUQB 4V24A 3D5QA 5G4KB 4GKJB 4O25A 3TLBA 4MYHA 2WWIA 3L18A 1JMVA 3NW9A 3B1KA 4F4DA 4PF1A 1A9XB 4CR8A 3K30A 1QP4A 4Q12A 3TIFA 3EVAA 1DQSA 1K98A 3FZEA 4MUNA 3EQ2A 4LNUA 2A0WA 4P53A 5DOVA 3SQDA 4BFUA 5I7OA 1QGUB 1G5RA 1ZGCA 3FNQA 2NWQA 3R8CA 1V41E 3DEJA 2H2IA 3JXEA 1K63A 2HO4A 1LLFA 4MO2A 3AWIA 1LPBB 5DXFA 1W96A 3LIIA 1UK8A 1DPGA 1US8B 5EGSA 2X2PA 3HR8A 5I9BA 1U9ZA 3ONWA 3ZV5A 1Q6YA 3TQTA 1M72A 1Y9DA 1SUDA 5EWMA 3D7MA 3ONNA 4BE9A 3PFNA 4GICA 5HIAA 2C7QA 4J8PA 5F64A 4ZYXA 4GDFA 3SF8A 2VP5A 3QP9A 4LJ4A 1EU1A 4XWYA 4Q3BA 3ZV4A 1J1UA 2XDYA 4B5LA 3Q8KA 1QOPB 1MEJA 1O2DA 1WXFA 3LUFA 4KWEA 4NAHA 3TVDA 4BASA 1JXOA 3G2OA 4WN3A 3OZTA 2BBOA 5KEIA 4AYWA 2CJWB 4PHFA 4R2JA 1A9OA 1L8OA 1OXUA 3LA8A 1XAHA 4UVIA 3CURA 1PNRA 4J3JA 3AR6A 1G4HA 2AR0A 2H2FA 3KSMA 3KFVA 1G63A 4GBJA 4UU7A 4MKRA 4FQ5A 4YV0A 3NC4A 4IS3A 5HE9A 3ZXUB 2YQ5A 1FRVA 4Q4DA 1X1DA 2TRSB 2CLCX 2JH8A 3H2HA 3QE0A 1M8GA 1T26A 4QUAA 4U1RA 1VRVA 1ADGA 1O94A 4FXOA 1JEAA 4JJ4A 3BEOA 2Y9MB 5EZ5A 3KE9A 3GIDA 1OE0A 4PIPA 5DNVA 4DA9A 3OZ7A 3RVMA 1VCNA 3EEYA 2JZNA 1O6ZA 3EXAA 1SCUB 2V55B 3GLVA 5IYZF 1SWVA 2SNIE 4MV3A 1KZHA 2O8FB 5IHXA 3WBFA 2W43A 4DXAA 4IEFB 4BBZA 4HEJA 1AB6A 2I7TA 5EKTA 5BRAA 2PBLA 1IJFA 1DKOA 1E2MA 2JLQA 2IK8A 2ZI6A 4KQ1A 5P21A 4Z8XA 1LY1A 3D6TB 3C24A 4OHBA 4PXYA 3ZBUA 3KBOA 3IKVA 1R6DA 3GJYA 4H2DA 4K26A 4FUQA 3ROKA 2QTAA 2GN9A 1L5LA 5EUBA 3IDFA 1N2XA 1T0JB 3BGSA 1VRCA 4D4KA 4TTPA 4WNCA 3CUSA 1EX7A 5D01A 1OC4A 4G9GA 1ZXBA 3FKQA 2VT2A 3KRTA 3DVLA 4A3SA 3VR2D 3KXDA 3ESXA 4RF3A 1OILA 1YQXA 2QRQA 4JQYA 3SNHA 2B92A 1DJMA 3JWJA 1UC5B 1MZVA 2OCYC 4YCCA 4A8TA 5CFOA 3MMNA 5CCXA 3CM0A 1K3FA 4ZEVA 5CH3A 4INZA 2GJSA 2WWRA 1PKXA 3HCEA 3GJ5A 1BD3A 1F7UA 4EEKA 2QZ9A 3C3MA 3OJWA 4CT4B 4KI7A 4UDOA 5LKAA 1NN0A 2AOUB 2FX2A 3B53X 2FZ5A 3F6CA 4WZAA 2PYZA 3LW7A 4CJXA 2XVAA 3SKXA 2VAVA 1VMAA 3P71T 2O20A 2AW3A 1H23A 4O2AB 4MLZA 4ZQIA 3FA2A 2C2YA 3U31A 3DE3X 1KYVA 2FR8C 1SC6A 3JQRA 4JB2A 4X7MA 4AG3A 5ES4B 3ZDCA 4JEIA 2HJRA 1RJ9A 2YWJA 5GINE 2Z5LA 4BKMA 1F14A 4ZAXA 1R74A 4L07A 3A06A 1QUFA 4MDEA 3V8QA 3V7UA 4I55B 2OORA 5HZGA 4Z3OA 3P0EA 1H2HA 2J6IA 3I01M 3KKNA 2JI6A 3BC1A 2C0PA 3PVSA 4MV1A 4MPRA 4DLAA 2VYVA 1NLFA 3WI7A 2F1JA 5EMJA 4OPMA 2C97A 3T5TA 3QYFA 4KQGA 2UZ1B 4L9AA 3ZY3A 5LJLA 4GG1A 3BMNA 3O94A 3BIWA 5TJ9A 2EFDB 2ZTHA 1VB3A 4P1ZA 4LQ4A 5I7FA 3C6MA 1M6NA 3EJ6A 2YHIB 4G0MA 4BN5A 1HI9A 1OYYA 4RK5A 1XWWA 1C1XB 1TLLA 3LLUA 4X5OA 3OCVA 4C3UA 5DHFA 2HK6A 1QIKA 2HJSA 3OT5A 4OB7A 4U2BA 5EXSA 3TL2A 1V3VA 2AQHA 3CNEA 4MQ4A 3VZRA 4GI5A 2EAUA 3WLHA 1CQWA 2PUFA 4X92A 3AFOA 1RQ2A 2FTKE 4M9ZA 1J0DA 3UY4A 2NQTA 1WV1A 1IEXA 3G6WA 4JSRA 2FA9A 3U4AA 3P19A 1XQ6A 3H5NA 3WKCA 4YNBA 3T4EA 1W2HA 3D4OA 2QENA 3B6EA 1ARZA 2DU8A 3OIVA 5DOZA 1IC6A 4R9RA 3W3AD 4ALKA 4EEZA 5C8YA 5F7OA 4PSUA 5BYKA 3NHAA 3IHTA 3V4ZA 2HRZA 4YQYA 3VNBA 1E5XA 5KSPA 5FYQA 3BRCA 4QL3A 2F8LA 2OFWA 4EZEA 5BORA 2HLHA 2HTFA 4LMAA 2ZB4A 3F7OA 1QS0A 3ZE6A 1XRLA 4R1OA 4UXIA 3IBTA 4M99A 2P35A 2X0RA 3LHSA 2ERYA 5T57A 3AR8A 3VSBA 4AIIA 1TD9A 3I34X 1OXKB 5EIAA 1ZCBA 3FHOA 4AO6A 5HXAA 2HGZA 4N65A 1N9GB 2M1ZA 5AM0A 4Z1OA 1ZJYA 3B51X 1GNLA 1Z6QA 5G1PA 4ZEMA 5KO2A 4JJZA 4MOWA 3O3OB 4ACBA 3I23A 3PDHA 4PO8A 2XMSA 5MN6A 4I4IA 3RF6A 2HA4A 3CT4A 3F9CA 2CJPA 1I4TD 2K7FA 3HP7A 5TF0A 4CF4A 5DHQA 3LUAA 2XH8A 5JH7A 1Z62A 1WUKS 4KMRA 4ISBA 2R751 3TMYA 5B6PA 2RIPA 2ZSEA 1K3UB 2X1LA 3PWKA 1NBOA 3EZLA 4YMWA 3NHKA 2Q0SA 4ZAVA 4IVQA 2OO3A 2F9MA 3ZI4A 3TLCA 5LFAA 2XVZA 1WVGA 3G6KA 5EUCA 1JHRA 4LJAA 5ERYA 5KX5F 3P27A 4INPA 4AFNA 3MJEA 4TWBA 3LKVA 4IIJA 1QGED 4MUBA 2AI3A 4CCSA 5FYDA 4PTYA 4NCJA 5CB4A 3NKVA 2IXGA 4GRIA 3Q7RA 4R9UC 4RK7A 3O8RA 4B6QA 1Z5OA 2Z43A 2VPTA 1Z15A 3M83A 1GRQA 1LV7A 1ORHA 1ZH8A 2LDBA 3AEQA 1OWOA 4XR9A 3M82A 5CHYA 3D7RA 3DTVA 1YFJA 4PRKA 4ZPXA 4J4HA 5EUMA 1DG9A 5FA8A 5FJIA 2P77A 1RFLA 3IT0A 3RRXA 5LOVA 3O8CA 3ZU4A 2PUBA 4OVKA 1ZP6A 2HBRA 4EPTA 2NTJA 2IOFA 2G4LA 3KS9A 4U5XA 1M6EX 1SOMA 1CJVC 3BGDA 4JEMA 3MS2A 1T9ZA 4JD5A 4PNPA 1Z7BA 5HS6A 5IYZB 5JZSA 4QTYA 4Q1CA 2R7AA 1OTHA 4KUGA 2ACWA 1FEZA 1W76A 2VHZA 5DNYB 1UWCA 1M2VB 4BDTA 3ICEA 3DGEC 1RLUA 5C34B 1GY8A 1IXRC 3OY2A 4JBXA 2QUAA 1TU3A 4QDJA 4RAOA 3GB9A 4JYAB 3T8YA 1MB3A 4FQ8A 1WCIB 1EWRA 1A9PA 1WHTA 4NE7A 1EKXA 1W0JA 3R0JA 4FDUA 4G63A 4CMJA 4BGEA 1G6Q1 1BH2A 1M6YA 3A9SA 3JVUA 3OLWA 4L5YA 4YJ2A 2JLRA 4URFA 3RKSA 4MRMA 1TEHA 4UU0A 1A7UA 4AN0A 4A1OA 5BWLA 2I66A 3GDWA 4JKYA 4LJSA 4J75A 3PT9A 4P3XA 5ALIA 1X2EA 3KOOA 1FMTA 1GYQA 1HEYA 5MFPA 3GGOA 3AUYA 3AGQA 4AVYA 1K2VN 3KKOA 2B6HA 4G4SP 4IGAA 1HT1E 3VSAA 2DT8A 5H82A 3GUVA 3M81A 3PBKA 2NSLA 2YY6A 2KPOA 3CH6A 3CF4A 3HK2A 1KMQA 1CQJA 4DNFA 3B89A 2CLMB 4U4AA 1FX1A 2XADA 3AM4A 4B6FA 4MJXA 2DCMA 4BAZA 2TMDA 4LYJA 1YQEA 3DKIA 3QU5A 3NM6B 4R16A 5DLPA 5AK4A 2HHAA 1TJYA 1CUHA 2G8LA 5GGYA 3AINA 4BGVA 3IOBA 2VJPA 5JY6A 4XM0A 3TIVA 1NZDA 3QH4A 4CVNA 1ZX1A 4MS3A 1F06A 1Y6RA 5AW0A 1OF1A 2GD0A 4BQFA 4JASB 1CUCA 1AJEA 4WADA 3HPRA 4GOND 5L3ZA 3GLFA 4RPJA 3DDZX 1Y1LA 4B7XA 4CM6A 2VQFB 1LBQA 3BZWA 3EGXB 4HAIA 1AM4D 2BEUA 2Z58A 2PXCA 3NAQA 5AKXA 5KYWB 4YRMA 4G0UA 3GBPA 1A9QA 3AVYA 2QN9A 2NU7A 2QSJA 1ZFNA 3EUEA 2Z3WA 3Q7QA 3I9LA 2IYXA 4BKUA 2B9EA 2WHPA 4U2DA 2J0VA 1QF9A 2XMPA 3V6LA 5BSUA 3WGNA 4C30A 2OBLA 4RS3A 1GU1A 1JEJA 1SU6A 1U2DA 3CRZA 1JAIA 1TO2E 3BIOA 3DZKA 3FGPA 2ZXEA 4J49A 5BN3B 3WE7A 1G38A 2JFXA 4B74A 1DFGA 2A5DA 3K4QA 5LQSA 2PH3A 2R8XA 4OL9A 5TQVA 1KH3A 3G9ZA 4EUKA 2WUGA 5K0JA 3IMEA 5EZYA 1KY2A 3CF4G 2F6RA 3DD5A 2ZRPA 1N9ZA 3OH8A 5DBEX 1X77A 3UGJA 4EK9A 2XIJA 4BZWA 2I54A 3VM6A 3WO1A 2QX7A 2NO0A 4D97A 1HYEA 2HQBA 1PNQA 5FP0A 4WRRA 5EJFA 1NMXA 1ESDA 3TLKA 3O8OA 5BP7A 1Q74A 1PTJC 5EIFA 3T38A 4C4PA 3SN6A 5AKZA 1MO3A 2XNDA 4ZAYA 3WNZA 5E8RA 1M2NA 3Q9LA 2A8YA 2V7XA 3DCJA 1JAXA 3MM4A 1K8YB 2AE2A 2WYUA 4HDSB 4NU0A 2IZ6A 4D46A 1ZVVA 4QUJA 1IH8A 4AKSA 3M89A 3PC8A 1KPIA 1USGA 721PA 1YHZA 2Q9AA 2VTDA 3KU1A 4PN3A 5LQRA 2WAYA 3ZBTA 1T6XA 4W1QA 2H7XA 3AFMA 3FDZB 4TT3A 4G67A 4YR7A 2O8CA 4IFBA 2X15A 3FROA 4MVJA 1U1IA 4ZDIA 1L5SA 3IEXA 1P6QA 1R0YA 2PGIA 5AKJA 2IYZA 3ACBA 4ZYVA 1WV0A 4EAAA 4GP6A 1O4WA 1K9SA 2FCAA 4KSCA 1IWBB 2BFPA 3G8AA 4RLFA 1QXSA 2YCLA 2FFRA 4I66A 2O2GA 2QMUA 3DB2A 1Q84A 1KY5A 5H16A 5BV1A 1KDOA 1OAOC 1G3QA 4POAA 4B0PA 5B2EA 3PF8A 5K6RA 3HYRA 3V4RA 5E9AA 4XE5A 3LT2A 4UNSA 2Z8ZA 3COJA 1IBKB 1U0GA 5L6MB 4D3SA 2OBMA 2WIDA 1Q7RA 4IMJB 2QMOA 4LBYA 4HWRA 3AJ8A 2IX3A 1XKQA 2ZFUA 1H2YA 5DGDA 3TI7A 4JC4A 3ZXXA 2R7MA 4F3TA 1CYEA 3EZ6A 4Y0NA 2PK3A 4G5YA 1PR0A 3NRJA 4ZO6A 3UB4A 4B6OA 4C9BA 4V1CI 8ADHA 5KX5B 4D44A 2FPWA 2RC6A 3F5MA 1A8UA 2G83A 4N7JA 4WE3A 5D7BA 3P0RA 1HL7A 4LVUA 5ELLA 3ZLVA 3B78A 3G3EA 3NZEA 4KN5A 4B45A 5LQNA 1QQ5A 2O8BA 3KJXA 3IQEA 3OG9A 4DDVA 4NMWA 3D4LA 1FUUA 4KRGA 4E70A 1KO8A 2JJQA 2D8AA 3G7UA 3NTQA 2ZE8A 4WXMA 1V35A 1DAEA 3D2AA 1U2GC 1OUMA 3Q12A 1DMSA 1JP7A 2BF7A 2D1TA 1TYZA 2AG8A 5ECGC 5FTNA 2BGGA 1QORA 4RJ2A 3RSFA 1LB1B 2VHCA 1UK6A 3NTXA 3HCPA 1PGNA 2BIFA 4PYKA 3AUUA 4YP7A 4D7AA 4EHIA 3U4MA 2EDAA 2I29A 3KK0A 2I9PA 3D9QX 2UYOA 2PT6A 4BLSA 1XP5A 3Q0IA 4MVJG 2KB0A 2X6TA 1E79D 4JR2A 3LYLA 2WT8A 3OJ0A 4KOEC 2HSGA 3C3YA 2VRWA 2BWJA 3M6VA 3WY9A 3MA0A 3LPLA 2W4IA 1YL7A 1TZ2A 1ZJJA 3ES9A 3Q9UA 1BMDA 1CE8A 2A5YB 4RD6A 4MVXA 2PRZA 2ON6A 3LXUX 1FK8A 3OCWA 4NFHA 2O0HA 2CSXA 4HGQA 1F6BA 4NF2A 3AR4A 1MQSA 1YRHA 5C8XA 5I9NA 5DTIA 3GP3A 4JQOA 5KDDA 3R9XB 3B1ZA 2FXIA 4HYEA 4F3YA 4WBXC 3GUZA 4UM9D 2C07A 3U39A 5AXCA 3AJDA 3MILA 1DOAA 1A96A 5CJJA 2AD5A 2OV1A 3QX3A 3LHIA 3WG9A 2EWMA 3KNZA 2H29A 2VYND 4M0UA 4Z99A 3CH7A 4LMRA 4CKWA 3WV4A 1V5FA 3OUTA 3GMIA 3DTTA 3B8HA 4DMKA 1XZHA 4EY6A 4OGFA 1XL1A 5EXEA 4BJ1A 2DT5A 1L5ZA 3S2EA 2AH5A 5CVJA 1VJRA 3OPMA 1KNQA 5IG2A 2DUUA 1IMOA 1Q77A 1L3CA 3LHDA 4KBGA 5BVGA 4BJ3A 1Z4PX 2P68A 4P5PA 4E5VA 1OGIA 1GG8A 9MHTA 1JDSA 3KLPX 2BGNA 4FD3A 3ZWDA 3K96A 4W9NA 1YHNA 1GNSA 5DU2A 3DFZA 3ILSA 3AK4A 4EJSA 3UWSA 3WLQA 3STWA 1YDWA 3N8IA 3LECA 1PFWA 3ZHXA 4RVCA 1V25A 4B3JA 4A03A 2PVPA 4GC5A 3IVMA 2YBEA 5B2FA 3I2GA 3DMTA 1UJMA 1LK0A 1ZHFA 3O1HB 3TW0A 2A9OA 2XCLA 2P3SA 1FFXA 5D85A 5F7XA 2PTGA 4J1NA 4ALNA 4O2RA 4OP2A 5K4HA 2FP4B 5DYNA 1TCBA 3EW9A 1E8MA 4A36A 3RUFA 2JLZA 1E1RD 2XEDA 3RYFB 4LE0A 3I4FA 2Q3BA 4YP9A 1KSGA 2P69A 4IEIA 4Q4JB 1J00A 1NLUA 1ZK0A 2H1VA 4KQ9A 4AW9A 1D0IA 1K6XA 3ULKA 2Q9CA 1PLLA 1MV5A 1BHO1 2C4HA 3F90A 3TDNA 3NGLA 4LRUA 1ES9A 4UNPA 3EIXA 3ZKWB 2DWOA 1TYEB 3PS9A 1YKFA 3UHJA 4CTMA 2HZBA 5B7NA 4DQUA 4LX8A 1XRPA 1E1KA 1DEKA 1IBCA 2JARA 1RYFA 2RH8A 1SJ9A 3H1EA 4HDRA 1N6LA 5M3BA 3WGKA 2YJ5A 1LC3A 1NQXA 5LQJA 3SQXA 3M6XA 2WWWA 2G1AA 3HKBA 3TL3A 4TS3A 1RYNA 2H1FA 4AWBA 2FN3A 3H1TA 3QK7A 5HF8A 2CW5A 1HG1A 2V1XA 1YZLA 1JDZA 3G68A 5HFAA 3PFBA 3AM5A 4HWGA 5K2MA 2PRYA 5A4DA 4G8BA 1LLUA 3ZHUA 5BVHA 2UUCB 3KCQA 4IGKA 2W6ZA 3GVPA 4BO7A 3PI6A 4RTMA 3QEAZ 2KLHA 1PX0A 4TX1A 2ROQA 1CUFA 1JDVA 2QTBA 1V5GA 3CUWA 3O21A 4YCAA 5ALJA 3T7JA 5IF9A 4GE3A 1U11A 3BCHA 4BTEA 3GPLA 4DV6B 1SHJA 1UPAA 2NYVA 4HGPA 1WUTA 4L4RA 2MYPA 3MF4A 1U0EA 1X0XA 3FKSD 2BYTA 3RYIA 2AG5A 4RACA 1NI4A 1NX9A 1AXEA 2C04A 3M6LA 1Z2OX 3Q85A 4GZ3A 1Z4MA 4H7IA 4RE5A 3N2KA 4Q6WA 2PJUA 2GZSA 5IZ4A 3WQBA 1G5PA 1A8SA 1XO1A 1PQWA 3K0EA 2V7WA 4IIEA 1FRFS 4CKBB 2VHEA 5HK9A 2VCEA 1RXWA 4A4DA 1LS1A 4F60A 2BFFB 4MVJI 1G3RA 1ONBA 2EZ4A 3RVPA 1NMQA 2HRRA 2VTBA 3CO5A 1O0SA 3PDIA 1UJBA 4XCQA 1SBNE 4EYOA 3LWZA 1JSXA 4QU9A 5CFQA 4KXFB 1DDOA 2II6A 3I6IA 1KMHA 3F9RA 2V7VA 2P6RA 1BHSA 3Q2OA 2ZIAA 4RPHA 3W8RA 4Q7LA 4UTVA 5K8CA 4X0EA 2XSZA 4HRYA 1SCAA 3IB6A 4GKBA 1NP7A 1WPRA 4GS5A 1R4NB 1DINA 2SICE 4Q03A 4C4TA 2FDCA 4FD2A 1RTKA 1ZMRA 2HH9A 2WUWE 4YT8A 3ZQJA 2NSYA 4UM7A 2DULA 3ZZ1A 1OU0A 2WSSD 1AN9A 1JH9A 1ESCA 3B3FA 3TW8B 4BKQA 4Z4HA 3M49A 3TIIA 4I9UA 1J2UA 3QNMA 3S81A 4BVHA 2I2BA 5KSOA 1UOEA 5I7EA 1FFGA 3DCIA 2QRZA 3H2BA 3ZR4B 1E2EA 3TUJC 1QQAA 2NG1A 2Q3FA 2QVZX 3JYHA 5F12A 3ZYCA 5CA0F 2JRLA 5ULLA 3HCCA 2OGZA 4X94A 1KAGA 3L1HA 3RK4A 2GCPA 5JPIA 5HMMA 2NUTA 2FZLA 4RMJA 1YI1A 2BEWB 2MSCB 1F6DA 5EE0A 2BTQB 2IPOA 3UWPA 1ZVMA 3CRQA 1HNZB 5I7SA 4HLCA 3QV1A 1M2KA 3HBNA 3RC1A 3IH5A 3ANXA 3ENQA 3LQ1A 1LSOA 1XCJA 3ZWCA 1PQYA 2YWDA 1MMFB 4GR5A 4PX9A 3R7WA 1P80A 1W29A 2IIPA 4MQFA 4TMYA 3L43A 3LP8A 1H1LA 4YP1A 5K3FA 2M9MA 1JMYA 5HGJA 2WUFA 4YYEA 5JJ5A 3TOVA 1X6VA 1GUYA 3ZXIA 4V38A 1HR0B 1G9SA 2EG5A 2YXBA 3NBFA 16PKA 4Z4EA 1ENZA 2P75A 1Y80A 3PUZA 4KIUA 4X00A 4U0KA 4Q1DA 1VJCA 1AK2A 4G81A 4NBWA 1XYGA 5ENZA 2ZUFA 5DSXA 2JK1A 3MMZA 1H8HA 3A9VA 3D7NA 1C7ZA 4NS1A 2VAXA 3C8ZA 3R74A 5AKEA 3PL5A 1FRNA 4L28A 2Z6QA 4OKSA 1T15A 4RHTA 3VYTB 5IT4A 2JD2A 1EDBA 2B25A 2ZBQA 4KDEA 2Y0CA 1ZIOA 1XD2A 2PCLA 1E4OA 3C5CA 4AKIA 4PBSA 1VKHA 1I3KA 2F3PA 1Z6TA 2A33A 3JR3A 4F2DA 2W9XA 1XN4A 2AMYA 4BNYA 4P4LA 1GP2A 3MGCA 3N2NA 3EQ9A 1GCUA 4L6AA 3PUIA 4N3GA 5HUHA 4RZXA 3VGJA 4RY9A 1S02A 4X20A 5A3RA 5LIRA 3BWXA 1DCTA 4KQMA 4PGHA 5K0BA 2HCJB 2WKWA 3ERCA 2VDWB 2Q99A 1W52X 1T9HA 1QHSA 2C84A 3OLYA 3K0CC 4LYFA 5H68A 5DK4A 5CLLA 3SYRA 3T12A 1T5IA 2ZTSA 2HYIC 2ICAA 1O77A 3UTDA 4BNJA 1W0CA 1NWCA 2JFBA 4DSZA 1P2UA 4WZZA 4Q9DA 2AX3A 2D5IA 5KYUB 3WAKA 3JQGB 1G1AA 5E2AA 5IXSA 3JX9A 3IEPA 4D9MA 1Q57A 4G23A 2DQSA 2R8OA 2WG0A 4MICA 2RGCA 1RKBA 1WHSA 3RT7A 3OX2A 1I2MA 3KZ1E 4NU5A 4E03A 3EXFA 2PSDA 3HV2A 2BHSA 2Q6VA 1QHIA 4KHZA 3TZKA 1UBHS 1PYGA 2B69A 2BGMA 2FPKA 2YNMC 3K5HA 4IJQA 1E5LA 3GVIA 4KN9S 3C2QA 1L8XA 1A4XA 3E0QA 3AR5A 5A6SA 1NYLA 1ZL2A 3ZTTA 3BXXA 4Z7JA 4BC1A 3R44A 221PA 2GWHA 1UJ6A 4W5TA 4LIPD 2A5JA 5CXQA 1KBQA 5TGTA 4FM9A 4DTCA 2PLAA 1EJ6A 3ICVA 3H9JA 1W36B 3HDYA 4E2ZA 2IU3A 4DCMA 3L8MA 3IQFA 1PBTA 1VZ3A 1LLDA 2LUOA 4PZCA 4PANA 1NHWA 1QDEA 4FNAA 1DO2A 2PZEA 4JT9A 4N03A 1XLVA 2NZVG 3ZWYA 1W5FA 1OIWA 1W59A 2ZSFA 4W5WA 3AYXB 1E4EB 2I2AA 5HSGA 3KXLA 4AYTA 1T6ZA 2BCGY 5BSKA 5JFOA 1T3ZA 5KZMB 3IR5A 1NM5C 1U7TA 1P19A 3ESZA 2DSTA 3LZCA 3BMOA 1JX6A 4I5EA 3AETA 3LBYA 3MTIA 3LBAA 3NORA 3HUEA 3QXJA 5K3CA 3VBCA 5BV8A 1OW3B 4AJ2A 2ZR7A 1UDAA 1PNVA 2ZPTX 1DS6A 2Q27A 1VYTA 2QVYX 4GO1A 4H4DA 5HIJA 1N5JA 2QPTA 4IWNA 5EIBC 3KDSE 2QRVA 2O23A 3I1IA 4P80A 3J80A 1YTLA 3E9EA 2CFOA 3DZJA 4HNVA 4X45A 5EMKA 2OGUA 5AI5A 1ISJA 3K5WA 4E2YA 2IT1A 2VSXA 2C4VA 3VBEA 3ZUPA 4WXPA 2V59A 5JEEA 3PI7A 1Z12A 3LX8A 1VSBA 1P29A 1XVAA 4YRKA 4MB0A 2FOXA 4CFSA 1ORRA 1QCDA 2H9YA 1ZOSA 3AP2A 2Q2VA 2B83A 4FR0A 2WQ7A 2IPAB 2QM3A 3JYLA 3QA9A 1LRKA 4OQ4A 2VJLA 4LGYA 1WCWA 2O1EA 2JVKA 3SDZA 5JXIA 4QNNA 2XPCA 4TTSA 3EBPA 2NSHA 3TTSA 3B52X 5BNTA 1DU4A 1QVVA 1DKMA 3GARA 1PT8A 4TMTA 4M46A 3OJOA 1I1NA 3O84A 5ICGA 4ZZ3A 2A0YA 4HFNA 4O4HA 4I08A 1GR1A 3DOFA 1QCYA 3NP9A 3LQQA 4K7JA 3ND7A 5K6AC 4L8FA 3ICQB 1ENYA 1HKUA 2AT1A 1S89A 4KXWA 1DXYA 1J9EA 1ODKA 1JTFA 4MWTA 3ZGNA 4ZJUA 3B85A 3CW9A 3LDGA 1S2NA 3P52A 3RFVA 4CWAA 2WV7A 1RHKA 1AUPA 1NBAA 2NO4A 2P4EA 3K09C 2P2GA 4TWJA 4JCCA 3VR2A 3JYNA 3T7DA 5CFMA 1K2WA 1SBQA 5CT4A 3KWMA 5BOSB 3AW9A 1R4ZA 1TJNA 4MA5A 4MTCA 4PX5A 2BGJA 3WWOA 3CVUA 3PLAE 2OAGA 1F5SA 4FYYA 3W90A 2Z3VA 5DHPA 4UEOA 5U4XA 4AJ9A 5JV5A 1JHPA 1HE5A 5DEIA 3K72B 3WRYC 2VDVE 4KVAA 5K8UA 1HRKA 4X1OA 3U4GA 3KQKA 1ZA2A 4PFQA 1FYWA 1S8AA 4ROSA 1XQYA 1XU9A 1F2UA 1UAYA 2CMDA 3H8WA 4MKHA 3V9AA 1GEEA 1UADA 1GCIA 1Q0ZA 1MTOA 3OZSA 3P2IA 5EWLA 1NC1A 3O9ZA 4HLUA 4CZ2A 3JS5A 1HH4A 1B16A 1KR2A 4RZ2A 3REQA 3IT2A 2J0EA 1T1GA 2V5VA 1IG0A 4PXSA 4Z0PA 3L05A 1MOQA 1V4VA 3EDRA 4BVEA 4EKEA 1J6UA 1NVUQ 3F74A 4HD8A 4OREX 2OHOA 3PR3A 4DC1A 3AI7A 1TDJA 1B00A 3QLJA 4FYPA 4HJXA 1VBNA 3TGWA 3ZBPA 3K8ZA 2RARA 1WQ4A 5JAHA 3CR8A 4YFYA 4OQNA 2GAOA 1L5WA 3PNMA 5MGBA 1ISSA 2NVBA 1L5VA 3D43A 3NDJA 3MC1A 4P5DA 1S6YA 5AHXA 4EQ6B 1MF7A 3L7NA 1RFGE 2H1SA 4YAWA 4CTJA 2H00A 1MW8X 3EE6A 4M7RA 2VWGA 1L4HA 2HSEA 1KYWA 4AXXA 2G1UA 3E03A 3MWFA 3IOCA 2X3FA 4PLYA 3A9TA 1L6IA 1E1CA 2VWQA 1YK0A 4MGZR 4P7BA 2R62A 4DV5B 3HWX1 1LC0A 3ZDBA 2YH2A 2IHKA 5ALKA 5G0SA 1UQRA 2ZCVA 5B1DA 2QJTA 2F3RA 2I4TA 4MQUA 2DTEA 4FDLA 4OQYA 3W5SA 1U6IA 5TEWA 2LNDA 1IL0A 5FCDA 5KVCA 2WYHA 4IEEA 4UZSA 2PV0A 5REQA 4B35A 3IP5A 2JA2A 5H83A 3WGUA 4IJ6A 3GLSA 2COEA 4MVJP 5ILOA 3C5WP 1SKQA 1BO6A 1YVRA 1FQWA 1U3DA 2I03A 3LKBA 3W3AA 5LUAA 1Q15A 1GNVA 4PFKA 1BQEA 3WYAA 1IUKA 3IRUA 5GPBA 1AQLA 3OHMA 4P35A 1GG2A 1I1HA 2EZ8A 3PGMA 1XR3A 1X7HA 4EABA 2RI1A 1PEDA 1KK0A 3BFPA 3E7PA 3EHEA 3GFSA 3LK6A 4BAGA 4DB2A 2I91A 1B2RA 1P0IA 2J3MA 2XMZA 3NXKA 3UK1A 3GUCA 2OV4A 4OI0A 3BH6A 4G26A 5C7IO 5FI0B 2YYAA 4XFJA 1ZKMA 3KR2A 4HG2A 1J33A 1MX1A 4HQRA 1HZZC 1NVTA 5AI6A 3O9MA 1QTQA 2R8PA 2OGTA 4FS8A 3BT7A 1QO7A 2FVYA 2Y0BA 1TQDA 2B37A 1YGYA 3CCBA 3KSAC 1EM8B 2AMJA 3B1XA 1CK4A 5F73A 1KQOA 3ICCA 3A25A 4Y9UA 1MC8A 2Z08A 1S0UA 1RMTA 3GK3A 4IXWA 1G7TA 2ZJOA 4P4TA 1E6MA 4UBKA 1DFHA 3PKZA 4PTZA 1ULTA 4EA8A 2FF5A 4B31A 2VG8A 4UE3S 3OF3A 2VP4A 3QY9A 3HCAA 3IXLA 2WM9B 3CZAA 1KYYA 4ZT5A 5DBIA 3G5AA 1OYOA 5KQMA 3EK2A 3II6X 5K8TA 4TYYA 1CEYA 1PYDA 1GKIA 1ESEA 2Q3JA 1R37A 3ASYA 4HAXA 1Z6AA 4IUYA 3WGMA 4P34A 1K8RA 4BO4A 1E94E 1XXHA 4KWHA 4FI3C 4XRGA 2ZULA 5F5NA 5CA0A 1O5OA 2GFHA 1J07A 4QOIA 1EFHA 1N7JA 1B1CA 2WJ4A 2Y6VA 3KYDB 4R2KA 3EOZA 4XIFA 1G7RA 5T6MA 3VU0A 3TZQA 3H4MA 3CNLA 1E0SA 1EFLA 4NBRA 3V1MA 3FVRA 4U8HA 4AF7A 3H4IA 2R4TA 3OAAD 3PNLA 4GI2A 3T1VA 3ZIAD 5GVSA 1W36C 4FE7A 1G66A 4X65B 4E7PA 3NVKI 1C9KA 5CVTA 2CY0A 4WLEA 4E1BA 5DJ5A 4BO2A 1R7RA 4KSBA 3ZEIA 2CCKA 1ZJ5A 4H0NA 2RJ3A 1YR7A 1Z68A 1OZAA 1YOVA 2AG1A 3FTQA 3MELA 4M8NE 5IDWA 4H7FA 5J1SB 3KFLA 1PUIA 3LV8A 5A5DA 4GBGA 2WIAA 1T3LA 1RRPA 1Z18A 1NE2A 5DTQA 1X92A 3QVTA 4BU1A 4XGNA 4WQMA 3NHYA 4H1WA 2XA9A 5EMHA 1M0TA 4RK1A 1T5TA 3MHTA 2ZUEA 1N5OX 2IEAA 4D2IA 4ZI2A 2GPAA 1VBMA 2AXNA 1R3DA 4WECA 4ECAA 1EJ0A 1QX3A 3PE6A 1T4CB 3E61A 4PYJA 5JSUA 3GV0A 4ZU1X 2Z2ZA 4EKYA 1MO2A 1FMCA 3WWEA 2YN0A 2XLBA 4IDNA 2B9VA 2JATA 1DAIA 4KVGA 1RI1A 1HPLA 1G2OA 1HFJA 2FSPA 2J7KA 4GYYA 4IGIA 3DW3X 3I92A 5JYCA 1IXKA 4KODA 4QUGA 1FXUA 1WXWA 4JX8A 4REMA 5EJ4A 5IFKA 1XHEA 2R6AA 1A04A 3U9TA 4KREA 1CC1S 4JJIA 1MJNA 4GZ5A 2FDRA 2JLUA 2C2MA 1GGKA 2J46A 1EGAA 3NHWA 2YWFA 4TV9F 5JOQA 1A7AA 2BFDB 1J21A 5FOQA 1EZZA 1VCIA 3C6YA 4FT2A 5T3UA 5J2UF 3D8BA 5TPZD 2IPNA 1THTA 4WOBA 1RD4A 3TRDA 1KHTA 4Q4AB 2BFCA 3JQBA 4XUCA 1H8ED 2Y76A 3SZGA 2C7GA 2XCUA 1UMDA 2DH6A 1XTPA 2QD2A 5DBOA 3G5MA 5COBA 2LIPA 3O31A 1DQRA 2QJOA 4IO1A 2GPJA 3E3NA 1SQ6A 3FZGA 2H54A 4B3RB 4J16C 4OIMA 3U56A 1VKNA 3H2YA 3A9CA 4CLDA 4RU1A 3RRFA 2PZ8A 4LISA 4C7VA 4QHYA 3CXUA 3SS9X 1O3YA 1T8TA 3RAPR 3GI1A 4YWHA 1R0BA 2VXCA 3IPLA 1KF0A 3OEED 4ND7A 1CPYA 4YUAA 3ZNOA 3K5IA 1I6KA 3ER9A 2Q8QA 1JGTA 4V0NA 1A5BB 2C61A 4FW9A 4LZOA 1PR1A 4UZEA 4NZYA 3TRJA 2IZ0A 1SXQA 2NP7A 3AL3A 1V9LA 1W19A 3QVOA 4NFYA 1K8XB 1SBTA 4ZVUA 1NULA 5DLYA 3T3DA 3BWCA 3OHSX 2VP2A 2ZDHA 3O4FA 3PC2A 2O2JA 3UJPA 4BLRA 1U0HC 2ZLBA 3R3WA 3V8MA 2FRXA 2O7NA 4WL0A 5IKMA 1PUJA 1U0BB 3OCUA 3I6QA 3T3PB 4XB1A 4B83A 4KLAA 4B7UA 1FUKA 3UAGA 4R6XA 3NGXA 2DFLA 1MENA 3FMVA 1S2IA 4KNVA 4ZJZA 1VLHA 4H1TA 1QIDA 3RUEA 4G01B 4DLLA 4R1QA 4M0DA 3CZQA 4GX0A 5EIOA 1BN7A 4L75A 3LO8A 2I7XA 4PNEA 1V3QE 5TSDA 4BPRA 4ODIA 2G9RA 3D0RA 4TMZA 2G77B 4U2CA 4RTNA 2OBFA 4H4CA 4PFJA 3FWKA 2DUMA 2H08A 3UJHA 1SGWA 2B4TO 3DAGA 3OO1A 4S2EA 4MVJH 2J48A 3KFXA 1NVFA 4F85A 5AKKA 2AQKA 2ZJ3A 1Y8RA 3JR7A 1NMSA 1CDDA 4N18A 1LTKA 1L1RA 5A5GA 5BUZA 5DBHX 5T41A 1L5GB 2G0AA 3C7CB 1KSFX 1VFPA 2NAPA 1HDZA 4NCAA 3E3LA 1YB2A 2R9VA 1UBLS 3SR0A 1ACJA 1XVTA 1GITA 2DC1A 1O87A 4J1TC 3M4NA 1UBSB 4RTJA 4DUZB 4X8MA 1NWHA 1VGRA 3I0ZA 1Z5ZA 4DEYA 2IU0A 3MW8A 4DDHA 1T5SA 1ZRHA 1U9IC 1MRSA 1RAHA 1JFFB 3NBQA 1PFVA 4OQDA 3QELA 1MFZA 2LDXA 4NBVA 5CNMA 2ZT7A 3ROQA 1M8PA 3QQPA 4BX0A 2NP6A 4Q19A 1W8DA 3PR2B 4EPYA 4P7KA 3UJNA 2ACEA 2L82A 2IHUA 3GX1A 3KZNA 2H8KA 1RPNA 2Z4TA 1IBLB 3G2HA 1THZA 1ZUHA 2Q5EA 3P96A 3ZY2A 4OQZA 1WVIA 2C4MA 5JYBA 3IR6A 3MJHA 3NWEA 3RFTA 4CM5A 1VTKA 4YHBA 3B7GA 2IE8A 4JXJA 5FLYA 3SEQA 1CLEA 3G23A 1QNLA 1NYQA 5JMOA 3WLAA 4MK4A 5KWIA 5LYJF 2UZ0A 4L2IB 3VH1A 3AU9A 4WXEA 4NOMA 3CZMA 4RY0A 1X39A 3P7MA 1WEHA 2JLWA 3JYOA 5IHPA 3ZLBA 4GOKA 4WFJA 1XMVA 1RRKA 4WBSA 4YRTA 1Y33E 5DNWA 3THSA 3EIUA 4Z0HO 4YR9A 2Q9UA 2O2ZA 4E21A 5H4GA 3GBSA 1TADA 3EVFA 1KO1A 3FUWA 3GAMA 2V7EA 1PKEA 4WXRA 3W7VA 1OD6A 1SXIA 5J2TF 2OBNA 2W2XA 4RTSA 1E79A 3CLKA 4QDUA 1Z2NX 1GPH1 1GPDG 3VHRA 2Q29A 2CUTA 3DZDA 1QGOA 5T5QA 1KJ8A 1NW8A 5JVDF 1Z6XA 2FLWA 4RK6A 3WMGA 2DLDA 2X4GA 1W88B 2XGMA 4BNKA 4BNXA 5JATA 4JDUA 1TIKA 1UFQA 3QW4B 4O4IF 2DH5A 1RVDA 1D0SA 3EGVA 3SC4A 3IKLA 3L8CA 2CF6A 2A94A 5IAOA 2R66A 4WT7A 1U5AA 3M4ZA 1XCMA 2ZAYA 1C7RA 2MR6A 2Q6OA 3QHAA 4GRDA 2ZSBA 5JHHB 4QOHA 1H0RA 1NJSA 1HXHA 2IDMA 3WNDA 1ZU4A 3WKDA 5D7NA 5K8JB 4ZI3A 4EX7A 4NE2A 4CQLA 2G72A 2VYNA 5FTKA 2PA3A 3CF2A 4MW0A 4HB2A 1V43A 1XBTA 4TV9B 3OTIA 2J31A 1N6OA 5LBTA 2XNJA 3EBLA 2VJKA 2P0AA 3BMQB 5F76A 5K1ZA 5JJLA 1RAFA 5J2UB 3P26A 4F97A 2HPVA 2PDAA 3KQOA 4L72A 4NAUA 1LS6A 4X66B 1VPVA 7REQB 2RD2A 2OXRA 4LWZA 5KQRA 3RIHA 3H1PA 1WP9A 3CPHA 5IJWA 1VSTA 3DZCA 1DLIA 1TYAE 3H7IA 4QFDA 3TL6A 2OYCA 3OO0A 4K0KB 3B6IA 3CMCO 3FYUB 3NP7A 4XI9A 5DTJA 3AR7A 4JUAA 2QTRA 1OFVA 4QSMA 1M2FA 3PXUA 3DVQX 4RKFA 2HA7A 2BGUA 2JIQA 2Y4OA 4W1RA 5KYVA 2YY5A 2NVUB 4A0HA 2WFLA 4Q3OA 5I6DA 2QV0A 3D6JA 3HKDA 5F35A 1NX6A 2P4QA 1BU8A 3VDXA 4EB0A 3VPHA 2C59A 3PUXA 3U7EB 5BNWA 3FYTA 5TARA 3G1TA 2Q3MA 3LGSA 1UMCA 4M8LA 5A2GA 4WERA 4TPKA 4I1OA 3DL2A 3AUXA 1H9BA 3UKJA 3WDMA 4Z86A 4D8VA 5HZKA 1N1DA 4ASUD 1PEYA 2FCRA 1NY5A 3D1JA 1DZ3A 1E1RA 4JP1A 2P9HA 4L85A 1E9SA 4ALJA 1IXYA 2QVCA 2GN8A 1ADBA 3E05A 3LZ6A 3TOSA 1FP4A 2HU8A 1RWVA 4L0MA 3H3XA 1KGSA 1NF8A 3IELA 1A5ZA 5C80A 1VHQA 1VLLA 2IW1A 3QSGA 2J30A 4OHMA 3FE2A 1RLJA 3URMA 3KSBC 1T8UA 1BX1A 2ZIEA 1ND6A 4IOLA 1MEOA 3WBBA 3FZNA 4K8RB 3KEOA 3QF7A 1NXWA 2M2IA 1O58A 4EWLA 2W2OA 3LT5A 1P61B 5ADVA 2WU1A 3R3VA 2VVTA 3LPAA 4FOPA 1P2FA 1G2IA 1GTVA 2GK7A 2J9XB 1D6NA 3V7YA 1GG5A 1OLSA 4KAFA 4F12A 3KQTA 1E7RA 5TMPA 1Q7BA 3AP3A 5DGTA 4A0RA 4GXRA 2L42A 4M9UA 1WCV1 4GBMA 5A9SB 4HDKB 2VJQA 4V02A 3D1VA 3E2MA 3PEVA 2OHIA 3QE9Y 4KQFA 2GBPA 1GPYA 3SJBA 5KYTA 2W37A 2KJQA 1II0A 4RKWA 4KR9A 3X1JA 3GRUA 3VHXA 1IIBA 3FI9A 3NBYC 3NDBB 1D07A 4XCXA 7MDHA 1P2VA 2R6HA 3B9QA 4EI2A 4AZVA 4V0QA 3DR5A 1PS8A 1V11A 1XAIA 3DAPA 3FR7A 3HFSA 4WUVA 4QE3A 5BNZA 3FKSA 4DSOA 1UZUA 3EVBA 4OYLA 5M04A 4NMLA 3R0IA 4PCUA 1S8FA 5K3OA 4RSRA 2PE5A 5BV0A 1G19A 3PUWA 3HU3A 1ID1A 1O0CA 4HLDA 1JLMA 2IVZA 2YW2A 4ZQHA 1TX4B 5B30A 4EL5A 3HA5A 3UF0A 3I61A 3RIEA 1KKMA 1VKZA 2OOSA 3O2JA 4K9PA 3RVJA 3K1AB 3LU1A 1NJGA 5C51B 1CY4A 1Z28A 2ZBPA 3I09A 2NX2A 4YRPA 2C3MA 5DLQC 1FB5A 4ND1A 3T61A 1IN8A 1FTSA 3AZPA 3PEFA 3QEMB 4Q21A 5ECDA 4JVLA 3IQXA 1Z47A 2W8BA 4U2EA 2HM7A 3FGOA 3ZH9B 1V1RA 2AUTA 2BEKA 4PGMA 3V7WA 2ZJ4A 1UDBA 3QM1A 3RHZA 2ZBVA 3KEMA 4YJ3A 3EC1A 3K0SA 2P78A 1CERA 2A3RA 2WSSA 1OGJA 2DPLA 3L7KA 4RQTA 2DMRA 2FQ1A 4NJMA 3ZDQA 1HLGA 4JH0A 4ENRA 3O4RA 5LYJB 2GN1A 2G9ZA 2VJAA 4MB6A 4PLWA 5GWXA 4PX3A 1VPDA 3PJRA 3PXGA 4DPKA 4UHDA 3NWOA 1X7XA 3A1DA 3PTLA 2EWVA 1M33A 3UENA 1X7GA 4NTZA 2ZYGA 1XJ5A 1UT5A 3L7DA 4K05A 3WWZA 3IT1A 5JY1A 4LHEA 1EUQA 1D1PA 3F98A 4E5PA 4DZRA 1Z6ZA 4GXQA 4RTLA 2FMKA 2HWUA 4QGFA 5J1TB 1J2YA 2EBFX 3F4BA 3CFYA 3G0OA 3VKVA 4TL7A 5J2TB 3HH8A 3SR3A 2NVUA 1E3WA 1YULA 1IZ0A 2WD9A 3MN1A 2OBXA 2WMYA 3E9MA 2COUA 1CVIA 2AFIB 2UZAA 4TROA 3V8EA 3LKZA 4YAUA 3GEHA 3ELDA 2FSFA 2JI4A 2G07A 3PQFA 1GKKA 3IHKA 3L0SA 5JVDB 1WAMA 4FEEA 2AZMA 4YCSA 4KGXA 5ALTA 1GTZA 1UOQA 1QZTA 2ID9A 4O4IB 4ND8A 4KYUA 3A6PC 3T1NA 1HORA 2R47A 4XSGA 2COKA 2HA3A 4Z4FA 2ZATA 3P0HA 3TCNA 2GCNA 4KO2S 4EYEA 1B8OA 2ACVA 4YDSA 1K5PA 3UWDA 2VH1A 3SNKA 4LTNA 1BEUB 2JGDB 4RHEA 4RQUA 4UHBA 4YROA 2QTGA 4XWOA 1AXRA 3OURA 4MS4B 1DKPA 2X4IA 3IDAA 3DMDA 5ALXA 3SK0A 1XVUA 1A95A 1ISHA 3FI0A 4BMPB 5DBGA 3HCNA 3GNQA 5HCNA 3S1AA 3PHHA 3DE1X 4H59A 3VMFA 1E77A 3CN7A 4LHSA 4YRBA 1EP2B 2VP9A 3AERA 3FAZA 2X7XA 5K5EA 4CEIA 1TTQB 1WDWB 2NV6A 2V0NA 2R8YA 3DOJA 3CZRA 4IDAA 3RLIA 2B7LA 3VZCA 1E8DA 2NVWA 2LCQA 4MWDA 3RS2A 3BYZA 5E9WA 1P5RA 1ICEA 2Q49A 1H42A 5G4KA 1J25A 1NE7A 1XZCA 1JFLA 2F90A 2EDCA 2Z9BA 3P9KA 4OHVA 1KH1A 1R5JA 2EQ5A 3B3AA 3WYFA 4EI9A 1HDRA 1SKMA 1NFFA 3CLUC 1UBJS 4QDXA 1JG4A 2I1LA 2Z4RA 3V4LA 4TKZA 4OX9Y 1WSWA 5FBWB 2F17A 1ZW1A 4IJVA 2O7VA 2BUAA 2PUJA 5AKHA 2PXAA 5CIWA 1Y7PA 5CRIA 3W9BA 4R0MA 3FY4A 1PLJA 3O4GA 1I0LA 3TPFA 4CFZA 5KHOC 3IYLW 3JATB 4KQXA 5IEBA 3UICA 1W36D 3A31A 1Y6FA 5L9AA 2FX5A 1V9CA 3JQEA 2YHAA 2ONJA 4CG0A 4D3ZA 3K20A 3VKGA 3S8YA 2C78A 1LK5A 2ARKA 2EEZA 3CB4A 4KBYA 4KKXB 4O63O 4X8HA 5THQA 3HVJA 3PX7A 1QHGA 2D2FA 2IGTA 2H4ZA 3JW8A 1NR7A 1PT5A 3QXSA 1UKYA 1PSZA 4GR4A 4ZCPA 3DHVA 2MTBA 3WIEA 3HDTA 3CNNA 4ZD6A 2Z5FA 2QN8A 3IKTA 3FYUC 5DWQA 2WG1A 1ZVQA 2R85A 3U26A 3D64A 4PAMA 2ZIZA 1ML4A 1YXMA 3GGSA 3ZVRA 3H2IA 4IZIA 3DG9A 2VUUA 3HP4A 1V6AA 4D8TA 5GJVC 1LDGA 1D6JA 3GH1A 3LCVB 3K05A 1QH0A 3CLHA 4YJDA 5TS3A 3GJ8A 1YJ8A 4LDPA 3C41J 2XQIA 3RI3A 3Q0TA 2P2NA 2VPIA 2BFMA 3M33A 2HCTA 1T6BY 2JA1A 4GI1A 3U80A 4EHAA 5JTTA 5CX1B 5B55A 2C4TA 4N5DA 1ZH6A 3FLMA 1V6CA 5TQ2B 1KOLA 4EHNA 3C3JA 5E3HA 2B8EA 4GLJA 1Q95A 2BMWA 3Q8LA 3HXQA 2E4YA 4RIEA 5FPTA 3I5YA 5CPFA 3SBDA 2OQ2A 3H9BA 5ED0A 1IY9A 5AM3A 1LDBA 3I6YA 4Q3AA 1PP4A 1KZ9A 2DUNA 4ICIA 4N3NA 2GESA 4YJFA 3TJMA 4HS9A 4XIJA 4LC1A 3OTQA 3GRCA 2K2WA 3LQYA 2Q50A 2NU8A 3NYRA 3D4PA 4GYWA 4O4LF 1BOFA 2X58A 3UIEA 5BT9A 3GO4A 4M7PA 3ECAA 5CEJA 3KXKA 3FTFA 4D9KA 1J0CA 5SYMA 3RAJA 4BE4A 4BCDA 1GUZA 2QB5A 4RL4A 3OBIA 5DTRA 1XMOB 2ZOSA 2VBFA 1KBZA 3VI4B 5ICEA 2O48X 3HMQA 3F6RA 1V39A 1PG0A 2JLSA 3OUZA 2I4IA 2JCVA 2O14A 3RV3A 5KQSA 1TZKA 1MABB 3O4VA 3T9CA 3IAM1 4UUOA 4BMOB 2WJ6A 4D9EA 7GPBA 2AWNA 1RKUA 5L3QA 1XA0A 3K9BA 5LXTF 1NL3A 3HDHA 4XQEA 1AO0A 4BWGA 3S6JA 4LJLA 3V32A 2O3SA 4WBNF 1TM2A 4LY9A 2TMGA 4RKYA 2YVQA 3PGLA 2C5GA 1CFJA 3D0OA 2XRMA 3GC6A 1M7GA 2W6JD 5TQ0B 1CUSA 3RRZA 2XAUA 3I1JA 5CNJA 1WIWA 2C4WA 1NXQA 3OCXA 4JQSA 4TN1A 4X60A 3UMJA 2WHYA 3GHHA 3R4VA 4YJHB 3SBXA 4Z3KA 1U5CA 1CDEA 2IGBA 3KXPA 5HRUA 4EUHA 4S1WA 2KLBA 1Z45A 5IANA 3JWIA 3W78A 1MB9A 1UKCA 3LD9A 3PFKA 4EMBA 4BVKA 2B61A 4MS1A 2B0JA 4G1CA 4KK4A 4X6UA 3P2OA 5AI9A 2OM2A 4O08A 5LMZA 5CU7A 4YV7A 2ZJ0A 1YE5A 4RV9A 4ROTA 3TAHA 3ZWNA 1KAQA 4DARA 4ZMRA 3F78A 1U7PA 2CHVA 1XTTA 3LDUA 3OHPA 1F9EA 1R8YA 3ZCUA 2YQ4A 1LSUA 2OECA 2HFJA 4PSDA 3W04A 3WNVA 1SC3A 1ZJ4A 3QPDA 2BLLA 3UKDA 4AP6A 1PTJA 2UYQA 3DGFC 4IV8A 1E1YA 3JQAD 4L0QA 4WOCA 1CZKA 1FTNA 1P3Y1 3GEMA 5G4LA 3TRFA 5JAUA 1I5EA 2OKCA 2XXJA 4GMGA 3GMDA 1DBQA 5ER6A 2GHIA 1K5GA 3KV1A 4QJ4A 5TDHA 2J3JA 2HUNA 4UPEA 4UD6A 2FXVA 3EZ2A 2D7CA 4ZAWA 1RRGA 1GYPA 2YZGA 1QVRA 2W70A 1AZSC 4ENUA 3QMWA 4YT5A 3A9UA 2BHLA 4JVNA 2B4RO 4MWOA 1KYTA 3VMMA 2XBLA 1JEEA 3HDVA 3KOYA 4FKBA 4K81B 4UZFA 3UHAA 2QX6A 1RQPA 3LXRA 3N8DA 3Q7EA 3IO5A 3NEPX 1I32A 4GNKA 5LYYA 3CONA 1NNLA 1EVEA 4K9DA 1NY6A 2NTYC 2FFBA 1GYRA 2ZXUA 4LQDA 3MTQA 5AIBA 4A8HA 1Y89A 1SXHA 5F9HA 2H57A 2OHHA 3H0KA 3EFBA 3GR6A 3NX4A 4NESA 4E2WA 1Q0TA 4OB6A 1RJEA 1OLXA 2E37A 1CUDA 1HE8B 2HCFA 3R6TA 4C0LA 1PG2A 1R6BX 4RVSA 3L1UA 4WESA 4F3CA 4NLLA 4Q3CA 1M2EA 1KJNA 2ZRQA 4Q00A 5FO1A 2QE7D 3OD1A 1XCGB 2VNSA 1DFIA 2I6XA 2JF0A 3AP1A 2A6PA 4GGPA 4BIIA 4Q3DA 3W3AH 3IT3A 1IOZA 2D1YA 2QAGB 2RBGA 2NVOA 1NT4A 4B73A 3NDPA 3VOBA 3DMFA 1GL6A 2JFQA 4IJ5A 4WKBA 5FV7A 2JGAA 1D0VA 4GECA 3L79A 4YGXB 1X7WB 3GLIB 3R7BA 4N54A 2BR4A 3EHDA 1QHYA 2NXCA 4YO7A 1U2GA 3R75A 2OVFA 5T6BA 3S2ZA 3TCXB 4D5EA 1R1DA 2QJFA 4QUEA 1WB5A 2DYKA 1TQ6A 3OPNA 3L7CA 1GL3A 3YASA 3O0TA 1Y9AA 3UK2A 3MGAA 3MAAC 2QM8A 4KQJA 4U7FA 3NRBA 2IF0A 3IOYA 4XX1A 5G40A 3LFHA 3ZXSA 4DJFC 5HRCA 4J7CA 4LHZA 2VHQA 3EASA 3T0GA 5AJXA 1JG2A 4LV6A 4OX9B 5E4TA 4BFLA 1O6BA 5LQAA 3WGTA 3AI2A 4C29A 2XRZA 3KT0A 3K6SA 1G16A 4G2TA 1MGOA 4GPBA 1FNMA 2E0IA 1FUIA 2DFVA 1BD4A 3GROA 1ZN9A 3K1ZA 2JC3A 3OJCA 4YXFA 3PTAA 2ZXFA 4GT1A 3M6FA 1OX4B 2Z2YA 3WK6A 3E35A 4B17A 4JB0A 1LQUA 4UAGA 4HMPA 1FXWF 2BR3A 1Q0HA 2FRVA 2QUBA 2ZREA 4MUKA 1U28A 1NSYA 1TUGA 4X1KB 5A03A 2AQ8A 1R88A 3QVUA 2V7PA 3E48A 2N75A 1C3EA 1E2FA 2XT9A 4CQMD 5FBHA 2EU8A 1C9NA 2XTMA 4BV8A 2AQIA 2REXB 1DUIA 2J5BA 1C0PA 1JJFA 1EVKA 2Z57A 3A3NA 4F1WA 1ENOA 4DRXA 1KEVA 1V1MA 5CEEA 5JNSA 2WIBA 4L16A 2NUBA 5BPHA 3N7AA 4TTJA 2DSNA 5JRDS 5EIHA 4YH1A 4G1UC 2WJVA 1T34A 4F3NA 1NRIA 2PLRA 3FLEA 1T25A 4BC0A 3TTXA 3LPMA 1L8LA 2X7JA 3HJFA 1DELA 3C3DA 3DUFB 3OAAA 4OAOA 4O4LB 4P54A 3ZIAA 4DHWA 4EHKA 2HR1A 1Y8CA 5AXBA 3M70A 4Y6QA 2PBFA 3WHKA 1GZ3A 3L1KA 1WD5A 2XDWA 3CLRD 3ETDA 1NU6A 3V46A 4YC7A 5JCJD